GenomeNet

Database: RefSeq
Entry: NC_006039
LinkDB: NC_006039
Original site: NC_006039 
LOCUS       NC_006039            1753957 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Kluyveromyces lactis strain NRRL Y-1140 chromosome C complete
            sequence.
ACCESSION   NC_006039
VERSION     NC_006039.1
DBLINK      BioProject: PRJNA12377
            BioSample: SAMEA3138170
            Assembly: GCF_000002515.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Kluyveromyces lactis
  ORGANISM  Kluyveromyces lactis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1  (bases 1 to 1753957)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1753957)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1753957)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382123.
            This is an updated version of the complete genome sequence. The
            Kluyveromyces lactis sequence is made of 6 chromosomes (A to F).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1753957
                     /organism="Kluyveromyces lactis"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-1140"
                     /db_xref="taxon:28985"
                     /chromosome="C"
     gene            <2600..>3646
                     /locus_tag="KLLA0_C00110g"
                     /db_xref="GeneID:2892341"
     mRNA            <2600..>3646
                     /locus_tag="KLLA0_C00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452199.2"
                     /db_xref="GeneID:2892341"
     CDS             2600..3646
                     /locus_tag="KLLA0_C00110g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452199.2"
                     /db_xref="GeneID:2892341"
                     /db_xref="GOA:Q6CQ36"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ36"
                     /translation="MSSHPFQVIDLCAPAEETSRLLLEAANTQGFLFIDGHSFSQQQV
                     DALFRLSMEYFTNTPHHEKLQYAFDVAKNYGYTDYTREQGDPSKAKDFKECYNFGSIN
                     FSNGTYNGQSRSTSENCMQHGEVPPLFTYHNDLIVDSIKKFHELARNIMGLFTVALGI
                     IQEDFFVSRFSDDKKNGCVMRLLHYPLFRDDGVDGSSGIDPTLRIGPHSDYGALTLLL
                     QKEGEQGLEVQLDPGCDQWTKVPFLTSRYEGSAPPIVVNFGDMLSFWTKGVIRSTKHR
                     VKIDPGETRSSDRYSIVFFTHPDADTTLDPVPSRVIESNSNGIGAPPVTAYEYLSAHL
                     SRVINSIPSHDGMV"
     gene            <4440..>5963
                     /locus_tag="KLLA0_C00132g"
                     /db_xref="GeneID:2892652"
     mRNA            <4440..>5963
                     /locus_tag="KLLA0_C00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452200.1"
                     /db_xref="GeneID:2892652"
     CDS             4440..5963
                     /locus_tag="KLLA0_C00132g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452200.1"
                     /db_xref="GeneID:2892652"
                     /db_xref="GOA:Q6CQ35"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ35"
                     /translation="MSATLQSIMSENNTTFREKGEAATSLETSNISSAGELKDPGRLE
                     KEQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYY
                     MDSGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALL
                     AAFSTKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIV
                     FNLSTQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDM
                     FKYPVIWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPL
                     VGLAADKFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTS
                     IITRLVGLPKLEAVYSVVWMFLGVCAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTA
                     YLLAALALWCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
     gene            complement(<6401..>6868)
                     /locus_tag="KLLA0_C00154g"
                     /db_xref="GeneID:2892086"
     mRNA            complement(<6401..>6868)
                     /locus_tag="KLLA0_C00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452201.1"
                     /db_xref="GeneID:2892086"
     CDS             complement(6401..6868)
                     /locus_tag="KLLA0_C00154g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452201.1"
                     /db_xref="GeneID:2892086"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ39"
                     /translation="MVSLECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNV
                     TAYFENGSFYRWESFATVAATSNLFASHELFNVADFIEYEEVQASVNGSFTETIAEPH
                     TLVTTPSGLKQRAINNCEQFCGKTDHCRGSNKRCRGCRILQWAIGLWQKHCVL"
     gene            <7953..>8393
                     /locus_tag="KLLA0_C00176g"
                     /db_xref="GeneID:2891884"
     mRNA            <7953..>8393
                     /locus_tag="KLLA0_C00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452202.1"
                     /db_xref="GeneID:2891884"
     CDS             7953..8393
                     /locus_tag="KLLA0_C00176g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452202.1"
                     /db_xref="GeneID:2891884"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ40"
                     /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLELDMVSNS
                     TSVCFNSTNYTIDVSELPLPEWLDDWDSLLLAMPCDDEIFVSVPKDLDSNTTAKILAY
                     SLASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVHN"
     repeat_region   8405..8798
                     /rpt_type=long_terminal_repeat
     gene            <10530..>10829
                     /locus_tag="KLLA0_C00190g"
                     /db_xref="GeneID:9487496"
     mRNA            <10530..>10829
                     /locus_tag="KLLA0_C00190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999311.1"
                     /db_xref="GeneID:9487496"
     CDS             10530..10829
                     /locus_tag="KLLA0_C00190g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999357.1"
                     /db_xref="GeneID:9487496"
                     /db_xref="UniProtKB/TrEMBL:B5FV62"
                     /translation="MGGVWYRYFSSGGNCGSTVEQKTIAGAIKGVIDSVEPNWFSDIY
                     CITMCRGDTWHGTLLIGPDPSAMTATCSGAHKGNYEMDLEKLTAPWSRNNQDSNY"
     gene            <12387..>12674
                     /locus_tag="KLLA0_C00198g"
                     /db_xref="GeneID:2892319"
     mRNA            <12387..>12674
                     /locus_tag="KLLA0_C00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452203.2"
                     /db_xref="GeneID:2892319"
     CDS             12387..12674
                     /locus_tag="KLLA0_C00198g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452203.2"
                     /db_xref="GeneID:2892319"
                     /db_xref="UniProtKB/TrEMBL:Q6CV36"
                     /translation="MWDNVAFFKTDRHSVENIMNTIITRRSLREGPPTLSLFEDDPSD
                     RKSRSNFMLQYISSNETVSESGISFKLIFYQSQVSYFFLRGIRKPKTGFAF"
     gene            <13632..>15506
                     /locus_tag="KLLA0_C00220g"
                     /db_xref="GeneID:2892172"
     mRNA            <13632..>15506
                     /locus_tag="KLLA0_C00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452204.1"
                     /db_xref="GeneID:2892172"
     CDS             13632..15506
                     /locus_tag="KLLA0_C00220g"
                     /note="similar to uniprot|P38724 Saccharomyces cerevisiae
                     YHL047C ARN2 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to the
                     siderophore triacetylfusarinine C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452204.1"
                     /db_xref="GeneID:2892172"
                     /db_xref="GOA:Q6CV35"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CV35"
                     /translation="MHNNPVLKMENDQIEDGVGHRKEGAAEKINEMDEDSKKGVQFSG
                     VCDGMKQTKSLVIRKTEIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYAT
                     NSYNTHSLLSTISIINMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAY
                     DIQRYAAGSVFYNIGVVGVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIV
                     KAANPLVNWSWNIAMWAFILPLSCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHG
                     FVHTIVEVFWKVDIVGLLLLTASMGCILVPLTIAGGISEQWNNGKIIGPLVLGVFLVP
                     LTIYWESNWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTE
                     LSATRIMNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGA
                     ESGIIGAMVVWGIASCMYTYPVTTSAQSVTSHENMATVTAMLLTIFRIGGAVGASVSG
                     AIWTNLLYPKLLQNLGDVELASAAYTAPLTFIVSHPWNTEVRTAMIDAYRHVQKYEVL
                     VGLIFVAPMLVLTFCLRDPELTDDYGQKLAEGQCVQTEGEDPIAEWFSDRFKKLKRRV
                     "
     gene            <15961..>16272
                     /locus_tag="KLLA0_C00242g"
                     /db_xref="GeneID:2892321"
     mRNA            <15961..>16272
                     /locus_tag="KLLA0_C00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452205.1"
                     /db_xref="GeneID:2892321"
     CDS             15961..16272
                     /locus_tag="KLLA0_C00242g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452205.1"
                     /db_xref="GeneID:2892321"
                     /db_xref="UniProtKB/TrEMBL:Q6CV34"
                     /translation="MNLSIDRLTRDEAIETLRSKLLINKPFVVGYFDYNGINVLLNYN
                     RNQIIIFKAICDLTSIPEFYQYHCHGVKPFKLQKLLNGLLDLTKTLILQVKQFFPRVY
                     L"
     gene            complement(<17326..>18102)
                     /locus_tag="KLLA0_C00264g"
                     /db_xref="GeneID:2891988"
     mRNA            complement(<17326..>18102)
                     /locus_tag="KLLA0_C00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452206.1"
                     /db_xref="GeneID:2891988"
     CDS             complement(17326..18102)
                     /locus_tag="KLLA0_C00264g"
                     /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
                     YOL154W ZPS1 Putative GPI-anchored protein transcription
                     is induced under low-zinc conditions as mediated by the
                     Zap1p transcription factor and at alkaline pH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452206.1"
                     /db_xref="GeneID:2891988"
                     /db_xref="GOA:Q6CV33"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR029482"
                     /db_xref="UniProtKB/TrEMBL:Q6CV33"
                     /translation="MLSKLSNIVGCISIISSIAGATPLKNHDFHSNSSLELIEFGESG
                     ESGWGSPVFPYFHQSCNATNQRMLSSGLKDTLEVTAVARDKLLANGTDKFFKRWFGNS
                     SVFTVIGTLEYVIESGKSDVLYRCDDPSGDCAVHSTDWPGYHVTNTTGETNICDLFYQ
                     TKKPLSTICFEGDIVELGPKHYSGIDLFHRFLHLDNLNGNGFISEWTETLPEVLYLAE
                     NNATFAARNTDNYLYYLADVYAATVNPGGCLGELPKAERP"
     gene            <19668..>21206
                     /locus_tag="KLLA0_C00286g"
                     /db_xref="GeneID:2892313"
     mRNA            <19668..>21206
                     /locus_tag="KLLA0_C00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452207.1"
                     /db_xref="GeneID:2892313"
     CDS             19668..21206
                     /locus_tag="KLLA0_C00286g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452207.1"
                     /db_xref="GeneID:2892313"
                     /db_xref="GOA:Q6CV32"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016215"
                     /db_xref="UniProtKB/TrEMBL:Q6CV32"
                     /translation="MPVTTVAETLERVPAAKKQKLSPVPNKKLILNAFLMGSAGNQTI
                     NSWRQEDDRSSELFQNPSYWTDLAKLLEKGKFNAVFFADVLGPYDVYKGPGNFGPVAK
                     AGSQWPISDPSYFIPLMASVTKNLAFGMTISTISEQPYHLARRLGTLDLLSNGRVGWN
                     IVTSYLDSASRNLLGGETLPENDERYERAEEYVDVVYKLFLSSWKDGAVKKNKKTGIF
                     TDPEGLRHINHEGKYFKVPGPSITSPSQQKLPVIIQAGASPKGRDLAARTAEIIFLSN
                     KTKESLRESIHAVKAIASEKFKRDLSKIKFLALITVIIGDTREEALEKYYNIKSLADD
                     EAAAAMFSGWTGVDLNQYKDDQVLEDVEHRAVASAVKKWKEAYPGVKKWTKKAIIDEL
                     KVAGSGPIFVGTVEEVADTIQEWVSYADVDGFNLSYTSIPSTYEKIVDELLPELRKRG
                     LVQDDYPEPKSSQKLTFREQLFGDNDLDVTHPAHDLRWRENETKSEFESRLPGALEKL
                     KGFN"
     repeat_region   22894..23276
                     /rpt_type=long_terminal_repeat
     gene            <23718..>24050
                     /locus_tag="KLLA0_C00330g"
                     /db_xref="GeneID:2892351"
     mRNA            <23718..>24050
                     /locus_tag="KLLA0_C00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452209.2"
                     /db_xref="GeneID:2892351"
     CDS             23718..24050
                     /locus_tag="KLLA0_C00330g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452209.2"
                     /db_xref="GeneID:2892351"
                     /db_xref="UniProtKB/TrEMBL:Q6CV30"
                     /translation="MILKSLVESSIKSLQDPIASLDVSDLATDLSNAFIDGDINTIVN
                     ILPEFVSLLLRCPQEMQTIAEDFLRCLSSAKQTDSVINANIAFQEKLKRLGEIRQYSY
                     RYGDSDEV"
     gene            complement(<24124..>24909)
                     /locus_tag="KLLA0_C00352g"
                     /db_xref="GeneID:2892594"
     mRNA            complement(<24124..>24909)
                     /locus_tag="KLLA0_C00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452210.1"
                     /db_xref="GeneID:2892594"
     CDS             complement(24124..24909)
                     /locus_tag="KLLA0_C00352g"
                     /note="uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1
                     Mating- type protein ALPHA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452210.1"
                     /db_xref="GeneID:2892594"
                     /db_xref="GOA:Q08398"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="InterPro:IPR017931"
                     /translation="MKSNAPTFKVAVSKRSCSSVRKTSKKIRSGMIRKPSVSSRYRKH
                     EGVNLYMSKVTPTSIPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTKTK
                     KKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASG
                     KHFFNWLEVNYGIDKQWLYEIVQYEECLTPTTKKPYVENIYNSGFKQRIDSPNQKDIT
                     FSQSDNSADWLVDPIFFDTEFLATSFDRTNLIISDCYSLMNSV"
     gene            <25132..>25803
                     /locus_tag="KLLA0_C00374g"
                     /db_xref="GeneID:2892167"
     mRNA            <25132..>25803
                     /locus_tag="KLLA0_C00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452211.1"
                     /db_xref="GeneID:2892167"
     CDS             25132..25803
                     /locus_tag="KLLA0_C00374g"
                     /note="uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2
                     Mating- type protein ALPHA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452211.1"
                     /db_xref="GeneID:2892167"
                     /db_xref="GOA:Q9HDS5"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /translation="MSRIPIHSLLNPSESCKSISNVPSNYRDLSTFNKERAKVITTFQ
                     EMFYSMLENNDDYNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVL
                     LKEKGKMREIEFSRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNNEFKKGKRFPK
                     SHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVSSDI
                     RNILN"
     gene            complement(<26146..>28839)
                     /locus_tag="KLLA0_C00396g"
                     /db_xref="GeneID:2892032"
     mRNA            complement(<26146..>28839)
                     /locus_tag="KLLA0_C00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452212.1"
                     /db_xref="GeneID:2892032"
     CDS             complement(26146..28839)
                     /locus_tag="KLLA0_C00396g"
                     /note="uniprot|Q9HDS6 Kluyveromyces lactis HMLALPHA3
                     Mating- type protein ALPHA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452212.1"
                     /db_xref="GeneID:2892032"
                     /translation="MAQVDVTRWVIHPSGSYESETRKRKLREEKRRKLNEIKRASLVL
                     NDSDFKNFEHWLVTSKGVGEYEQVFDFNFDAYTTRGKPAVDSSTSYSDNIFIDGDKNC
                     KIDTKTISFLDRKYQSNNQTKIESEKQMHVITLKNEQLIEECKNIRERLLELIREGTG
                     YIFVRGWTGYRVNTIILKCHCKQDKCHQILKPRCNVKKHHDPDNLKQFNCFSSFSVHF
                     NVKLNTIKICFCHKSKHETLPITIIPASLRQYISTNLCFTARECFECLKRTPVYLEFT
                     KSFDAKAIVRKIWKEISESQWNLDPDSKRSASKILKRFQNTGDVALLPVDNCSADLNI
                     SLQKAKPIAFIYERIISEIQHDVTEIVIDSTFCLSTDYKQYFVVVASFFGKGVPVGFM
                     ATETNNVDHLTILWFLRSVLQKLPKVKCINSDWSLAEIKAINLLKCSNQICLFHTLTA
                     IRCKRLASKKNMTESLFHQQFQSLLNYEWVDDNIFDPTRYEEKYQEKVSEYQIREIVR
                     LVRIAICDHILLHSAGLNKVFQDSDSENVKVLKLYEYHLKQLYVITVQKFSLPCYFCY
                     LFNQYYNFTSFQIMSRVGKPTFFSVLRTSMMCESYFNQLKSWNLSGSRNYRFDTLIYI
                     LLNKEVAKIKESIRITKKFEKEYDSNCLVQNHRKHLPTWRKQWIIEWKNILQELNCLQ
                     EKDVFNECQQYGTNMTTWICGCNDAKVSPSSTCIHLVSLYKQKFPFYHGYTLQRFGKR
                     NNGVPLVQHESLQSDTKIESTENMSFEISDVTINGVCNTTKQMSDANCRKLDYETEID
                     MISENKHSEIDDESEGKLRIFNFFLADEETRLLITQCPSFKSIIEEMTYIKQRTQSEP
                     QWKAKTNKPEKGFKYDSWIRCLKYYQCYADVKANGNFPLPF"
     repeat_region   29960..30363
                     /rpt_type=long_terminal_repeat
     gene            complement(<32008..>33141)
                     /locus_tag="KLLA0_C00440g"
                     /db_xref="GeneID:2892345"
     mRNA            complement(<32008..>33141)
                     /locus_tag="KLLA0_C00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452213.1"
                     /db_xref="GeneID:2892345"
     CDS             complement(32008..33141)
                     /locus_tag="KLLA0_C00440g"
                     /note="similar to uniprot|P25379 Saccharomyces cerevisiae
                     YCL064C CHA1 catabolism of hydroxy amino acids catabolic
                     serine (threonine) dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452213.1"
                     /db_xref="GeneID:2892345"
                     /db_xref="GOA:Q6CV26"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q6CV26"
                     /translation="MYVHIFPTSYSQTSINRLIMKAQLFSKTPLLKHQFKRSKGPQVL
                     LKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHVFASSGGNAGLAAAVASLEL
                     NVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFMKEHLMKKLDSFKYEPIY
                     SHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFGGGGLYNGLILGLQRYN
                     LADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATISTTAYQNVKRHGS
                     KSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILGSDIKDDDYVIL
                     IGCGGSSTSLEDLKELSSFTNCEFELPSTGVSRLNSHSLHTLQ"
     gene            <33948..>35330
                     /locus_tag="KLLA0_C00462g"
                     /db_xref="GeneID:2892347"
     mRNA            <33948..>35330
                     /locus_tag="KLLA0_C00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452214.1"
                     /db_xref="GeneID:2892347"
     CDS             33948..35330
                     /locus_tag="KLLA0_C00462g"
                     /note="weakly similar to uniprot|P25591 Saccharomyces
                     cerevisiae YCL063W VAC17 vacuole inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452214.1"
                     /db_xref="GeneID:2892347"
                     /db_xref="UniProtKB/TrEMBL:Q6CV25"
                     /translation="MEDMRYVAERLVIRCNEAVMQLELSIQRKMCEFDPNNSHCFIQV
                     QEYYSFLARLSSLKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEV
                     ARAYQSPTKSARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQS
                     LPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYD
                     VGLNGRAKKNADWEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQ
                     YPSKQVRRCNSHESILSRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTISCSTSNST
                     ASPTIGSPHLSKDMLSQFVTAPPSKKYRGWFSSSNSTPFASSIFQKWFNSDSLVTKEI
                     GNPDNSSPSSGRPIVENRQRHSSSNSYSTSIVIGPNGAKFIRGLNDPLVTCTVSYNEL
                     QEALNTEFNF"
     gene            complement(<35397..>38174)
                     /locus_tag="KLLA0_C00484g"
                     /db_xref="GeneID:2892334"
     mRNA            complement(<35397..>38174)
                     /locus_tag="KLLA0_C00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452215.1"
                     /db_xref="GeneID:2892334"
     CDS             complement(35397..38174)
                     /locus_tag="KLLA0_C00484g"
                     /note="weakly similar to uniprot|P25588 Saccharomyces
                     cerevisiae YCL061C MRC1 S-phase checkpoint protein found
                     at replication forks required for DNA replication also
                     required for Rad53p activation during DNA replication
                     stress where it forms a replication-pausing complex with
                     Tof1p and is phosphorylated by Mec1p protein involved in
                     replication checkpoint"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452215.1"
                     /db_xref="GeneID:2892334"
                     /db_xref="InterPro:IPR018564"
                     /db_xref="UniProtKB/TrEMBL:Q6CV24"
                     /translation="MDLLDDLNVGIHKKKGKTYSKANDAEDEELNVGEHKFLAENLLE
                     RVKKRLNGDSDDSTASAIDNSKKSTFFYSDTDLYEGKELDDEFEAMRETAAVPKQREV
                     EIQQKKHPISQTQLIPTFSSSWLAKTQVNTQALEGTNRTIDRQQQDLDTQLNNEEITQ
                     TTPDEHTLDKAATESKLLHSKETSFRNTSFTFKLTTNNNEGLLATKPNGTQIENEQKV
                     VATQLDVAEKEKAVPLIKDTIEEPHLPVAPLKAVRKKYLPEQFIAAFDDSESSNAEDL
                     SDEENDADELKDMASTQELVTKQKSVVTNMNGIIAITMKNSPQNVIELNSSSESEDDY
                     KSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREIS
                     GKKGISLEAIEDEKIQVEKLLEQELERNRRVKLREKREREKSKDTSKAASSGSASDVP
                     DSDVMESDLSLSDSDVEQHLGLHGSTGSDEDSADTSAAHKNNNPIIDDDESSSSSDDN
                     EVTQEPIGINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGELS
                     SDSSVDSDSSEDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAE
                     ESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMIN
                     KILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLENVDGVVNNSK
                     SKAFFDSMVEDITRKSIPAVTSFSNTRDEMGKKKIVISEEFVQSSLSFLSAKDDDINE
                     FEVTEAAHDATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSLDFKLPSIVKSFS
                     SNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVRKPTS
                     SLFDSNSDSFT"
     gene            complement(<38584..>39576)
                     /locus_tag="KLLA0_C00506g"
                     /db_xref="GeneID:2892323"
     mRNA            complement(<38584..>39576)
                     /locus_tag="KLLA0_C00506g"
                     /product="90S preribosome/SSU processome component KRR1"
                     /transcript_id="XM_452216.1"
                     /db_xref="GeneID:2892323"
     CDS             complement(38584..39576)
                     /locus_tag="KLLA0_C00506g"
                     /note="highly similar to uniprot|P25586 Saccharomyces
                     cerevisiae YCL059C KRR1 Essential nucleolar protein
                     required for the synthesis of 18S rRNA and for the
                     assembly of 40S ribosomal subunit"
                     /codon_start=1
                     /product="90S preribosome/SSU processome component KRR1"
                     /protein_id="XP_452216.1"
                     /db_xref="GeneID:2892323"
                     /db_xref="GOA:Q6CV23"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR024166"
                     /db_xref="UniProtKB/TrEMBL:Q6CV23"
                     /translation="MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTL
                     FPKYREAYLKSVWKDVTRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIK
                     LLARSVPFPQAVKILEDDVACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSVMGPYKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEE
                     DWSRFLPMFKKRNVARKKPKKIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEV
                     KKLHERREQQAAKHAEKESERAKDFIAPKETDYKSSISKSTKSSLGDRKRQRTD"
     gene            <40060..>40410
                     /locus_tag="KLLA0_C00528g"
                     /db_xref="GeneID:2892400"
     mRNA            <40060..>40410
                     /locus_tag="KLLA0_C00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452217.1"
                     /db_xref="GeneID:2892400"
     CDS             40060..40410
                     /locus_tag="KLLA0_C00528g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452217.1"
                     /db_xref="GeneID:2892400"
                     /db_xref="UniProtKB/TrEMBL:Q6CV22"
                     /translation="MAKKQDNARSRKNGNSSFNHSDNKISKKHSMKNNMKSNKKKNQM
                     QVRQLDKLDLSIADIVPNKAQKKPRSSASLEGQKVREHYKEDKEVVKKHDKEKKATEK
                     KIEDQLELISGFSL"
     gene            complement(<40901..>41149)
                     /locus_tag="KLLA0_C00550g"
                     /db_xref="GeneID:2892394"
     mRNA            complement(<40901..>41149)
                     /locus_tag="KLLA0_C00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452218.1"
                     /db_xref="GeneID:2892394"
     CDS             complement(40901..41149)
                     /locus_tag="KLLA0_C00550g"
                     /note="similar to uniprot|Q96VH5 Saccharomyces cerevisiae
                     YCL057C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452218.1"
                     /db_xref="GeneID:2892394"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:Q6CV21"
                     /translation="MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLF
                     FKRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLRKVNA"
     gene            <42069..>44207
                     /locus_tag="KLLA0_C00572g"
                     /db_xref="GeneID:2892384"
     mRNA            <42069..>44207
                     /locus_tag="KLLA0_C00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452219.1"
                     /db_xref="GeneID:2892384"
     CDS             42069..44207
                     /locus_tag="KLLA0_C00572g"
                     /note="similar to uniprot|P25375 Saccharomyces cerevisiae
                     YCL057W PRD1 Zinc metalloendopeptidase found in the
                     cytoplasm and intermembrane space of mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452219.1"
                     /db_xref="GeneID:2892384"
                     /db_xref="GOA:Q6CV20"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:Q6CV20"
                     /translation="MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDFVVP
                     QAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFN
                     QLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKD
                     HFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFT
                     KEELIGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNK
                     VPQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLG
                     EKELTKLKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLES
                     TIKGMLQIYETVLKLKFIEEDNGDTWHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREG
                     KYGHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHG
                     IHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSL
                     LDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGD
                     IQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILA
                     RGGLYEIEDNLTEFLGRKPNNKAFLKELGL"
     gene            complement(<44220..>44804)
                     /locus_tag="KLLA0_C00594g"
                     /db_xref="GeneID:2892392"
     mRNA            complement(<44220..>44804)
                     /locus_tag="KLLA0_C00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452220.1"
                     /db_xref="GeneID:2892392"
     CDS             complement(44220..44804)
                     /locus_tag="KLLA0_C00594g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452220.1"
                     /db_xref="GeneID:2892392"
                     /db_xref="GOA:Q6CV19"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q6CV19"
                     /translation="MCGDKEDDTEKLLDATKTIKSLIANEDAPSNSLEDLLIDSLTSV
                     SSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRSLTRLYTLIRLK
                     LKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDLLQDLLYMIIVSIDI
                     FKINLSLKFKRALELISSAATVLKFVSSSYQISL"
     gene            <45284..>45739
                     /locus_tag="KLLA0_C00616g"
                     /db_xref="GeneID:2892317"
     mRNA            <45284..>45739
                     /locus_tag="KLLA0_C00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452221.1"
                     /db_xref="GeneID:2892317"
     CDS             45284..45739
                     /locus_tag="KLLA0_C00616g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452221.1"
                     /db_xref="GeneID:2892317"
                     /db_xref="UniProtKB/TrEMBL:Q6CV18"
                     /translation="MAEKTTSTDISYSLETRPIIHISPESNFLESFALPFSTYLLVMS
                     PTQQSTEESSNYNYPVCPDKVAVLLPCVFWTKIREKPANNQILYRYTIMIGITMYLLA
                     RPTLWYYFHCSYITKNVVFSVFVLYDPRHHGRPFCHLSQFSSPFLYYPL"
     gene            <46562..>47566
                     /locus_tag="KLLA0_C00649g"
                     /db_xref="GeneID:2892079"
     mRNA            <46562..>47566
                     /locus_tag="KLLA0_C00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452223.1"
                     /db_xref="GeneID:2892079"
     CDS             46562..47566
                     /locus_tag="KLLA0_C00649g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452223.1"
                     /db_xref="GeneID:2892079"
                     /db_xref="UniProtKB/TrEMBL:Q6CV16"
                     /translation="MALTGKRSHILLLSDRNNNKDNTTRNNNPEGSGGTHNAPFILQQ
                     KRAKLNGGRYKVTAEYSSPVDSEDDCNDTGYSSIDFDSVVHPSRKANLHFPNPRALAE
                     IVNCPASCSDAFTLNSKLDIKNAASTVNDTSDFSTVNSDNTGVEKESTDPNMFSSTAS
                     TANYLTTSIPRPLSRHSSCVVPQSDLLARERCFDYIVQSIDEVWARYCDTTSSAENQL
                     YPYGYVSPVSDSETSGSESDSGYKSSTDAETDCEYRKVSNLPDSKELQSLKDRLTKAK
                     HSLEQTVDSVQFQDCVLFWNRWDMIKYNAVEMMEEEDDDELVESVIEELEEGRWYNES
                     "
     gene            complement(<47903..>49039)
                     /locus_tag="KLLA0_C00671g"
                     /db_xref="GeneID:2892179"
     mRNA            complement(<47903..>49039)
                     /locus_tag="KLLA0_C00671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452224.1"
                     /db_xref="GeneID:2892179"
     CDS             complement(47903..49039)
                     /locus_tag="KLLA0_C00671g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452224.1"
                     /db_xref="GeneID:2892179"
                     /db_xref="UniProtKB/TrEMBL:Q6CV15"
                     /translation="MHTIHAVDSEIGMLYSISSGEKDLSKKSNDLLENVGRYTENLVI
                     DLNVLREIQVINDTILKSEAFLEAVVVQNGGENPVFQYLHDIETKSKGPFDPESRSIM
                     QEIVYKTVSSRFEFNKIWLPKFFLKVPKSFSAGVILQEQFLVSLWDTLDDDMFLTFVN
                     VCCSMLREVSDHEMIALLRLITEYNTTRDLKEVFAVIFQVFSDTTEIVGKIIQDLDGT
                     LYHRTLTFIGYLISGDSRFITLLFLEQCDAIVPKMENILLLQELLIDLNISAVPLPNH
                     LRSLKLSSMWYTFSENSLFWAVFQRLNSDFNKAAKELAYQLVVRIFEYSGGRIVALWN
                     DDLQTVIPRSVSANLAESIEIKYIGSLYGTLKLLALTSGMQYIV"
     gene            <49512..>50483
                     /locus_tag="KLLA0_C00693g"
                     /db_xref="GeneID:2892371"
     mRNA            <49512..>50483
                     /locus_tag="KLLA0_C00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452225.1"
                     /db_xref="GeneID:2892371"
     CDS             49512..50483
                     /locus_tag="KLLA0_C00693g"
                     /note="similar to uniprot|P25583 Saccharomyces cerevisiae
                     YCL055W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452225.1"
                     /db_xref="GeneID:2892371"
                     /db_xref="GOA:Q6CV14"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="UniProtKB/TrEMBL:Q6CV14"
                     /translation="MSAVLEEIYQKKGNSSKSVAREHVTLRPANEFHTNDHSNNYIHT
                     GSLPQTHVRNIENTVDGYPKLQRLFSLKERQVMQFNTKPFGCKVELDEIVPTLNDWVQ
                     KDGLTFDVVMIGCLTDNQFIYPLLTQLPIHKLISKPGFLFVWGSAQKINELSRLLNNE
                     IWAKKFRRSEELVFVPVNKNSPFYPGLEADDESLFEKMQWHCWMCITGTVRRATDGHL
                     IHCNIDTDLAIESKNSKVGAIPNQLYKVAENFSTATRRLHIVPARTGSETPIRMRPGW
                     VIMGPDVLLDNFNAMEYKNEVGRVGSNLPKDPSIESLRPKSPISIKN"
     gene            complement(<50670..>52187)
                     /locus_tag="KLLA0_C00715g"
                     /db_xref="GeneID:2892470"
     mRNA            complement(<50670..>52187)
                     /locus_tag="KLLA0_C00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452226.1"
                     /db_xref="GeneID:2892470"
     CDS             complement(50670..52187)
                     /locus_tag="KLLA0_C00715g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452226.1"
                     /db_xref="GeneID:2892470"
                     /db_xref="GOA:Q6CV13"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CV13"
                     /translation="MSKYSFETIQFKETPPAETPEPVNSKYGVKTTASPAIKNAPLPA
                     EGPSSRHFSNWLLFSLLGGIPYYVTRKVGGGLKTFLFFAVLFAIPILMAFWTIASTYS
                     PRLNEKCKLPGKPIEYYLTFHDDALKEKYHGKKIPMETFHELFFANKVSFNFDALEVM
                     EYRHDWAQFSFTLSLFKFFLLGMIPEVIMHTRSQDEEQVRDHYDRGDDFYSWFLGPRM
                     VYTSGLISDIEKEESLEQLQDNKLKTVCDKIDLKPGEYLLDLGCGWGTLATYASKIYG
                     AKVTGITLGRNQTKWGNDKLDLQGIDNEQSRILCKDYRDTPLATEDGKKYDKITCLEM
                     AEHVGIRKFGSFLQQVYDMLEDDGLFYLQYAGLRKPWQYEDLIWGLFMNKYIFPGADA
                     STPLDFVVSKLEATGFEVVSIDNIGVDYSATLWRWYRNWIGHKDDVVNKYGMRWYRIW
                     EFFLAYSTIISRQGSATCFQIVLRKNLNAYHRINYVPKQKGLLTPIKEGVEQWFK"
     gene            <53188..>55689
                     /locus_tag="KLLA0_C00737g"
                     /db_xref="GeneID:2892065"
     mRNA            <53188..>55689
                     /locus_tag="KLLA0_C00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452227.1"
                     /db_xref="GeneID:2892065"
     CDS             53188..55689
                     /locus_tag="KLLA0_C00737g"
                     /note="similar to uniprot|P25582 Saccharomyces cerevisiae
                     YCL054W SPB1 AdoMet-dependent methyltransferase involved
                     in rRNA processing and 60S ribosomal subunit maturation
                     methylates G2922 in the putative tRNA docking site of the
                     large subunit rRNA and in the absence of snR52 U2921
                     suppressor of PAB1 mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452227.1"
                     /db_xref="GeneID:2892065"
                     /db_xref="GOA:Q6CV12"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /translation="MGKKTQKKNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHF
                     LEKSKVVIDLCAAPGSWCQVASNLCPVNSLIIGVDIVPMKTMPNVITFQSDITTEDCR
                     SKLRGYMKTWKADTVLHDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTK
                     IFRSKDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRLLDPKE
                     VFEELPDGPQNMEAKVFNPEKKVRKRGGYEEGDYLLYHETGLMDFMKSEDPITMLGEY
                     NKFIVDEEDHDWKIVKKLKQTTKEFLACIEDLKVLGRKDFKMILKWRKAARELLGLDE
                     EEEKPEIEETPLTEEEQIEKELNTLQEKQRLSVKREKRKKNEMKQKEIVRMQLNMINP
                     VDIGIEAAELGRESIFNLKTAEKTGILDKLAKGKRRMIFDQNELAIDNDIHIDENAPL
                     DDRDELAEADELESQLDAMYSNYKERKSERDAKFRAKQARESSEADNWNGFEDKQSDE
                     ENEEETKDYVDDDDNSDLSDSDDDEAINQLIAKLKSRENSSKLSSKARALFSDSLFEG
                     VEPDLPGKADLADSESVGDVKQLTKKRKLNPLPAEQISEAESSDEDSDFEIVANNEDG
                     DVDSEYDSEEEAKRTKQEKHSKDIDIATVEAMTLAHQLALGHKTKHDLIEEGFNRYSF
                     RDMENLPEWFVEEEKQHSKINKPITKEAAMAIKDKLKALNARPIKKVAEAKARKKHRA
                     VARLEKLKKKAGLINDDSDKSEKDKAEEIAKLMRKVTKKAKQKPKVTVVVASGKNRGL
                     SGRPKGVKGKYKMVDGVLKNEQRALKRIAKKHHKK"
     gene            complement(<55778..>57022)
                     /locus_tag="KLLA0_C00759g"
                     /db_xref="GeneID:2892115"
     mRNA            complement(<55778..>57022)
                     /locus_tag="KLLA0_C00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452228.1"
                     /db_xref="GeneID:2892115"
     CDS             complement(55778..57022)
                     /locus_tag="KLLA0_C00759g"
                     /note="similar to uniprot|P25580 Saccharomyces cerevisiae
                     YCL052C PBN1 Essential component of
                     glycosylphosphatidylinositol-mannosyltransferase I
                     required for the autocatalytic post-translational
                     processing of the protease B precursor Prb1p localizes to
                     ER in lumenal orientation homolog of mammalian PIG-X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452228.1"
                     /db_xref="GeneID:2892115"
                     /db_xref="GOA:Q6CV11"
                     /db_xref="InterPro:IPR013233"
                     /translation="MSVQTIQSESFIEEKRRITVLLDRDGRSVEEKVVNRDGVITIPN
                     QSGHVQDRAVLFVPQLASRPDFIHISWKRNAEADITPIKSYIPYGFNIFTNSSGSIAK
                     FIDTPVGKVYYSDTFEDNALSKWFPPEFVDQLLRYSEDNDLDITVTRGRVEVNRYYEL
                     TDDNLFPLNGTESVKTEAGIFQVDTEDDTDTSLSGLRCTWHTGSGALNKCQRTLFFYN
                     QIYADKSSLSEVSLTLSEPVNLHPVVQIDLTSKRPIHNCEYYAYFNLPKYFFIDQFQS
                     IPTLLFGEHDLELPEYKLSGFGSISLFTLQPGSINEVTLHSRYIKPTNDGSAFFEAAF
                     TPQVFYACDTSIELTKRSPFYTGKIGYEHFFTDNTKFYYLNSTKMTINLPKLDSSDNL
                     CIQLFTLGLVLFSVLYLIRKLF"
     gene            <59258..>60580
                     /locus_tag="KLLA0_C00803g"
                     /db_xref="GeneID:2892364"
     mRNA            <59258..>60580
                     /locus_tag="KLLA0_C00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452230.1"
                     /db_xref="GeneID:2892364"
     CDS             59258..60580
                     /locus_tag="KLLA0_C00803g"
                     /note="some similarities with uniprot|P25579 Saccharomyces
                     cerevisiae YCL051W LRE1 Protein involved in control of
                     cell wall structure and stress response inhibits Cbk1p
                     protein kinase activity overproduction confers resistance
                     to cell-wall degrading enzymes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452230.1"
                     /db_xref="GeneID:2892364"
                     /db_xref="UniProtKB/TrEMBL:Q6CV09"
                     /translation="MLSVPKPPTEPNTGGTPLRRGHRHKRSFAISGDFEFLKKDPLRD
                     ATFPIGSEANYAVDSRDATPVSVCDVAELKTDLTFNTARSASTHFLTSPRFFITEEPK
                     FTGGFKDVPDAIINLDDALKTRPRSFKSHRRTESAPADLQLSFNLERKLKITEEQVAE
                     EEEEDANATLLQMKSPENSSTESFPDKETSDLAPPNSTMLLSPLRARCPSPVASRDSP
                     SKISGYNTLKINKQKERYYNYYNKQIPSNGSGSSTIAHQTSAMSLSSESSLSNRQLST
                     PNTPVSASHGHGRKLTPRNKPFKYETQIYDIRQNNQDSELPRRSTVSTIESNDASFSR
                     RRPSTSQSLSSTAPQLTQDVLLGQPGDSIEISNGQCDIFQEQVKLTQTNSKRKTEREC
                     SKHSSSRSISDPSHNIQAKPHTLLNSSEKKKKHGRFNIISSLFTRSKR"
     gene            complement(<61186..>61569)
                     /locus_tag="KLLA0_C00825g"
                     /db_xref="GeneID:2892603"
     mRNA            complement(<61186..>61569)
                     /locus_tag="KLLA0_C00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452231.1"
                     /db_xref="GeneID:2892603"
     CDS             complement(61186..61569)
                     /locus_tag="KLLA0_C00825g"
                     /note="highly similar to uniprot|P00128 Saccharomyces
                     cerevisiae YDR529C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452231.1"
                     /db_xref="GeneID:2892603"
                     /db_xref="GOA:P49345"
                     /db_xref="InterPro:IPR003197"
                     /translation="MPQTFTSIAKIGDYILRTPALAKVVVPIAHQFINLSGYRKMGLR
                     FDDLIEEENELAQTALRRLPADESYARIYRIINAHQLSLSHHLLPKDKWTKPEDDIPY
                     LTPYLLEAEAFVKEKEELDNLEVAK"
     gene            complement(<62156..>63151)
                     /locus_tag="KLLA0_C00847g"
                     /db_xref="GeneID:2892615"
     mRNA            complement(<62156..>63151)
                     /locus_tag="KLLA0_C00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452232.1"
                     /db_xref="GeneID:2892615"
     CDS             complement(62156..63151)
                     /locus_tag="KLLA0_C00847g"
                     /note="similar to uniprot|P22108 Saccharomyces cerevisiae
                     YDR530c APA2 Diadenosine 5',5''-P1,P4-tetraphosphate
                     phosphorylase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452232.1"
                     /db_xref="GeneID:2892615"
                     /db_xref="GOA:P49348"
                     /db_xref="InterPro:IPR009163"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019200"
                     /translation="MFPSNLREIVEATYEKAVANGHVKFTESSSKKLKDVDAGISYQV
                     TFAPSLQSKPERLPIAIDENGAPIPKKDPFAEPEPELTILDDCAGDYKLLLNKYPVAA
                     NHLILVTKKYLLQTAPLSPKDLLTTYKLLQELDDEDEMLRHLAFYNCGPNSGSSQDHK
                     HLQILPLPYKFVPYQDKLCSGKEHFIPNAKTEPLQDAKIPFAHYAVPLPEDPEKVDED
                     LLAMTFVSLLQRTLSMFQDWEGSNAEKSNDDEASIPAYNVLMTKEWLCLVPRSKAFAE
                     TPSIGFNATGYAGLVLVKWDETLKVLNENPSAVTKLLLECSFPSTAGAKPTEYHY"
     gene            <64120..>65241
                     /locus_tag="KLLA0_C00869g"
                     /db_xref="GeneID:2892157"
     mRNA            <64120..>65241
                     /locus_tag="KLLA0_C00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452233.1"
                     /db_xref="GeneID:2892157"
     CDS             64120..65241
                     /locus_tag="KLLA0_C00869g"
                     /note="similar to uniprot|Q04430 Saccharomyces cerevisiae
                     YDR531W Pantothenate kinase (ATP:D-pantothenate
                     4'-phosphotransferase EC 2.7.1.33) catalyzes the first
                     committed step in the universal biosynthetic pathway
                     leading to CoA."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452233.1"
                     /db_xref="GeneID:2892157"
                     /db_xref="GOA:Q6CV06"
                     /db_xref="InterPro:IPR004567"
                     /db_xref="UniProtKB/TrEMBL:Q6CV06"
                     /translation="MTSDILLTHSQLIPTPQEDETTNGSGNVFTIAVDIGGTLAKVVF
                     MPLNTNRLMFRTLETERIEEFMELLHDIIQEYHDGLYERTLLVATGGGSYKFYDLLVE
                     QFPTVIGIERSDEMDCLIKGLDFFIHEIPNEIFTYNDLEGEEAVEPLHNSNSIYPYML
                     VNIGSGVSILKVDSPTSFSRVGGSSLGGGTLWGLLSLITGAKSFDEMLSWAHRGDNTN
                     VDMLVGDIYGTAYDKLGLKSTHIASSFGKVFQNRSQVEPEDKRYPSPSETSTEDIQKD
                     KKFNNADISKSLLYAISNNIGQIAYLQAKIHHVKNIYFGGSYIRGHYTTMNTLSYAIN
                     FWSEGRKKAFFLKHEGYLGAMGAYLLACKDKMSSNVEPS"
     gene            complement(<65443..>66498)
                     /locus_tag="KLLA0_C00891g"
                     /db_xref="GeneID:2892376"
     mRNA            complement(<65443..>66498)
                     /locus_tag="KLLA0_C00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452234.1"
                     /db_xref="GeneID:2892376"
     CDS             complement(65443..66498)
                     /locus_tag="KLLA0_C00891g"
                     /note="weakly similar to uniprot|Q04431 Saccharomyces
                     cerevisiae YDR532C KRE28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452234.1"
                     /db_xref="GeneID:2892376"
                     /db_xref="GOA:Q6CV05"
                     /translation="MTHYHSEYYSEVEKFEYQVTHVTEQILQEQDRLRGSTLHEYNQT
                     ILQLVSDYEMFNSNGQCDPSEINLPLEKLESWTNSLKQIHLELESIDNFLRYAIPSDQ
                     TILNLSKFNESKYETLQAEVSELRDINVVQLQKEIESLQQQITTKSDENLLISEKIKE
                     SCLEASQDIDQCWKLLEQLEAYENANPSTEVITTTDPAFSTYNQWKWNQLAESELKHI
                     NQQLITLRATKEKLDKVFSKRSELETSPKSIETFTSYQLLSQLWRSKFIRQLLPDIAN
                     LEVYPQSGKLKFEVGIMQVIMQIESGIIKSVSLFSYELSYDRIETIKEDILGRIEHQK
                     SLFKVLVVITDYIVNSL"
     gene            complement(<67336..>68760)
                     /locus_tag="KLLA0_C00913g"
                     /db_xref="GeneID:2892136"
     mRNA            complement(<67336..>68760)
                     /locus_tag="KLLA0_C00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452235.1"
                     /db_xref="GeneID:2892136"
     CDS             complement(67336..68760)
                     /locus_tag="KLLA0_C00913g"
                     /note="similar to uniprot|Q04418 Saccharomyces cerevisiae
                     YDR527W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452235.1"
                     /db_xref="GeneID:2892136"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="UniProtKB/TrEMBL:Q6CV04"
                     /translation="MDLFGDIVERETVAPDAVSNQGMPTTGFPKLHQPEKVSSWKQRL
                     MEKKKKKQQRSNTGSEPPNANFVEVGNDSCFSDDTKTDPNALSEAERIHLQNLAVLQS
                     MTPEQFERERQELMDSLNPNVLKSLIARVDKKMTSLSLKDGETSRSKPPVPQYAEIEG
                     PGTWIGGSNKVKDLPKLDDKAVDEALGINSVEVQPLKSVRFERDLKKEEVHNIKPDEY
                     DRTDEVPNGTFNDEDDMAPQEYQFVQSIDHMSNKDLLAEVHFIKARKTMGKEQEYEPL
                     DINDPNFDQELHKKFFPDLPQEPDKLKWMQQVENTGKAEEVIHDVSVCRFDFKGNMVP
                     PGRKLTTTNNGLHHHSDAPELAGYTIPELAHLSLSKFPAQRSIAIQTLGRILYKLGKQ
                     SYAQLVPEVDAETYQEEGGSKQIINKIYYMFWDVMKDCKVIETLQLAADESKTANISV
                     RNYAIDALWLWKQGGGDLRAVSKE"
     gene            complement(<69125..>69352)
                     /locus_tag="KLLA0_C00935g"
                     /db_xref="GeneID:2892111"
     mRNA            complement(<69125..>69352)
                     /locus_tag="KLLA0_C00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452236.1"
                     /db_xref="GeneID:2892111"
     CDS             complement(69125..69352)
                     /locus_tag="KLLA0_C00935g"
                     /note="similar to uniprot|P56508 Saccharomyces cerevisiae
                     YDR525W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452236.1"
                     /db_xref="GeneID:2892111"
                     /db_xref="GOA:Q6CV03"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:Q6CV03"
                     /translation="MHARDWFLVFIAIFLPPVAVWIKRGFFTKDFLLNVLLFLLGFFP
                     GLIHALWVISKHPYESEGDVLSRGQGYGSMS"
     gene            <71640..>71855
                     /locus_tag="KLLA0_C00957g"
                     /db_xref="GeneID:2892134"
     mRNA            <71640..>71855
                     /locus_tag="KLLA0_C00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452237.1"
                     /db_xref="GeneID:2892134"
     CDS             71640..71855
                     /locus_tag="KLLA0_C00957g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452237.1"
                     /db_xref="GeneID:2892134"
                     /db_xref="UniProtKB/TrEMBL:Q6CV02"
                     /translation="MQFKNIVASFAAVAAVASAQNATNGTNATNGTNGTNGTNDTTSV
                     STGAAAANAMGAGVFGAAVAAGVAFLF"
     gene            <73295..>74746
                     /locus_tag="KLLA0_C00979g"
                     /db_xref="GeneID:2892365"
     mRNA            <73295..>74746
                     /locus_tag="KLLA0_C00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452238.1"
                     /db_xref="GeneID:2892365"
     CDS             73295..74746
                     /locus_tag="KLLA0_C00979g"
                     /note="similar to uniprot|P08458 Saccharomyces cerevisiae
                     YDR523C SPS1 dispensable for mitosis involved in
                     middle/late stage of meiosis required for spore wall
                     formation serine/threonine kinase homologous to Ste20p
                     expressed in middle/late meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452238.1"
                     /db_xref="GeneID:2892365"
                     /db_xref="GOA:Q6CV01"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CV01"
                     /translation="MLSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPL
                     AIKCINLEHSNEPIDLLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLL
                     NLLRYYSRLTEQTTCFIILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGV
                     TGQLKFNSTRHGGKNLNTFVGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPP
                     MSHLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHKWL
                     KKCSITNIMEEITVMKTNQILSKEKPRSCKPRFPLSDKVYKTNLPNQLESWRFEDESV
                     LRFDGLGDIPNLYNNSNNKNEMANSPLLTKQQLRTPNISTPTSALSPTSMAISPKTNL
                     STPATESYEDVSSSPSEQKMKLGHENQNIDYWKDVFLYSLKKVRQRAINEPTKETVKS
                     LTRYMGDLEKDFPGLSEALVQEISTRVAKLKNL"
     gene            <75286..>76575
                     /locus_tag="KLLA0_C01001g"
                     /db_xref="GeneID:2892566"
     mRNA            <75286..>76575
                     /locus_tag="KLLA0_C01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452239.1"
                     /db_xref="GeneID:2892566"
     CDS             75286..76575
                     /locus_tag="KLLA0_C01001g"
                     /note="similar to uniprot|P25380 Saccharomyces cerevisiae
                     YCL048W SPS22 Protein of unknown function redundant with
                     Sps2p for the organization of the beta-glucan layer of the
                     spore wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452239.1"
                     /db_xref="GeneID:2892566"
                     /db_xref="GOA:Q6CV00"
                     /db_xref="InterPro:IPR000494"
                     /db_xref="UniProtKB/TrEMBL:Q6CV00"
                     /translation="MLKISAALFLTIAVAFVNGINIEVSEYDREIQVKNQNELKSTSN
                     NALCKKDQHIIENQNDLYQLSNECPTIDGSISFQNYVEPHINLGNIKTINGNFILEEN
                     NEVVSIQGDALEKIGGTFKLYDLTSLNAVNFPHLHDLNVVHWRVVPILGSVAMDNNID
                     SIKSLVISDSSLTSLRGFDKIAKLDTFNINNNRYLESIATNVKYISKQLSVSANADEL
                     NLDMSELIWANNVTIRDTKEINLEHLQYVNQSLEFIENKVNKLELSELKSVGGTLGII
                     ENKHLSKADFNNVSQISGGLMIAGNDALEKIGFFKSLKLIGGAIQFKGNIKDTDFPNL
                     RLVKGSAIIQSTSDELDCSKWVTPNSGSSIIRGGKIECEPKGKKSSANVRQDGTVLDR
                     TTTTESAEAKETNGSTIMGANFLLLALAVLGTVRILG"
     gene            <76863..>78773
                     /locus_tag="KLLA0_C01023g"
                     /db_xref="GeneID:2892390"
     mRNA            <76863..>78773
                     /locus_tag="KLLA0_C01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452240.1"
                     /db_xref="GeneID:2892390"
     CDS             76863..78773
                     /locus_tag="KLLA0_C01023g"
                     /note="similar to uniprot|Q04411 Saccharomyces cerevisiae
                     YDR520C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452240.1"
                     /db_xref="GeneID:2892390"
                     /db_xref="GOA:Q6CUZ9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CUZ9"
                     /translation="MATEEKQTTIRPRKKRKTYSCELCRKFKTRCDFEPSEGKCYRCR
                     MLNLDCSLTNDPELNIKFPQVAANESSNNRTEQLEAHVRDMDRKMDIILSKLGEVTSL
                     LNMNNSATRENTVDHSFNTAYISTTNGLKLQEPPLQLIQDIDTRLFPHQDNSESANLE
                     KAKRPYVVARLAFWDYFKEHENVCLELSHQFLMKSHFWIIPGGIKSIDREFVEKHCFI
                     TSVFTIIAMGFDENDKYEKEQEELYPLVEHLLTNTLTMFEKLIDHDIEALLYCCMYRF
                     TRKSKRYRQLSFNPLVLCNFAINSLLNIVDFHKIKERVLLEEQYNGIDLYHLRILNSL
                     TACNLQFSIGFGTFTNQDPFIKELNNLIAKFPQSNFRDDIKLSEINLSDVVNGIFLNF
                     KNYFWSFFNIFKQGGNRDRNDDAILVFPELDYWLKNWEELLSKDNGGILWFSYDFFYV
                     MICRCFIMEFYQQTLAQNTQFLDSILLTMKQYCVSLLHGFLKLPPSLIKGAPIITTNQ
                     VVYACLTLCDFLHKFNAKERQQTLNLCTKIYWHLNAIGEKRNEATENVAVIIKSLIDT
                     GKKKMFSSPDSSNSKTSPNEFARVEGLQQTSEIPQTFSIPDVNRFNSFEDFFQDFFEN
                     LQPTAQHLFSDI"
     gene            complement(<78938..>79360)
                     /locus_tag="KLLA0_C01045g"
                     /db_xref="GeneID:2892052"
     mRNA            complement(<78938..>79360)
                     /locus_tag="KLLA0_C01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452241.1"
                     /db_xref="GeneID:2892052"
     CDS             complement(78938..79360)
                     /locus_tag="KLLA0_C01045g"
                     /note="similar to uniprot|P32472 Saccharomyces cerevisiae
                     YDR519W FPR2 Membrane-bound peptidyl-prolyl cis-trans
                     isomerase (PPIase) binds to the drugs FK506 and rapamycin
                     expression pattern suggests possible involvement in ER
                     protein trafficking"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452241.1"
                     /db_xref="GeneID:2892052"
                     /db_xref="GOA:Q6CUZ8"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /translation="MKFTTGLSVLLFFVLQVFAEKLTELVVGVTKEPVDCKIKASKGD
                     VVSVHYTGKLRDSGEIFDSSYNRGVPIQFKLGYSQVISGWDQGILGMCIGEGRTLHIP
                     SELGYGSRGAGSVIPPDADLIFETELVDIQREAVDDEL"
     gene            complement(<79651..>81825)
                     /locus_tag="KLLA0_C01067g"
                     /db_xref="GeneID:2892657"
     mRNA            complement(<79651..>81825)
                     /locus_tag="KLLA0_C01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452242.1"
                     /db_xref="GeneID:2892657"
     CDS             complement(79651..81825)
                     /locus_tag="KLLA0_C01067g"
                     /note="similar to uniprot|P25574 Saccharomyces cerevisiae
                     YCL045C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452242.1"
                     /db_xref="GeneID:2892657"
                     /db_xref="GOA:Q6CUZ7"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:Q6CUZ7"
                     /translation="MLTLIFTLWVLLLKSTGAVFNDEAFHVDWQIENLGDIKCIDKSD
                     SSFVVLGETPTGIPVISLLDAASGNIVERFVQDASVAAMKVVDGNIHLNTGQVLDSLT
                     GFPKSTHSGQVECRKLDIQSVTLNNNTLRFNISSSEGDVVVKIPETFRKIEYFGLSSD
                     STVAEVLISTTNKEYYYTRYENHSLTAHWERNEGYSDIIAYTVLDETNHNLDFVRDEL
                     LHEQQLSLIDAYKFRVQSNWERLKSYLIRKRFNLGRMFADLITEDDSSALRDLNVRFG
                     FAKQLVVASKSGIITSLDIISGKKLWSLQSNLKDILKLRLRSENELSIVTRSSIYSVN
                     LLEQPLGLTPENKAPDGFQFDANSESPIIKLVNVKNSSFKIFNASHIGNTNISFVHFE
                     EQKVTGYALQGDALLPTYQRNVGGNERIVGHAVRDKGHVPGLGAILGNRTVLYKYLNP
                     NIGGYLMGNSVENSLLLEIFDTVTGQTLYTVKHEEFVDLTLPVNLVIGEHWCIYSYFS
                     SAPIPEQKLVVVEFYESLVPDERRSLPGSLVNPLDDIVKPATISNAYYFPQIIHSLAL
                     SKTKFGITTKAILLQLDDGSITYLPKYVVNARRKPESDMTKKDKEEFMASVYEPTIPI
                     NDFSVVSHLRQILPSDKSKLISVPTNLESTSIICSIGNDIFCTRVSPSSQFDKLGASF
                     EKSKVLFTIMGLFILCYILRPMVDQRKLKVKWLVKDLDITSI"
     gene            complement(<82159..>83307)
                     /locus_tag="KLLA0_C01089g"
                     /db_xref="GeneID:2892372"
     mRNA            complement(<82159..>83307)
                     /locus_tag="KLLA0_C01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452243.1"
                     /db_xref="GeneID:2892372"
     CDS             complement(82159..83307)
                     /locus_tag="KLLA0_C01089g"
                     /note="similar to uniprot|P25573 Saccharomyces cerevisiae
                     YCL044C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452243.1"
                     /db_xref="GeneID:2892372"
                     /db_xref="GOA:Q6CUZ6"
                     /db_xref="InterPro:IPR013911"
                     /translation="MAIYTSGTQSDNSEPVGNDPKFYTRPSLGLKLWGPLVPSSDNTT
                     GLWSLVAIQTGLGLFLMQRFRKLGKKWVKRDIADFPSLNRFSTTHGDMYMTRHIPVQF
                     GGTHSFNIRVGTRTGFWYSERFRTIRRVTYLLAGTLILSQSMLEVSRLTLLKYDPWVE
                     EAKSVREKQFFNDIVKYYHEGVDSTKFKAKDELSGQSISLNLPEVKQSIAVARAQAQA
                     ENLVTKWFGPLDYKPQSFSEFLDKLEYYLNMTDFLNNLRRQKKNDKINSQLVKLEEEN
                     KRNRQRIHTLMAHAPARAIRTNQEVQDIYAIRKVLLHHDTESPNDIPLTEIWAIYNPW
                     TNLALDTALSIKFFPSVIFNEDYYEHQKRLKDSEHVTSIENSEDERKP"
     gene            complement(<83710..>85293)
                     /locus_tag="KLLA0_C01111g"
                     /db_xref="GeneID:2892548"
     mRNA            complement(<83710..>85293)
                     /locus_tag="KLLA0_C01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452244.1"
                     /db_xref="GeneID:2892548"
     CDS             complement(83710..85293)
                     /locus_tag="KLLA0_C01111g"
                     /note="similar to uniprot|P17967 Saccharomyces cerevisiae
                     YCL043C PDI and similar to uniprot|P32474 Saccharomyces
                     cerevisiae YDR518W EUG1 Protein disulfide isomerases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452244.1"
                     /db_xref="GeneID:2892548"
                     /db_xref="GOA:F2Z6F2"
                     /db_xref="InterPro:IPR005792"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:F2Z6F2"
                     /translation="MLFKNTVRFGLAALMAASCSAQGDAVAPEDSAVVKLDADTFHEF
                     IKEHPLVLAEFFAPWCGHCKTLAPEYVKAADELESKDIPLAQIDCQENQQFCQEQGIP
                     GYPSLKLFKNGNPEAAGEYQGGRDAKAIVNYMLKQSEPAVQVVEDEKAFNEIIAKNLD
                     NTYVVDGSVPEFNETFYQVADSLRDDYSFIQHGSDGKLSIYLPGESEPIVYEGEDFDA
                     ETISTWIAVEAFPYFGDVNGETYQAYMAVKVPLAYFFYTSPEEREEYESHFVDLAKKF
                     RGKVNFAGLDASKFGRHAENLNQKQQFPLFAIHDTIKDLKYGLPQLADEEFAALEKPI
                     TLATEEITKFVEDFLEGKAEPIVKSEEIPEIQENSVFKIVGKNHEEIVRDPKKDVLVE
                     YYAPWCGHCKKLAPTYESMAEFAHENDELKDKVLIAKIDATANDVQSVEIPGFPVLYL
                     WPAGEETEPILFEGPRTAEAFLAFIKENGSHGVDGLALYEEYLVEVEKKKQEEEEAQK
                     AKEVEEVAEEDSELEQDEL"
     gene            complement(<85863..>87029)
                     /locus_tag="KLLA0_C01133g"
                     /db_xref="GeneID:2892402"
     mRNA            complement(<85863..>87029)
                     /locus_tag="KLLA0_C01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452245.1"
                     /db_xref="GeneID:2892402"
     CDS             complement(85863..87029)
                     /locus_tag="KLLA0_C01133g"
                     /note="similar to uniprot|Q04410 Saccharomyces cerevisiae
                     YDR517W GRH1 Golgi localized protein component of the
                     spindle assembly checkpoint homolog of human GRASP65 which
                     functions in postmitotic reassembly of Golgi stacks"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452245.1"
                     /db_xref="GeneID:2892402"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:Q6CUZ4"
                     /translation="MFRIAKNLVRTLEESVTGTVGDKPIDSYFHSVPPQLFPIREDDP
                     RYAHQTDSLYGLRVVQVDESQLQLTSFFDYIIGFNNQPIPLVQDGTMGASQTFYPDYK
                     RIISFFNEHCGNTIKLHVWSGKGGVYREEYLYVSAKNSVSEIPLDETDAQQSLMTSKM
                     FEALGFKVQWTPLIAVTYSYHVLQLNIENGPAMQAGLIPDQDYIIACQDGLLATGGEH
                     LLQDIVRSRANHSLVLYVYNKAVDCVRPVTVHLAADGRLGCNVGYGFLHRIPAPIQNS
                     QSIIHSPAAVESHNSNNIIHPITQPTLIPATLANNADNKETMPSNPLQVPVPVGRRQA
                     QLHRGSNTTNAAAASASMADYFQEGKDQSPRSSSKATPPPPPPASSTASNTASD"
     gene            <88084..>89529
                     /locus_tag="KLLA0_C01155g"
                     /db_xref="GeneID:2892353"
     mRNA            <88084..>89529
                     /locus_tag="KLLA0_C01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452246.1"
                     /db_xref="GeneID:2892353"
     CDS             88084..89529
                     /locus_tag="KLLA0_C01155g"
                     /note="similar to uniprot|P17709 Saccharomyces cerevisiae
                     YCL040W GLK1 Glucokinase catalyzes the phosphorylation of
                     glucose at C6 in the first irreversible step of glucose
                     metabolism one of three glucose phosphorylating enzymes
                     expression regulated by non-fermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452246.1"
                     /db_xref="GeneID:2892353"
                     /db_xref="GOA:Q6CUZ3"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /translation="MSDPKLTKAVDSICDQFIVTKSKISQLTEYFIDCMEKGLEPCES
                     DISQNKGLPMIPTFVTDKPSGQEHGVTMLAADLGGTNFRVCSVELLGNHEFKIEQEKS
                     KIPTFFFQDDHHVTSKDLFQHMALITHQFLTKHHKDVIQDYKWKMGFTFSYPVDQTSL
                     SSGKLIRWTKGFKIGDTVGQDVVQLFQQELNDIGLSNVHVVALTNDTTGTLLARCYAS
                     SDAARAINEPVIGCIFGTGTNGCYMEKLENIHKLDPASREELLSQGKTHMCINTEWGS
                     FDNELNHLPTTSYDIKIDQQFSTNPGFHLFEKRVSGLYLGEILRNILLDLEKQELFDL
                     KESVLKNNPFILTTETLSHIEIDTVENDLQDTRDALLKAADLETTFEERVLIQKLVRA
                     ISRRAAFLAAVPIAAILIKTNALNQSYHCQVEVGCDGSVVEHYPGFRSMMRHALALSP
                     IGPEGERDVHLRISKDGSGVGAALCALHANY"
     gene            <89978..>92131
                     /locus_tag="KLLA0_C01177g"
                     /db_xref="GeneID:2892380"
     mRNA            <89978..>92131
                     /locus_tag="KLLA0_C01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452247.1"
                     /db_xref="GeneID:2892380"
     CDS             89978..92131
                     /locus_tag="KLLA0_C01177g"
                     /note="similar to uniprot|P25569 Saccharomyces cerevisiae
                     YCL039W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452247.1"
                     /db_xref="GeneID:2892380"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CUZ2"
                     /translation="MAVQTAGSDVSQSNASVSTVPTSHDSFIPKYTKKPLSHLDIDGS
                     DQPFDRVQLTKLLIDALKQIGYEETAITLQKESGGILVESTHVKSLFSAIKEGRFYHC
                     TLDLLLQLPIFLESLELSGDLSHVELPQTKRNISTTIIDHFLAEYEKLGFVMKRLSEF
                     KDVDIVKLTICVEMLVAIQTLAFSEILMSDRRMALELLRLVIRPTISIWDTLLTLQTM
                     KYDSEIQWQTGNDVMYSNSFSSFQPEHLLSQLSTLIVCGQNSNAAPFVTREATFEHIA
                     HFINPNDLVPRGRLMQLLKQAIQYQRSRDLLSFHIEDSSTGTKRSASSTYNLLQDNVT
                     KSTQFQFDNIKTLNRNNDEIWFLQFSSDGRFLASASPSKKFERKIIIYDVKNNFEIYA
                     ICCETRQSVLYLKFSPDNTKLIACSINSAAKIYDLNQLSPPTYDGYLCEYDQLKPVAS
                     VFVTFPTTSDSSAISSNNTPASAETMRLWCGDWFHDPELKDFIVLGSPDSDVIIYDMK
                     TATIFARISMTMGEDLKSSFPHVHDIKISSDDNDLIVMNNEKYIDVFDISTLKYCIKE
                     NATFVSPRKRRLLIGKRMTGMQFPDTSQCSPDPSLSSLLLVSIQNQELQLWDYQRDIL
                     IQRYIGQIQSNFIIRSCFGYYSNFIASGSEDGKIYLWDRFYGNIIGVIPAHSENSTSS
                     QSKICNIVAWNPQDQTMFASGGDDGLVKVWRVSAT"
     gene            complement(<92124..>93602)
                     /locus_tag="KLLA0_C01188g"
                     /db_xref="GeneID:2892359"
     mRNA            complement(<92124..>93602)
                     /locus_tag="KLLA0_C01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452248.1"
                     /db_xref="GeneID:2892359"
     CDS             complement(92124..93602)
                     /locus_tag="KLLA0_C01188g"
                     /note="similar to uniprot|P25568 Saccharomyces cerevisiae
                     YCL038C ATG22 Protein required for the breakdown of
                     autophagic vesicles in the vacuole during autophagy
                     putative integral membrane protein that localizes to
                     vacuolar membranes and punctate structures attached to the
                     vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452248.1"
                     /db_xref="GeneID:2892359"
                     /db_xref="GOA:Q6CUZ1"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR024671"
                     /translation="MSYEAVPAENSAFIPDQAKRNIKGWYFYCFSSEPFIVSAVSTYV
                     PLLLEQFGRINGVKLDDHSLRCEVNDDKCVLPMFNGRWFIDTSSFALYTFSLSVLFQT
                     LLVISVSGIVDKCQSIAFKKRVLLFFGTVGALATWFIGTLRSDQYYVLPLLAIVGNCS
                     YGVINVVGNSLLPVFVGFLVGNEDQLEVDIKTSIISGRGASYGYFSALIVQLFSILLV
                     KQSKNHDNLQIAILFVGLWWLLWQIPIAFLLQDIPRDTDQEQHEFTWANTGNYMEYGW
                     NSLWESLKHARLLKDVVIFLIGWFIISDSLTTINSTAILFAKTELKMTAINLITLSII
                     TMVMAMLGAVYIPHLLSERLRLPLQQVLIIIIIWSSVIPLYGMTGFVFQNIGLKHKFE
                     MYILGVWYGVSLGGLAAVSRSLFSLLVPRGKESTFFSLFSVTDKGSSILGPLLIGLIT
                     DKTHNIRYAFYLLFLFLVVSLPVFHGLDVERGKREARQLSTM"
     gene            complement(<93918..>95408)
                     /locus_tag="KLLA0_C01210g"
                     /db_xref="GeneID:2892368"
     mRNA            complement(<93918..>95408)
                     /locus_tag="KLLA0_C01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452249.1"
                     /db_xref="GeneID:2892368"
     CDS             complement(93918..95408)
                     /locus_tag="KLLA0_C01210g"
                     /note="weakly similar to uniprot|P25567 Saccharomyces
                     cerevisiae YCL037C SRO9 Associates with translating
                     ribosomes may function in the cytoplasm to modulate mRNA
                     translation may be involved in organization of actin
                     filaments RNA binding protein with La motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452249.1"
                     /db_xref="GeneID:2892368"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6CUZ0"
                     /translation="MSETVTTTTVPVTDTPHETEAVSVEVATASSNDTTVATANDDVE
                     SSSVDSEGEKPKLVLAPLPKKSPWEETGVTEYKPLDLSKVVAAKNKKVSSSSKSRSKG
                     TPSLTGKERWVPLDVDITVKDKIPDVSNANGGKGKKLKNKTKKDKPKVAKKTKGKDST
                     AKPKKDSEGEKKATKKQDRQTNKTSSSNGTNEKISVNGTTPASASGSSDITKNGYTEE
                     SNQADKRPETASSSNSEASSENGISAPPSAETDGKKVESQQRRFTPNSKPFYPRNANH
                     HNNHGHGYHHQHNKNNHNNENHYHGSKYQRQRSYAPVMYQQNYTPSYVLVNEIVRQIQ
                     YYFSIQNLSKDMFLKSQMNAQGYVPLALISRFHRMLNLSYGDVGLILAALRELKNSEN
                     SNVNIAKLTEPFENVVGNPLFQYALSSKVWTADESISEPKSYDTVEFVSDELELFKIE
                     PINPIIDSLPSFKPNSSTEKHEQNQDQDQQESSENQENQNQEVSVQ"
     gene            <96317..>97417
                     /locus_tag="KLLA0_C01232g"
                     /db_xref="GeneID:2892311"
     mRNA            <96317..>97417
                     /locus_tag="KLLA0_C01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452250.1"
                     /db_xref="GeneID:2892311"
     CDS             96317..97417
                     /locus_tag="KLLA0_C01232g"
                     /note="some similarities with uniprot|Q04408 Saccharomyces
                     cerevisiae YDR514C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452250.1"
                     /db_xref="GeneID:2892311"
                     /db_xref="GOA:Q6CUY9"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY9"
                     /translation="MSDIDLDSYYEALGVKTPEEILKDWERTSPPRKFGDNSEEIQYN
                     GYVRNQLAEKLVALYLKDLGSILKKTYIAQKKSHVALVQRFEEEVFNTCPFHSDVTPS
                     DALLCDRIRDAAKPKLQCYPGRSEWKKWKNAIECINLKKTILFCVDLEAYERDTNIVT
                     EIGITIYDPRENFDHSVLPLTRSFHFCVEEAYDLRNGRFVDDAKDNFIFDDSQILPLD
                     EVVELVQNLIDKYLIPHNRAEHSWKRALVGHGISGDISWLESLDIRLPNNVQTLDTQK
                     LFENMYGRQSSLKRLLNLCRIPHSYLHNAGNDSYYTLQLLLSMCDIGTRIKLDLDNWH
                     HVRRLEENLYCVEQLEKQGKRKRNRGNNFSQR"
     gene            <97735..>98940
                     /locus_tag="KLLA0_C01254g"
                     /db_xref="GeneID:2892426"
     mRNA            <97735..>98940
                     /locus_tag="KLLA0_C01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452251.1"
                     /db_xref="GeneID:2892426"
     CDS             97735..98940
                     /locus_tag="KLLA0_C01254g"
                     /note="some similarities with uniprot|Q04408 Saccharomyces
                     cerevisiae YDR514C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452251.1"
                     /db_xref="GeneID:2892426"
                     /db_xref="GOA:Q6CUY8"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY8"
                     /translation="MSSGKSYRPGPNNHRTKFGINIQNHNQDNRAMSSSKKFFGHIGN
                     AVQSYQAALRVLKPVKYTAVNSVVLKETNKKQYHPDRELQKHIEDYLTAFGERSKLAH
                     TESDLKLNQKIEALSPSNASDKELIQKITANHIPKVRLLPGTPSWAEFTKVLKSIQSR
                     NTICMSIDIEAWEKNPSIVTEIGISIWDPRVEDGKYSISGPTFQNHHILIDQSLPLRN
                     TQFMPDHKYQYLLGKSKVMDIRHCQAFIQGLIDKYMVPDPNESQTLGYQRAFVGHGFA
                     SDLKWLKTLQLRISDDIPIFDTMKFFQSIYGSTGSGLGKALRLLQIPHAYMHNAGNDA
                     YYTLRLLLHMCDIEKRKLLALDDIERIQNIIEGWRSHDSGNSSGKSKRRKKLVSTEFQ
                     GVAPFSSLP"
     gene            <100213..>101334
                     /locus_tag="KLLA0_C01276g"
                     /db_xref="GeneID:2892481"
     mRNA            <100213..>101334
                     /locus_tag="KLLA0_C01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452252.1"
                     /db_xref="GeneID:2892481"
     CDS             100213..101334
                     /locus_tag="KLLA0_C01276g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452252.1"
                     /db_xref="GeneID:2892481"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY7"
                     /translation="MVSFNKLCSLALISSAALVSAATYHIDVDYEEYLDVYFHYRESG
                     DAVTVEADATGLTINVDSNSVIASDCQILQSGMLVYTKDGSSDRTLVTWDQYEVFHLT
                     YDGSEITYNAVNPQSCGPISSVSSTTVITANDDIPTKDVPVDQITYSASLTESVPSTT
                     VVTTTVSGVVTSYTSYCPISTIYGNSVVTVTENDVVTSYTTYCPVSEVVLTTQPKTVT
                     KTITSCDNNACTATTSELTTGETITVTKSIQTDVITNTKANSGTVTKSIETVPTTSAK
                     ANSEIVTKGVKTEAATSTKGDTVIVTKTTGNTQGQTETRKQTQTPITTSATYAPTDKV
                     TTVLSASSTDSVHVYEGEANFFSVNKLAIGILAVGAAMI"
     gene            complement(<101676..>101999)
                     /locus_tag="KLLA0_C01298g"
                     /db_xref="GeneID:2892377"
     mRNA            complement(<101676..>101999)
                     /locus_tag="KLLA0_C01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452253.1"
                     /db_xref="GeneID:2892377"
     CDS             complement(101676..101999)
                     /locus_tag="KLLA0_C01298g"
                     /note="weakly similar to uniprot|P25567 Saccharomyces
                     cerevisiae YCL037C SRO9 Associates with translating
                     ribosomes and weakly similar to uniprot|Q12034
                     Saccharomyces cerevisiae YDR515W SLF1 RNA binding protein
                     that associates with polysomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452253.1"
                     /db_xref="GeneID:2892377"
                     /db_xref="GOA:Q6CUY6"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY6"
                     /translation="MPSAATIARVQGLINSSKIFVASKTYCPYCQATLKTLFEEKKVD
                     KKLATVLQLNQLEDGSDIQDALAEITGQKTVPNIFINGKHIGGNSDLQELNNSGDLDK
                     LLASL"
     gene            <103218..>104225
                     /locus_tag="KLLA0_C01320g"
                     /db_xref="GeneID:2892425"
     mRNA            <103218..>104225
                     /locus_tag="KLLA0_C01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452254.1"
                     /db_xref="GeneID:2892425"
     CDS             103218..104225
                     /locus_tag="KLLA0_C01320g"
                     /note="similar to uniprot|P25369 Saccharomyces cerevisiae
                     YCL034W LSB5 Protein of unknown function binds Las17p
                     which is a homolog of human Wiskott-Aldrich Syndrome
                     protein involved in actin patch assembly and actin
                     polymerization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452254.1"
                     /db_xref="GeneID:2892425"
                     /db_xref="GOA:Q6CUY5"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY5"
                     /translation="MGFFTDHPYTSVTESINKAVISENATLEVELGNILQLIRTGDTD
                     TNQVEAARAIRKRLKHGDLYQQSRALDLLNLFVSQLIHLPLFYSDFRLINVLLDMSSN
                     SGKYPKQISRKCTCYLIGWYQYLASHQEVEGFEMLFTVCEKAYKNKKRHTKVMNKSYQ
                     KKKKALPQFLSDTADRRAVTADERYGIPRIDLEKEAPKIKLLISDSLETAVSLSNALL
                     AIPAHSKSTDSELCTAKFVQARALRRKVLRYLQLITGGELLGALLHANEELVNALMAF
                     DQLAEEGDMASLNERDSDEDDQEDNEAYISDEASIPSYTSRGGAAQPNDPFSDNNKIK
                     N"
     gene            complement(<104355..>104954)
                     /locus_tag="KLLA0_C01342g"
                     /db_xref="GeneID:2892540"
     mRNA            complement(<104355..>104954)
                     /locus_tag="KLLA0_C01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452255.1"
                     /db_xref="GeneID:2892540"
     CDS             complement(104355..104954)
                     /locus_tag="KLLA0_C01342g"
                     /note="similar to uniprot|P25566 Saccharomyces cerevisiae
                     YCL033C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452255.1"
                     /db_xref="GeneID:2892540"
                     /db_xref="GOA:Q6CUY4"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY4"
                     /translation="MSHAIVKRKQLETRICNHHRIYCSAFIILLIGIILKVLPLHNCF
                     TLLMLSRSCSRILSLNLSKQFYRTMNSTGKWNPSLTSEQLRVLRDKGTERPNTGNYLH
                     NKQTGIYSCANCDLPIYKSETKFDSGCGWPAFYDAIPGSLTFTRDESFGMVRIEICCS
                     RCGGHMGHVFEGEGWQKILNLPTDQRHCVNSCSLNFKEG"
     gene            <105157..>105417
                     /locus_tag="KLLA0_C01364g"
                     /db_xref="GeneID:2892307"
     mRNA            <105157..>105417
                     /locus_tag="KLLA0_C01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452256.1"
                     /db_xref="GeneID:2892307"
     CDS             105157..105417
                     /locus_tag="KLLA0_C01364g"
                     /note="some similarities with uniprot|Q04406 Saccharomyces
                     cerevisiae YDR512C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452256.1"
                     /db_xref="GeneID:2892307"
                     /db_xref="InterPro:IPR021475"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY3"
                     /translation="MSSNYPTTMSCTDAFDQLTGCFSLGGQFRNYYRHGHMNECLKEF
                     EKFKFCVIHSKDPVKVQEWHKEQWQKNQERKGTSDDIWKERV"
     gene            <105812..>106699
                     /locus_tag="KLLA0_C01386g"
                     /db_xref="GeneID:2892108"
     mRNA            <105812..>106699
                     /locus_tag="KLLA0_C01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452257.1"
                     /db_xref="GeneID:2892108"
     CDS             105812..106699
                     /locus_tag="KLLA0_C01386g"
                     /note="similar to uniprot|P25344 Saccharomyces cerevisiae
                     YCL032W STE50 Protein involved in mating response
                     invasive/filamentous growth and osmotolerance acts as an
                     adaptor that links G protein-associated Cdc42p-Ste20p
                     complex to the effector Ste11p to modulate signal
                     transduction"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452257.1"
                     /db_xref="GeneID:2892108"
                     /db_xref="GOA:Q6CUY2"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR015316"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY2"
                     /translation="MSGTNEWSTEEVCKKVKAELGLTDGDTFILDRIRENKITGSTLS
                     EITLADCKELCPDSISAVRLKTCINKFVDTEEQAPEQELVLTMKGLHQTLNEKLQEFQ
                     SNYAQLRLDLLEIVKRNSGSGSGSSQSSQQLQHQPSSQDYFDRAPHHSSHTPSSPKYR
                     SNSNPGLPPQSSSTRNVSSSHIATTPGSANTPGGAGVSSAPSSEPMKQLRASKEDSCE
                     KVLRNAMKRHNLNETDWRQHVLVICYGDQERVLDLDEKPVQIFKSLKQQGLHPAIMLR
                     QKGDFEEVGEMAATPGGRL"
     gene            complement(<106905..>107885)
                     /locus_tag="KLLA0_C01408g"
                     /db_xref="GeneID:2892437"
     mRNA            complement(<106905..>107885)
                     /locus_tag="KLLA0_C01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452258.1"
                     /db_xref="GeneID:2892437"
     CDS             complement(106905..107885)
                     /locus_tag="KLLA0_C01408g"
                     /note="similar to uniprot|P25368 Saccharomyces cerevisiae
                     YCL031C RRP7 involved in rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452258.1"
                     /db_xref="GeneID:2892437"
                     /db_xref="InterPro:IPR024326"
                     /db_xref="UniProtKB/TrEMBL:Q6CUY1"
                     /translation="MRRDELKKFASTTFNEFVWVIHRSRYLSTHFQYERMVLEQMQNG
                     FLIVPFLLPQVKSLNQKPTKVYHYMFVRKHQSKLENEQHCLFLVNLPLLTQLENLKKN
                     FQEICHQNETVSHVQDLLYHDEFGLHDVDLSSLTSHLMSVDEPSEKRFTPRNTALLQF
                     VDKQSVENCWEALRKYSSSKKQQQILWEFQSPSIETFTAFYRPLPLKYLKTDIHEHMA
                     LFEQREQQAQEEVQSSIVDEDGFTLVVGKNTKSLNSIRKKIFNRNPLLKHEKPKKMPN
                     MVDKKAKKDFYRFQVRERKKQEINELLAKFKQDQEKIKEMKSKRRFNPYT"
     gene            complement(<108092..>108481)
                     /locus_tag="KLLA0_C01430g"
                     /db_xref="GeneID:2892688"
     mRNA            complement(<108092..>108481)
                     /locus_tag="KLLA0_C01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452259.1"
                     /db_xref="GeneID:2892688"
     CDS             complement(108092..108481)
                     /locus_tag="KLLA0_C01430g"
                     /note="some similarities with uniprot|Q02562 Saccharomyces
                     cerevisiae YDR511W ACN9 Protein of the mitochondrial
                     intermembrane space required for acetate utilization and
                     gluconeogenesis has orthologs in higher eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452259.1"
                     /db_xref="GeneID:2892688"
                     /db_xref="GOA:Q6CUY0"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR008381"
                     /translation="MQVNHLLRQAVKQTTRAGRLGSRKPHKPLLPPLQLYRRILREHR
                     NLPTMQRELGDQYVKNEFKLHKSTDNPLYIVGFLASWQDYLHMITRGEWEEGTLSTDL
                     LEKMSPEQVTQLYELMKEAEQLKSGGE"
     gene            complement(<108796..>111183)
                     /locus_tag="KLLA0_C01452g"
                     /db_xref="GeneID:2892606"
     mRNA            complement(<108796..>111183)
                     /locus_tag="KLLA0_C01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452260.1"
                     /db_xref="GeneID:2892606"
     CDS             complement(108796..111183)
                     /locus_tag="KLLA0_C01452g"
                     /note="highly similar to uniprot|P00815 Saccharomyces
                     cerevisiae YCL030C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452260.1"
                     /db_xref="GeneID:2892606"
                     /db_xref="GOA:O13471"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016298"
                     /db_xref="InterPro:IPR021130"
                     /translation="MLPVVPVFNAVNALKEKTYLYLSSQLVLDGKDMTKDDILEFVQN
                     SHGQNISVLLKDAKFEDDDLIVLLNNGVVTLFIDSDDYAAHLVEIGVPSIRLTLLKDG
                     AYQFSFGQIQEIQQSQLVKASEISLETFTNSVLSGMKTDRPDGLYTTLVVDENERSLG
                     LVYSNKESVSLAIETQTGIYFSRSRNEIWRKGATSGNVQKLLSIELDCDGDALKFVVR
                     QGGSGSFCHLETESCFGNFRHGLYGLQKLLQERLLNAPEGSYTKRLFNDSDLLTAKIK
                     EEAEELTEAVDKKDIAWECADLFYFAMARLVANGVSLEDVERNLNTKHLKITRRKGDA
                     KPKFLKKEPVAVHEEDGKIVLNVVSASDKAAVEKAVTRPIQKTAEIMNLVNPIIENVI
                     KNGDKALVELTAKFDGVQLETPVLEAPYPEEYLDGLTDELRDALDLSIENVKKFHAAQ
                     MQSETLDVETQPGVVCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVAGCKEIVF
                     ASPPRKSDGRVSPEVVYVASKVGASKIVLAGGAQAIAAMAYGTESVPKVDKILGPGNQ
                     FVTAAKMYVQNDTQALCSIDMPAGPSEVLVICDEEADVDFVASDLLSQAEHGIDSQVI
                     LVGVSLSDSKIEALQNAVHEQAMQLPRVDIVRKCIAHSSIILCDSYEEAFKMSNQYAP
                     EHLILQISNAEDYVKDVDHAGSIFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGVNT
                     ATFQKFITSQVVTPVGLEHIGHAVMSVAKVEGLDAHRNAVKIRMSKLGLLPSGFE"
     gene            complement(<111545..>112765)
                     /locus_tag="KLLA0_C01474g"
                     /db_xref="GeneID:2892096"
     mRNA            complement(<111545..>112765)
                     /locus_tag="KLLA0_C01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452261.1"
                     /db_xref="GeneID:2892096"
     CDS             complement(111545..112765)
                     /locus_tag="KLLA0_C01474g"
                     /note="similar to uniprot|P11709 Saccharomyces cerevisiae
                     YCL029C BIK1 Microtubule-associated protein component of
                     the interface between microtubules and kinetochore
                     involved in sister chromatid separation essential in
                     polyploid cells but not in haploid or diploid cells
                     ortholog of mammalian CLIP-170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452261.1"
                     /db_xref="GeneID:2892096"
                     /db_xref="GOA:Q6CUX8"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX8"
                     /translation="MDNQDCIGLVIEVPNIGRGQIRYIGSVETKKGTFVGINLFAGNG
                     KNDGTFRGRRYFETSFPQSGLFIQWEKIANLIPIPSNPEANMTIPPASPTPVRINANF
                     LGYHEPLQNSFPEIKSRTSISNVIQPNDDPMQTTSSDLKMLQTELVQYKRLVEDQRIV
                     FEEIQAAIDEYETKLDTTEKEKVLLQNQLDHERTSHQRQKQFYESEHDQLLTVIDELQ
                     SEINRNAAILAEIMQKEKKNSLENDYVMQDEPNSDALLINDLREQILELQQHKTQAEL
                     HRVQWEKEKEQLQFRNQSLSKEYKNLTTEMTEYQQKSHDTETKEYTLNKELDDARKKI
                     GELESRVEELSKKQEENTLIVDSNIETLPLYNPGAEVKSTLVNAAAGRSLWCALCEKD
                     GHESVDCPYDDKFF"
     gene            complement(<113533..>114903)
                     /locus_tag="KLLA0_C01496g"
                     /db_xref="GeneID:2892436"
     mRNA            complement(<113533..>114903)
                     /locus_tag="KLLA0_C01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452262.1"
                     /db_xref="GeneID:2892436"
     CDS             complement(113533..114903)
                     /locus_tag="KLLA0_C01496g"
                     /note="some similarities with uniprot|P47032 Saccharomyces
                     cerevisiae YJL079C PRY1 Protein of unknown function, has
                     similarity to Pry2p and Pry3p and to the plant PR-1 class
                     of pathogen related proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452262.1"
                     /db_xref="GeneID:2892436"
                     /db_xref="GOA:Q6CUX7"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX7"
                     /translation="MKLNSVIVSSFIAASVLAQNTVTLDLTLDATSTRLSKPVATSTD
                     SGYSATSSTSVPSDEVSSRDTVTGSVTSVPSSTASSDSTSTDTVPSSSETSELETSSS
                     ISSPYYGNTTLTDSIPTSDFGSEVTSSIVPTSEVDLTSIGETSTSSGALSSESSILST
                     SSDGTSEGNSAPSSIQSSTSSSSEVTSTPSSTESSTSSISSEETLVSSATESSTSSTS
                     SEYTSTPSSTESSTSSISSEETVVSSATESSTSSTSSEVASTPSSTESSTSSTTPTST
                     LASTTADSAATTTAEAISDADRESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQT
                     LFGSDNDPCNYKLQHSGGPYGENLAAGTNSDPAALVGLWYDEINYYDYNNVTGISHNG
                     HDVGHFTQLVWAASTDVGCSVTKCSSGSVYLICEYSPAGNVKVVGGNDAYVLYKQNVK
                     PLLESN"
     gene            <116685..>117131
                     /locus_tag="KLLA0_C01518g"
                     /db_xref="GeneID:2891970"
     mRNA            <116685..>117131
                     /locus_tag="KLLA0_C01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452263.1"
                     /db_xref="GeneID:2891970"
     CDS             116685..117131
                     /locus_tag="KLLA0_C01518g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452263.1"
                     /db_xref="GeneID:2891970"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX6"
                     /translation="MTSLCFAPRLIPILGYSYDILCVRREFVSTFVSHFLPSHFEPSE
                     NWSALAASIRLFNICYQPKPYASKYLTNSSAEAYDCLRYFTKQNGTFVHLVPFSLLHI
                     SRTLNLPLTCITVFSDCTSKRENNFVRFPLTDNPYTQSFRKNFGMI"
     gene            <118950..>120482
                     /locus_tag="KLLA0_C01540g"
                     /db_xref="GeneID:2892541"
     mRNA            <118950..>120482
                     /locus_tag="KLLA0_C01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452264.1"
                     /db_xref="GeneID:2892541"
     CDS             118950..120482
                     /locus_tag="KLLA0_C01540g"
                     /note="uniprot|Q8NJT3 Kluyveromyces lactis Fus1 protein
                     (Similarity)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452264.1"
                     /db_xref="GeneID:2892541"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:F2Z6I8"
                     /translation="MEIETETRTVIQTQMNELILHNEATVINTIYVDQYYRASNTLPY
                     ALTTVSTAFATQLNKNVKTATITNQVTTTIETSQESTSTSSTSHSSSSLGVQSSQSAR
                     MTSGISLNSLASTSDGKNTSGTILGLAIGLPIALFVVGLGIVFGFLYYRRFHSKVDPD
                     NENMQQHEPDSVLGKLYGMQELNDLKKAELFNEKKQDEKYDSGVSSKITYKVSKPYIS
                     HPELIQTPEKLAFTDNPYRKNVNQKSDTNAYSNSTMDLGQFPRPLASPFKKWNYESPL
                     SRWFLTKSTLIQDKIQTAKTPTIHLKQLNILARANKSKITINGEEPYTEMSPMLPSVP
                     RSPYEAIESLPSLELKEESEIPINESKIRTEQGVIKPQIIDTNLKPTYPTLLKLDKLS
                     KTKPLPKPPNPHFTSANDDQHVSDNVSARSDHHDLRSARKSTAQEQAKLYRVVKDYQA
                     VLMDEIDIRGGELVRVLARHTDGWCLVERSNIQNHSSLDGPTYLNENRGIVPGLCLQE
                     SM"
     gene            complement(<120691..>121281)
                     /locus_tag="KLLA0_C01562g"
                     /db_xref="GeneID:2892396"
     mRNA            complement(<120691..>121281)
                     /locus_tag="KLLA0_C01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452265.1"
                     /db_xref="GeneID:2892396"
     CDS             complement(120691..121281)
                     /locus_tag="KLLA0_C01562g"
                     /note="highly similar to uniprot|Q8NIM8 Saccharomyces
                     cerevisiae YCL026C- B Hypothetical ORF and similar to
                     YCL026c-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452265.1"
                     /db_xref="GeneID:2892396"
                     /db_xref="GOA:Q6CUX4"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX4"
                     /translation="MSAAATKQFLKAIAARRTIYALKPELPSGVSINDVQEVVQAIVK
                     DTPTSFNCQGNRAIILTGETHKSVWDSVVNAIEGDNGKKRPASARDEAFGSIIFLTDD
                     KTTEKLQADFPAWSAIFPSFAEHSSGAAQISTWTAIELLGLGGHLQHYNGYVKAALPE
                     GAIPQEWTVQAQLVFGLPAAEAGEKTYIDNPVKILN"
     gene            <122103..>123098
                     /locus_tag="KLLA0_C01584g"
                     /db_xref="GeneID:2892438"
     mRNA            <122103..>123098
                     /locus_tag="KLLA0_C01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452266.1"
                     /db_xref="GeneID:2892438"
     CDS             122103..123098
                     /locus_tag="KLLA0_C01584g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452266.1"
                     /db_xref="GeneID:2892438"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX3"
                     /translation="MVELLQDLQAILPFPEDAKSSPHVIEWLNVLIGKTNEPIQCFLP
                     IWYFSYLESYSKRFPNVTVADKWKLVQDWLNNPSLLLNTGVSALTLGESYTFQLPEQW
                     ARSIEEFGLWIQLDEPYRRKDVPFYAQLRIMVGDEDETFEYLLFDNDVKVSLSDKFDQ
                     AGLYCIKFKTESPIDISTISSLKGDGSIVNCTWIFDMQLFVETEDVDRLQDLPLGRVL
                     CVDTANYSQGKDWDHIYVPFDQQLCDFLYNKSDNSSVFGQQMQDIEPELIQILDPGFD
                     FKPLHSYIIKGTSISEKPIDFFKPQEYNATSMQTVLCSYQNKKTFVNLLEDNDED"
     gene            complement(<123485..>125347)
                     /locus_tag="KLLA0_C01606g"
                     /db_xref="GeneID:2892234"
     mRNA            complement(<123485..>125347)
                     /locus_tag="KLLA0_C01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452267.1"
                     /db_xref="GeneID:2892234"
     CDS             complement(123485..125347)
                     /locus_tag="KLLA0_C01606g"
                     /note="similar to uniprot|P48813 Saccharomyces cerevisiae
                     YDR508C GNP1 High-affinity glutamine permease also
                     transports Leu Ser Thr Cys Met and Asn expression is fully
                     dependent on Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p
                     (SPS) sensor of extracellular amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452267.1"
                     /db_xref="GeneID:2892234"
                     /db_xref="GOA:Q6CUX2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX2"
                     /translation="MTGATGSSNSDFISPVGSDVKHNDKSDTIIQSEGFPSIEGEAEY
                     YEKTFSQSDEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASL
                     KRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGE
                     LAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSI
                     NPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSV
                     YIGGKYWNDPGAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPS
                     AAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS
                     FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVG
                     CICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRS
                     QVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK
                     IWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC"
     gene            <126942..>127223
                     /locus_tag="KLLA0_C01628g"
                     /db_xref="GeneID:2892007"
     mRNA            <126942..>127223
                     /locus_tag="KLLA0_C01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452268.1"
                     /db_xref="GeneID:2892007"
     CDS             126942..127223
                     /locus_tag="KLLA0_C01628g"
                     /note="highly similar to uniprot|Q12306 Saccharomyces
                     cerevisiae YDR510W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452268.1"
                     /db_xref="GeneID:2892007"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX1"
                     /translation="MSEEQEQKVDVKPETHINLKVSDGSSEIFFKIKKTTPLKRLMEA
                     FAKRQGKEIESLRFLYDGVRVLPDQTPEDLDMEDNDIIEAHREQIGGSL"
     gene            <128119..>131457
                     /locus_tag="KLLA0_C01650g"
                     /db_xref="GeneID:2892358"
     mRNA            <128119..>131457
                     /locus_tag="KLLA0_C01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452269.1"
                     /db_xref="GeneID:2892358"
     CDS             128119..131457
                     /locus_tag="KLLA0_C01650g"
                     /note="similar to uniprot|Q12263 Saccharomyces cerevisiae
                     YDR507C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452269.1"
                     /db_xref="GeneID:2892358"
                     /db_xref="GOA:Q6CUX0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUX0"
                     /translation="MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAA
                     VKIISKSIFNAQGSTMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLY
                     MVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLD
                     HKFNVKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYA
                     LLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTR
                     EILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLEGGNQCVDETILQNLVVLWHGRN
                     KEDIITKLMEPGANLEKTFYALLHRFKHDNYQDQLKQQELQKKQSVSSNSLMYVGSLP
                     SPNKSDSPVTTPKKKRTSIIVASSSHKRPVSMQKLSSQHSSPVKNGSIGKRLSKTFPS
                     NKRISQLVSNSSSPTPAAHKRVSRINDSAAPPVPKEMLRDYKRQSKRQSKRFSLLPNM
                     KRGSITTKLIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEE
                     LERKVNEAREKEEAERKERERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAE
                     YEAVQGSSDERNTANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPV
                     SRLDPGIIAAESRLSANLEDDQASKEKTILETIRRSKFLGSQFNLNVELEKAQKDLVS
                     KERQEQLRKYSEQTAKYEVQKLPKNAKAVATLRDDEVEPRKLSEVKVPQFTRRSKHFS
                     SSNKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEE
                     LDENSKLFEVPETEEGKLASAARKESTDARKQSTNDKDINLPSLPPLQVSHDVADENG
                     ALGLGIYQPNDQTQKPHKTMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNNNER
                     KPLEEITPKVENKRKISFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNE
                     WTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGST
                     KTFNRLVKEIEKILEKEKVLVFSF"
     gene            complement(<131543..>132772)
                     /locus_tag="KLLA0_C01672g"
                     /db_xref="GeneID:2891935"
     mRNA            complement(<131543..>132772)
                     /locus_tag="KLLA0_C01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452270.1"
                     /db_xref="GeneID:2891935"
     CDS             complement(131543..132772)
                     /locus_tag="KLLA0_C01672g"
                     /note="weakly similar to uniprot|P41816 Saccharomyces
                     cerevisiae YPL171C OYE3 Widely conserved NADPH
                     oxidoreductase containing flavin mononucleotide (FMN)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452270.1"
                     /db_xref="GeneID:2891935"
                     /db_xref="GOA:Q6CUW9"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW9"
                     /translation="MVMPVKLEKSDQVAFWTPKQPEVGKFLRYFDGIERDAPLLFQPL
                     TIRGMTISNRVGTSPMCTYSSENFEANKYHLVHYGSISSSGPGLVIVESSAIDQIGAS
                     SPNDLGLFTDEQAITHKENIVDWAHVHNIKIGVQLGHAGRKASLASPLNGELGVYVPN
                     EEGGWLDKLVAPSTVPFDDSGVIPNELTLAQIEKTIKQYGISAKLAVEKAGYDFVEIH
                     AGYGYLPCQFYTATANKRNDRYGGPFENRIKFLLEVIDEVRSSIPDSMPIFLRLCADE
                     NVEDPDGWKLNDTIRLLPFLVQHGVDVIDVCSGGLNSKEYGWDHPNFLPPREIAKRIK
                     EAAHSKILVASTGGLQDGTTANSLLESNTVDILLIGRVYLKNSGIIWQLADDLGVQLE
                     QAKQKAWIFDSEGHLKK"
     gene            <133089..>134927
                     /locus_tag="KLLA0_C01694g"
                     /db_xref="GeneID:2892187"
     mRNA            <133089..>134927
                     /locus_tag="KLLA0_C01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452271.1"
                     /db_xref="GeneID:2892187"
     CDS             133089..134927
                     /locus_tag="KLLA0_C01694g"
                     /note="similar to uniprot|Q04399 Saccharomyces cerevisiae
                     YDR506C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452271.1"
                     /db_xref="GeneID:2892187"
                     /db_xref="GOA:Q6CUW8"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW8"
                     /translation="MLIEALWIVLLFGVSQCKDLKFDISRHEDGRTIRLNENDDLIKP
                     PLRLRNGEQLNLQIENHLDQPTAIHFHGLLLENFVGEELATGKQPAVLGDGVPGISQY
                     EVGVNRSYWQNITVSKTTCGTFWYHSHYAVQYGEGLRGPVIVDCDQFDNHERDVAKEF
                     GLGAHVQEQIITLSDWYKYPHDFIMDAFLQPNKGADPHVDGSLFNGKQDENQVIQVDP
                     DTEYLRLRILNMANSNTQVFHIANHKMIVIETDGILVKPVELSTLTLATGQRYTVLVK
                     RDENNQNARIIHGCNKMMGYITKSHVLQYYPSFSTAVSSSSVSISRLPDFTSIELYKK
                     YEPIDWMLLPDPESNDQKFSLDYEQSTSAATKQKYHTSMFFVNGDTMGEFMNPASAVP
                     LLISMENATKKPINVGFGGTVDIAINSIDHMRHPWHLHGHHFQVISIGESGDGPLHWD
                     NPSSRAYAKYSEDLTYWKSSGRVPMTRDTINIAGSSFAVIRFQADSPGLWLLHCHVDW
                     HMVKGLGVVIQEGLETLPLDSLVIREPTNIVTPKPKLNPDIELLHEESISSTPTPPPT
                     PLPTVQADADHAINTQPETSKLKVIGIYCAVVVFLDIMLYKYMLSR"
     gene            <135681..>138188
                     /locus_tag="KLLA0_C01716g"
                     /db_xref="GeneID:2892545"
     mRNA            <135681..>138188
                     /locus_tag="KLLA0_C01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452272.1"
                     /db_xref="GeneID:2892545"
     CDS             135681..138188
                     /locus_tag="KLLA0_C01716g"
                     /note="weakly similar to Saccharomyces cerevisiae YLR177W
                     Hypothetical ORF and to YDR505C uniprot|P50896
                     Saccharomyces cerevisiae YDR505C PSP1 Asn and gln rich
                     protein of unknown function; high-copy suppressor of POL1
                     (DNA polymerase alpha) and partial suppressor of CDC2
                     (polymerase delta) and CDC6 (pre-RC loading factor)
                     mutations; overexpression results in growth inhibition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452272.1"
                     /db_xref="GeneID:2892545"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW7"
                     /translation="MMNELPQVSSTTSLSDNPQLRQYYDKFLFKNSSGKSLSDLPAKA
                     REQARSNLNPEEGFSSGTWTGTGASLDNSVGQGRGQSQGQGQGQGQGQGQGQNQSQRQ
                     SQGQGHATGTGPGNVDFISGFRNPMYQMDASPISSSGSHNRASMSFSDAMGGPQAAAA
                     VGGPMGGSIPEPVPGSSSMFQFSYSGPGSINAQNQPFGMVPLSASGHAQDYSVITGGP
                     QQQQHMMPPHLQAQVPYGPGPGVPGNMASASIQQGQVQGGGSRGAPHSRNNSVVSASS
                     VSPSSYYAALNQTVSPSDQLSPLNSAGSSSYGAGAMTPSNLTFGQDSNNFIGDIHSSG
                     RRSSYVSDALIHGHSLNNPNSNFTIGGGSGNTGGNSNQQRFFTQRQSLSGSVSGGGNG
                     YQSPRNFHQMKHNSVSSGSSGPITTNMGSVPGHQQPPLALLSQSGNTNPQTVSAGLPQ
                     QGTFPLDNGLLLQDGQIVSSESLSQLYKECGENFFASKSCTEFVDAVKALIVGTSENK
                     TRSEKVQKFLGFLKSCNLNYNPQSDAFVSTGKHRRSSTSSYLHYRPLVLVALKNGKLE
                     LLSLPQGTNLKLARDDLIIIDGDRGKDLAVCIAPVVQLELALFINFLKKKIHFDSLIT
                     SRNQHYPADKFIDALMNNANGSQDDLNPKLYDVIELTQLIIPSKQILRFATPWECFTN
                     LHSKFQDELKALHIAQLKLKTLNSNNAVNGKPSLNIKILNSEFQFDRKKLTFYYICQE
                     RNDFRELIKELFKFYKTRIWLCAIPNNLEIDSKYYDNERKEWAMYEDMMKHFQQEELS
                     DNNLPPQTGFIVAPSLKNIQLDNFQIGVYKELVNSMF"
     gene            complement(<138679..>139272)
                     /locus_tag="KLLA0_C01738g"
                     /db_xref="GeneID:2892252"
     mRNA            complement(<138679..>139272)
                     /locus_tag="KLLA0_C01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452273.1"
                     /db_xref="GeneID:2892252"
     CDS             complement(138679..139272)
                     /locus_tag="KLLA0_C01738g"
                     /note="similar to uniprot|P14306 Saccharomyces cerevisiae
                     YLR178C TFS1 Carboxypeptidase Y inhibitor (putative) lipid
                     binding protein supressor of a cdc25 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452273.1"
                     /db_xref="GeneID:2892252"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW6"
                     /translation="MFASINSAKAIKDSLTSHGVISKVLPDFSNKGSTSLVIEYASKH
                     PVALGNTLSIDGTQEKPEIKVAGGNDAQLDTDALYSLCLTDPDAPSNSDNKWSEYCHY
                     LETNIKLSLDPDTPMSLDLKAGDVQLPYVGPAPPKGTGPHRYVWILAQQSPDKKPESV
                     SDRPNWGFKKPGTGFQHYAELFNLTPVAVNFFYAENK"
     gene            <139887..>140798
                     /locus_tag="KLLA0_C01760g"
                     /db_xref="GeneID:2892250"
     mRNA            <139887..>140798
                     /locus_tag="KLLA0_C01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452274.1"
                     /db_xref="GeneID:2892250"
     CDS             139887..140798
                     /locus_tag="KLLA0_C01760g"
                     /note="similar to uniprot|Q04396 Saccharomyces cerevisiae
                     YDR503C LPP1 Lipid phosphate phosphatase catalyzes
                     Mg(2)-independent dephosphorylation of phosphatidic acid
                     (PA) lysophosphatidic acid and diacylglycerol
                     pyrophosphate involved in control of the cellular levels
                     of phosphatidylinositol and PA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452274.1"
                     /db_xref="GeneID:2892250"
                     /db_xref="GOA:Q6CUW5"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW5"
                     /translation="MISDMEEYWLYFRQFVPFYIVALCTLAHFVYTELTWMPRMDKPF
                     RLDDQAISKAFVENELVSGGMCMLLTVSIPMSVCLAYCMSKETDWKRSNLSKKFERPM
                     SIDTNTHRFHCAMVMLWVSIGVTGMLTNVLKFKISNFRPDFIERCVPKEGFTKDSGTA
                     MAYVSEACLQPNLRFLVEGMKSTPSGHSSMIACGCWYAWRWIYDHVTRPAISSTSTST
                     TTTTGSKLSSISSRIDIRTIWLPVLIATVMVSRLVDHRHHWYDVIAGCLLGLTCVNVI
                     YYYWSTVNNTTSTSSFLNQGHGDLLPT"
     gene            <141519..>142673
                     /locus_tag="KLLA0_C01782g"
                     /db_xref="GeneID:2892009"
     mRNA            <141519..>142673
                     /locus_tag="KLLA0_C01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452275.1"
                     /db_xref="GeneID:2892009"
     CDS             141519..142673
                     /locus_tag="KLLA0_C01782g"
                     /note="highly similar to uniprot|P10659 Saccharomyces
                     cerevisiae YLR180W and to uniprot|P19358 Saccharomyces
                     cerevisiae YDR502C SAM1 S-adenosylmethionine synthetase
                     catalyzes transfer of the adenosyl group of ATP to the
                     sulfur atom of methionine one of two differentially
                     regulated isozymes (Sam1p and Sam2p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452275.1"
                     /db_xref="GeneID:2892009"
                     /db_xref="GOA:Q6CUW4"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW4"
                     /translation="MGNNNTFLFTSESVGEGHPDKICDQVSDAILDACLREDPLSKVA
                     CETAAKTGMIMVFGEITTRANLDYQKIVRDTIKQIGYDSSEKGFDYKTCNVLVAIEQQ
                     SPDIAQGLHYEQALEELGAGDQGIMFGYATDETPEHLPLTILLAHKLNMAMADARRDG
                     SLPWVRPDTKTQVTVEYKEDNGRWIPLRIDTIVISAQHAEEISTADLRQSLRTNIIDK
                     VCPAEMLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDY
                     SKVDRSAAYAARWVAKSLVHAGICKRVQVQFSYAIGIAEPLSLHVDTYGTATIPDEEV
                     IEIIKKNFDLRPGVLVKELDLARPIYLPTASYGHFTNQEYPWEKPKALKL"
     gene            complement(<143120..>144034)
                     /locus_tag="KLLA0_C01804g"
                     /db_xref="GeneID:2892367"
     mRNA            complement(<143120..>144034)
                     /locus_tag="KLLA0_C01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452276.1"
                     /db_xref="GeneID:2892367"
     CDS             complement(143120..144034)
                     /locus_tag="KLLA0_C01804g"
                     /note="similar to uniprot|Q07057 Saccharomyces cerevisiae
                     YLR181C VTA1 Protein involved in endosomal protein sorting
                     binds to Vps20 and Vps4 and may regulate Vps4function has
                     coiled- coil domains mutants show class E vacuolar-protein
                     sorting defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452276.1"
                     /db_xref="GeneID:2892367"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW3"
                     /translation="MSNVAQYKRVIKLSKELSTLPVISYYLKLYAAELILNEKERDGE
                     ATELVMSLLDDVESFKNEVNDEGTKILLNEKDKALAFVLNLAMSIYNGILVQIQDDRI
                     NDDIGKGLWCCIDLFQCCKHIWADSMDAIVKEQCDKRIKHSKYYLMKLKRGQLQSDKK
                     PQETTSEPTNSNPLSEVEDEIPNFVEDLEDQPLFEEPKDSEIAQQHGPSPSLKVDESV
                     EKLKQLESPEVPIKLLTPEPIKLESPKPAVRHDVATLKEIMSREHRIQKAQRSAKYAI
                     SALNYDDIVTAKAELLQAFKLLEDLTPE"
     gene            <144307..>146532
                     /locus_tag="KLLA0_C01826g"
                     /db_xref="GeneID:2892682"
     mRNA            <144307..>146532
                     /locus_tag="KLLA0_C01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452277.1"
                     /db_xref="GeneID:2892682"
     CDS             144307..146532
                     /locus_tag="KLLA0_C01826g"
                     /note="uniprot|P40418 Kluyveromyces lactis Regulatory
                     protein SWI6 (Cell-cycle box factor, chain SWI6)
                     (Trans-acting activator of HO endonuclease gene) (MBF
                     subunit P90)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452277.1"
                     /db_xref="GeneID:2892682"
                     /db_xref="GOA:P40418"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /translation="MSRPIFKVHKGDRITFQQRLQDGYVCLDQFIPLLTNLSSFNFHR
                     DDPLVENLDDMVTSQFNILIDTDRSGTRWITLQKAHELWDLLQIKDDSGSENLTDHDD
                     DNEANHNGVEDDGQKTPENNGRKTDNHTMENGGTENTNNGNNSSNKNDGNVTAEGSNF
                     RPATITNGTTSRISGGEPDTVKHELLDLPDSPTKRHQTKSVSKIPVFQHDLPTVSTLQ
                     KTLPPVSNYSNDERAKLETLLQRILFPETTNLNVAEGYPSVSLTQQVQELDTQFPNVP
                     LNFNIPIDEHGNTSLHWLCSIANLDLLKQLIVFGSDRRIGDKSGESVLVKSVKSVNNY
                     DSGTFEILLDYLYPCIVMVDDMDRTVLHHIVITSGMPGCNAAAKYYLDILMGWIVKKQ
                     SRTKESHCVLLEDIDLQWVITHLLNARDSNGDTCLNIAARLGNVAIVEALLDYGADPN
                     IANNSGLCPVDFGAGTQPRFQSNTKNLMATPTKTHETSLDPMAESTSLITNIKSLLSK
                     ISNDYGDEIKQHNGKMKELLDTLNIKREALANARDRLAKAKQIQDEYNLLSDRLNNVE
                     NTIAEEDQNFQLASRELGLSLDDVQEEGLNSADIAFDADEPFRISYVYTKFEEKIKDE
                     YNNDFELFLKHCNLSQLVHEIYDNFPSRAEIPHPKILKARIKAYNRNELHLDSTLQTI
                     KDKQKNLESKFRKVLSLCLKIDEEKVDSMLDGLLQAISNEDPEDIDTDEVNNFLESAA
                     E"
     gene            complement(<146739..>148310)
                     /locus_tag="KLLA0_C01848g"
                     /db_xref="GeneID:2891917"
     mRNA            complement(<146739..>148310)
                     /locus_tag="KLLA0_C01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452278.1"
                     /db_xref="GeneID:2891917"
     CDS             complement(146739..148310)
                     /locus_tag="KLLA0_C01848g"
                     /note="similar to uniprot|Q04383 Saccharomyces cerevisiae
                     YDR501W PLM2 Plasmid Maintenance and to uniprot|Q06266
                     YLR183C Saccharomyces cerevisiae TOS4 Transcription factor
                     that binds to a number of promoter regions, particularly
                     promoters of some genes involved in pheromone response and
                     cell cycle; potential Cdc28p substrate; expression is
                     induced in G1 by bound SBF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452278.1"
                     /db_xref="GeneID:2891917"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW1"
                     /translation="MNSQFPPSSPIASSHQYDLENPFYHPEKDTESVVSSASLKLFKD
                     KDDLKQGNVKNYPTPHPSSTVGRSSSPMRDQAGEILSSDYEMEKHLETELKKVSLIDI
                     SLDPRDNSRLAIGRKKSVCDIHLPRGKNISRQHAFISYISPSNQLKLECNGTNGLVIS
                     FPKKLSHVLVKRSKASDVYELVTQDQLHDNEQIISPEEKQLLKSTYLTSFVLLKGETV
                     IMPYIKDTIFDFRQCEARVRLQDVTTDEEDAKNDTETEDELTKVDLHSDEFHDEDFSL
                     EEQESVANMIPMSTVECSPPTPQCMKPSVLPVAIRHTSDTERPNVERTKCKLTPYSSF
                     TIKTPNAPKKLEASTPVKDMTTPSKVKVDENADEVRRRKLNTPSPKKKSKKKSRKQID
                     SDEASKEQTLSSLTTRGVDYKELQHVLSNHLAFSNIQQVPLFQLQDVNSVVSKLSRTE
                     LRAILNDEQCIGVIYRTGKDAAGKPLDEEYYYDAENDPDDDRRQLVASLKGGRSGLRS
                     CRRVHKQYFWKKPTK"
     gene            <148935..>149708
                     /locus_tag="KLLA0_C01870g"
                     /db_xref="GeneID:2892544"
     mRNA            join(<148935..148941,149449..>149708)
                     /locus_tag="KLLA0_C01870g"
                     /product="60S ribosomal protein L37"
                     /transcript_id="XM_452279.1"
                     /db_xref="GeneID:2892544"
     CDS             join(148935..148941,149449..149708)
                     /locus_tag="KLLA0_C01870g"
                     /note="highly similar to uniprot|P49166 Saccharomyces
                     cerevisiae YLR185W RPL37A protein and to uniprot|P51402
                     Saccharomyces cerevisiae YDR500C RPL37B protein,
                     components of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L37"
                     /protein_id="XP_452279.1"
                     /db_xref="GeneID:2892544"
                     /db_xref="GOA:Q6CUW0"
                     /db_xref="InterPro:IPR001569"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR018267"
                     /db_xref="UniProtKB/TrEMBL:Q6CUW0"
                     /translation="MGKGTPSFGKRHNKSHTLCKRCGRSSYHIQKHTCSSCGYPAAKM
                     RSHNWAAKAKRRRTTGTGRMRYLKHVSRRFKNGFQSGEAKAQSA"
     gene            complement(<149917..>151911)
                     /locus_tag="KLLA0_C01892g"
                     /db_xref="GeneID:2892543"
     mRNA            complement(<149917..>151911)
                     /locus_tag="KLLA0_C01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452280.1"
                     /db_xref="GeneID:2892543"
     CDS             complement(149917..151911)
                     /locus_tag="KLLA0_C01892g"
                     /note="weakly similar to uniprot|Q04377 Saccharomyces
                     cerevisiae YDR499W LCD1 Essential protein required for the
                     DNA integrity checkpoint pathways interacts physically
                     with Mec1p putative homolog of S. pombe Rad26 and human
                     ATRIP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452280.1"
                     /db_xref="GeneID:2892543"
                     /db_xref="GOA:Q6CUV9"
                     /db_xref="InterPro:IPR018622"
                     /translation="MADLWDDNDDDDDILELVNRPPMSQMAVPIKPPESQAEQLMKAK
                     GEVGVLRQKLSMLEKTLREHDDNQKKLESSLKSSHEEEVTKLKIELERLEDERKFMLL
                     EQKHLFTPRNSSKSETTHETETAEPSPIENKRRRMEPVKEYVTLTQNFKVDDGSLFYD
                     HLLNFKLLGSEHTVLEMLDHICTYKTDLILSPEHKIIKARLPLGPPIRSLIFKWKSIY
                     TLDQLVDKTLEILAIAIKSVSVLPENKLAIPFLISLMHCTINFRHSATSVSSLKDVFQ
                     FITDFIISDPKFLKQPLHESPLDLDVSPDVFQYSMLDQLCMTYSFDVLETCIVILLNC
                     NTRAQEIVLNDATIAENLIKCCNFTLSISYKPIMPIIVNVTEILLGIVELDGAENVWK
                     GKWAVLFSKLIQNWERSLTFDSVSLNFAGLNRCCGDNSNHSMIDNIISLEEVRYLPMI
                     IENEFEPLTFTALDNLEYWSIQIQINITLIMHKLLHRYRSTLCSLEFLQKTFSLFSSH
                     QELLLTVFLDRDHISDIKRQELLSVLLKLIYFCWVSISDEYKRALRLDELTICLWRIV
                     YGWPESTDELSTEWAALINPLKALALEEEKKYFDDAYDEDNLPAFMHSEELDIKRESA
                     VSKFNNNSSWPLRDMAKYILESITTMDEADSLYVAMVSET"
     gene            <152834..>153592
                     /locus_tag="KLLA0_C01914g"
                     /db_xref="GeneID:2891832"
     mRNA            <152834..>153592
                     /locus_tag="KLLA0_C01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452281.1"
                     /db_xref="GeneID:2891832"
     CDS             152834..153592
                     /locus_tag="KLLA0_C01914g"
                     /note="highly similar to uniprot|Q06287 Saccharomyces
                     cerevisiae YLR186W EMG1 Protein required for the
                     maturation of the 18S rRNA and for 40S ribosome production
                     associated with spindle/microtubules nuclear localization
                     depends on physical interaction with Nop14p may bind
                     snoRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452281.1"
                     /db_xref="GeneID:2891832"
                     /db_xref="GOA:Q6CUV8"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q6CUV8"
                     /translation="MVEDSKVRDAMKNGEKKVLPASLVPQAPPVLTSKDKVTKRLIVV
                     LSQASLETHKISSNGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDS
                     PVNKAGKLQVYIQTSRGVLIELNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPITDHLPTKCRKITLSFDAPVIRVQDYVEKLDDDESICVFVGAMARGKDNFAD
                     EFVDEKIGLSNYPLSASVACSKFCHGCEDVWNIM"
     gene            <153971..>155902
                     /locus_tag="KLLA0_C01936g"
                     /db_xref="GeneID:2892642"
     mRNA            <153971..>155902
                     /locus_tag="KLLA0_C01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452282.1"
                     /db_xref="GeneID:2892642"
     CDS             153971..155902
                     /locus_tag="KLLA0_C01936g"
                     /note="similar to uniprot|P53835 Saccharomyces cerevisiae
                     YNL279W PRM1 Pheromone-regulated multispanning membrane
                     protein involved in membrane fusion during mating
                     predicted to have 5 transmembrane segments and a coiled
                     coil domain localizes to the shmoo tip regulated by
                     Ste12p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452282.1"
                     /db_xref="GeneID:2892642"
                     /db_xref="GOA:Q6CUV7"
                     /db_xref="InterPro:IPR026777"
                     /translation="MGHIYLKLNERLSQIWCNKYTIIILVMMVKILLFIKMLSNGFEN
                     IMDYTMENCRNIDYYYSKYVNSSPHYMGLMGNFLIQKSMEQSVALSLKSISLLVSVSE
                     NVIDFMIDLWLGTWVCLIVSAIDGSVDVATNATESVIDLVNGTVSSVADEIDDGLSGL
                     TKVVNKVLSAVNDIQNFFKGNDDESDINDQVKKVNLTINGLRTLSIPSSIDDKLVKLS
                     ANTPDFDTVKNKTKQAIAVPFDIIRNEIKSINASKLVGDPQYLEVPAIDTSGVKICSD
                     NKSEINEVFDTIRKVFNASTMTILIVFILAALSLIVYNAWAEWRQWIRLKRFRDQYRH
                     QTIMLKNPFDDMADEKVPQNVDILETYHLVFNRYQSGFGRWLSRRISSKLETQRNIQW
                     LVTYLTSSTSLTLLALGLCGILMCCVQFAIIAIISNKINGKETEKMMTSMSTAMNDTV
                     QQGMTDWSKSANLYINDTETQINRQVFGWIQNTTDTVNGTVTDLIEDIDNAISKAFNG
                     TILYKPMDTVMQCVIGNKLEAISTALTWVHNTAQVNLPRVNGSELYQQLQQNLTDSNS
                     TTSSTAELPNSTSIATQLKDNLISAANKILSQYKNTVVIELIVSSVFLALYFFQIPVA
                     GIILAAQKHKSKHNNQNRP"
     gene            <157410..>160460
                     /locus_tag="KLLA0_C01969g"
                     /db_xref="GeneID:2891946"
     mRNA            <157410..>160460
                     /locus_tag="KLLA0_C01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452284.1"
                     /db_xref="GeneID:2891946"
     CDS             157410..160460
                     /locus_tag="KLLA0_C01969g"
                     /note="similar to Saccharomyces cerevisiae YLR187W SKG3
                     Protein of unknown function; green fluorescent protein
                     (GFP)-fusion protein localizes to the cell periphery,
                     cytoplasm, bud, and bud neck; potential Cdc28p substrate
                     and to YNL278W uniprot|P53836 Saccharomyces cerevisiae
                     YNL278W CAF120 Part of the evolutionarily-conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation, elongation, and degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452284.1"
                     /db_xref="GeneID:2891946"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:Q6CUV5"
                     /translation="MKKVFSEKLSPSSPTLSSAVNFLAPPRNIFSDSSSTIGSDKGSG
                     KSRSRSSSFGRIFSNSSDNGSKEKAAASLPKEQTVNTLSPELVPIVTLLSAQSHRRYQ
                     EGVFLILKDLKSDGSPADRVWKEVFGLLIGTQLALWDATELAKNGNDAEKLMNATLKP
                     TYVNFTDAQLRVLDPSDTSLQGPNSSKKNVDNTIVVSTTLKNRYFLQFSDRESFQKWV
                     SAFRLSAFEFTLLQEAYTGAFLSTRGAKLSDIRVILADTKFDYEDWVSVRFGAGMPWK
                     RCYAVISQPTKKNKEGKKKYVGEINFYENEKKTKKTKAMATVTNAYAVYAIYPQSPVL
                     IDTSTMIKLEGLISFGKKDTPKDTDIFVMPEKHYAVPGYDTIIRFLIPTMNAFNLYGR
                     PKRLIANKDDPSSLLFALPTLPHIHYLQVDDVLSLTKRSGSSQWNIQDWRQQMKELLS
                     KKQSSGYTGCGSSTGLMGALSSPAIGAGELFDHTPNSPSFLSAQRFVSTPIDTKFEPQ
                     NTSPLRNDAAKDTVISAPKLSLNDSAVPMINPDSSEEAMHNSLSAMDNTRSFSIPIQQ
                     NPTFEDQIQSRSVEGKEAKRVVSSIDIQDSNYDRFIQPKPIVSSSKPRNNQVPDNRSR
                     LSDLSQIYDNYGSNSNGPYSQGGNDFDRSFDSQNSLIKDASSAYNEYTGSPTIKKFDI
                     SNVNATGSDDVLEDFYQLSKQISSLSVVDKPRTANEKSDDFDFANADTGYEAPSDNVF
                     DPDYMEENDMLDMESKFTQEDYKNVSTDSLNSDKYYEANDNIQNRGAQNREFSPNPYL
                     DSHSYQNSRKPPVHIPRSKPVPLQPQLHPQQGPPYSMPRNPTAAVRTQNPYVQQSNAP
                     PAGYVNGHQGNAAPQRIPPKGLGYSRAPNAPQQLPSKGYEKRPPQLQQISPQQYRHQN
                     QGQQMGTHNPYGNPGRPMPNQQFPHSPNQQQHPPGQQYQQYLPQQYPPQQYPPQQYSQ
                     KYSAPHENSRQALNAQFNAPKSPANGGFSQFMPPSQGSNNPYSN"
     gene            <160778..>162898
                     /locus_tag="KLLA0_C01991g"
                     /db_xref="GeneID:2891811"
     mRNA            <160778..>162898
                     /locus_tag="KLLA0_C01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452285.1"
                     /db_xref="GeneID:2891811"
     CDS             160778..162898
                     /locus_tag="KLLA0_C01991g"
                     /note="similar to uniprot|P33310 Saccharomyces cerevisiae
                     YLR188W MDL1 Half-type ATP-binding cassette (ABC)
                     transporter of the inner mitochondrial membrane mediates
                     export of peptides generated upon proteolysis of
                     mitochondrial proteins plays a role in the regulation of
                     cellular resistance to oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452285.1"
                     /db_xref="GeneID:2891811"
                     /db_xref="GOA:Q6CUV4"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUV4"
                     /translation="MFPTMLRLRYIVQNVPLRVNSPSTILRYPINLGKRSPLISFQSR
                     SFARCSIALQAAKKQGKPSLTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFI
                     ALILIILSSAVSMAVPTVIGKLLDIAREEHEQPETEKETMIFGLTSTQFYTALGGVFV
                     VGALANVGRIVILKVTGERLVARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGI
                     VSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNL
                     SRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRKVFHVGLKEALTSGA
                     FFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSEL
                     MKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKFSYPTRPQHHIFEDLN
                     FTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRDFNLRKYRRLLGV
                     VQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQTTVGPR
                     GTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTTIS
                     IAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSKEQEVEEESHEPH
                     DPQQQEEEEGINEEKEVQPKLITT"
     gene            <163538..>165001
                     /locus_tag="KLLA0_C02013g"
                     /db_xref="GeneID:2891828"
     mRNA            <163538..>165001
                     /locus_tag="KLLA0_C02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452286.1"
                     /db_xref="GeneID:2891828"
     CDS             163538..165001
                     /locus_tag="KLLA0_C02013g"
                     /note="similar to uniprot|P08465 Saccharomyces cerevisiae
                     YNL277W MET2 L-homoserine-O-acetyltransferase catalyzes
                     the conversion of homoserine to O-acetyl homoserine which
                     is the first step of the methionine biosynthetic pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452286.1"
                     /db_xref="GeneID:2891828"
                     /db_xref="GOA:Q6CUV3"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CUV3"
                     /translation="MSTVKSSLPELDQEELSKTNPFIKIVHGQTIVEVPELELECGIT
                     INNFPIAYKTWGYLNEAKDNVLVICHALTGSSDVSDWWGPLLGNGLAFDPSKFFIICL
                     NSMGSPYGSFSPLSIDSSTGERYGPEFPLCTVRDDVNAHRIVLDSLGISSIACVIGGS
                     MGGMVALEWAAIFGTDYVKNLIALATSARHSAWCISWSEAQRQSIYSDPKYLDGYYPL
                     EEPPTVGLSAARMSALLTYRSRNSFENKFARSVPSQQHQQKSGRSESQNSLTSKKLQE
                     LNKEIHNDGHYRRNSPSFERKPSVSSVSSSCSSPRDSNHSLSSSTSTTSLNRLKGSKQ
                     VKPVQTYFSAQSYLRYQGEKFIKRFDANCYISITRKLDTHDLARDRDDEDITHVLGSF
                     KQPTLVIGISSDGLFTYSEQEFLANNIPKARLEKIDSPEGHDAFLLEFKLINELIKSF
                     LATNCKGLVSSEGRLWQDTSEVVTNSVFGEAEEVTNW"
     gene            complement(<165312..>168941)
                     /locus_tag="KLLA0_C02035g"
                     /db_xref="GeneID:2891856"
     mRNA            complement(<165312..>168941)
                     /locus_tag="KLLA0_C02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452287.1"
                     /db_xref="GeneID:2891856"
     CDS             complement(165312..168941)
                     /locus_tag="KLLA0_C02035g"
                     /note="similar to uniprot|Q06321 Saccharomyces cerevisiae
                     YLR189C ATG26 UDP-glucose:sterol glucosyltransferase
                     conserved enzyme involved in synthesis of sterol glucoside
                     membrane lipids involved in autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452287.1"
                     /db_xref="GeneID:2891856"
                     /db_xref="GOA:Q6CUV2"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002213"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="InterPro:IPR011993"
                     /translation="MPKDSSEHQKSPSRFTRSMFVDPRAFVRRSVSPVDQLCHSVADL
                     RFVSSNTETLESRLQALSKKFDNGSENHGQDTDTVEDVAKTQYMAKSFAGLIATASMY
                     VGINELGDKEENDEDELELMNDAASVLDTSSQANQTLFEVSIEMNADAISQISTDSKS
                     RKELIRERLIKKFLPNDDEKYIEEYPCWLLRDIMIQGHAYLTNKHLFFFAFIPNFESD
                     FNVTGSLRLISGHVLSKSHRYWVVLKGHTLSFHNSSTDLYFPLLTIDLRDISSVQMTS
                     SENNPTKFELSIKDQSLVLKADSFHSARHWVSSIKKQMFASQHSDTNTMTIKIPLQNI
                     VDLEETSILDKSGTLRIKALENLSTYAVDEYFFVFFKGNANAMKQKVNSLLKDLEMNG
                     SQILVNFNKVDSPLGINEKLPDLNYDDPSNENNLVDDADINSAETDTLSPGTMQSALT
                     LQQTSSAFSPRHSAYPRKVKKKLKSMAGSLKLGSPSKFTKLEDDIIIEHYSPGLINDQ
                     TIDYDKDSKSIISRLTPKKFQNVPLMWAADPVHFNSDDGIVFPLDDKYTADADISNQS
                     NVRFRQHFSFDETANLVASYHGYLNRNVPIYGKIYISDKNICFRSLLPGVSTKTVLPL
                     EDVENCYKETRFRFGYFGLVIVIHGHEELFLEFGNKNARDDCEFVMIKVMDAVSSHRS
                     TLKRKSTAEVVHRLSEAASLKLLEEKISEQGFDIPLIVEKNPYFTTVIKPSKSYKFGL
                     LTIGSRGDVQPYIALAKGLQAEGHEVIILTHGEFKDWIVSHNIGFREISGNPAELISL
                     MVQHGSMNMGLLRDASTNFSTWISSLLDTAWEGCQGIDILIESPSAMAGIHIAEALRI
                     PYFRAFTMPWTRTRAYPHAFIVPDQKRGGNYNYFTHVLFENIFWKGISGKVNEWRETK
                     LKLPKTNLVSMQQNRVPFLYNVSPIVFPPSVDFNEWIKVTGYWFLDEKRSYKPPAEFM
                     EFLNKARELKKKVVYIGFGSIVVNDPEKMTDTIIEAVRDAGVYCVLNKGWSNRFGDPL
                     AKKIDKELPSYIYNSGDVPHDWLFTKIDATVHHGGSGTTGASLRAGLPTIIKPFFGDQ
                     FFYASRVEDIGAGVALKKLNRSSLAKALKEVTTNTRIIQKARQIGESISKEHGVATAI
                     GAIYSELGYARSLIKTKNPVDDKEMEAASTKLSNDAVVTAKGNEKEEYSSEGSGSNDG
                     SWLLI"
     gene            complement(<169406..>170758)
                     /locus_tag="KLLA0_C02057g"
                     /db_xref="GeneID:2892356"
     mRNA            complement(<169406..>170758)
                     /locus_tag="KLLA0_C02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452288.1"
                     /db_xref="GeneID:2892356"
     CDS             complement(169406..170758)
                     /locus_tag="KLLA0_C02057g"
                     /note="similar to uniprot|P40015 Saccharomyces cerevisiae
                     YER019W ISC1 Inositol phosphosphingolipid phospholipase C
                     hydrolyzes inositolphosphosphingolipids activated by
                     phosphatidylserine cardiolipin and phosphatidylglycerol
                     mediates Na and Li halotolerance contains a P loop-like
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452288.1"
                     /db_xref="GeneID:2892356"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6CUV1"
                     /translation="MTDSFNGQAIDPGRIRFLTFNTWGLKYIARFRKQRLTALAERLA
                     GNLDAGNFWDQNPNDTKEQYDVVALQEVWCDEDWNYIVERCKHRYPYYRRFKSGMISG
                     PGLAILSKIPIESTFLYRFPINGRPSAFWRGDWYVGKSISVTLLKRTSPEYPPLAILN
                     SHMHAPYALTGDAAYECHRACQSWDFSKLVKLYKKAGYSVVVVGDLNSRPGSLPHKFL
                     TIEAGQVDSWEQKFGVQDLKDIAALSPANQITYGGTTCDSTLNTWRASRGAHEACRLD
                     YALIDSNTLHTLDAKVTFTETIPNIGSFSDHFAYSILLQLKDLTQTDQKPHILQETDH
                     SMAKEQALERIQMYDDLLLCIDNYMATAKWQKLWRGTHFWVSIFFIIASMVVTTFTSN
                     IAGWSSIFWILFSVALTASGLIDGLISLLFGNKEIRALQEVYEEVSDAKRFLSSSVNN
                     "
     gene            <171259..>172042
                     /locus_tag="KLLA0_C02079g"
                     /db_xref="GeneID:2892694"
     mRNA            join(<171259..171463,171564..>172042)
                     /locus_tag="KLLA0_C02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452289.1"
                     /db_xref="GeneID:2892694"
     CDS             join(171259..171463,171564..172042)
                     /locus_tag="KLLA0_C02079g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452289.1"
                     /db_xref="GeneID:2892694"
                     /db_xref="GOA:Q6CUV0"
                     /db_xref="InterPro:IPR013255"
                     /translation="MGIDDFNELKLKMDDFQSKIHQFLIKNNQDLATKSETYWNSESE
                     KIKKIEALKDKLRQLEEHQISLEEEFESSQREVSEVNAQSKAFLTKRDKLIGEREFLH
                     KELDKLDILLKEQTKDLEREKQSRLLQSSKDTNEVALFETLLGLHISANAQDAITFHF
                     TSRTVDVSPQLSITLDVSQDTYKITDSNPKLPQIIKNDLLNNLAATDDLRSFLKAARS
                     HLSALTEAT"
     gene            <172317..>173351
                     /locus_tag="KLLA0_C02101g"
                     /db_xref="GeneID:2892370"
     mRNA            <172317..>173351
                     /locus_tag="KLLA0_C02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452290.1"
                     /db_xref="GeneID:2892370"
     CDS             172317..173351
                     /locus_tag="KLLA0_C02101g"
                     /note="similar to uniprot|P25625 Saccharomyces cerevisiae
                     YCR044C PER1 Vacuolar membrane protein that seems to be
                     involved in Mn2 homeostasis mutant is dependent on
                     activation of the unfolded protein response pathway for
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452290.1"
                     /db_xref="GeneID:2892370"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU9"
                     /translation="MLNATKRLACLSFFVYVSLASPGDRLPEFSDCVRACEVVRHCTD
                     RFEEDSFNPFINEQFSEPALVYKALLWDCTSDCDYQCQQKITLDREERNEDIYQFHGK
                     WPFKRVLGMQEFYSTIFSICNFVPHYRGFKLARKSLAKLQKTSQRRVLILNYIFISMA
                     GMIAWICSSIFHTRDLIITEKLDYVFAGATVLSGFHGVFYRVARLDLHPRVGALFSLS
                     VFTIFVGHLLRLYLNWSYAYNMRFNIFFGLLQYILLITLAILNYRTFSSIRPDLVHDL
                     SVVPVLLVVFTGVAMSSELFDFFSYRWQIDSHAIWHALTIVPSFYLYEFFLKDYHVLG
                     SRTSTNIKNV"
     gene            <173935..>175614
                     /locus_tag="KLLA0_C02123g"
                     /db_xref="GeneID:2892350"
     mRNA            <173935..>175614
                     /locus_tag="KLLA0_C02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452291.1"
                     /db_xref="GeneID:2892350"
     CDS             173935..175614
                     /locus_tag="KLLA0_C02123g"
                     /note="similar to uniprot|P53838 Saccharomyces cerevisiae
                     YNL275W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452291.1"
                     /db_xref="GeneID:2892350"
                     /db_xref="GOA:Q6CUU8"
                     /db_xref="InterPro:IPR003020"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU8"
                     /translation="MLLHHRDPALHSSSSQGEHFRITNLDIASQKSKDSDVEIQSIEK
                     PRKRFPPLCAGLIHDIKDKVPQYPSDWKDSWDYRVIPSVLETYFNNLLPALAFAQDMF
                     DRTDNSYGVNEVLLSSAIAGLVFGIIGGQPLCIVGVTGPISIFNYTVYEIIMPLNIDY
                     FGFMFWICIWSMITHFLLVIVNSVCLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQF
                     VDENSDFNLASGYSSIMVALLMAIFGLAFKFFQLTPLLTYTMRTLISDYSTALSVVFW
                     SGFIHFGGLLDSVSFQKLPITKAFAPTRHGDSRQTWLAYQDISVGDVFLALPFGIVLT
                     ILFYFDHNVSSLMAQRKEYKLRKASTFHYDFALLGITTGIAGVLGIPAPNGLIPQAPL
                     HTQSLLVRDDDGNVIRCAEQRFTNTVQGLMILGTMTRPFLICLGLIPQAVLSGLFFIM
                     GIQGLVSNTIVHRIWFVFTDPKKKSKDSTLNTVSTKSLLLFISLSLVGFVAEFAITNT
                     KGAIGFPIVLLLTVILSLFFPKIFPDKDLAILDEPVSEEFTLKNILPRNLI"
     gene            <175962..>176348
                     /locus_tag="KLLA0_C02145g"
                     /db_xref="GeneID:2892435"
     mRNA            <175962..>176348
                     /locus_tag="KLLA0_C02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452292.1"
                     /db_xref="GeneID:2892435"
     CDS             175962..176348
                     /locus_tag="KLLA0_C02145g"
                     /note="some similarities with uniprot|P25361 Saccharomyces
                     cerevisiae YCR043C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452292.1"
                     /db_xref="GeneID:2892435"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU7"
                     /translation="MLPPPVDAALLREHAYADTGNSQIVLDIKTFTDDGGYKPIEKYG
                     LGYFNYMFALNKRVTEVSLKEIIRGHIYEYFTIYFVIIVIILAIWILSVSIYAECLTK
                     RIRSAFGKTSSYSKKVDGISYDHVQV"
     gene            complement(<176570..>177619)
                     /locus_tag="KLLA0_C02167g"
                     /db_xref="GeneID:2892538"
     mRNA            complement(<176570..>177619)
                     /locus_tag="KLLA0_C02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452293.1"
                     /db_xref="GeneID:2892538"
     CDS             complement(176570..177619)
                     /locus_tag="KLLA0_C02167g"
                     /note="similar to uniprot|P53839 Saccharomyces cerevisiae
                     YNL274C Putative hydroxyisocaproate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452293.1"
                     /db_xref="GeneID:2892538"
                     /db_xref="GOA:Q6CUU6"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU6"
                     /translation="MSKPVVLRLGQVKYAQKAWEELSKIAQVIPIDPSLTRAQFLDQC
                     QDPESPISKAQILTRTFPSVKNTGRFDAELAKALPESVVAICHNGAGYDQIDPTPFGQ
                     RHIQISNVPELVNNSTADTHVFLLLGALRNFEYGHRLMEEGKWPSGGAAAGAPVGHDP
                     EGKVVGVLGLGGIGRAIIERLKPFGFKKFIYHNRNRLSSDLENGCEYVSFEELLSQSD
                     VISINIPLNAATRHMIDKEAISKMKDGVVIVNTARGAVIDEPALISALKSGKVRSAGL
                     DVYENEPQVPQELLDLPNFIGVPHMGTHTVETIQKMEEFVVENVKSVINTGKVLTVIP
                     ELKKEGWINEAKPLV"
     gene            <178544..>182686
                     /locus_tag="KLLA0_C02189g"
                     /db_xref="GeneID:2892248"
     mRNA            <178544..>182686
                     /locus_tag="KLLA0_C02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452294.1"
                     /db_xref="GeneID:2892248"
     CDS             178544..182686
                     /locus_tag="KLLA0_C02189g"
                     /note="similar to uniprot|P23255 Saccharomyces cerevisiae
                     YCR042C TAF2 TFIID subunit (150 kDa) involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452294.1"
                     /db_xref="GeneID:2892248"
                     /db_xref="GOA:Q6CUU5"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU5"
                     /translation="MVQMKSTPKTPGSAYPVVEQQFGPQFKVAHQRVQIDVDLSKNCI
                     VGTTEMIIMPLTPNLEYIALDCKNMRIKDIIFENRRLDNFVHDDPYKKLSDSYLNNSE
                     DDILYNCNGIEQSHLLRKKFSEFNHNPEGSSKSQLLVKVPSSVKILPHDVNTLSAYLG
                     TAAGTSGITPSLRNTPSTFPNDTIYTPLTLRVDYELDHPHTGVCFDTISPEPHLWNAY
                     TTNSELNSSVSHWLPCIDSLDEKCTWDLEISVPKRVRDIGTTKVVGARNLRKRTARDR
                     RSNLNANDEHMKEEDDDEDDEDEEEEDDEDEDGTIQNEDLNREIVVVCSEMATRKVTA
                     HPMDMAKKTVSFQIFTPVAPHHIGWAIGAFQTIELPSILQADEDEEMDEFKIPQQEQV
                     LADEPRDEIPIFVYTLPTVDLNEKTILNSTLVCQEIMDFYSKEFGSYPFTSYSLLFLP
                     TLTTDLMDFTSATFYNSRMLYPPEIIDLIYPTTNTLAWGLANQWSGVNITPLELNDLW
                     CVVGMAGYMVLQLIRKLMGVNEYKFRIKMASEAIVEQDWEKQPIGTTFDSASLPISTL
                     SKEINFIKLKAPMVLFILDRRMTKTERSFGMSRVLPKIYLQAMSGELTNNSLSSTHFQ
                     RVCERVNKNRLETFFKQWVYGSGVPIFRITQRFNKKRMAVEMGIRQVQMQELGLGKIV
                     GKENFNSSAMEYLQDQDKSPTQVFTGSMTIRIHEADGTPYEHIVELKDVFTKLDVQYN
                     TKYKRLKRRRKVNRVTKEAKEEINEDTQEEENANEDIVLINCMGDVLVSKDDCNKWNL
                     TDPMTTSEGDDLQQQNEAFEWIRIDSDFEWISKVHINQPDYMFASQLQQDRDVEAQVE
                     SVRFFEDVILNGTSNSLIYSSILTRTAMDPKYFHGVRLAACRALSKFTIKAEEQQEFK
                     GGPRHLVQIFRELFCYEDSNIPKNNDFSDYPKYFLQKAIPKLLSSVKNDEGVCPAFVK
                     EFLLDVVRYNDNTDNIYSDTFYITELLESLVDCSISDINDTKYIDEVMNEIQRFYNLD
                     QWMSSYQFLTTKTIQKQRLKLAVHGLYHYEDYNELLSSTMLDQPTTDHPVICHAREGL
                     QDIALQALKILLVIGGIKNKEVLKYYFETLCFHPDVYIRTKLVDTFAGAIDLISSKNS
                     ISEIEDDIDYMMNEICPTDPTTVASIVVEDFTKEVAHRREKQLRSSINGMITLTRQKF
                     KDYEPLKMIMWDVLHSPLINVYQRKRLFDIANVIYQLYDAYNVILPVPRDKKLVCKNI
                     GNNTVVIKREGILKVHLAPLKPAIVEPKHPPTTIKITIPKKSTSKPSMPAVAAKAKKK
                     PSSVKGTVTKVGTLPIRFLKISTKTNSVHISSLPHNPNVSILKSNRRTLSIKLKVPAN
                     KK"
     gene            <182975..>184675
                     /locus_tag="KLLA0_C02211g"
                     /db_xref="GeneID:2892530"
     mRNA            <182975..>184675
                     /locus_tag="KLLA0_C02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452295.1"
                     /db_xref="GeneID:2892530"
     CDS             182975..184675
                     /locus_tag="KLLA0_C02211g"
                     /note="similar to uniprot|Q12232 Saccharomyces cerevisiae
                     YOR154W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452295.1"
                     /db_xref="GeneID:2892530"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU4"
                     /translation="MRYLVFLLVLFLGVNCEGDSVLFSSATDVFERPKPLKVTTALAT
                     KNSNKSRPLQVSMSSTIRNVPLATQGKDSSVFKSFNEWNKEKLRQNKLAQQERPKRSL
                     FHNNNNGDVIRDELEMDFEIFNDDEPEGKIYKDKFNYASVDCAATIIKTNSEAQGAVS
                     ILFENKDKSLLNPCSVPNKFFVVELCEDILIESIVMANFEFFSSTFKNVRFSVAERFP
                     VPKNGWKVLGEFEAENIRNTQQFTITNPMIWARYLRVEVLSHYGEEFYCPITLIRAHG
                     IAMIDEFKMEVQNAGEKLEEVVSIEQKLAEEKEKCMIPSSFLTNNMSINFDLDINHQC
                     LASLKHMNFDEFFTGYKDNENITQAKDSSSFIPINTEESIFKNIMKRLSGLETNGTMS
                     ILYIEEQSKLLSKSFDKLEDSYSQQFEALVKAFNETMTSNLENLNQFALQLRESSIKI
                     IEEQRLATDKFISTTTNKVEELENAYQHQARVMYLILFGLISSIIYISLTRESYFEEE
                     MVDDGWYTDNSSLQKLKNNIKRSVSETKGHPYTEAAHYSPISSDSEFEDEDSIVIPAK
                     "
     gene            complement(<184908..>186374)
                     /locus_tag="KLLA0_C02233g"
                     /db_xref="GeneID:2892433"
     mRNA            complement(<184908..>186374)
                     /locus_tag="KLLA0_C02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452296.1"
                     /db_xref="GeneID:2892433"
     CDS             complement(184908..186374)
                     /locus_tag="KLLA0_C02233g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452296.1"
                     /db_xref="GeneID:2892433"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU3"
                     /translation="MYLNDTGIRRCGPPRPRPRSTHPLLAQLESSACATAIKDYEKEL
                     LAYFQELQECDLPNPKMIDNQPELDWYMRPYLLDFLIDLHGILRLSEPVLFLAIQIMD
                     RYCSKRIVFQKHYQLVTTTSLWIAAKFEDKKSRTPTLNQLISACSHIYDSYMFIQMES
                     HILETLRWNIRTCFTTFDAIQLCFKDTDIIWPTEDVSMLQIVSIFFAELSCYDKHYMA
                     FSSSVKATSGIILASVLLGDNCFQKHISTLLLDFLDLKCESLGLTVCHHSVVSSCKEK
                     DPFSIICAPLLRVDENTHVDIRRCCLLYLNDIFKPLTANKDLPTALMSKYDKICLQDY
                     ITAYTSQNIDKYLHLCKLTQALLNPIYDRTRLLEQINMVTDIMVGLELCQQGPIRDEL
                     PLKIYQSVLLPSSDELKEEILKNNELHGSSRSASSTEITSPWTPASVFSAKRSLSDAS
                     SIDNELDLVDVPRAKDARALRLPTPLRKCVSSDFAPNI"
     gene            <189083..>192571
                     /locus_tag="KLLA0_C02255g"
                     /db_xref="GeneID:2892434"
     mRNA            <189083..>192571
                     /locus_tag="KLLA0_C02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452297.1"
                     /db_xref="GeneID:2892434"
     CDS             189083..192571
                     /locus_tag="KLLA0_C02255g"
                     /note="similar to uniprot|P53840 Saccharomyces cerevisiae
                     YNL273W TOF1 Protein that interacts with topoisomerase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452297.1"
                     /db_xref="GeneID:2892434"
                     /db_xref="GOA:Q6CUU2"
                     /db_xref="InterPro:IPR006906"
                     /translation="MSEPDDVDTVKERLAEDRQNIHIQNEYQDISYTIIKARIGMLAT
                     AIGGPDHSVDSVNPPYKVGDDCLACIKDLIRWFKLVDDNQKRWDVEMATAEFKILQND
                     LIPILLDWEAKNSAATRKSKKTGEDISIFFPNKSYHDRIALGALQLMVLMTWPLIITD
                     QSSYNQVNYYFELKKHQLLYKHAILTTENGKVLKAAIRLALNVMSVDVDHRTARDDSL
                     IRMVLNFLKNVVAIEPGEVTISSVKRLKRPLTMAEMLPTNITVDDISINSVITAFDKN
                     KVFGFLLTVASSLSDAVDPNFVSWPLLEVMFFLTKDINPIRLFKNQRKSYKLGTDHEI
                     TDSNMTTSGKHLSELLAKEHEKKLNVIKNTSSRHSRFGGLLSIQTPQNTRLTIASNSV
                     NMRDDAALQELDSRKKWNKTITMRLDVIEGLSSSFFSTEGNSIYMSSDNITSIKEFLA
                     DFVDSSFNLLLQNATDSFTSEIQDQLPLHKIEYMLFISWFVKFQRSRCIYEIDATPDY
                     VSGALLDECYILFTKYLRESYEQKNWPVVHAGMLLFTEYLEFLLSLDQSWEADVQAVI
                     SKILSENMLQLLASLPKSATSHSSQYVKACINLTHVVLKTIDKFDENSSLTVESKRKR
                     KVNLNHTAIEKYAKDNDLDYESAFDILEEQFKQVTINFDKVFRGYLTEPTISTYIRYL
                     QSYKELEDKDLIRVLKFFQRVFVKAKEELFLFRIDFMILCREILSQQGLPTTSELRTH
                     FTKFNEYYLKQLKNKLKKMPSLYINILFPMLHDSQISYYMRHGKMKLTEGTPDIVLPS
                     TFINIPDEGSLPKKVLLDMQVGILVSSLIDDGYEDLIEALLLNLQSSFDGLKGKVAEG
                     INSLEEERVKKVAFNATNSEIKRALYQQPEFRRLLILAGFAIPEANQPACYFINNKTP
                     TEVQLVIETIQKHRSLPFESEIGKPASYYLSSHYQEYEDPEEYGSDLNNGSYFEDLEI
                     MDKRTEGRELSKGKAQSKLVQRSKGKRKAIAHHPEENESDFEANASSSTKLPVVSKEY
                     IMDSDDEDPDFGAIFFENETYLRQLLDKHNGSLTETQFSLFAQFCEERVKNNGQLRND
                     YSALFNETPKSPIFSDVDAETIIIGSASLPSLANEPIETQVVSSEEYSSHPLEEEVTS
                     EQRKRKKPRIESDTEY"
     gene            complement(<192607..>194004)
                     /locus_tag="KLLA0_C02277g"
                     /db_xref="GeneID:2892529"
     mRNA            complement(<192607..>194004)
                     /locus_tag="KLLA0_C02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452298.1"
                     /db_xref="GeneID:2892529"
     CDS             complement(192607..194004)
                     /locus_tag="KLLA0_C02277g"
                     /note="similar to uniprot|P39981 Saccharomyces cerevisiae
                     YEL064C AVT2 Putative transporter member of a family of
                     seven S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452298.1"
                     /db_xref="GeneID:2892529"
                     /db_xref="GOA:Q6CUU1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU1"
                     /translation="MQIAADKKYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAV
                     DQNIFNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGG
                     LFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGC
                     VGFCIIIGDSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSML
                     ALLGLIAIVIIIVVKAPLVSGEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFI
                     FFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVIN
                     FARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIM
                     CIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVI
                     LMFVSTAQTILEAFA"
     gene            complement(<194267..>196243)
                     /locus_tag="KLLA0_C02299g"
                     /db_xref="GeneID:2892539"
     mRNA            complement(<194267..>196243)
                     /locus_tag="KLLA0_C02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452299.1"
                     /db_xref="GeneID:2892539"
     CDS             complement(194267..196243)
                     /locus_tag="KLLA0_C02299g"
                     /note="similar to uniprot|P17065 Saccharomyces cerevisiae
                     YNL272C SEC2 Guanyl-nucleotide exchange factor for the
                     small G-protein Sec4p located on cytoplasmic vesicles
                     essential for post-Golgi vesicle transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452299.1"
                     /db_xref="GeneID:2892539"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="UniProtKB/TrEMBL:Q6CUU0"
                     /translation="MADQEESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTIST
                     QQNIANSYNELKQELQSLKLQYETDKTKFKKQEEICADAEKKVATLNQEIEDLTASLF
                     DEANNMVADARKEQNAVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNS
                     SKNVSLSDSATSSTTSIDRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLK
                     FLAVLPQCENLQQTTSESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLV
                     SIEPISGINETYRTGYSSPSIPDSPEVENKDSHLFSRPVNSPPVAMVEPCAFCGENRN
                     DILEHGRLYIFKTYQKLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHL
                     EKVALASIHQGKVNAYSEVTKASRPKMKSKRLSIFQGLKQSQSSTPIIENGPQFADKN
                     GLPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPSTDISKAKSFEEEQGLG
                     IASNNIPVPITHEEDETFDFEADTANSISVDETVNGIRHTDQSSDDIGDHNEKTNEKT
                     ATDLQGKNEEKKSKKIEPQHSRQPSQSSTVLNDNKESAESAHDTHASSEEPSDLLETY
                     QDLSADLEPESEKPENLDNSDEEDSFNDAKDVVN"
     gene            complement(<196533..>202061)
                     /locus_tag="KLLA0_C02321g"
                     /db_xref="GeneID:2892528"
     mRNA            complement(<196533..>202061)
                     /locus_tag="KLLA0_C02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452300.1"
                     /db_xref="GeneID:2892528"
     CDS             complement(196533..202061)
                     /locus_tag="KLLA0_C02321g"
                     /note="similar to uniprot|P41832 Saccharomyces cerevisiae
                     YNL271C BNI1 Formin nucleates the formation of linear
                     actin filaments involved in cell processes such as budding
                     and mitotic spindle orientation which require the
                     formation of polarized actin cables functionally redundant
                     with BNR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452300.1"
                     /db_xref="GeneID:2892528"
                     /db_xref="GOA:Q6CUT9"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT9"
                     /translation="MQRSQSSRGPTGNENSHSRSLSNSQGSSLFSNLKKLATGGNHGS
                     SQPSQTRKELISSPKRVFTTASLESATPIGGSKPLNKISSLNTHNLSHYTMDPEANSR
                     SQSASLLTSPTKYSYSRRSSQLTRSSTNKSIISSSAVSVSSNSTSILNRFLTNDGTLK
                     LDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRL
                     KSTKPRFSANDTQNMLKRKTSTSKLNTQYEGMLHTNESQGSLLSPSHFPPEYYVRQII
                     SKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQNAVTDP
                     QFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATETLIYL
                     VTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQLYQVC
                     KILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNE
                     DVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTE
                     NVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLI
                     DSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDY
                     LNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIE
                     LRKMLTIVNSKTSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRR
                     LGTAVGSKSRLKLLRSKMEDIENQARELEMTNFADVKPKQNQKFKEQVKGQQATKLAE
                     LRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDPE
                     LKELLTQSSNGGPSLDPTIVQRKVEEMNSIIDELNALKEEMKNRPKTGSSSSSSSSLS
                     SASSSSEDGSSQSQASHGSDIVSNGSSFLESLSQKYSTGQQTATSTNGGRVGRETRYP
                     GSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVKMTDDIDDVPVGIGISVSPG
                     ASLKSTEKPVSQFTEKPILTDAQQGSDKISNVILNDKYSPTTMQSEIGDSESIEANPT
                     TTIVSAASPPPPPPPPPPPPLPVSLGGTLTAVPSPLPTALSPGIAPPPPPPPPPPPPF
                     PSANTPKATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVAD
                     DLFERGVLSQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVK
                     DVVGKVMKCDREFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPP
                     EKDPNELQRADQLYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQC
                     IEQSESLRHVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKI
                     IRENYPEYSHFVEELEPIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKF
                     HPLDRVLNKVVPVLPEARKKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQK
                     FADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQQRKQQEADSKATAKNLSTSQEPS
                     DDRDDIEKLLDKLKNAAPSKGDPSSTRKRALARKKLLDGKSGASIFDNITADSTIEAF
                     VEQNRTLTESPTAKKSASLPETESLSSSKQDPADRARNLLLELRGPDERKDASPSPIK
                     AKDKLRDLKKKDSSVKVDQPNKLQFVGSLEVGPHPKPLSPTQDLMDTSNSSEDEFIDA
                     "
     gene            complement(<203552..>205297)
                     /locus_tag="KLLA0_C02343g"
                     /db_xref="GeneID:2892430"
     mRNA            complement(<203552..>205297)
                     /locus_tag="KLLA0_C02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452301.1"
                     /db_xref="GeneID:2892430"
     CDS             complement(203552..205297)
                     /locus_tag="KLLA0_C02343g"
                     /note="similar to uniprot|P04817 Saccharomyces cerevisiae
                     YEL063C CAN1 Plasma membrane arginine permease requires
                     phosphatidyl ethanolamine (PE) for localization
                     exclusively associated with lipid rafts mutation confers
                     canavanine resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452301.1"
                     /db_xref="GeneID:2892430"
                     /db_xref="GOA:Q6CUT8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT8"
                     /translation="MTSIAQQIELEELEALHSNLSQSQSARSGMHVSNSKIDDPLRFS
                     KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGP
                     LWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGY
                     MYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFW
                     VASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWV
                     SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPY
                     NDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRIL
                     FGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA
                     GFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTA
                     FAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEE
                     EEPKNLWEKFWAVAA"
     gene            <208462..>210201
                     /locus_tag="KLLA0_C02365g"
                     /db_xref="GeneID:2892531"
     mRNA            <208462..>210201
                     /locus_tag="KLLA0_C02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452302.1"
                     /db_xref="GeneID:2892531"
     CDS             208462..210201
                     /locus_tag="KLLA0_C02365g"
                     /note="similar to uniprot|P32487 Saccharomyces cerevisiae
                     YNL268W LYP1 Lysine permease one of three amino acid
                     permeases (Alp1p Can1p Lyp1p) responsible for uptake of
                     cationic amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452302.1"
                     /db_xref="GeneID:2892531"
                     /db_xref="GOA:Q6CUT7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT7"
                     /translation="MGFPGSKYSSSSNSGIGVTKSIKGMFSTDSGTLSKRSKAGEDSI
                     ELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKP
                     LSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGY
                     MYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFC
                     VASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWV
                     GSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPY
                     NSPQLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYS
                     LALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGL
                     CAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFA
                     PRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDE
                     PKNLWEKFWVALA"
     gene            <211012..>213882
                     /locus_tag="KLLA0_C02387g"
                     /db_xref="GeneID:2892536"
     mRNA            <211012..>213882
                     /locus_tag="KLLA0_C02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452303.1"
                     /db_xref="GeneID:2892536"
     CDS             211012..213882
                     /locus_tag="KLLA0_C02387g"
                     /note="similar to uniprot|P39104 Saccharomyces cerevisiae
                     YNL267W PIK1 Phosphatidylinositol 4-kinase catalyzes first
                     step in the biosynthesis of phosphatidylinositol-4
                     5-biphosphate may control cytokineses through the actin
                     cytoskeleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452303.1"
                     /db_xref="GeneID:2892536"
                     /db_xref="GOA:Q6CUT6"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT6"
                     /translation="MESTDDRNPDILLKYINSSNFTLYNNIEYLTRYADNIGIHFYLC
                     EKLLSFPHKELQFYIPQLVQILLTMETESLALEEILLRLSSENPHFALITFWQLQALL
                     GDLAHDPTSYSFQVARRVLNHLQFILFNTTRKNDNEKINENIAPALILCSMVTTGFAF
                     PGLLEHTKPLIKSQGRRQKSYVFKLAKHAMKNLTKNLTLKNTLANSSSGRKVSSDSVT
                     NIANVDLVDTVTTKEDVTYKKKRQDSISDLSFDMVDDIGEKLFEDHISNSIKLPKRRD
                     TSYIHAVYKNPPITEEEYTNSMPDLRARSSSSASMPDLSAKKSMDAIRETTTNPSSYN
                     ESKRQMIDVTHLSTTKKIKLLKVNYFHCCTQFAIALESISQRLAQVPPEARLSALRAE
                     LSILNRDLPAEVDIPELLPVNKKGKLHKLIKISANEAQVLNSAEKVPYLLFIEFLKDD
                     FDFDPTSEQNIKLLENNPRSSYIFDLSYVKQNNAPFKANMPLETSSGSANQEMDLADV
                     SMVKLTNQSEAENYRHELMMKNAKTVPVIPPDSHTRGSELDFVADLQEATERLTDIKL
                     HRDSSDDLATQMRVSAMMLAQLDQSPQQLSDSANQIRAKIIASMQEMQDKFGYRDLEA
                     IHGMAGERKLENDFKTGGLTTSNDKTSTSYLGEDWNAKKEKIRKSSEFGHLPNWDLCS
                     VISKSGDDLRQEAFACQLIQAMAAIWSKENVGVWVKKMNILITSSHTGLVETITNAIS
                     VHSIKKSLTTHMIEEGSLDEKGDIASLLDHFSRVYGDPNGFKFRHAQDNFASSLAAYS
                     IICYLLRIKDRHNGNIMIDNEGHVVHIDFGFMLSNSPGSVGFEAAPFKLTYEYVEVMG
                     GSESETFKKFVELCKAAFKALRKYADHIVSLCEIMQKDSLQPCFQAGDQTSVQLRQRF
                     HLELSDEECDEFVENVLISKSLGSRYTRLYDHFQLLTQGIYS"
     gene            <214337..>215518
                     /locus_tag="KLLA0_C02409g"
                     /db_xref="GeneID:2892537"
     mRNA            <214337..>215518
                     /locus_tag="KLLA0_C02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452304.1"
                     /db_xref="GeneID:2892537"
     CDS             214337..215518
                     /locus_tag="KLLA0_C02409g"
                     /note="similar to uniprot|P53230 Saccharomyces cerevisiae
                     YGR046W Essential protein of unknown function mRNA is
                     targeted to the bud via the mRNA transport system
                     involving She2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452304.1"
                     /db_xref="GeneID:2892537"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT5"
                     /translation="MLRGKVANSVKNVPGVKSVNRLVRFQSGNNLLLKTETSSTQEVI
                     HPNPNKFRRRAIAKLNEDIVAEKTGDADLYLLEKGLKKIDERTSRFTNYLFKINRLPP
                     NYGDNQLITVDKSLERDLQSILGHFKSPIKYAFGYGSGVFQQAGYSKSSEKPQIDMIF
                     GVTHPEHFHSLNMRQNPGHYSSLRYFGSEFVSKFQEVGAGVYFNPFININGHDVKYGV
                     VSMSRLLKDLATWDTFYLAGRLQKPVKVLKNDLRVQYWNQLNLKAAATLAKHKLSKKF
                     NGDSFTEFDFYKEITALSYLGDIRYKLGGENPKKIDNIVEKNLDNFKFYYKPIYKDVF
                     LNNSTYLPQNFTLDNATDQLTERISRGSTIQTAKGVLSAGLMKSIKYAWAKKLKAIKS
                     H"
     gene            complement(<215644..>216465)
                     /locus_tag="KLLA0_C02431g"
                     /db_xref="GeneID:2892387"
     mRNA            complement(<215644..>216465)
                     /locus_tag="KLLA0_C02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452305.2"
                     /db_xref="GeneID:2892387"
     CDS             complement(215644..216465)
                     /locus_tag="KLLA0_C02431g"
                     /note="similar to uniprot|P53843 Saccharomyces cerevisiae
                     YNL265C IST1 Putative translation initiation factor as
                     suggested by computational analysis of large-scale
                     protein-protein interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452305.2"
                     /db_xref="GeneID:2892387"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT4"
                     /translation="MSIQRLRYAQEKQQALAKRSRRDVAKLLNEGKEQKAHYRVESLI
                     NDDIHIELLEILELYCELLHARVAIFNTVSNEVTLIESHVDDGINEAARAIVYAAIYI
                     PEIKELVQIKDMLGLKFGNEFVKAIIEDKIGVPEKVLQKCSPRLPKKELVELYLKEIA
                     RTYEVPYSGLEELETEGVDANDAELTEKEPNSDKSSTNSDDSRPILAVDNDEPGDDKH
                     PIIIKKPRQNSETLNQELKIPKAIVNDVKVSHGKSKATSKDSLDELRKRFEALKR"
     gene            complement(<216740..>219826)
                     /locus_tag="KLLA0_C02453g"
                     /db_xref="GeneID:2892432"
     mRNA            complement(<216740..>219826)
                     /locus_tag="KLLA0_C02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452306.1"
                     /db_xref="GeneID:2892432"
     CDS             complement(216740..219826)
                     /locus_tag="KLLA0_C02453g"
                     /note="similar to uniprot|P33339 Saccharomyces cerevisiae
                     YGR047C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452306.1"
                     /db_xref="GeneID:2892432"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:F2Z5Z0"
                     /translation="MSHEHDDEEQFYEELDQYREIIERDKDGDTNDEDDNQRNSSEDE
                     FNEDNFDLLAEFSDYGEFSDDDYDEQAFMDAIREANNFKRRKGKKSAGTKHGPVPKQR
                     RERPLDPEVAQLLSEANEAYVRNDIQVAEQLYNKVIKADAKNFAAYKTLGDIYHLQGR
                     FNDCCNSWFLAAHLNSTDWEFWKMVAELSAELAHVRQAIYCYTRAIRINNEEWECIYN
                     RALLYKEIGQLGRAFDGFQKLYAYDPLDANILRELAVIYVEYNRVSEAIELYMKVFGD
                     NVTRRNAFILASEDAIDSENESEEETEEGDEDLNLTQEELDMYPNVSVKKIAKKHRCI
                     PFDWSSLNILAELFIKQNGELHGIKTIKKCARWIQYRETQTFWEDVYDDSEFDNRRFR
                     NAKFQSLTEREKSKSYSLPIDIRVRLGLLRLNNKNVSEAMQQFQFLYEEKFDEIADLY
                     FEVGVQLCKLDRYQEAIDFLAPLSQLDEYDTIELYRPLSKCFRELDQLENARDAFEKL
                     VEFDPSDLEHKLSLAEVHHSLGNEDEFDKLLHEVVEERKKQAKETAPEAPDDTSTGKK
                     ARPRLAIAPLEEELPSEEIRSATLGTGKPLLEDHNYKKAPIKKKKTAEEIEREKKERE
                     KKIRSNVLNKYGQLQIYKEGMEVGDATKTTLWIDTASDLIDIFSSIKNFFVKSRSKKF
                     VGIIKRSRKFNKVIDYRIEKLSKLSQGENLMDGLPLMEEKITTSSTTELRGLTYDQWF
                     ELFMELALTIARLQSANDASSIIETASEVNVFSQHPERVKMMKFVKLAIILRLQDEQE
                     IVENLRGLLNQFQFNRKIFQLFMFSVSEGQTSLKILSSTVQQKFFLRQLKAFDSIRFG
                     QHVNGQASITNKVSNPERKICTYLNYIYAMLLYSSKGFMPALQYLKRIELEVGDDPML
                     DLIIGLSHLHRSMQRLTGNRQFQILQGLKYLYQYHEQRLKYYSDVERQEADYNIGRAY
                     HLLGLFTPAVKYYNKVLNIYDDIKLKRHAAYNLTLIYNESENFNLSNDLMERYLSI"
     gene            <220395..>221432
                     /locus_tag="KLLA0_C02475g"
                     /db_xref="GeneID:2892535"
     mRNA            <220395..>221432
                     /locus_tag="KLLA0_C02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452307.1"
                     /db_xref="GeneID:2892535"
     CDS             220395..221432
                     /locus_tag="KLLA0_C02475g"
                     /note="highly similar to uniprot|P53044 Saccharomyces
                     cerevisiae YGR048W UFD1 Protein that interacts with Cdc48p
                     and Npl4p involved in recognition of polyubiquitinated
                     proteins and their presentation to the 26S proteasome for
                     degradation involved in transporting proteins from the ER
                     to the cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452307.1"
                     /db_xref="GeneID:2892535"
                     /db_xref="GOA:Q6CUT2"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT2"
                     /translation="MFSGFSGYGNAYANIPQRLEEFFRCYPIAMMNDNIRKDDANYGG
                     KIFLPPSALNKLTLLNVRYPMLFELKSQESGKVTHGGVLEFIAEEGRVYLPQWMMETL
                     EIQPGSVLQICSTDVPLGQFVKLEPQSVDFLDISDPKAVLERVLRNFSTLTIDDIIEI
                     SYNNKVYRIRILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKSQKKQTPSFDPS
                     IKGLGSMSKRINYAEILDPTDKDKSFHGEGQKLSGKAIKPKEDDIKEISVSLDGNPAP
                     LNLPEGQLFFGFPYVPPKSDDGEDNEIASSKVFQGEGKSLRQSAKRKDKGSHQGSKTK
                     APKSPEVIEID"
     gene            complement(<221470..>225054)
                     /locus_tag="KLLA0_C02497g"
                     /db_xref="GeneID:2892431"
     mRNA            complement(<221470..>225054)
                     /locus_tag="KLLA0_C02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452308.1"
                     /db_xref="GeneID:2892431"
     CDS             complement(221470..225054)
                     /locus_tag="KLLA0_C02497g"
                     /note="similar to uniprot|P53120 Saccharomyces cerevisiae
                     YGL140C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452308.1"
                     /db_xref="GeneID:2892431"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT1"
                     /translation="MKGSSSLKNGYAKFQRYFPCDKVLAKRIFKSTVHSTVALIFCLI
                     PKVRERLGNEPAMLPLISVMVHPGRRVGGTIQGAIYCITGLIFGLAFSLLGRFLAQRC
                     LGSTWNILDEKEQLVSNYNSYRSGLAILSVFEVIMLFVHGWMRSVSHHYFGIVFPLFL
                     VVHFAFLAPLSNSAAAIANSFSTPFYLGIAMSLFWNLTLFPEFGSTYLGNTTVYTLNE
                     IHHSLNNAINFFLSIDEESKKLYAADTVSSAKLLKMKDNVAKKVSACSAVTEECIYEI
                     SYSYMSPTELKPVTSRFKDLAIYVNAIINACQLEFMLLGHTHNEHDLLNIDTEKEIRH
                     ADAAKLTKVLLKVRIHIFRLHKTLSDCFYLVKVILARDFDVQLDKVRIPKAFEMDDFP
                     QFKNRDDLPMHIDTEMYINKLVKALVQFDLSFREELSNIDADLLEPNDEMFLLASFLM
                     NFKEITNTIISIMKSVKEMHIKRMEREEKGWFRGKSIWFVALHNRASFIDWFYGSQRR
                     AQRGTENDSLGGGHSIHFNPETVPLRPDYEEDELLSQQASSHVNLNESESSGPVLPKN
                     NTDNSTEDITSPSQGFISVCNRWFKKLLLSINRFYKSSRNHFRFGLQVTVALMLASFP
                     MFVPESRNWYVNIHGAWIGFVCILCLEPSVGGTFWVFFLRGVGVIAGAAWGYLSYVAG
                     INQTNPYLEVIITIFGAVPGFYFLLGSPYIKAAIIQIISIYIVMLAAILPGSIKGSIL
                     QNFAKRCLAVGYGGGVALVVQVTLFPITARDQLNAEIAFSVGCLAEMETLYAAGIEGE
                     ALKLSLSDEKYERFRKLSEATKSALSRATSYKGLTRQEPRLKGEYTELENVFTQIIFI
                     LKQVVERLDNSVLLRRQYGSAIAEELNSIVYPYRRQFVASIVNILRAVQEAIINKTPM
                     PQYLPSSRIAHRRLINKVRETLKIRYGTQLHKPNTSENSGESYLRKNGNIYNLSDSSE
                     SDEDLGLIMKPKRNINVNMKERQFILKEKFLSWSASSSASEEIIEYIEELVELTKILV
                     GVNEFKYGFLSRPLYEDWAAEAVVGFADFVNHTQAPRKPPTRGRELDEDVPSENEMQS
                     LDEDAVESNSDVEAIQPVALPTDEHVSRTLARMATNTTQHSHGESSSKWRRRAYSIGS
                     GMGTDDLNSLTKVHTLGEANIAYYDEDRSSEEEDELPLVLKRIVSHKK"
     gene            complement(<225470..>226489)
                     /locus_tag="KLLA0_C02519g"
                     /db_xref="GeneID:2892534"
     mRNA            complement(<225470..>226489)
                     /locus_tag="KLLA0_C02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452309.1"
                     /db_xref="GeneID:2892534"
     CDS             complement(225470..226489)
                     /locus_tag="KLLA0_C02519g"
                     /note="similar to uniprot|P53844 Saccharomyces cerevisiae
                     YNL264C PDR17 Phosphatidylinositol transfer protein (PITP)
                     downregulates Plb1p-mediated turnover of
                     phosphatidylcholine found in the cytosol and microsomes
                     homologous to Pdr16p deletion affects phospholipid
                     composition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452309.1"
                     /db_xref="GeneID:2892534"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6CUT0"
                     /translation="MRLFQRKGNDLIRQPADLIPCDTFISDPPLRYTKPHRQPELDNE
                     QQVIYHAVLQHFSDPQLRLPVNGHAEDLQDSNNYSTLGDWEKFWLSRECILRYLRATA
                     WNAEQTIRRLHNTLLWRRQFGLADYANLKETATSVANENDTGKISLLGYDRKSQLVLI
                     LKNGRQNTDPSFEQIRQIVWFLEAASILAPKGTECWTLIIDLKNHHIDNGGTRSLYEY
                     PPLSLAKQVINIFQDHYPERLYKCLICNVPNSAWTFLKLVYPLIEPEPRKKILYNDPL
                     EIHIESDQLGAEYGGRLDFNYDNSIYWPDLIQTVESRKKVQYEKFEALGANVGIREFE
                     IKRNT"
     gene            complement(<226721..>227533)
                     /locus_tag="KLLA0_C02541g"
                     /db_xref="GeneID:2892427"
     mRNA            complement(<226721..>227533)
                     /locus_tag="KLLA0_C02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452310.1"
                     /db_xref="GeneID:2892427"
     CDS             complement(226721..227533)
                     /locus_tag="KLLA0_C02541g"
                     /note="weakly similar to uniprot|P52868 Saccharomyces
                     cerevisiae YGL128C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452310.1"
                     /db_xref="GeneID:2892427"
                     /db_xref="GOA:Q6CUS9"
                     /db_xref="InterPro:IPR001623"
                     /translation="MDLAHVKDNHVDLYRILHIHVNDNEHLNSVTPTLINKQFRKLSL
                     TLHPDKSNESDLNITRDRWDNLQSAYRILSEHKKEYDIWYQRTFLHSNRELLEKLEIS
                     EKAKKEKLISYDEIEKIQRYGQTLRKLVHFEIPISDWRNPSFTENTDDLNKLTETCLF
                     RIKLVKRKEYNNEQKLNEWFRKIDIPITVQYYSENNDQREDDLVVYASARNVQTTIEI
                     LRTIENEKELHPDILEFTPAVEFEHFSFKEKVELDPSLGSIIYNSSDNPIIM"
     gene            complement(<227814..>228731)
                     /locus_tag="KLLA0_C02563g"
                     /db_xref="GeneID:2892533"
     mRNA            complement(<227814..>228731)
                     /locus_tag="KLLA0_C02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452311.1"
                     /db_xref="GeneID:2892533"
     CDS             complement(227814..228731)
                     /locus_tag="KLLA0_C02563g"
                     /note="similar to uniprot|P53845 Saccharomyces cerevisiae
                     YNL263C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452311.1"
                     /db_xref="GeneID:2892533"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS8"
                     /translation="MSYNPYYSEIGSDSNVGMAAAGKGKNISATGKQYGMQQPSLGPQ
                     TPQQQQQQNGSYLPSASTNMAFQFGQTAFNQFVGQENISQFQETMSKATGATNSSVAH
                     YFQVSNSYVFHKFKLITVPFLQKNWQRIPDSSNSFQPPRIDVNSPDLYIPVMGLVTYI
                     LAWNVTQGLNGSFDPENLYFKLSSTLAFFLLDLIILRLGLYLLVSNTTSPVTSLVELT
                     CYVGYKFVPLIFSMFFPASFIWLNRLAKLYLFVAFGVFLLRSIKFNLFADMGNSADFS
                     FKKGTVKKVNYFLFVYGFFWQSVLMWLMG"
     gene            <229274..>235831
                     /locus_tag="KLLA0_C02585g"
                     /db_xref="GeneID:2892428"
     mRNA            <229274..>235831
                     /locus_tag="KLLA0_C02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452312.1"
                     /db_xref="GeneID:2892428"
     CDS             229274..235831
                     /locus_tag="KLLA0_C02585g"
                     /note="similar to uniprot|P21951 Saccharomyces cerevisiae
                     YNL262W POL2 Catalytic subunit of DNA polymerase epsilon
                     one of the major chromosomal DNA replication polymerases
                     characterized by processivity and proofreading exonuclease
                     activity also involved in DNA synthesis during DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452312.1"
                     /db_xref="GeneID:2892428"
                     /db_xref="GOA:Q6CUS7"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR029703"
                     /translation="MSAFKGSTTAKFVGRGNEYPTQANSFAQVAQQLLNSKKVDEIDE
                     MMGFPRFIPSPALSDSKVGWLSNMHPTIISQEMLEEEGNLHSATVSGISGVDFYFIDE
                     EGGSFKTTVTYDPYFFVSCTDETRIHDIEEYLKKTLEQCIKKVELVLKDDLAMNNHLV
                     GLKKHLIKLSFSNSNQLFEARRILRPILKINEDENGKKDIYNTGSDYSTRDVKTLIED
                     IREYDVPYHVRVSIDKNIRVGKWYAVSAQGLVELEEKVTFADPVVLAFDIETTKAPLK
                     FPDSAIDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKDEYKGQFAIFNEPDEMA
                     LLQRFFEHIRDVRPTVISTFNGDFFDWPFVENRAKFHGLNMFDEIGFAPDSEGEYKSS
                     YCTHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYNPLELDPELMTPYAYEKPQILSEY
                     SVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTLCEMLLMVQAYQNSVLL
                     PNKHTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDLKNDFKIDPTVIDILLEDLP
                     YALKFCIEVENNGNMEDVTNFEEIKQQITAQLTDLKINNKRNELPLIYHVDVASMYPN
                     IMTTNRLQPDSMKDEKDCASCDFNRPGKSCDRRLKWAWRGEFFPAKMDEYGMVKRALQ
                     NELFPNKNPKSKKQFLTFEELSYSDQVSHIKKRLTDYSRKVYHRVKVTETVEREAIVC
                     QRENPFYVNTVRSFRDRRYEFKGLAKLWKGKLSKIKPDDVHSKDEAKKMIVLYDSLQL
                     AHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGANIIQMARSVVERIGRPLELDTDGI
                     WCILPKSFPENFEIKLRNGKKLFLSYPCSMLNYKVHQKYTNHQYQDLVDPMKFKYQTK
                     SDNSIFFEVDGPYKAMILPTSKEEGKGIKKRYAVFNEDGSLAELKGFELKRRGELQLI
                     KNFQSDIFKLFLEGTTLESCYAAVATVANRWLDVLDSKGAMLETEDLIELICENKSMS
                     KTLKEYQGQKSTSITTARRLGEFLGEAMVKDAGLQCKFIISSKPHNAPVTERAIPVAI
                     FSSDLHVKRTFLRRWLLDSSLNDFDPRAIIDWDYYRERLASVVQKIITIPAALQNIKN
                     PVPRVEHPDWLRKKIAVSEDKFKQTSLNRFFKSTKAPPEVKDIEDSFDEHSANKSRIA
                     KVTYKRKSKRRNGDTALEEESLLLPSEMPPMLDDYVGWLQYQKTKWKIQHIDRKKREK
                     LFGKTSRASDRSALGNLIRKHVESYADKSWEILQCKPSIDLGVVEIYALIDRKIQLLK
                     VNIPKTVLMNFKTENFPSGGIENCIVEKSNAELPNVKGINNESSSQLFKLTMSEDTYF
                     NEVNKASSVLNNENVLGIYESSISSNERVIMRLGTCIQFSSEKMGALGKGLQNGFHMK
                     NLHPVEADRYLQRFDLDIAYLLHFVTDIGYEFYFLYKAWEDVVEIFVLKPSTHAQEVS
                     NKAIESLYNEIYEKKFEKLDKYYDLIKINKNVSFNVNDYTELKRLLKDLSKMLQNIKE
                     EKGSHTMVILQSPYTHRVAKLLQPLNAFPVVEIATAETHLPALNWQGQLMRKAVNHIL
                     SLGSWISNLITLSKYSNIPICNLKVDNLGYIIDLMYARQLKKNNIVLWWNDKSPLPDH
                     GGVERDFDPRKAELMTDLVFPIMNNPDIYDDVIFEISVYNSVVNTVLSSTMLNEAEGT
                     DLAQNSTSKEESFGFVEDSFSSSALSVLRALLKELWDDALGDNITADSLVHAFIGWVY
                     NPDAKLFDYALRYHIHTLTQKAVLQLINEFKLAGSSLIFADRNKLLIKTQKRSVENSY
                     AYGQYLMKAIRSKPMFAYLDLKIDRYWDVLIWMDKYNYGGRACLQIEDKEVQSFQAYS
                     HWHIKDFLPAIYQQEFDDWLVVILDSMVKTKEAYHERNASTQRLTQLPKNTLADSDVD
                     SQTDSLGGFTHNFSKALIKRAEKLYKNQQEYILDPNFGKDYLSPTIPGSHLVVKNPLL
                     ELVKYLSHILSLSSNHLLEGRALRKELLKTFEIREFDRLAEFKDPSTSFVIPSFICEH
                     CSYISDIDICRESMERVFICQSCNRSLNKNLIEEHVIERLQAQVASFITQDVKCNKCH
                     KIKEDAMSPYCPCSGKWELAVSKESFMAQLQIFKNLAESFDFRTLKETLNDFL"
     gene            <236042..>237463
                     /locus_tag="KLLA0_C02607g"
                     /db_xref="GeneID:2892429"
     mRNA            <236042..>237463
                     /locus_tag="KLLA0_C02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452313.1"
                     /db_xref="GeneID:2892429"
     CDS             236042..237463
                     /locus_tag="KLLA0_C02607g"
                     /note="similar to uniprot|P50874 Saccharomyces cerevisiae
                     YNL261W ORC5 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452313.1"
                     /db_xref="GeneID:2892429"
                     /db_xref="GOA:Q6CUS6"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS6"
                     /translation="MVRPDVRYREEQLDFLEAFVDADPKLSPPILFIEGPHGSGKTHT
                     LKKFFACNEEIMNILLPAKDLIYSKSTCQRLATCLRQLLLKQFPSVETTDLDPFEAED
                     VYLLQKFINKLFIRFNHLVERVNLYVILDGLDDNSQVNLETPTQLMALPGSILPQAMI
                     QLRLIISFSKSSFLSNYSTFKVPTIFFPKYKPLEIEYIVSQTPGFSDDPLLLEKMDEI
                     GCGNTEQFRSEIFEKYIHFLIESLIVYTGYDPTALIDIMRIKWRCFVRSLNQENIKNT
                     VQLYKSNLELFNKPNERLIPQTSRSDQNSLSGTGSVGYSSHSLCFMAKYLLIAAYLAS
                     YLNHRYDSKVFSKKSHLRGGRSSYGRRSKPANNPRYLQPSGFSLERMLAIFQSIYPVR
                     VSKELSPDFFQRDVHMKANVEVYENVSELITSQLLTGLNMHKLGYLHERLKFKVNVTW
                     DYILLVAGSVDFDISEYFSDVVE"
     gene            <237655..>238632
                     /locus_tag="KLLA0_C02629g"
                     /db_xref="GeneID:2892532"
     mRNA            <237655..>238632
                     /locus_tag="KLLA0_C02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452314.1"
                     /db_xref="GeneID:2892532"
     CDS             237655..238632
                     /locus_tag="KLLA0_C02629g"
                     /note="some similarities with uniprot|P38852 Saccharomyces
                     cerevisiae YHR156C LIN1 Nuclear protein that physically
                     interacts with Irr1p a component of the cohesin complex
                     may link together proteins involved in chromosome
                     segregation mRNA splicing and DNA replication"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452314.1"
                     /db_xref="GeneID:2892532"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS5"
                     /translation="MNVNKGSSDQNDRSVITKSKDKLQVKKTDFNADSYDDHFEESDY
                     QDISCSDDSSDNEEEIEDFVRRGQTETDEIFDGNSSEISESDSAVADDSVSEEEINGS
                     NVQIEAFNMEEELKNGTVDKVGNATGKTINDDFENEDQWIQDFSSKESIKRAREAHEN
                     SQTLQRKKRARMLYRLEEVLEQLYYFVPRGKTIQEALILLQQLRKSLPKEHKERTKYI
                     ANAIQIILTLVNVLEQKGIDNPMQLQKEGIRELYDEENLMGSTIDDVESKNWVFKWFA
                     DFETAHESFSNYEMQTWKEKYFNSSVVVKRKCDTDETDHWYHVDCIYFM"
     gene            complement(<238695..>239189)
                     /locus_tag="KLLA0_C02651g"
                     /db_xref="GeneID:2891818"
     mRNA            complement(<238695..>239189)
                     /locus_tag="KLLA0_C02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452315.1"
                     /db_xref="GeneID:2891818"
     CDS             complement(238695..239189)
                     /locus_tag="KLLA0_C02651g"
                     /note="weakly similar to uniprot|P53846 Saccharomyces
                     cerevisiae YNL260C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452315.1"
                     /db_xref="GeneID:2891818"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS4"
                     /translation="MDFDELLNLEQEFYQEGYEEGRNENLKHNLLEGKQYGLQVGFQR
                     FQLLGIIYGISDVLIQKFDDAALQKNAKVIKDLIEEIQMDNNQENVAIYEKSIFKIRN
                     KFRLVLMSLHKNISSIDSSSDRLTLEKIESLSREIAGKLHGYTEDDSGSNNETMMQDQ
                     TTDW"
     gene            complement(<239589..>239813)
                     /locus_tag="KLLA0_C02673g"
                     /db_xref="GeneID:2892489"
     mRNA            complement(<239589..>239813)
                     /locus_tag="KLLA0_C02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452316.1"
                     /db_xref="GeneID:2892489"
     CDS             complement(239589..239813)
                     /locus_tag="KLLA0_C02673g"
                     /note="highly similar to uniprot|P38636 Saccharomyces
                     cerevisiae YNL259C ATX1 Cytosolic copper metallochaperone
                     that transports copper to the secretory vesicle copper
                     transporter Ccc2p for eventual insertion into Fet3p, which
                     is a multicopper oxidase required for high-affinity iron
                     uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452316.1"
                     /db_xref="GeneID:2892489"
                     /db_xref="GOA:Q6CUS3"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS3"
                     /translation="MSSTNHYQFNVQMSCSGCSSAVERALSKLEPEVSKTEISLEKQT
                     VDVYTSLPYDTVLEKIKKTGKEVISGTTLN"
     gene            complement(<240212..>242272)
                     /locus_tag="KLLA0_C02695g"
                     /db_xref="GeneID:2891911"
     mRNA            complement(<240212..>242272)
                     /locus_tag="KLLA0_C02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452317.1"
                     /db_xref="GeneID:2891911"
     CDS             complement(240212..242272)
                     /locus_tag="KLLA0_C02695g"
                     /note="weakly similar to uniprot|P53847 Saccharomyces
                     cerevisiae YNL258C DSL1 Endoplasmic reticulum
                     (ER)-localized peripheral membrane protein required for
                     Golgi-to-ER retrograde traffic component of the ER target
                     site that interacts with coatomer the major component of
                     the COPI vesicle protein coat"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452317.1"
                     /db_xref="GeneID:2891911"
                     /db_xref="InterPro:IPR021875"
                     /db_xref="InterPro:IPR021876"
                     /db_xref="PDB:3K8P"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS2"
                     /translation="MATLEKLLNDLLSDTSALSQAIEADPQFKSSDSVHPKPNSKLLE
                     EVLREDSDLTKDLAKYNQYKILSDLLKEFNTNYELNELENCYYSLQNIHKKFKDVNIS
                     GESFRFQQSVATYIDCLHLNVLERFKEVSNMFYTISGNEMMFKKTIELDSVEFNFDEM
                     VELFENNFFDHNMIDQTHWFIASTNLETYKDKEIVLLQEILDDTVKLNPLIKFFKEFV
                     FDEKCIMVRAEPGKLTLATSEYNSLDQIKSYQTLTTFIENDLSKHAKESVMIHFGNVL
                     LTELLKIIRANPELLSNDKEQTTEIISSIHDSLTKISEETEWAYDGFELNRILKDENI
                     YTTLKFESMMQQRVIQIRSIPEEEYHELVSVQFKTDGGKYEKGEKQDLELSEKKTENG
                     KDTESWGWNENQDSDEHDGWDEELDIDVDNVPIQVSVFVQSAAKVFTEFEQGCDTIGR
                     SKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLD
                     LNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTIL
                     VALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREK
                     LGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVRE
                     EATD"
     gene            complement(242462..242560)
                     /gene="SNR71"
                     /locus_tag="KLLA0_C02706r"
                     /db_xref="GeneID:9487464"
     ncRNA           complement(242462..242560)
                     /ncRNA_class="snoRNA"
                     /gene="SNR71"
                     /locus_tag="KLLA0_C02706r"
                     /product="snR71"
                     /note="C/D snoRNA monocistronic SNR71"
                     /transcript_id="XR_002633569.1"
                     /db_xref="GeneID:9487464"
     gene            complement(<242948..>246508)
                     /locus_tag="KLLA0_C02717g"
                     /db_xref="GeneID:2892546"
     mRNA            complement(<242948..>246508)
                     /locus_tag="KLLA0_C02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452318.1"
                     /db_xref="GeneID:2892546"
     CDS             complement(242948..246508)
                     /locus_tag="KLLA0_C02717g"
                     /note="similar to uniprot|P38717 Saccharomyces cerevisiae
                     YNL257C SIP3 Protein that activates transcription through
                     interaction with DNA-bound Snf1p C-terminal region has a
                     putative leucine zipper motif potential Cdc28p substrate
                     and to uniprot|P38851 Saccharomyces cerevisiae YHR155W
                     YSP1 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452318.1"
                     /db_xref="GeneID:2892546"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS1"
                     /translation="MTAYETRRNDKLTRLTALAYKEASIDTPSFRTSANHFHMQVLAL
                     ENWIQENTNLSKNQALSGLAELNKDEDSMIDRLLPPLPYLNNGLVENQAYTPAMVNEF
                     QLALKTFASSISSLMYGNPETYLSTYLDILVKVVKPYKEVRENFDYYQGRYDMLNKNY
                     HELKISALMNTESIREKAIELFDIRKLYRDASFDLLWSIGTIQIKLDELISKMIASTI
                     PSTAQNKNAKYSINISDELELEFSRYRKWTQALSICLDNSTEHLQKLKSQICEYCETS
                     FEPSKDLRTYDITNINSAALIKNTKPSENKKSGWLYVKTKIKASGRFTWLKRWCFLER
                     GMFGMLMLSPSKTFVEESDKFGVLLISCNYNPHEDRRYCFDLRIINKDETAESQDIIL
                     TLQAETLEELSSWLTLFSYAKKEAYKLDNKSPEYSMLLSRVSPLFIEFACSSITEIDF
                     QTTSVTEHQTHSLLNIIQANPNIANDFGVFKNPTFRFPVMTQATKLAVISNAFTEDQG
                     LSGAIPANIWGCTATSHSFRLTDPRDDKFPIDNNAWNPISYPAYYPEKLKSDDLLFRT
                     LFTGFLNIEICDSELLLFKEPCICSFSSVSRYPSTMFATSNMLYFYTNFMGFVYLNEY
                     SFKSIVGVSVVSNELEMDSGKLEIDLKNKSKIVVEAFYCDPYCLSEKILGALETTLQK
                     SDLRIDQLIIKLDNIESTFARKESSNPKTLIPEMSLVRSLNIDKMNMRQRQQKFQLEH
                     DSIFRMDFHVPSRALAHLMFGDKSTVFHECTFLSRSKTKHDAVGAWFINPETKELVRK
                     MRFRLRLARALISDNKVHRSTNTDFSYMDILQTLTKTSENFYYEIDQKTGFFSLPLTK
                     LFCIETKYVIIDNPKNDYNTKIRKTPGSSCSLYTYYNVIFVNSNSLKPVSSLNYIDKF
                     IKATVLSILGNESRILKHVLSTYVSKLGNSSKIVKAIRLGGQIGVANQATPADAEYMI
                     NSISNQVVYTKMLIFKLAIKWIFLFWSKLCINGIRFFFGMIYGLMTNLMMLNRLVLGL
                     FLLSILTNLYLMQRATFDYWAYKKAEKFADSIVDLKSVDMERSISLDDLTILTKELTS
                     KNEVIEHFLADSPYSKGSYHDIRNDMALRRNEILIELSLLNNVERELIGTDFKSFLLK
                     EVERCSIVQNSYKDVMENNTKLREYCNSCKEQLRSFNSLL"
     gene            complement(<246771..>247952)
                     /locus_tag="KLLA0_C02739g"
                     /db_xref="GeneID:2891814"
     mRNA            complement(<246771..>247952)
                     /locus_tag="KLLA0_C02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452319.1"
                     /db_xref="GeneID:2891814"
     CDS             complement(246771..247952)
                     /locus_tag="KLLA0_C02739g"
                     /note="similar to uniprot|P54857 Saccharomyces cerevisiae
                     YDR058C TGL2 Triglyceride Lipase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452319.1"
                     /db_xref="GeneID:2891814"
                     /db_xref="GOA:Q6CUS0"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CUS0"
                     /translation="MLEYDVTTARSLFLSTFTSLFASDYSFYIHRFSFLKELIPLSKA
                     KDEGLVKDRVIKSIPPIEQYKAPKYPIVLCHGLSGFDKLILIPSIFQLTKMIKASILS
                     NHSDSFMQEDDDKDIQSDALVHVDYWIGVREALEARGCTVITAKVPSFGSIEERAKVL
                     NSFIDTELGKVKRTLAKGDVYNTNEVNSKSFKKEDKIKVNLIAHSMGGLDCRYLISHI
                     PNKNFEVCSLTTISTPHHGSEMADYVVGLFSDMTQTFDVNTKKKLLPPAFYQLTTTYC
                     SHFNKITPDDPSVAYFSYGACFKPRWYNMFYMSWCVISNLSGGVPNDGMVSIQSARWG
                     RYLGTLENVDHSDLINWKNRLQKEFQYRLQGTLKKPQNPDIDILHFYLKVTENLANLG
                     F"
     gene            complement(<248365..>249783)
                     /locus_tag="KLLA0_C02761g"
                     /db_xref="GeneID:2892542"
     mRNA            complement(<248365..>249783)
                     /locus_tag="KLLA0_C02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452320.1"
                     /db_xref="GeneID:2892542"
     CDS             complement(248365..249783)
                     /locus_tag="KLLA0_C02761g"
                     /note="similar to uniprot|P53318 Saccharomyces cerevisiae
                     YGR255C COQ6 Putative flavin-dependent monooxygenase
                     involved in ubiquinone (Coenzyme Q) biosynthesis located
                     on the matrix side of the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452320.1"
                     /db_xref="GeneID:2892542"
                     /db_xref="GOA:Q6CUR9"
                     /db_xref="InterPro:IPR000689"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR010971"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR9"
                     /translation="MLSSRILSRSFFASAVNLQAKLTDVLIVGGGPAGLTLAAAIKQS
                     PHLSDLSTVLVDAGDLKEKIGGFYHDPPDNFTNRVISLTPQSKHFLENTVGVSLMEER
                     IQPFDGLYVTDGCSNGTLEMERDSMGFMVEILNIQSSLLAKLRSSNAPNLDLIDKTKV
                     QSIEYEDPEDTKSWPVVTLDSGEQYKTRLLIGADGFNSPVRKFSGIESRGWFYERFGV
                     VATLKLEYPPFKIRGWQRFLPTGPVAHLPLPGTNSTLVWSTTEPLSRLLLSLDDDVFV
                     ALVNAAFILEDVDLEYYYKSLQEGTITGEELIQDVDFRINEKFNSFKDDSVIDEKYPP
                     KVIDILDKSRGRFPLKLSHADTYVAERIALVGDAAHTTHPLAGQGLNMGQGDVESLIK
                     ALEKARQRGLDIGSLLALEPYWADRYPTNNMLLGVVDKLHKLYSTDFGPLVSLRTFGL
                     NLVNSLQPLKDLMVGKVSGPSK"
     gene            <250633..>253029
                     /locus_tag="KLLA0_C02783g"
                     /db_xref="GeneID:2892221"
     mRNA            <250633..>253029
                     /locus_tag="KLLA0_C02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452321.1"
                     /db_xref="GeneID:2892221"
     CDS             250633..253029
                     /locus_tag="KLLA0_C02783g"
                     /note="similar to uniprot|P53848 Saccharomyces cerevisiae
                     YNL256W FOL1 Multifunctional enzyme of the folic acid
                     biosynthesis pathway has dihydropteroate synthetase
                     dihydro-6-hydroxymethylpterin pyrophosphokinase and
                     dihydroneopterin aldolase activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452321.1"
                     /db_xref="GeneID:2892221"
                     /db_xref="GOA:Q6CUR8"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="InterPro:IPR016261"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR8"
                     /translation="MTKSVVPAGRRWVSHDQVHVKSLDVKAVVGPDSWDQLKPQNLKV
                     TLHMQTDFKKSSITDDLKYSLNYAVVSRDISNHVQKNIKRNYKDVNTFGRNIVEYAKK
                     SYPGINALTVEVESKEANIRSNSIKSTTSDSHDELDHIIISDFKILTLIGVFTFERLK
                     RQYVDFTIKLPIAEGSDVPQYDKIINQVTEYVENSNFKTVEALVETAAQVVLTNNGYF
                     FDRPSLPIEVKVMKLNAITETEGVGVSCERCYDDFKSVAPISLPVAKSKVINSCTGGD
                     FDLPVQNIKLDKDSWKSAILAFGSNIGDRFKNVVEAVSLLKAHKDVEVVCSSSLFESE
                     PMYFKDQQPFLNGCIKIKTRLLPDALLELCKKIEYDELNRVKHFDNGPRTIDLDIVTY
                     YDSNGADFSMNTPELTIPHPRMLERSFVLEPLCELISPCCVHPITAEPIHNHLKQLYE
                     NDNPEDVLWKLVPVGDKFLKFKIQWEKDILTGLRRPVSSSSAYLMGVVNVTPDSFSDG
                     AQDYDNKEVVVSKIEAMVSAALELHEIVILDIGGCSTRPGSLQASEEEELARILPIIN
                     AVTTSKSIPLDKVVISIDTYRSVVAEAAISAGVGIINDISGGVFDPRILQVVSKHPNV
                     AYVLSHIRGTIDSMSSETSYLTSDENVKEYISGKEGNEIDNLFIKTIGREVCSRYQDT
                     FRNNIFRWQLFLDPGIGFAKVGKQNLELIKGIPLLRNYSCIIGNEYYSLINLPVLVGP
                     SRKKFIGDITKTPSAKDRDFATGAIVSACVANGCDIIRVHDVANISKALKLLNELYRN
                     "
     gene            complement(<253320..>253790)
                     /locus_tag="KLLA0_C02805g"
                     /db_xref="GeneID:2892292"
     mRNA            complement(<253320..>253790)
                     /locus_tag="KLLA0_C02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452322.1"
                     /db_xref="GeneID:2892292"
     CDS             complement(253320..253790)
                     /locus_tag="KLLA0_C02805g"
                     /note="highly similar to uniprot|P53849 Saccharomyces
                     cerevisiae YNL255C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452322.1"
                     /db_xref="GeneID:2892292"
                     /db_xref="GOA:Q6CUR7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR7"
                     /translation="MSGKACYICGKLGHLASDCDSEKLCYNCNKPGHVQSECTVPKTV
                     EFKQCYNCGETGHVKTECTVQKCYNCDGFGHISRECDQPKRFRNNERSGPKVSCYKCG
                     GPNHIAKDCLKSEPTCYNCGQAGHLSKDCQNGENEKVCYNCNGVGHIAKDCSSY"
     gene            complement(<254087..>255217)
                     /locus_tag="KLLA0_C02827g"
                     /db_xref="GeneID:2891851"
     mRNA            complement(<254087..>255217)
                     /locus_tag="KLLA0_C02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452323.1"
                     /db_xref="GeneID:2891851"
     CDS             complement(254087..255217)
                     /locus_tag="KLLA0_C02827g"
                     /note="some similarities with uniprot|P53850 Saccharomyces
                     cerevisiae YNL254C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452323.1"
                     /db_xref="GeneID:2891851"
                     /db_xref="GOA:Q6CUR6"
                     /db_xref="InterPro:IPR028094"
                     /translation="MVSSSNASSDQLSQESLVIISSSSHEGFSYGKRHPTVALNGSLN
                     KKLRVRSGSLEELSDSEFDVSAKEEEKKSTELQDPKSIDLETQFSDVESDLDSLNERN
                     KGADMLELTDDESVHELPGSSRDFFDENDVEEMSMELIKMYSIGLNAEGVSEFKKSSA
                     SLVLPKNTEKSTYLKSNAVRQKFMTKYDLPPVLFLDQLESRTREHISVCDAILTGKVS
                     SLYYSMAKTVQKNSKRQVITNEELRDLNILKFTAGYFGSRRQAIVGMLILETYGEKLK
                     RNKNPVISFWGPYDFSQYILAPEVLSYLCMDDFKLNNIEDAWDIMQTTIEFGTMVADL
                     SPLEVYEIECEEESLRRLRLPQQYSSMSYRDDPRRKQDSNVG"
     gene            <255963..>257285
                     /locus_tag="KLLA0_C02849g"
                     /db_xref="GeneID:2892385"
     mRNA            <255963..>257285
                     /locus_tag="KLLA0_C02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452324.1"
                     /db_xref="GeneID:2892385"
     CDS             255963..257285
                     /locus_tag="KLLA0_C02849g"
                     /note="some similarities with uniprot|P53851 Saccharomyces
                     cerevisiae YNL253W TEX1 transcription export complex
                     component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452324.1"
                     /db_xref="GeneID:2892385"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR5"
                     /translation="MSRFGYTASKAFEITCLNESGLKSHYSSLLESCCKDKRVLKDYH
                     ATAVKDSRSVRTSLNEIIALDSHSASKYVSWSRIDGSLTVMRPPLTSDRSQDHVLIGS
                     IKKDVHGEGKIVYSISWNPNELQFASVGNTPTVKIWNVVDDKLSVLKEFKTNFKAKNF
                     ITEYDPSGKYLVVATKTNEIYIYNAESGYESCISFSPDEKSDDAIHSLCWSNDSKQII
                     VAYKSGFIKLFSLQDDGLKFLCERRNDMKTITSLIMDPLGRALLVGTHNECSIYSLPD
                     LVPLKKSIKTDNRITGIDISFDGSIISILSKALDSHDSFLSLYWYNDLSILYNTVVKN
                     SSRSTIKWSKSCLIFYTTGALDKMTMVDLRSGRPKTMVSTDDRKRNDFVKKSTDRSSR
                     TQRDTPQRGKRDKELRKQPYKRDADKFSEKSFGRSNTGSSFRKPNDRW"
     gene            complement(<257493..>258284)
                     /locus_tag="KLLA0_C02871g"
                     /db_xref="GeneID:2892389"
     mRNA            complement(<257493..>258284)
                     /locus_tag="KLLA0_C02871g"
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /transcript_id="XM_452325.1"
                     /db_xref="GeneID:2892389"
     CDS             complement(257493..258284)
                     /locus_tag="KLLA0_C02871g"
                     /note="similar to uniprot|P36528 Saccharomyces cerevisiae
                     YNL252C MRPL17 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /protein_id="XP_452325.1"
                     /db_xref="GeneID:2892389"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR4"
                     /translation="MSVKAAASSIPKAVKAGLVLSRVPIVTPELNALENKYYQYQAEL
                     ERRLMWTFPSYFYFKKGTLAERRFQSVQKGVISKQPGVWFPKGVPDVRHNRERSQKQD
                     IMLPREASEGSNKSDVSRPIVPNSRTTKADENNDITSLDRKLDRTLHLLVKDDKGSWV
                     LPSFPVDIEAKEGKKALHETAEVGLRKIGGEDINTWTVSNTPAGVLQSEKDLQFLIKS
                     HIIAGEFKLKDEKSIKEFAWLTKDEIKKAVDERYFNSIQYVLAEN"
     gene            complement(<258602..>260473)
                     /locus_tag="KLLA0_C02893g"
                     /db_xref="GeneID:2892294"
     mRNA            complement(<258602..>260473)
                     /locus_tag="KLLA0_C02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452326.1"
                     /db_xref="GeneID:2892294"
     CDS             complement(258602..260473)
                     /locus_tag="KLLA0_C02893g"
                     /note="similar to uniprot|P53617 Saccharomyces cerevisiae
                     YNL251C NRD1 RNA-binding protein that interacts with the
                     C-terminal domain of the RNA polymerase II large subunit
                     (Rpo21p) required for transcription termination and 3' end
                     maturation of nonpolyadenylated RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452326.1"
                     /db_xref="GeneID:2892294"
                     /db_xref="GOA:Q6CUR3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR3"
                     /translation="MMQSDEHEDFVATLESFKELKSGISGSRIRKLTDYAVNHGRNIE
                     ALLSFVIQYSKECPPTHKLGSLYIVDSIVRALMSKSETVKQEEGEEGNYFLKGVELLN
                     DNIQPLLIDGIERSDPAHLEKIQELINIWDKNNVFNNKPLNAARSRLSELVNSNSIPP
                     SSSSNSSLTPRPAPSNDNKSSSGSKIDQVLNAIPKFENLPGIQVPSGLFSEDISVQDS
                     CLKELLGKLQVELTKNQKLVQVNKQAPRSIDNSTSSTSSSSRSTRSTQYVGRDSRNDR
                     SRSPPRNKNDRSRAQATTSLHLSRQQQQQQQQQQQQQQQSINGQQGNNHHLYPDEQNV
                     PSNPHFRPKPVSFDPTVPRDHVKVYSRTLFVGGVPQNFKEHDIARMLRQFGEVQSVIL
                     NNARKHAFVKVYSRAEAERIMAHFTGGGNPTHGLRIRWAVGFGPRDCCDYQYGYSIIP
                     LARLTEIDFKWSQSAEWGGTGGQPIQTNMVYEEPDIIVGEGVSSKAISQKMPTDKGVL
                     GPKSGKVGQATAVSQTPIPYSNISPPPPPVQTSQIPNVPQIQQQYYNQPLYQQPPSMV
                     YGQNQLLGSASSAQQQQQQQSHQSTQPSGQKSPQPPQNFDPTAQLNTLMNILNQTPK"
     gene            <261280..>265170
                     /locus_tag="KLLA0_C02915g"
                     /db_xref="GeneID:2892233"
     mRNA            <261280..>265170
                     /locus_tag="KLLA0_C02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452327.1"
                     /db_xref="GeneID:2892233"
     CDS             261280..265170
                     /locus_tag="KLLA0_C02915g"
                     /note="similar to uniprot|P12753 Saccharomyces cerevisiae
                     YNL250W RAD50 Subunit of MRX complex with Mre11p and Xrs2p
                     involved in processing double-strand DNA breaks in
                     vegetative cells initiation of meiotic DSBs telomere
                     maintenance and nonhomologous end joining"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452327.1"
                     /db_xref="GeneID:2892233"
                     /db_xref="GOA:Q6CUR2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR007517"
                     /db_xref="InterPro:IPR013134"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR2"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGTNGSGKTTII
                     ECLKYATTGDLPPNSKNGAFIHDPKITGEKDIRAQVKLAFTNAKGVNMIVTRNIQLLA
                     KKNANTFKTLEGQLVAINHGERTTLSTRANELDQQIPLYLGVPKAILDYVIFCHQEDS
                     LWPLSEPSILKKRFDEIFQAMKFTKALDNLKTIKKDISIDIKLLKQSVEHLKTDKDRS
                     TATKVNISKLENKIEEYQKEVKSIEHDLNIITKESDALFSSNQKFQETLSKLDNLKHN
                     KTSFMEQIQRLQSSIEILPNSKSELEDMLQNFQRLLEEKNIELFEYQSEKERLLSLLN
                     DCRNEQQEVVRLQGELGSKKNQYETSKIKMNTILTELSELYNISKESVTSEVSTMLHT
                     ANKNLESLLAKHHFEETTLEEKLSVLRNSFAKKEQQLSYISSDLNKLADQTKKLRNRL
                     NDKRVSEKDLKVEKEALNNYESKLKQWNTERIVDAISTSIKTKNQDILSLEDELEVIQ
                     QQITKANQHSDLYAKLSLLKASESTKKKDVETIKKQLEEGANLVSVSFNLEGDLLSQF
                     NSILDKKRVDLKKIKNDSDIATKEFIQYENQLQGIEEQIYEIESNITSIESRLKESLP
                     DEVEIDTYDEELRDSEESYRIALENLKMHKTTLEFNLKALEVAKNEDCCYLCQRKFND
                     VTSSSKLIEDLKARTNKNFQIALETTAKEMETYLHDLKSCYDDVLSHRKYQRELSTMK
                     DNYARIKRSTEEKRSNQQEKFHTLQNLESKLATLTEKLQPNVSKVLDTEEELSKLTSD
                     LRRVEEELSIYISDEKLETIETLHSKQKRVNNELRALRKDISDLQIQKEDKSKEYNNL
                     LSLIREKNSNINNMESALQEYLNITKEVCENESIIESSEKESEILTEEVNDLKLEISS
                     ASGSLNEGKAKHRQLEVEARERKDKIESQVANVNELVELIQNFEINDAPRLIECEEKL
                     TEISNSVESKTAEIKSIEDSINNTVQKLKDSDNEFKNIKLNIDLLGLKCELQRIENAI
                     SSMDVTHAEQERNKYQEDSLRLRTAYEKLSSENAGKLGEIKQLQNQISNLKNQLQTDY
                     KNIDEHYQREWIKLQTKSLVTDDIDTYSRALDSAIMKYHSIKMKDINRIIDELWKRTY
                     SGTDVDTIKIKTDEVSNVRGKSYNYRVVMYKQDAELDMRGRCSAGQKVLAAIIIRLAL
                     SETFGVNCGVIALDEPTTNLDEENIESLARSLATIIEVRRHQKNFQLIVITHDEKFLN
                     HMNASSYANHFYKVKRDDRQKSQIEWVDINKVNP"
     gene            complement(<265205..>266755)
                     /locus_tag="KLLA0_C02937g"
                     /db_xref="GeneID:2892660"
     mRNA            complement(<265205..>266755)
                     /locus_tag="KLLA0_C02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452328.1"
                     /db_xref="GeneID:2892660"
     CDS             complement(265205..266755)
                     /locus_tag="KLLA0_C02937g"
                     /note="similar to uniprot|P53583 Saccharomyces cerevisiae
                     YNL249C MPA43 Mitochondrial protein of unknown function
                     and similar to uniprot|Q04585 Saccharomyces cerevisiae
                     YDR109C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452328.1"
                     /db_xref="GeneID:2892660"
                     /db_xref="GOA:Q6CUR1"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR1"
                     /translation="MQDVGIGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGI
                     ITQCTSDILTAVEKAFNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNG
                     RYHDIIFWMHSAAIEETEYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT
                     VLDLHIWLLWKISLKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGN
                     NAVIKKNEQFGDSCIDCYASWFQCWSTAMLNRTLFVVAGTSTCFLYASDCFESFIPGI
                     WGPFKDILVNRKHISKHDNYSVYEAGISRTGVLLEKLLSTHPAVKDSDVNFLETVEHK
                     IDLIEQSDTQSIHLMIKNTFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYV
                     VIIETLAFQIVDVINAFEEGHITISKLLITGSQAKNSRLLQILQVLLEEISIDTPCSE
                     SSTAGVKGAYQLGKAHRNNTALLGYPQEATPRPCLLRTDDICLTDVQEHLREKYISYG
                     NITGTKIR"
     gene            complement(<266971..>268209)
                     /locus_tag="KLLA0_C02959g"
                     /db_xref="GeneID:2892293"
     mRNA            complement(<266971..>268209)
                     /locus_tag="KLLA0_C02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452329.1"
                     /db_xref="GeneID:2892293"
     CDS             complement(266971..268209)
                     /locus_tag="KLLA0_C02959g"
                     /note="similar to uniprot|Q01080 Saccharomyces cerevisiae
                     YNL248C RPA49 RNA polymerase I subunit A49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452329.1"
                     /db_xref="GeneID:2892293"
                     /db_xref="GOA:Q6CUR0"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="UniProtKB/TrEMBL:Q6CUR0"
                     /translation="MGSKRAFTEVGVSAYHDEPSVAVSSFFKGFQAPKDTTFELYKNK
                     KNSDKYVLHGENDRLEYEGQTDDDFVNSSQYVVGVYDAATKSVELYKAPLVSSKVLSK
                     SRKNLMGPDIKQANVRAALMRNALGEAFGTKKAKKAIADMERNRIDSDKLVDSAIDIV
                     DTVKTASKELPSKEELQETVSSDRPTPLADLDATDVEQIYPLYNIIPKKEWSFIRVGS
                     IMKEQDPEKRLEYFPYTKFQYVANKLPTLTQAAQMQKLQLLYYLSLLAGVYDNRRVNN
                     KTKLLERINNPPDALLNGILERFTISRPGQFGRSKDKSFFIDPQREDKLLCYILVIIM
                     HLDNFIVEVPPLAQQLNLKPSKLVSLFKILGATVKGATVAQAEAFGIPKSSASTYKIA
                     TLKVPFKLPEMIRRGKGPRR"
     gene            <268669..>269157
                     /locus_tag="KLLA0_C02981g"
                     /db_xref="GeneID:2892229"
     mRNA            <268669..>269157
                     /locus_tag="KLLA0_C02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452330.1"
                     /db_xref="GeneID:2892229"
     CDS             268669..269157
                     /locus_tag="KLLA0_C02981g"
                     /note="similar to uniprot|P47138 Saccharomyces cerevisiae
                     YJR097W JJJ3 Protein required along with Dph1p Dph2p
                     Kti11p and Dph5p for synthesis of diphthamide which is a
                     modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452330.1"
                     /db_xref="GeneID:2892229"
                     /db_xref="GOA:Q6CUQ9"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /translation="MQRSFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNG
                     NNTSSHSVTDIQEAYQTLIDQDLRKKYDEELAESFKKLGFHNAGDGLDLFSLDLFDYS
                     GDEQSFSMNCPRCQITDGFQLTEDALEEHAIDYEGGGYFVLVQCSACSLWLKVLFDVM
                     EE"
     gene            complement(<269315..>271279)
                     /locus_tag="KLLA0_C03003g"
                     /db_xref="GeneID:2892262"
     mRNA            complement(<269315..>271279)
                     /locus_tag="KLLA0_C03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452331.1"
                     /db_xref="GeneID:2892262"
     CDS             complement(269315..271279)
                     /locus_tag="KLLA0_C03003g"
                     /note="similar to uniprot|P47139 Saccharomyces cerevisiae
                     YJR098C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452331.1"
                     /db_xref="GeneID:2892262"
                     /db_xref="GOA:Q6CUQ8"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CUQ8"
                     /translation="MPVDQLSTDSDLEREEAAQSQLDVNSVTSYESPKDLYAEEASSF
                     IGGSAVISRVNTQRRKSTGAKSLYEDEEESNEGESRKEDFSNLLASPDLVESKPKKLD
                     AQEKVSKDVESDESEISSFDTKPSHKIFTFSLPFGGKNLLPVSPLTSIRAFLSNEQIS
                     NDGVTEPTTSSDDKENRKLDRNQIKLKLKRQESITSIEERFLFANNKGIQNVRSKAVK
                     HALKPETLINAIRSFSNIDPEEITEDGYSVSRLETVWDELEGDVVILGGYRGSILRNA
                     ETMKRVWIPIKAGFNIRKINLLLGPKEDDELRATETIIPDGMLTHIGPIDVARKLIRR
                     LKMNPNVNVEDFGYDWRLSLDITATQLKDKLQELYDKQTIKKGTFLIAHSMGGLLAHK
                     VLQDYTHLIRGIIYVGAPSQCPNILGPLRFGDEVILNKSILNAESNFFMRSSFYFLPH
                     DGRCFINKDTYERYDLDFFDPNVWKEYGLSPLVSKERESTSKIDKVKDSLKLAILSPV
                     KMIKSSSNLLKDETENDFITSFEDSYNYLKRILPKTKRFLDQLEHDSEKTYPPLAIVY
                     GDRVPTVRGAKVKNREEIKKGLYQDFYYGPGDGVVHHKWLLPEKCGFPIVAKIASEMP
                     HVSLMTDFEAISKAFISILDAEQTNTEKEP"
     gene            <271793..>274093
                     /locus_tag="KLLA0_C03025g"
                     /db_xref="GeneID:2892083"
     mRNA            <271793..>274093
                     /locus_tag="KLLA0_C03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452332.1"
                     /db_xref="GeneID:2892083"
     CDS             271793..274093
                     /locus_tag="KLLA0_C03025g"
                     /note="similar to uniprot|P53852 Saccharomyces cerevisiae
                     YNL247W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452332.1"
                     /db_xref="GeneID:2892083"
                     /db_xref="GOA:Q6CUQ7"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:Q6CUQ7"
                     /translation="MLARKRLAIIEAIRKVRTMSAPKVVQPKWFKPEQQKPLPVLKLY
                     NTLTRNKEEFVTHSNSKCVTWYSCGPTVYDASHMGHARNYVSIDINRRILQDYFGYDI
                     NFVQNVTDIDDKIIIRARQNFLFEEYVKRNDNKVTEDTVEEVKISLFEFVEKNLNQKF
                     STVEEYESWFSGLDLEKEKVENPKFSMYSTSVSNAIESLKSKGDNFFELAKDVLVPLL
                     DKKFGSTLNDPDIFRKLPAYWEQRYDQDMAALNVLPPTVTTRVSEYVPEIVQFVETII
                     SNGYAYATSDGSVYFDTAKFDSSEGHEYAKCQPWNKGQLDLIQDGEGSLSDFSAKNGK
                     RSANDFALWKASKPGEPEWPSPWGKGRPGWHIECSVMASDIHGSVIDIHTGGIDLAFP
                     HHDNELAQSEACYDNHQWINYFLHTGHLHIEGQKMSKSLKNFITIEEALNKYSARQLR
                     LAFASVQWNNQLDFKDSLLNEVKSLESSFTNFFKNIRALNNDYKHSLGLGKIVSKKLS
                     NEEKALLNVLKSTQEKVHASFCDNLSTPQVLKHLNELLTKSNSYIANISSELKIEPLL
                     AITRYISKILGVIGFQLRSDGLGWLDDSSSDSSPDVSKEDIALPYVRCLSYFRDEVRQ
                     LAMNKAPSSQFLQATDRLRDEELVALNVAVDDRQGQASLVKFLTDKEKDEIMKINEEK
                     LQKEAEKQSKKLEQLRLQEAKKQERLEKAKISPQDMFKNDLYSEWDEDGIPTKDKDGN
                     EVTKSMNKKLKKQWLAQKKLHEEFFQ"
     gene            <274325..>275247
                     /locus_tag="KLLA0_C03047g"
                     /db_xref="GeneID:2892226"
     mRNA            join(<274325..274347,274440..>275247)
                     /locus_tag="KLLA0_C03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452333.1"
                     /db_xref="GeneID:2892226"
     CDS             join(274325..274347,274440..275247)
                     /locus_tag="KLLA0_C03047g"
                     /note="similar to uniprot|P53853 Saccharomyces cerevisiae
                     YNL246W VPS75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452333.1"
                     /db_xref="GeneID:2892226"
                     /db_xref="GOA:Q6CUQ6"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q6CUQ6"
                     /translation="MCIANSVCGNAFRGLAECEDEMALAENEAELYKIKLMAPVFDKR
                     DKLIEKIPFFWNIALTQHSDFSNYVRASDFKYIEAIKKIVVKPLALEDEECTARDFQI
                     TIEFNEIKGDLKAQHVSKVFKIEKDVSKILIKKNRTAEDDELDADLGFLTSEPVNIDW
                     PKSYDNINPELISDKSTPEGKKNYRTGMKTFFAWFKWTGLKPGKEFPNGDALANLFNE
                     ELYPYCVKYYTEAQRDVMDESDGDSEDDSDAPLDLDLEEVNDEEGSDSKHLNKKTKLQ
                     "
     gene            complement(<275322..>275942)
                     /locus_tag="KLLA0_C03069g"
                     /db_xref="GeneID:2892264"
     mRNA            complement(<275322..>275942)
                     /locus_tag="KLLA0_C03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452334.1"
                     /db_xref="GeneID:2892264"
     CDS             complement(275322..275942)
                     /locus_tag="KLLA0_C03069g"
                     /note="weakly similar to uniprot|P53854 Saccharomyces
                     cerevisiae YNL245C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452334.1"
                     /db_xref="GeneID:2892264"
                     /db_xref="GOA:Q6CUQ5"
                     /db_xref="InterPro:IPR019339"
                     /db_xref="InterPro:IPR022209"
                     /translation="MSDLNLLKSWNPKLVKNRKKVWEAQQQLVEENKKIKERQKEIEK
                     ERELDRYSSLIRDEDQKNVKRKTGLEWMYDNTSTALTENVDYLLGKKEITDTLLDLSG
                     NNNKSEKSENQKQTIRKHYQGIEDVICSKTNHKNVDLSSDDPMAKFKAAKQAHLKTLK
                     QNIQPTSHEYPVHKPLRGANSKRYDSGNGSRSNYKNSRYNNKYYRS"
     gene            complement(<276491..>276817)
                     /locus_tag="KLLA0_C03091g"
                     /db_xref="GeneID:2892223"
     mRNA            complement(<276491..>276817)
                     /locus_tag="KLLA0_C03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452335.1"
                     /db_xref="GeneID:2892223"
     CDS             complement(276491..276817)
                     /locus_tag="KLLA0_C03091g"
                     /note="highly similar to uniprot|P32911 Saccharomyces
                     cerevisiae YNL244C SUI1 translation initiation factor
                     eIF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452335.1"
                     /db_xref="GeneID:2892223"
                     /db_xref="GOA:F2Z6F9"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:F2Z6F9"
                     /translation="MSIENLKSFDPFADTGDDETTSANYIHIRIQQRNGRKTLTTVQG
                     VPEEYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQGDQRAKVSEFMITQLGMQKKN
                     IKIHGF"
     gene            <277789..>279804
                     /locus_tag="KLLA0_C03113g"
                     /db_xref="GeneID:2892170"
     mRNA            <277789..>279804
                     /locus_tag="KLLA0_C03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452336.1"
                     /db_xref="GeneID:2892170"
     CDS             277789..279804
                     /locus_tag="KLLA0_C03113g"
                     /note="uniprot|Q707Z3 Kluyveromyces lactis KLLA0C03113g
                     Sla2 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452336.1"
                     /db_xref="GeneID:2892170"
                     /db_xref="GOA:F2Z654"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:F2Z654"
                     /translation="MSREEQTLEKSIKKALSGGDVAPKRKHVRACIVYTWDHKSSKTF
                     FNLLKLQPYATDELQLFKALVLLHKVLQEGHPSALVEGIRNIDWIESLSRIFSVDSDD
                     GSKYGSSRMRYIGDEYAKAIGEYVFFLVEKLQFHKSHKGFNGIFEYEEYVSLVSVSDP
                     NEGYETVLDLMNLEDVADNLQKLIFAGISNRKSGFGSFSSGLDCRGAVLIPLVSETYG
                     IFKFVTSMMKALYKQMGDYDALSGLFDRYTEQCARLNEFYFDCNTVQPLKNLITIPTL
                     PSDPMSRIIDDEDDAEVNDVVFEKRSKSSVSSLPSRTPTRENLRDPSPVHEAPPVARP
                     AEVRSLSQPAAPVVPIATGVVMPVVTGYSQPPLQVVPTGAEFWSIPSTSAPTRSVVAS
                     HDDLLIEQQKQQQIQQQQYALQLEHQKQLQLQQEQQALLQQRIQQQEMEKEALIQQKT
                     ASLQNDIMSFKNQYERDQVMLEQYDKRVQKLESELESVKEFKEKYQSLAKLYSQLRQE
                     HLNILKKMKKTQDDLAEAESEVKKLKSSALSNVGIRNNNKGESEREEAKDRSGMILKS
                     LVESSIKSLQDPIASLDVSDLATDLSNAFIDGDINTIVNILPEFVSLLLRCPQEMQTI
                     AEDFLRCLSSAKQTDSVINANIAFQEKLKRLGEIRQYSYRYGDSDEV"
     gene            complement(<279869..>280555)
                     /locus_tag="KLLA0_C03135g"
                     /db_xref="GeneID:2892130"
     mRNA            complement(<279869..>280555)
                     /locus_tag="KLLA0_C03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452337.1"
                     /db_xref="GeneID:2892130"
     CDS             complement(279869..280555)
                     /locus_tag="KLLA0_C03135g"
                     /note="highly similar to uniprot|Q9HG12 Kluyveromyces
                     lactis KLLA0B14553g HMRA1 Mating-type protein A1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452337.1"
                     /db_xref="GeneID:2892130"
                     /db_xref="GOA:Q9HG12"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /translation="MCDNDMADIQSKLSSFCEEIRALALKEGYNLEGDKSPSSKPYFM
                     SWPKEIDVNHPNFAFFTKLQFQYDKSLETILNSCYLQELQLDPTRIIETLQQHFNNSI
                     LRYADIENISDVKDESPMSFDTEHECTDTSEDISDKSEISSTNSDNPIQNCYPTYKRS
                     FIKHESRGILEKIFKVKQCPNTSERLYIAQKLDLTPSQVRIWFTNKRMRAKKHTTGKG
                     TKRKSKKYPS"
     gene            <281410..>282183
                     /locus_tag="KLLA0_C03157g"
                     /db_xref="GeneID:2892068"
     mRNA            <281410..>282183
                     /locus_tag="KLLA0_C03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452338.1"
                     /db_xref="GeneID:2892068"
     CDS             281410..282183
                     /locus_tag="KLLA0_C03157g"
                     /note="highly similar to uniprot|Q9HG13 Kluyveromyces
                     lactis KLLA0B14575g HMRA2 Mating-type protein A2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452338.1"
                     /db_xref="GeneID:2892068"
                     /db_xref="GOA:Q9HG13"
                     /translation="MANSTLRRTTFFKLTTTEDEDTIPKLLQPNNNSVAFPNLKRTGK
                     AFTNDTIKENTKKYTRPRNQFVLMRTLFNRRVNNHILQYYNKSKLEKKMFTLTSKITS
                     ELWNESSPDLKSYFSLLATLEENWHKYTHYCSWDRNSAQTLSMEPIELSQVRPRLISS
                     LTVGAGSSVSTYTLRELLLVRKIKSRKRKTTTLTQDSSPTTKFKYKFKKQPKTKMNSN
                     LSKLRFKSKQPPTPPEENSNVFKKRYTSENRIIEDLFLM"
     gene            complement(<282251..>286687)
                     /locus_tag="KLLA0_C03179g"
                     /db_xref="GeneID:2892005"
     mRNA            complement(<282251..>286687)
                     /locus_tag="KLLA0_C03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452339.1"
                     /db_xref="GeneID:2892005"
     CDS             complement(282251..286687)
                     /locus_tag="KLLA0_C03179g"
                     /note="weakly similar to uniprot|P39526 Saccharomyces
                     cerevisiae YJL207C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452339.1"
                     /db_xref="GeneID:2892005"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CUQ0"
                     /translation="MGDTYVSLTERLASSEGKRATFINWITESLSCKTLNTADVLDDT
                     VEFLRSIIVAEDRDVVEYESKVISYQLSNLCVLCLKDLYQEKPGKVYDFAGFLCNILC
                     ENYEEVVQGPALKKRFKKHKSTHLYSVVKDYAITILCHLYACFSEDLHSLSAMIIPVL
                     FKDLKKVLEKPKYFNSNYAIFLMRLFQTISMYNSNNAIDDHYHQKYLKLVKDVFSDIS
                     DERVDYPSDFVSSLVENLTGYFESNYFVKAHKNDFLDVMRSNINSILTVCVKCPKWRI
                     AIAESLAKILGYYVSVDLMEPKVACEFYGNLFCSLNFKAGRIAILESLHQFMFVNFTR
                     NTKFLMGDKYLSLFQCFVECLCRCGIVISIEDIELFNLVHNQTLPFLTDSARTSVIDE
                     IFNAADRYILSDNLEQTQSILGLLSVFFRDLPANVIADRGLGEKIQASLLKVSAVENL
                     TVRINSVYCLQLFLHSVPYKIPGVVDELLEKLSSQFQIEKGFSFAGNHGICLLISSII
                     TSRDPDFVSFDLIMRVTAFAVGTLKSNSLSTKKVLYEKELLCWILLTGALCFQDEKYI
                     KTHSPQLFIFWRNIFTHSAVYHTEDELMKNIEIRNHALSCMISFLRSSVLNEELSKQV
                     FYLISKCLNFKHSVTAVSGSMKELLARYEHRMYQVFLLICPYVHKDVSTSALLQALKN
                     FSNPVNCFEDGCLHVSAPQKAEEVARFPAVGRFSDVLTCSESADYGVSTFVKSVQSFG
                     TSKPCLLEEAWEKPVVTSRSFDYNHVILNLSPPVPYSIALIDVSLELFSLCFPFTSQS
                     VQRSLIETLISNVLTNSHTRHKYSVVKANVLFAMYMALVEVDRCKLGVHCTIGELIIN
                     VLDECSFSDDDILYDLKGRCFGFVCAAVKRTGDEKFSKSLINVSIQRIVSDVNPISRG
                     LNLFIICNILNEDPGCSEFAVVLDIVKKFISDPHPVINVSGLKCLFVLLKKHNICDIR
                     LAGELLELISVNLFCNNYGPFSTLSFGNNYCQKFNPGIVICFIVSALVAMLGPGVLGF
                     DDSKRSLLKGIILALQFSPFDGVQTSSLKICETLSLFKLNEFFCLKLSLNVVKSRILS
                     LLRQNVGSGYLALYDDRSSAGYCSSESFTVSVQYLCELAKLQVYDIYIDASLSQLCWG
                     ALLVFPKSRLLRSYLEGWCMFQVKNSVNVFKVLIRLFDMCFAEYMSLMYYRGREEHIF
                     LDDNFLFEEEQDISVGCFQESAVKESVGSFSRQFIVELMSGCVKLLVGSKKALELLPE
                     MSAIIKVCFFCCSSEVAWLQISALGLLKCILNVYGEMVDKEDESSFVLEQYSAVLSGA
                     VLPIFMKPSYPKVICEGIDVCAEIVGCGLVPYSDDDRVVNVLVESLLEIAGNKTEIKV
                     GCSTFQLTKRQQEVKHSILKGWGILECKSYQNKNEELEKFVKEYLNVLVPLWIITIRE
                     LHSPVWLKIVDSLCAVQSQDPSIINNFDLEGFVFVMFGEILP"
     gene            complement(<286973..>288925)
                     /locus_tag="KLLA0_C03201g"
                     /db_xref="GeneID:2892374"
     mRNA            complement(<286973..>288925)
                     /locus_tag="KLLA0_C03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452340.1"
                     /db_xref="GeneID:2892374"
     CDS             complement(286973..288925)
                     /locus_tag="KLLA0_C03201g"
                     /note="similar to uniprot|P39529 Saccharomyces cerevisiae
                     YJL206C and some similarities with YIL130W uniprot|P40467
                     Saccharomyces cerevisiae YIL130W ASG1 Proposed
                     transcriptional activator member of the Gal4p family of
                     zinc cluster proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452340.1"
                     /db_xref="GeneID:2892374"
                     /db_xref="GOA:Q6CUP9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP9"
                     /translation="MISLTLPTDIPNVSVLATEPSTNQLEPVRHKVKHACSSCKERKV
                     RCDGQSPCASCINARVKCEYVMNMKPLKKKRKVSFIRSNLSKNELKGGSSVISSQNAQ
                     GVDYKKVFHSLFPDVDLSQSNLCTESLISIVKSSNECPQTQVPSSRRKLILPPKQIAL
                     TLISKSWDSACLLFRFYHRPTFIKVVESLYTVKNFEYSEKQKRFLPLVYSVIAVGALF
                     CKSYAETTDHKQMMEFFQDEGHKYFIEAKCLLDPINSQDVESLQAIFMLTIFLQCSAN
                     LSSGYTYIGIALRTAIKQNFHRKTSLQNLNLLEQETIKKLFWTIYKTDIYMNCILGLP
                     NSLDESLIDQEFPSDIDDDRILENRLLVQPSGKLSSVGMNNEHTKLILIMNNAHKILY
                     PMSLTVTSISHSEISKLEGELSNWLERLPFQLKPEFSPTSEKLAPYLKPNRYLHLDYL
                     HAEIMLYRPFIHYLVLDSEEFPNYQFHIHMANKCINTARKVIRLAVEMDQQKVLNAVY
                     WFSVHTIFFSVACLLYFMHQMKLKGCNLSSPNTEKDCRDGFNLLLQLKNVSLASSKTF
                     EVLKSLFEKLNQKTMELSDTVLPNIIAKQKEHELEAFTKISDLFMENEIDENLLEYQN
                     VALPDPTEFDNDFLNKILSQFSSDLS"
     gene            <295057..>295449
                     /locus_tag="KLLA0_C03256g"
                     /db_xref="GeneID:2891803"
     mRNA            <295057..>295449
                     /locus_tag="KLLA0_C03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452343.1"
                     /db_xref="GeneID:2891803"
     CDS             295057..295449
                     /locus_tag="KLLA0_C03256g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452343.1"
                     /db_xref="GeneID:2891803"
                     /db_xref="InterPro:IPR013924"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP6"
                     /translation="METTATFLPKSVQKQCQAHLVPCKIRYTGQTDELEEQFIMDKQV
                     ISPLHENRNVTYIRGRKVIGEQVVFDDRTTYIMSTREDDSGNLLIEPTYKVTEIFNYE
                     REGNEERLTDEISKFIECRELDSLIHEG"
     gene            <295796..>296806
                     /locus_tag="KLLA0_C03278g"
                     /db_xref="GeneID:2892197"
     mRNA            <295796..>296806
                     /locus_tag="KLLA0_C03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452344.1"
                     /db_xref="GeneID:2892197"
     CDS             295796..296806
                     /locus_tag="KLLA0_C03278g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452344.1"
                     /db_xref="GeneID:2892197"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP5"
                     /translation="MALLKRSITWDSDHSRVKVLKCLFENSAPLNFEKFLENIPHEVL
                     LMLLDEITSKDRISLSCTSKAIRLVLRPYVFSSAKCPWEELLDVDHWSVDSTILNLIE
                     SLRISTSCSKNEWTYPFHELFTCSTNRGLDNLSSLQLQSSGSTSFFKYCNVGTNLRRL
                     VINTTKEKSLFSLNHVRPFVNLETLEVSNFQIDDFEDEPDLCPYLKDLKLTNCTWEYP
                     FMIENFGRHKIVTLSLHYSNSFIISERFRVFLLKPGFTRLESLEITNTERNLKLTISL
                     EIMKLIQAIPTLRILKLKGNIYNETLNNFTKVDFDNCMKYLALDNVKVFYSSFFTEEQ
                     ES"
     gene            complement(<296848..>299328)
                     /locus_tag="KLLA0_C03300g"
                     /db_xref="GeneID:2892587"
     mRNA            complement(<296848..>299328)
                     /locus_tag="KLLA0_C03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452345.1"
                     /db_xref="GeneID:2892587"
     CDS             complement(296848..299328)
                     /locus_tag="KLLA0_C03300g"
                     /note="similar to uniprot|P39531 Saccharomyces cerevisiae
                     YJL204C RCY1 ReCYcling 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452345.1"
                     /db_xref="GeneID:2892587"
                     /db_xref="GOA:Q6CUP4"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP4"
                     /translation="MLNREQIVDLSRKTKRNIQIKRTFPEDADTLMPLGLRETSLLTM
                     DSAVTFADILKVSNIVKQIAFSLNTSDYLSFQCLNRNLYHIQLNGVTDKDYWLDKIKG
                     IGLIAEVGYLFDESTSLNACNIFDIHKKFDPKRPKNAYMLFYKFFQGFTDKLYYNDVT
                     AFFPDEYSDPVSQAKIIESLQKYIKSNDNDWSYYKKVEENLNTFKELFTTSIIRELDI
                     RFDKKEYFTCSKFVEVLLSLGHEMSAVDFFKSKNEFSDSVELPQTIFDEEDNLRYDQL
                     ELALNTFRDFLNDKITITDELFQDKYPVMVLYTENFVQDHLIPYFNKQISSNDDLDPN
                     NIRIMALPTICDHMSVYLVDKLTTSINAGESYKRFVAEFIQLYLEPEIQNFFDTMVSD
                     FTTKTEKAFKDYQEQTQLKQREKDEELFQSLKDRTLTNEELLDGKTNFLKSFTKIFKI
                     NNNASKSQADQDLEMSYTLQKINNKLQNITSLISLDLCYKVIQSCREHMEKIYYFKTI
                     KVFESVVKAECQEIYKTLIWQLSENHIKLGFETALQLLQDYDANETKLAKLSINGTSD
                     DDNKVEPLVQFTELINIGDIILQMISIFYNNELIAKGIINKNKDIFNDVVHTKKVFET
                     MLDDYVANGLNIGIDKLMDQVEFLFNTMQFPDDFNPDPKDILRREILPSKCAVACVEL
                     LSEHCFLLTGATDKGTIDVFQQEVGERFFDEAVKNIKKHLISEDGAIFLIADLNYYHD
                     FISKKLKQKNIVPYFAGLKSVGQLYLISGKDSKELGKLICDVGKFQGVFTQEEIYELV
                     QRRTDWLKVRKDVEKVMYGLGVSDCVIC"
     gene            <299405..>300562
                     /locus_tag="KLLA0_C03322g"
                     /db_xref="GeneID:2891870"
     mRNA            <299405..>300562
                     /locus_tag="KLLA0_C03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452346.1"
                     /db_xref="GeneID:2891870"
     CDS             299405..300562
                     /locus_tag="KLLA0_C03322g"
                     /note="similar to uniprot|P32524 Saccharomyces cerevisiae
                     YJL203W PRP21 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452346.1"
                     /db_xref="GeneID:2891870"
                     /db_xref="GOA:Q6CUP3"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR022030"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP3"
                     /translation="MNETDKGSKTSQATSLNMDSFDYLSVPDGVEVPADESQRRSIWK
                     TVEYVIRNGATYEEKLKSQDIGFTQPGNKYNDYYAFLLEHQRSRQDTLVSTKNELDRK
                     PSEPYPFVYSTYRNDIGQKDLELIKAAAHFCVINNDINYLEKLRERYAEDPRFAFLRL
                     DHSLNSVLTDFINQYEQILSEEYGPIVRLEGPLQSTILRRAFQKAEYMELQDELKQKM
                     KADIKTSRIRFSAYEWEKFELVGTVTISEEENLEQLPEALNFDILKATKLTNDVDIFK
                     TEDVSAAAQKRKRKNMNIRKAGETRLKKKSGLSNTSEHMLKCPITGRLVPEPDFDSHL
                     KILLSDPEFKEVRDKYESKHKLTNLSTSEVYENIKRIVSQDNANPVKRQKI"
     gene            301073..301162
                     /locus_tag="KLLA0_C03344r"
                     /db_xref="GeneID:2892683"
     tRNA            join(301073..301110,301126..301162)
                     /locus_tag="KLLA0_C03344r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2892683"
     gene            <301679..>303421
                     /locus_tag="KLLA0_C03388g"
                     /db_xref="GeneID:2891872"
     mRNA            <301679..>303421
                     /locus_tag="KLLA0_C03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452347.1"
                     /db_xref="GeneID:2891872"
     CDS             301679..303421
                     /locus_tag="KLLA0_C03388g"
                     /note="similar to uniprot|P32525 Saccharomyces cerevisiae
                     YJL201W ECM25 Non-essential protein of unknown function
                     promoter contains a consensus binding sequence for factor
                     Abf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452347.1"
                     /db_xref="GeneID:2891872"
                     /db_xref="GOA:Q6CUP2"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP2"
                     /translation="MDPINVNVNSIFYKSYSVDPESEYPIYVFDSTYLPSFNVVDDKQ
                     VYELLIDGLMDKVLTKLPAEPFSLVVFSSGFTTNDISWVYGIKLYSKVPKNVRSLIQK
                     TIVVHESFFVKTVFQVLKNAMRIKDLSNKDSNTDTVIHVPSLTALANHLDITLLRISL
                     NVYLYDYQFNEKITIPDQYTVNPGSIANRQYRQLIFDRIFKRLKVEGPKSELVFQKPG
                     SYKKINILLDVIERNHYVDLSQWDIYSLGSVFLNFLKNKSKPLIPLDLIPLPVTDDLE
                     YTKTTFKSITEYNGYYDLVRAVFPLFIDFLDNSDETKHNLKTLSKSLTPTLCKEKVSM
                     KSSDKLSIGTRFIRNLLSQFYLVIDELDSKNAPALPARIISSTTITPPELPKPRKASP
                     TRYTITSPTPPETTPAVRPRSSSVKHTPPSTELGVSASSSNVLQEPNALPVINLTEVP
                     TLEPPSPFINDSRNDSTNSFDSNGSMQRDRLRSPTRHLGKDIITDADTNGVDEIVGLT
                     DLLDQLTIEKNAKIQSFDKEMKKKKMIQQKSTNATRFSNEGYADISKGSKVSKLAALY
                     EERLQGLQAISDLK"
     gene            <303739..>307821
                     /locus_tag="KLLA0_C03410g"
                     /db_xref="GeneID:2891855"
     mRNA            <303739..>307821
                     /locus_tag="KLLA0_C03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452348.1"
                     /db_xref="GeneID:2891855"
     CDS             303739..307821
                     /locus_tag="KLLA0_C03410g"
                     /note="some similarities with uniprot|P25300 Saccharomyces
                     cerevisiae YCR038C BUD5 GTP/GDP exchange factor for Rsr1p
                     (Bud1p) required for both axial and bipolar budding
                     patterns"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452348.1"
                     /db_xref="GeneID:2891855"
                     /db_xref="GOA:Q6CUP1"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP1"
                     /translation="MSYNTTPLFGRQSFLTEDNEVELNISPTQPLDLRMSIIKAQKRT
                     SSQAIRISTIAQRLTNDSKHVSIQSTNTYTSNDTFLTANSREAQLQNDLSFQQSHPFT
                     VFTKSKEQLHDVDVTPVVKESTFIDVTTPKASKFELVPPEEELSNSPNPIKGLGLTHS
                     NHTPEFSYDVNQTVSDTEEGDTTHEFTFDSYGKFAHNGTLISAGDTITTTPPSTEGRE
                     HCINPRHTERKSPGFSLSEENLAYLFIIAVHSFNVSSLENKEDAAICISFEKGDVAFV
                     HSVDESGWGEVTLIKDMRKGWVPFNYFGDAVKEEKQPNDKNGLNTFIDTRKPLEQLLS
                     ATAKFILHPQDSQVNNSNEYSFRIEYINSIRDGVKTLLQETDCVSRSNAFVQKKPMIK
                     KMRKRLLAEWYNLMIKADSYKNTTNVSKIDTLVSLTFAVLRKAFLFYEIWSVEKRSYD
                     LEKTHQIINKSHLIQKDLRGEQNPLDDQTVAKSCTRKDIPCLKLPPSAFNRLKEIHDI
                     LFAYFALILGRLDMVEHSPANCEVLESIVHQVILLLRELLYISQSCSSIIHQKYKNQY
                     ENNLDYNLDPLLSLVSELVSSVKVFVTQTIKERIDDSRDLLMKDERYYYTDEGEHMIL
                     IVSQMTRFISNAVSGCNNYLKLIGDFQLSDERNYPDFAAIRITPDQFIKKCSSNLIKK
                     LDDKDQFRSFLQANKSKIISSSSYSKNLARFSTIRSGSQYNALSFGGTQMLLDYLPDK
                     KSFFRDSLFEPFAPDPQSEKEADQINDIDKMKDEIVFDKNENLAGISFRALVFMITDE
                     MRKSDDNLLYTFLLNYKSFGNSEELIELLISRFDSKSQAIKYTFGGKNGTFSSLASRV
                     RSRRRLVCKVIQLWMESFWDYGDDYKLIALLINFFNEEVTEHLPIEAKLLIEIAAKLY
                     TYSPKRLHKNPDPYIQLIPRNVNPVKKTNSGLSITSSASSSISSSTASTSFDEKFIEK
                     YELTKLPLSSHSTISLPVPILSLGNSSLLTKRNMSDIERIVLTYRDMVGFPNGAITTR
                     NFVTNYSLENLISEWMKLVSNSKNQAPPRNLIHNDLNISELNPLEVSKQISLIESTIF
                     LKITPPELLKCKYSSKNPDLSKSPNVNSIITLTNLLSNYVLESILMPGIPLKKRALRI
                     KSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSMLWGMLSNEDVELFEYLSKIIHP
                     NNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFNLFLQDLTFIDEGNPNFKNPD
                     SFRPNKLINIDKYFKIMNTVSMMQFFQVGYDLENKHNPSKKRDSFFSLTGTIDIDSKS
                     IKPVAELQEFILFEFWRTNTLYVKDSDRGYTLSLEMLPRN"
     gene            complement(<308036..>310423)
                     /locus_tag="KLLA0_C03432g"
                     /db_xref="GeneID:2892663"
     mRNA            complement(<308036..>310423)
                     /locus_tag="KLLA0_C03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452349.1"
                     /db_xref="GeneID:2892663"
     CDS             complement(308036..310423)
                     /locus_tag="KLLA0_C03432g"
                     /note="highly similar to uniprot|P39533 Saccharomyces
                     cerevisiae YJL200C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452349.1"
                     /db_xref="GeneID:2892663"
                     /db_xref="GOA:Q6CUP0"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q6CUP0"
                     /translation="MLSARRSVVNRARNLSTVIGNGVEPFLQAPADLKSRVPPYAKLI
                     SNLEVVKSLVNDAPLTLAEKILYSHLCDPHESITSSNLNDIRGQQYLKLNPDRVAMQD
                     ASAQMALLQFMTTGLPETAVPGSIHCDHLIVGKDGEAKDLVSSIATNQEVFDFLQSCS
                     SKYGIQFWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDA
                     LTGTPWELKAPKILGVKLTGHLSGWTSPKDVITKLAGILTVRGGTGFIVEYFGEGVGT
                     LSCTGMATICNMGAEIGATTSTFPYQEAHKRYLQATNRGFIASAADQALHQYNFLKAD
                     EGAEYDKVIEINLSELEPHVNGPFTPDLSTPISEFGEKTLKEDWPQRISAGLIGSCTN
                     SSYQDMTRAAELVRQASQAGLKPKIPFFVTPGSEQIRATLERDGLIKTFKDNGAIVLA
                     NACGPCIGQWDRQDVAKTSKEYNSIFTSFNRNFRARNDGNRNTMNFLTSPEMVTAMIY
                     SGDAQFNPMKDAIKLQNGEEFKFNPPKGEELPGAGFISGRKEFYPENDPKPNPSVEVK
                     VAPDSDRLQLLDPFEPWNGKELKTTVLLKVEGKCTTDHISAAGVWLKYKGHLENISYN
                     TLIGAQNKETGEVNKAYDLDGTAYGIPELMIKWKQDKRPWIVVAEHNYGEGSAREHAA
                     LSPRFLGGEIILVKSFARIHETNLKKQGMLPLTFADESDYDRISSGDVIETVNLADMI
                     AKYGDNGGTLDVKVTKRSGESFIIKTKHTMSKDQVEFFKAGSAINYIGTLRRSAA"
     gene            <311611..>314313
                     /locus_tag="KLLA0_C03454g"
                     /db_xref="GeneID:2892352"
     mRNA            <311611..>314313
                     /locus_tag="KLLA0_C03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452350.1"
                     /db_xref="GeneID:2892352"
     CDS             311611..314313
                     /locus_tag="KLLA0_C03454g"
                     /note="similar to uniprot|P25360 Saccharomyces cerevisiae
                     YCR037C PHO87 Low-affinity inorganic phosphate (Pi)
                     transporter involved in activation of PHO pathway
                     expression is independent of Pi concentration and Pho4p
                     activity contains 12 membrane-spanning segments and to
                     uniprot|P39535 Saccharomyces cerevisiae YJL198W PHO90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452350.1"
                     /db_xref="GeneID:2892352"
                     /db_xref="GOA:Q6CUN9"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN9"
                     /translation="MKFSHSLKYNAVPEWQDYYIDYSHLKKLIYSLQQQELDQLNGGS
                     DNKAGSSSKSNKLSSLKFWKKNGLEDDSDTGIVSGSGFGKNSGGDDDANVETIELGEY
                     PNTKKSSKRSKFGFDFDKRSSVSSERTIFNSQDVFLAKLTDEKRKIDDFYKRLEAKLY
                     SKFETLTKDLENAGFANLPNHLYNEAFEAQSLSGVATRVKSNETVFSGISRRLSVHSQ
                     RDHGDEEDSAIDEEEEEDDDDHVQDNTALLNYADYNLKSQKRSILKKNVIDLYVDLAQ
                     LKSFIELNRIGFSKISKKFDKVLSCSIKRDLIESGEFFHDAHIFLPDTITELDNKISH
                     LISYYAVITDQEDDLQTVKDELRSYLRDFIVWERNTVWKDLLGLESQQNDFTSVGRPA
                     VNGEISALENITHLEYYSYTLPKPINIKFTTIEKLSIPKLFFTMKALKIYVIIIFTII
                     LLAVRTFHDEAQHRCMALVECVALLWATEAIPLFVTAMLVPLLVVLFRVLKTDAGQVL
                     NAVDASSLILSKMWSSTIMVLLAGFTLAAALSKYNIAKVLASYLLTAAGVKPRNVLIV
                     VMGVVFFLSMWISNVAAPVLTYSLIQTVLRTLDSEAPFAKALVLGVALSANVGGMASP
                     ISSPQNVIAMDYLKAYDIGWGNFFAVAIPVSIVAVFLIWILLILTFKINTSTLKPYKP
                     IKEQFTLKQYYIIAVTLATILLWCVLSKIESAFGSAGQIAVIPIVLFFGTGLLTTHDI
                     NNFPWSIVILAMGGIALGAAVSSSGLLGTIAGSLQKRVMDYPTYAILCIFGIVMLVVG
                     TFVSHTVSAIIIIPLVQEIGDKLPSGNAAPILVFGCTLLASCGMGLASSGFPNVTAIS
                     MTDEVGNRYLTVNNFITRGVPASLLAFIVVITIGYGIMSSVLHG"
     gene            <314815..>318573
                     /locus_tag="KLLA0_C03476g"
                     /db_xref="GeneID:2892382"
     mRNA            <314815..>318573
                     /locus_tag="KLLA0_C03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452351.1"
                     /db_xref="GeneID:2892382"
     CDS             314815..318573
                     /locus_tag="KLLA0_C03476g"
                     /note="similar to uniprot|P39538 Saccharomyces cerevisiae
                     YJL197W UBP12 Ubiquitin-specific protease present in the
                     nucleus and cytoplasm that cleaves ubiquitin from
                     ubiquitinated proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452351.1"
                     /db_xref="GeneID:2892382"
                     /db_xref="GOA:Q6CUN8"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN8"
                     /translation="MTSEKRINKSDSECLKYSLHGTPSEGINLEQLISGSNADGIIST
                     SSIEENPTDLPSSESSIPSILYDAIPPIQDQRSIVANMWVRFNNEKKEGDLVFIIPER
                     WLALFQDPNIIDYRSIPSIDVASISLDYKNFILQDYTQHLYTAVPASMFTLLQQWYDL
                     TPNSKPISTFIVRDANNQLLVEYDRPRCRIHHLVAGNGNANIYPGSSRHSIDHKIPLM
                     FTMSRLATMKDVIQRCLEVFYAKEPHLDKSSLTHRIWYINERVADPKSTQTLLSNYVL
                     SPSAFLELQTKHEITKSMYSRQLKDYDSQIISLVVEVKQKSSNQHWPSNFFHYNKLNA
                     PSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAF
                     GHLLYSLFAPSYGQSTFYAPRNFKNTIGHYNSLFAGYGQQDSQEFLAFLLDGLHEDLN
                     RVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMDLFVGLYKSTLVC
                     PNCNHVSITFDPYNDLTLPLPIENYWSTKVTIFPQNSPPCTLEVELSKTSSYNDLKAY
                     VAQHANMHANDLIGAEIFNHQFYNNYESNVEADYLPISELISESDTVIFYEVHRGQDD
                     LVVPILNTRFEEGFKTPRLFGYPFFIALSQAEQFSYGAIRKKIEKCYQNFSGGFSEFP
                     IVGKTKMPDLSSMPLLEKRYSQCEIESIMPELEYINPEMSVDEFFQLKILKVDSVSSN
                     RRVTSFSGVSLGQTSDEPNSQIWIPPTASLITYNHSELIRKALPEAIEAAYYYSDMLS
                     NEDDIPNDQTVSDTANDLATKSYTSPNPEENVTSSAEALDGTLHLKVSPLLDVHNAII
                     CEWEAVKVINVFDEDNGVNWDHPAILENLSLSEVRKTRAQTEKSSITLDSCLRLFSQP
                     EILGSADSWYCPNCKQHTQASKQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPI
                     EGLDMSPYLSYKKEGENDVYDLIAVDNHYGGLGGGHYTAYCRNFIDGKWYYFDDSRVN
                     EVSPENSIAGSAYLLFYRRRTSGNQTLGNGKLRDIIDISRKEYEQKQDEFMTNVETLY
                     AATHTDTESEASDSDRSSVDEEMDSDNSDCENDKKSAFVDQSDISSNSLGMDNLTYSN
                     RPSKDNTIHTSKNANGSIESTLNNNELPEAEQTVTATERKGALQYNVSSLEVGSNIAK
                     LDTHDSSRRKLRLLDKIYLPDSSNLNSSTDSLSPCISHTESSSNNNES"
     gene            complement(<318733..>319734)
                     /locus_tag="KLLA0_C03498g"
                     /db_xref="GeneID:2891971"
     mRNA            complement(<318733..>319734)
                     /locus_tag="KLLA0_C03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452352.1"
                     /db_xref="GeneID:2891971"
     CDS             complement(318733..319734)
                     /locus_tag="KLLA0_C03498g"
                     /note="similar to uniprot|P25332 Saccharomyces cerevisiae
                     YCR036W RBK1 Putative ribokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452352.1"
                     /db_xref="GeneID:2891971"
                     /db_xref="GOA:Q6CUN7"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN7"
                     /translation="MGIVVVGSLNFDLVTYTERVPVAGETFVADSFETHAGGKGLNQC
                     ISLAKLTKPSDDQTSNIRMVGHVGSDSFGNQLLSKLQYHNINTEYVEEVDDESTGVAV
                     IIVEKAKGQNRIMITAGANSKTMYSDKQLEVMFQNNAKEFIVFQHEIPDPPSIMNWIK
                     ANRPNFEVVFNPSPFHALKVEDWKSVDILIVNEIEAIQIGESLYGEAVVENYKSRIAE
                     SFKLGYLELAQYYQSNLINTSNSSVVIITLGEFGAVFTSKQNVKGGHVPSIAVEKVVD
                     TTAAGDTFLGAVVSQLYQKRDLEKAIQFATVASSITITRKGAAETIPLYDEVINKIE"
     gene            <320298..>321437
                     /locus_tag="KLLA0_C03520g"
                     /db_xref="GeneID:2892140"
     mRNA            <320298..>321437
                     /locus_tag="KLLA0_C03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452353.1"
                     /db_xref="GeneID:2892140"
     CDS             320298..321437
                     /locus_tag="KLLA0_C03520g"
                     /note="similar to uniprot|P25359 Saccharomyces cerevisiae
                     YCR035C RRP43 Ribosomal RNA Processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452353.1"
                     /db_xref="GeneID:2892140"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN6"
                     /translation="MTESIDIHPIVFPPEVLARISPDISLQRHLSLETRPCSRGFEEF
                     RDVAINDGNISRYSTNCQNATTNNIIGSSLLRSGKTFVITSITGGIIEETLPANNTED
                     VGEEELMKLSEDTDRLCENSTIYPVVEVQRGRVGGPTDEEMITSEKLYKTLLHSGILK
                     KTALAVSCGIRRTEEDGSVTTIYSDELLDEEKKINEANNRKWSYVLYAKIQVFSRNGP
                     IYDLCWNSLISALKTVQLPRAFLDERAADLKIAIRTRGRSMTIRETYDILCDPHKSLP
                     LKLNEGELCYGSNYGIIDIEPLAQLAKNDDEMDVDKPTSVLLADIETEAEESSILSTL
                     SLTTNKNGQFKAATIIGGDSKITPEMIKRCIFLSKQRSKDIESKV"
     gene            complement(<321724..>322785)
                     /locus_tag="KLLA0_C03542g"
                     /db_xref="GeneID:2892081"
     mRNA            complement(<321724..>322785)
                     /locus_tag="KLLA0_C03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452354.1"
                     /db_xref="GeneID:2892081"
     CDS             complement(321724..322785)
                     /locus_tag="KLLA0_C03542g"
                     /note="similar to uniprot|P25358 Saccharomyces cerevisiae
                     YCR034W FEN1 Fatty acid elongase involved in sphingolipid
                     biosynthesis acts on fatty acids of up to 24 carbons in
                     length mutations have regulatory effects on 1
                     3-beta-glucan synthase vacuolar ATPase and the secretory
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452354.1"
                     /db_xref="GeneID:2892081"
                     /db_xref="GOA:Q6CUN5"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN5"
                     /translation="MSALSNTSQYLEDFVEKYPVVMDYVPTVDRPFFNISLWNNFDAI
                     VTKATDGKFIPSQFKFVSGELPLSELYPVLAAIATYYLVIFGGRAVLKNSEPFKLNFL
                     FQLHNLFLTLLSSTLLVLMIEQLTPMIIRHGLYYAICNYGAWTQPLVTLYYLNYITKF
                     IEFIDTIFLVLKHKKLTFLHTYHHGATALLCFTQLVGTTAISWVPISLNLGVHVVMYW
                     YYFLAARGIRVWWKEWVTRFQIIQFVVDICFIYFAVWQKVATDYFPSLPHCGSCVGST
                     TATFSGCAIISSYLFLFIAFYIEVYRRQGTKKSKVVKRVRGGVAAKVNEYVNVDLKNV
                     STPSPSPAPRKRNTRSKKA"
     gene            complement(<323354..>327553)
                     /locus_tag="KLLA0_C03564g"
                     /db_xref="GeneID:2891820"
     mRNA            complement(<323354..>327553)
                     /locus_tag="KLLA0_C03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452355.1"
                     /db_xref="GeneID:2891820"
     CDS             complement(323354..327553)
                     /locus_tag="KLLA0_C03564g"
                     /note="some similarities with uniprot|P25357 Saccharomyces
                     cerevisiae YCR033W SNT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452355.1"
                     /db_xref="GeneID:2891820"
                     /db_xref="GOA:Q6CUN4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN4"
                     /translation="MPIQHRIGEKKRYHYGGGASGRYSSSSSIGRNPGQTALSGERDR
                     GHSQESGNGTPNSSSGDGSPAHITGSRHSRYDPNANVSGRSSMSSRPGSRFNPNVTIS
                     DTVPTLVKRAGLNDNASNNNGSSGSRWAGSHSRYNPQISNNMQLSSGANVPLLGNGQL
                     IPATAPVSGVNSTHFYPSGSGAGSNPYSSYVTGKSQRPRSSFDTFPSNDNIHGMNVNG
                     SANNTNNNLSNITYKNSKPSSAKSSKNITSSVSGSRGSYWGSRNVRTGKYHSNSRYNG
                     FKKYSSDYGPHDMTDIPKSKKSFETSHSLGSSLINSVPQTTKKVEEQLHYDHKRIDIS
                     ADEYTGDSDAKSYTSVQDKHDRHDYGSELEDDSEIASNNNLKELAENHDKSFTLLTKK
                     NYDQQVSEGQPVVAISTVDKELPESDHKKPQVKEEEEAIEKVTLTEQPTVEEKEDIDE
                     DLDEDMAEEMSTIQESTGPLAEKNHIPNRDILPHPEPYPEPLVPIEKCIFPMLEPEMK
                     LWLLKNKPREERVKNQKYLLTKPIEYLFDYPFFAQAWIIHDQAVKPIITKNLTKIKRY
                     EYLRNLQLKDQFFKLQDIWEKKCDQMTELSESFHRSEPSGEQNKYENLQANVENANEA
                     FEQRPTSSRRRNRADFVDDNDIENVLLQIDPDYKHHQLAANIPAMTLNPVDKFACKFK
                     DVNNLVTDKDAWASRLLTDRIDSFTPYEHELFVEGYLTYPKKFGKVSHYMGGLRTPEE
                     CVLHYYRTKKKSKYKKLLLEKHKKRKASIGRRKKDKFDIKKKDSEDKVETEVPLPSTS
                     NVETPVSQTSVSETPVEQSVRTVEQVVPEVDHPPPAEVHPVSTLEQPPTLEQEPKSTE
                     EPPTLAKKVEPSLATFQEQPVINIEAKKESDTETENEATTDGDYNIKQQVMDSSVNVS
                     EPVYMVQEQVLLSNKPYEDIVPMLADMTSKSVINESVKNADHADIGFDNTESHLKPED
                     EVSSKHSLYDQSNVNSADQPMKKKLKQTEAVHKSSYWSVQEAKKFPELLREFGSNWTS
                     ISQKLGTKSTTMVKNYFQRKAEQNGWYALVEMGNNQLASSSVLSSGDQSTKPVAIAPA
                     PNVSSAIIVNSLPSPATVNKPAEKPSIEPLPLQTIPQQQKPAVGFFNDSKLSSIHKPS
                     FSLTGNEDSFSRLPTPTQGLPPQHSPVITSFSVPHTLPRLNTNKLPEIQPSISNAYSN
                     LGKPQTPSVHFSANASETHHAPVQSHTITSSRRSSIRSLLNDGEDSETKTNTILNTSP
                     TVVASPIGPSNLPILRPMRNASVSPPSIPPSKGSDSVVSKVIVQELSHNVPTKQSNDL
                     SKPMALAPTLPPAPSNPPPTVQAVPQSINFANDPLAALAAVASSSEAFGLMPTTNTSN
                     LNQQSPHQTQINSSTYNQQRQ"
     gene            <328910..>330481
                     /locus_tag="KLLA0_C03586g"
                     /db_xref="GeneID:2891808"
     mRNA            <328910..>330481
                     /locus_tag="KLLA0_C03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452356.1"
                     /db_xref="GeneID:2891808"
     CDS             328910..330481
                     /locus_tag="KLLA0_C03586g"
                     /note="similar to uniprot|P09119 Saccharomyces cerevisiae
                     YJL194W CDC6 Essential ATP-binding protein required for
                     DNA replication component of the pre-replicative complex
                     (pre-RC) which requires ORC to associate with chromatin
                     and is in turn required for Mcm2-7p DNA association
                     homologous to S. pombe Cdc18p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452356.1"
                     /db_xref="GeneID:2891808"
                     /db_xref="GOA:Q6CUN3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016314"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN3"
                     /translation="MMLNGRKRPFLAFESDGELGCGNSENMTPDAKRFSGLTTPPASP
                     EKKQIKKPLGIVSSNLTNINDEPYTIESDLKPKRLMFGSDPIFSKTKSLLQQSSVSNL
                     EQTWLATRKSEYDEIMHFFHNSISDRESADNSLYITGPPGTGKTAQLDLILRDKFHEI
                     ILDPKNKKVTKHDPELLNTSYFETQSDIFQSIAVAKVNCIALSKPECIFQKLLLEIVN
                     GKYKQQHHKACDSVKNLKSFCRSKPNTHFIFILDEMDKLIKQTTVLSSATKIILDLFL
                     LAKEPGINVTIIGIANSIDLKDRVLNRLNLQKELLPKVIHFHPYNSEQMFEIVRSKLS
                     IFPACFEIFQPMAIKFATTKCSGSTGDLRRLFDLLRSSVQLLELESLKGNSDKTRGRK
                     VTITHVAKAVSKYMNSATTKTRIAPLNIQQKIILCSLVHRERFDLNKCLCTVEEAYDY
                     YVKLLKRTDVMKPLSKAEFFESCYSLQSSGVALIEFTKKKLLPSGAAKTIKSTVIGTE
                     LQEEISKIDLLKRLL"
     gene            <330900..>331577
                     /locus_tag="KLLA0_C03608g"
                     /db_xref="GeneID:2891890"
     mRNA            <330900..>331577
                     /locus_tag="KLLA0_C03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452357.1"
                     /db_xref="GeneID:2891890"
     CDS             330900..331577
                     /locus_tag="KLLA0_C03608g"
                     /note="similar to uniprot|Q03390 Saccharomyces cerevisiae
                     YDR486C VPS60 vacuolar protein sorting (putative)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452357.1"
                     /db_xref="GeneID:2891890"
                     /db_xref="GOA:Q6CUN2"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN2"
                     /translation="MNRIFGYGNRKTHEQMMQDSSKAMGEAQSGLSGRISQLDTQISQ
                     LNFQLSTLQKKISNTKSSMGQKPLRQRALKLLNKRKQLEAMRDQLDSQSWSMSQVQMT
                     TDNLKNTMVTVNALKQTNQALKQQYSKINIDKIQDMQDEMMDLIEQGDELQDVLAMQN
                     QDIDDISESELDAELEALGEEDYLEELNLNDSETTGELPSYLNNAMPQFVDDEPLENP
                     PALETAN"
     gene            complement(<331750..>332733)
                     /locus_tag="KLLA0_C03630g"
                     /db_xref="GeneID:2891824"
     mRNA            complement(<331750..>332733)
                     /locus_tag="KLLA0_C03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452358.1"
                     /db_xref="GeneID:2891824"
     CDS             complement(331750..332733)
                     /locus_tag="KLLA0_C03630g"
                     /note="similar to uniprot|P27680 Saccharomyces cerevisiae
                     YOL096C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452358.1"
                     /db_xref="GeneID:2891824"
                     /db_xref="GOA:Q6CUN1"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN1"
                     /translation="MLSRTRILPYLGRYYSDIPKYNPAFINSSSSSNDAHPKPTHNPT
                     FDKSSGTSTSDDEIFHFQQLAPTWWDTWGSQRILHKMNLARLDFLQRTVRNQIKIKND
                     DVYIPGFNHHDHLPGYVTKAIDQDIFNEVQRGLGEKKFDALDIGCGGGILSESFARLP
                     FIQSVTAIDLTPECIEVAKAHAAKDPSIKDKIFYKFLPLEKVHGHYDIVTMFEMLEHV
                     DEPSEILRQAWSKLKPNGVIFLSTINRDPISWFTTIFMGEQILKVVPKGTHHVEKYIN
                     SSEIKQWFEDNVQGRYEILDTKGTMYLPLTGWVEHDCTNIGNYFMAIKKLN"
     gene            <333038..>335155
                     /locus_tag="KLLA0_C03652g"
                     /db_xref="GeneID:2892405"
     mRNA            <333038..>335155
                     /locus_tag="KLLA0_C03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452359.1"
                     /db_xref="GeneID:2892405"
     CDS             333038..335155
                     /locus_tag="KLLA0_C03652g"
                     /note="some similarities with uniprot|Q03388 Saccharomyces
                     cerevisiae YDR485C VPS72 Protein of unknown function
                     component of the Swr1p complex that incorporates Htz1p
                     into chromatin required for vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452359.1"
                     /db_xref="GeneID:2892405"
                     /db_xref="GOA:Q6CUN0"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:Q6CUN0"
                     /translation="MSSDSEPEELLMATRSRRANAGNKMQKLLQQELEDVQKQTSMLG
                     DDEINLLFQEDEEDEEFTFESKKRLEDEDMFSDSGDELSEASDADEGEKELQKQERQK
                     RKLIQKKKSRVPVIKRPKKAPVDKISKSTIDEINAESLLTESRRTSKRSAVVANKLKV
                     YENLTQAEKRRKIIQEKLRKQREKQSLKPLTQEERLKVAEETERINVSSLNKYKEQEL
                     SKKQTRLAMQLREKMKFKDGEHIIRWLSTQWEVSPLVELEDRAYWELYTSKRDKTKKK
                     YVRRRKAQIEEDNLREENKANTANENEKESSVDVINKSETIPNAENELTASSENSSRE
                     DSSCPPIVMSTPERENEIQEETSAKVDVENNTVTTDTPTLDKSLKEASSTESPTAALS
                     VETIESVERTQFGSQEDDCKQICTESPTLSSAESRSNDKIVLKEAADISNQNIETVKH
                     ITFAETDQISLINSEDPPIFVQSSMEATDLVESGELGEKVEVKEDSEEKVDDVLEELE
                     PTYEGPVQRVGKNFVILYTFPDHPIATQNSEVRKIILGKNWVLPSKARPDELETLMKI
                     TSSEEQEPLQSILIPDMSILDKFPRFGEFNKKTLRTVTIDTTKKDKIEIRTEAPTGVF
                     LPNGIRKNCLITNRECKYFDPKNGVPYSDVEAIKTIQLLQEYYDDNGEPIEPKFKWYG
                     FGRGGIYLDVHQKPASGVPEGFV"
     gene            complement(<335163..>337289)
                     /locus_tag="KLLA0_C03674g"
                     /db_xref="GeneID:2892288"
     mRNA            complement(<335163..>337289)
                     /locus_tag="KLLA0_C03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452360.1"
                     /db_xref="GeneID:2892288"
     CDS             complement(335163..337289)
                     /locus_tag="KLLA0_C03674g"
                     /note="similar to uniprot|Q05379 Saccharomyces cerevisiae
                     YOL095C HMI1 Mitochondrial inner membrane localized
                     ATP-dependent DNA helicase required for the maintenance of
                     the mitochondrial genome not required for mitochondrial
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452360.1"
                     /db_xref="GeneID:2892288"
                     /db_xref="GOA:Q6CUM9"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM9"
                     /translation="MMKRPTDSQNEIIQFPYIPASTLKVIAGPGSGKTYTLLCKVREL
                     IQTGQVKPREIIILSLTNKAVDNITDNLLGVFQELSDKPYTDHEVDDIVSQIGIYTIH
                     GLSNRIVTENMGIVNIIEENGWRGLVKLIPKDFWNKRNVNTANDRIITKKLQKLINEY
                     QIDTDNIDETIEKVTKLMKHSNVLTNDDLIKMAVEFLKEPNSEEDTAFTKFVLNEAKV
                     LIIDEFQDLYPGIFKLLKTLLGQKHFLIFGDINQSIYEFLGSNKEVMSELDRLRPDDK
                     KFTKYIHDNFRSTPEITAAANAVINQTVPVQIKRENIVEKHPSGVYPIKYNCEELIDE
                     LDFIVSEICQLVCSSAKLSDIGILARTNSHSKAIADHLSTFGIPVSKLTTQPDWMSDQ
                     RIRFMIDLLQVAVSVIEEATLPKDASFTMKTKSNFSVIVTLAALKGFGSNTLQKLHEN
                     ATATGASIWHFLTNTPVSKWGFTPAVTKKLENYLLAVSTLINDPPILEVEQPHILIDN
                     CSSVISKLDLPLFMCDSNSESGSFQVNLKEFYSAIKLSLLSKPQDLPTATWFLETFHD
                     QSIIYHNNQKSITQEQNTLGSVNVSTIHCAKGLEFPIVFLMGRTDYGNFPIETNALYV
                     AVTRARNLLYLMNVQHRSLSAFPDRQSSLLQNQAFWKYYNSDLKRPFHASNVNNAMKF
                     KKLQTKFGLMNRYFHSLSQSLKILRR"
     gene            complement(<337551..>339335)
                     /locus_tag="KLLA0_C03696g"
                     /db_xref="GeneID:2892413"
     mRNA            complement(<337551..>339335)
                     /locus_tag="KLLA0_C03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452361.1"
                     /db_xref="GeneID:2892413"
     CDS             complement(337551..339335)
                     /locus_tag="KLLA0_C03696g"
                     /note="similar to uniprot|P39904 Saccharomyces cerevisiae
                     YDR484W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452361.1"
                     /db_xref="GeneID:2892413"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM8"
                     /translation="MDVLSDLLELDATELQLPEDSPSGKDDNIDTYRAYVDSTLKKEY
                     QLHTEFLKEFDDLMEKNQSIRTSTETLIPSLKNYFAEFNNKLNDLTKDLDFVKGKFSE
                     FSSLLKSNSSKLKDISPIVNDLIISPEIIYQVLRGKIDQKWIDCIDYLNDKQEIFLKY
                     QEENKSERPNDFEQLNEILQILKAVSAERAKKYIVIRIKRLRDGHPVPAQRIQEELLQ
                     VREIYQMIYNTKSDIATELREAYINTMKWYYKTYFARYIRSLTILQYVQIDSQYALGQ
                     GLSNTSVSGSYSNYLYASGRTLFGAQTASHFNVTDDSINDYFQISKRLDLITQEDRTV
                     MVSQIAENNPIANYIEVGFKNLNLALLDNCTAEFMFLNEFFRLPTDKGDLIRTILLDI
                     FQPTFDNAMDFTHQLIDTSFDIFGVLISIRVAHRLQFEAQHRQIPCIDDYLDGQLILL
                     WPKFQKLVDFQCEQLRSVSITTNVARVRGAGTASDPLVTPHELTVQFSKFLLSLLKLS
                     LTHKELLDERAEPLFHSINRIRDDFETIMTKCSKKTKNADNFLTTNYMYIYNALQQSF
                     LRTDSEKEPLILSQTKTHLSQLLEAYSK"
     gene            complement(<339645..>340607)
                     /locus_tag="KLLA0_C03718g"
                     /db_xref="GeneID:2892422"
     mRNA            complement(<339645..>340607)
                     /locus_tag="KLLA0_C03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452362.1"
                     /db_xref="GeneID:2892422"
     CDS             complement(339645..340607)
                     /locus_tag="KLLA0_C03718g"
                     /note="highly similar to uniprot|P40339 Saccharomyces
                     cerevisiae YOL094C RFC4 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452362.1"
                     /db_xref="GeneID:2892422"
                     /db_xref="GOA:Q6CUM7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM7"
                     /translation="MSYATKLELPWVEKYRPHLLKDIVGNEDTVQRLQTIAADGNMPH
                     MIISGLPGIGKTTSIHCLAHELLGDAYSQAVLELNASDDRGIEVVRNQIKHFAQKKCT
                     LPAGKHKIIILDEADSMTSGAQQALRRTMELYSNTTRFAFACNQSNKIIEPLQSRCAI
                     LRYSKLTDEQVLKRLLEIIKLEDVQYTNDGLEAIIFTAEGDMRQAINNLQSTVAGFGL
                     VNGENVFQIVDSPHPLIVKRMLLSGSLDESLQYLKELWVKGYSAVDIVITCFRVMKNL
                     DEVKETVRLEMIKEIGFTHMRILEGVGTHLQLSGMLAKIQKLKS"
     gene            <341104..>342000
                     /locus_tag="KLLA0_C03740g"
                     /db_xref="GeneID:2892404"
     mRNA            <341104..>342000
                     /locus_tag="KLLA0_C03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452363.1"
                     /db_xref="GeneID:2892404"
     CDS             341104..342000
                     /locus_tag="KLLA0_C03740g"
                     /note="similar to uniprot|Q12400 Saccharomyces cerevisiae
                     YOL093W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452363.1"
                     /db_xref="GeneID:2892404"
                     /db_xref="GOA:Q6CUM6"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR016653"
                     /db_xref="InterPro:IPR028564"
                     /translation="MSDTSENSNAEIPADTSDVKDKPKPIVRAPQFPPPPEGISKSQW
                     KKICRKKRFEETRAEYAQIRKEKRNRAKLARREKLKEYTDRGEEIPEELKRPPKVNLN
                     QSDSGISIILDCSFDDLMNDREIVSLSTQVTRAYSSNKRENNYAKIKVTSFDKRLKQR
                     FDNDLSNSNYTKWKNFEFTADPTLPTENAVYLTADTEEKLDTLEPGTTYIVGGIVDKN
                     RHKNLCYNKAKELNIPTKRLPIGEFINLAGRKVLTTSHMVQLMLRYFDNKDWKEAFES
                     VLPPRKLEVDSTKEDSETASAE"
     gene            <342637..>343557
                     /locus_tag="KLLA0_C03762g"
                     /db_xref="GeneID:2892409"
     mRNA            <342637..>343557
                     /locus_tag="KLLA0_C03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452364.1"
                     /db_xref="GeneID:2892409"
     CDS             342637..343557
                     /locus_tag="KLLA0_C03762g"
                     /note="similar to uniprot|Q12010 YOL092W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452364.1"
                     /db_xref="GeneID:2892409"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM5"
                     /translation="MQLVPIVLNSQTVSGITGSISIACWIIVFVPQIYENFYRKSAEG
                     LSLMFVVLWLAGDIFNLLGAMLQHLLPTMIILAAYYTAADIILLIQCLFYGQDGPVDP
                     VHLSPANPINENVLQDVFHERQPLLTGHQHNERRVYVETSSTTSEATAPNADKPEDGK
                     LREQLLNIIIVSSVILAGFFSWYISYIKNPHQSNPELDLHMNWLAQSFGYLSAVLYLG
                     SRIPQILLNYQRKSCEGVSFLFFLFACLGNTTFIISVLSISFAPRYLLVNASWLIGSS
                     GTLIMDFIIFAQFFVYNKDTQPSADDLLTV"
     gene            <344101..>345969
                     /locus_tag="KLLA0_C03784g"
                     /db_xref="GeneID:2892275"
     mRNA            <344101..>345969
                     /locus_tag="KLLA0_C03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452365.1"
                     /db_xref="GeneID:2892275"
     CDS             344101..345969
                     /locus_tag="KLLA0_C03784g"
                     /note="weakly similar to uniprot|Q06704 Saccharomyces
                     cerevisiae YLR309C IMH1 Protein involved in vesicular
                     transport, mediates transport between an endosomal
                     compartment and the Golgi, contains a Golgi-localization
                     (GRIP) domain that interacts with activated Arl1p-GTP to
                     localize Imh1p to the Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452365.1"
                     /db_xref="GeneID:2892275"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM4"
                     /translation="MMEGSHTVRMNRPPELSEYSIKEDNSTSSSDNDYENQTADKPVS
                     HGIHGFSNILGFSRSKSSSSMNEHRGWNIFRRERTPTPANKLALDDKEDRAYDPKEVS
                     WWSKSIHRSRPNTEPTNNVNLFDEAISPEEKLLLSANDRLEAMLQDSFENVVDNSASP
                     TKKDDPIETSDSDTTDMDSLREASRIIKSKVQTIDNDSPETPPNEPAMKVHFKPSNHE
                     ISIYDYVYESPNAKNSKNIDLMMVDTNSVTFGKFQRIASCLKTGCDPLRSDQSIVALC
                     DYILTLSKECNAKLCTLESTKEQEDEDIKFKLAQTEDLKARLEDITNKYVKNTKEIDN
                     VKAENNNLKLKLKEVIEFNNICKQFFVEYKGQIALLSEQINNEVTKNETLKEKQERIS
                     KNYESEKSRNMELSESLAVSQGVLQDMEKKYLENINKTTGPEIVQDLSCSHAENLDLK
                     TKIEKITKGNSRLVKDCQRERKKVLDLRKQKGLTSKYVDGILAFQNYCIQFLTQYIMS
                     FKSAIDLADLLHVEQQLFQVSSFNPLSYRNLEYHSERDLLAHLQSFESDSNELFQNLS
                     NNILVQTFKKYTIEQNANKFLTSQLQVLRKESADKDRYIEAILQETNSLKLKLREK"
     gene            <346318..>348768
                     /locus_tag="KLLA0_C03806g"
                     /db_xref="GeneID:2892661"
     mRNA            <346318..>348768
                     /locus_tag="KLLA0_C03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452366.1"
                     /db_xref="GeneID:2892661"
     CDS             346318..348768
                     /locus_tag="KLLA0_C03806g"
                     /note="weakly similar to uniprot|Q7LGP7 Saccharomyces
                     cerevisiae YOL063C HUS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452366.1"
                     /db_xref="GeneID:2892661"
                     /db_xref="InterPro:IPR014839"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM3"
                     /translation="MELADYDKRRLNLFLKANGFFLRKLGPSEHVFMGGDNNNDAQGD
                     RYSWCKIPNAATKIDGLHLSERLEQIQEFEVDLSKGADSKYVEGIISRGSDMEPIWGN
                     GKICDPGEILLPNYYQIKVREIGSYPVHVFQHRSGCNNFIILQNRYALYISSVRTIKI
                     VDLTHLSTHNEILDAEQNLLIDDLFTNSSNEYTLSLMERLPSFMGVTVLVFGDSAGNV
                     SFYRESSFITSFSAVPDKAVLNLRLPSERTKVLSCDYVDQSSNLTIFSSKEVLTVLFF
                     DSKERTPISDEITFPASLSCITFLDCTVNGFIVICEDRTATKFTLHFPIKTLQSGQIY
                     YELLEDSKAIDSHGLCSHDESTLISISKDDFLSVPKYEFLTLSYNTSRNEETVRQIYQ
                     NSMILEVLPLYPSESNYLGFGASIAQIEVPIPNFSLLYRNDESLVNCPIELRYTAYQK
                     YGKHYHEVYVNKKVLNESFSQDPDCYISKRSHGYGDSKVGKVHVTSDRSDVRQTRIGW
                     EIVSDAELDFCKDYKDKFLSLQDQVETLRIERKGYPCFDLQFIDNIECSADLLRRIYF
                     HKTWKFTQIKSSELKSGEFSPSNIKDCFTARQLDIPILNRIDKDAVDEYVDKSIIKYL
                     RICDESRFNNDGPKFFSKTSGSNFIFEATSTFETSLLGTDPIIMNAFTRPIFPLNFNC
                     VDLSSNKIMVCHLREINCIVVANGSGLMFLYRLTEWRGIYAFRFEKILNILRIQDICD
                     DSDDEERSTFCETNRRFTQNNSDFHHTCNECRLVIKYPMVQSMDYIHMPETNAVLLYV
                     CTTACLVVYEISPNDFSR"
     gene            <349187..>351568
                     /locus_tag="KLLA0_C03828g"
                     /db_xref="GeneID:2892668"
     mRNA            <349187..>351568
                     /locus_tag="KLLA0_C03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452367.1"
                     /db_xref="GeneID:2892668"
     CDS             349187..351568
                     /locus_tag="KLLA0_C03828g"
                     /note="similar to uniprot|P54199 Saccharomyces cerevisiae
                     YDL028C MPS1 Dual-specificity kinase required for spindle
                     pole body (SPB) duplication and spindle checkpoint
                     function substrates include SPB proteins Spc42p Spc110p
                     and Spc98p mitotic exit network protein Mob1p and
                     checkpoint protein Mad1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452367.1"
                     /db_xref="GeneID:2892668"
                     /db_xref="GOA:Q6CUM2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016242"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM2"
                     /translation="MLGSDGVVRLNQSSFPTAESQHEYSRYQDAKTGLEEPTHSNPLH
                     FVRHFNGRNTTHTSNHTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEDNDISNSNSNHD
                     NKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSL
                     GPAKRNLSTSFNVDSPSESRVDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYH
                     DHNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELP
                     YISKVYFERQKEENRKTVLRKATSGTLALKREFTQYRRTQTARQPRRKHNFGTDKTSL
                     QDPLSSPLQKNQLVFQEVDRELANKREALKPLDVNNPSSSQEAKRPKYENDHVPEDYR
                     PPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNG
                     SFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSSDHKVYALKRVSFDEFD
                     ESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIP
                     FDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTV
                     NIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPP
                     YGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL
                     SGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL"
     gene            complement(<351772..>352947)
                     /locus_tag="KLLA0_C03850g"
                     /db_xref="GeneID:2892200"
     mRNA            complement(<351772..>352947)
                     /locus_tag="KLLA0_C03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452368.1"
                     /db_xref="GeneID:2892200"
     CDS             complement(351772..352947)
                     /locus_tag="KLLA0_C03850g"
                     /note="highly similar to uniprot|P32381 Saccharomyces
                     cerevisiae YDL029W ARP2 Essential component of the Arp2/3
                     complex which is a highly conserved actin nucleation
                     center required for the motility and integrity of actin
                     patches involved in endocytosis and membrane growth and
                     polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452368.1"
                     /db_xref="GeneID:2892200"
                     /db_xref="GOA:Q6CUM1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM1"
                     /translation="MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER
                     GHASTPLKDIMIGDEASEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTS
                     GGKVLLTEPPMNPIKNREQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEK
                     LCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPG
                     VGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPT
                     RLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWHEIGPAAMSKFGPR"
     gene            complement(<353385..>354515)
                     /locus_tag="KLLA0_C03872g"
                     /db_xref="GeneID:2892411"
     mRNA            complement(<353385..>354515)
                     /locus_tag="KLLA0_C03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452369.1"
                     /db_xref="GeneID:2892411"
     CDS             complement(353385..354515)
                     /locus_tag="KLLA0_C03872g"
                     /note="some similarities with uniprot|Q7LHC7 Saccharomyces
                     cerevisiae YDL027C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452369.1"
                     /db_xref="GeneID:2892411"
                     /db_xref="UniProtKB/TrEMBL:Q6CUM0"
                     /translation="MLPLNRFQLCVKSQIGLRPFQSLTKLKAYSPASHGCVKTGQFVN
                     LVPRFPLLAALNPRMNLLHYNQNILVSPVKMALRNFHSTPRNMVLGGRDPFRKSPFNN
                     PRFIFSISPFSFILSTLLFAGFITMIVFVLPFLLALLFPMVIFGIGWYQFKAFRTRKL
                     MQLLDHAFNQTKMKLSSTTRRELIMKQMVPKFKSFTQLKDFSGFPFKLSQAFTDKFQS
                     GEFPNADRFLSFVKSRLDESFYKNEHNIKSIVLGSDTAYVPGHMELVTNSYSFVSSVR
                     NNENIQAFSFMLLNMGSEGVRKPVALVYIVTKANPGDELLMFTGDYIDDSKLSPMVIY
                     VRALSPFSKCCFITDVGETGANAQYSVKRKKDGSKEYTYESD"
     gene            complement(<354889..>356316)
                     /locus_tag="KLLA0_C03894g"
                     /db_xref="GeneID:2892403"
     mRNA            complement(<354889..>356316)
                     /locus_tag="KLLA0_C03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452370.1"
                     /db_xref="GeneID:2892403"
     CDS             complement(354889..356316)
                     /locus_tag="KLLA0_C03894g"
                     /note="similar to uniprot|Q99186 Saccharomyces cerevisiae
                     YOL062C APM4 Clathrin associated protein medium subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452370.1"
                     /db_xref="GeneID:2892403"
                     /db_xref="GOA:Q6CUL9"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL9"
                     /translation="MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRS
                     PILTLGSTTFQHVIRESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDED
                     VLKDEFMLLYEILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSN
                     ILKAPKLSKRSSSSIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKS
                     FVDGSVDCVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAA
                     GSVILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIV
                     KNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWK
                     YNKYKGSTENTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQ
                     EPQLNYQPVKWIKYISHSGAYEIRY"
     gene            <357026..>358432
                     /locus_tag="KLLA0_C03916g"
                     /db_xref="GeneID:2892212"
     mRNA            <357026..>358432
                     /locus_tag="KLLA0_C03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452371.1"
                     /db_xref="GeneID:2892212"
     CDS             357026..358432
                     /locus_tag="KLLA0_C03916g"
                     /note="similar to uniprot|Q12265 Saccharomyces cerevisiae
                     YOL061W PRS5 5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452371.1"
                     /db_xref="GeneID:2892212"
                     /db_xref="GOA:Q6CUL8"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL8"
                     /translation="MNNIVVFAGSSHLDLVNKICENLGIERSQVKLGKFSNGETSISI
                     EESVREKDVYVIQSGCGHVNDNFMELLILINACKTADASRVTAVMPYFSYSRQPDIPY
                     TAKGAPLISKPKEKYTFESHPGTPIPQSMLTVEKPMSPNSSRLDAASSASSSGPQSLQ
                     SPTPLRPVELRPTSSTSSRIPMIPNGKAEHPSEQEQDSNADALFNASNSSYKLWVAQA
                     GTLIANLLTTSGADHVITMDLHDSQFQGFFDIPVDNLYCKPITQAYIQHHIPNYQDCV
                     VVSPDAGGAKRAAKIADVLELSFAMIHKERRSQLLKGPPGATLTSGGGVPVSTKPLIE
                     SLDIRTSLSNNGNNKYVNTTMLVGDVRNKECIIVDDLVDTSYTITRAAKLLKDQGATK
                     IYALITHGIFSGDALNRIGQSVIDKIIVTNSIPQDETIKVLGADRVEVLDVSNIFAEA
                     IRRIHNGESISILFEHGW"
     gene            complement(<358851..>360632)
                     /locus_tag="KLLA0_C03938g"
                     /db_xref="GeneID:2892407"
     mRNA            complement(<358851..>360632)
                     /locus_tag="KLLA0_C03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452372.1"
                     /db_xref="GeneID:2892407"
     CDS             complement(358851..360632)
                     /locus_tag="KLLA0_C03938g"
                     /note="some similarities with uniprot|Q12100 Saccharomyces
                     cerevisiae YDL025C Protein of unknown function potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452372.1"
                     /db_xref="GeneID:2892407"
                     /db_xref="GOA:Q6CUL7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL7"
                     /translation="MPDNQLSAESSHEIQSVKSASSAGTFFSKSSIKNKSRLALGRFF
                     RNANGNGSNGNDSGSEGSHNTDTRVSPQISGDLPPGLQTLKHTNHLHNPNNYQANGSS
                     QTRTPHPKDNKQRSFSNSNSVSSSPVTQNSHSNSVSGLSNTQSHPLLHNHTSHEHNKP
                     SLKVQHSTVTLDTSPQPNQHPAEYLQRQIEQFKLQPPPKLSSADNSHPKPHHKKSLRL
                     KRFFKLHEQSGEQKHVEQKQPTATAVVTDRKTTKLTLYDAEDAHELIQKYGIPGKLLG
                     EGVSGSVSVVKGSDNTLFAVKKFRPRAARETLLDYSKKVTSEFCVGSFLHHQNVIETL
                     DMLQEGEHFLVVMEYCQYDFFTLVMSDLMGKHEIACYFKQICNGVAYLHSQGLAHRDL
                     KLDNCVVNAQGILKLIDFGSATIFHYKYEDKIVKAKGIVGSDPYLAPELLVSQYYDPR
                     PVDVWSIAVMFYCMTLRRFPWKKPSEEVVSFKLFAQNPDDENDHTKGPYKILKLLPRH
                     SRPLIGRMLELSPHKRILMPEVLADPWFQNIHCCEVDNDGKLINPPTNHKHHLITEDE
                     LKELTEKREKEANERRAAELNHNTTQE"
     gene            complement(<361124..>363154)
                     /locus_tag="KLLA0_C03960g"
                     /db_xref="GeneID:2892077"
     mRNA            complement(<361124..>363154)
                     /locus_tag="KLLA0_C03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452373.1"
                     /db_xref="GeneID:2892077"
     CDS             complement(361124..363154)
                     /locus_tag="KLLA0_C03960g"
                     /note="similar to uniprot|Q12296 Saccharomyces cerevisiae
                     YOL060C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452373.1"
                     /db_xref="GeneID:2892077"
                     /db_xref="GOA:Q6CUL6"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL6"
                     /translation="MALGRYSALLFMVPRIFALPIFKRSVLSVLQKEAPPAEDEATFT
                     TFLVISMILVLLGGIFAGLTLGLMGQDEVYLKVMQTSGTASEKYHANRVLSLLNRGKH
                     WVLVTLLLSNVITNETLPIVLDRCLGGGWQAVVMSTVLIVIFGEIIPQSVCVRFGLQV
                     GSLFSPFVLFLMYAMYPIAYPIALLLDWLLGEDHGTIYKKSGLKTLVHLHRTMGMERL
                     TLDEVTIISAVLDLKEKKVSEIMTPIDAVFTLSADKILDEKTVEDIFNSGFSRIPIYL
                     PGQPTNYIGMLLVRVLISYDPDDCLPVSHFPLATLPETAPQTSCLNILNYFQEGKSHM
                     CVVSRDPGSSSGAIGLVTLEDVIEELIGEEIVDESDVFVDIHQRIMRDQPGPLSKRHI
                     TSYLHSLYTRKPSETQPLVNENAESSEASGKNETTNYLSVGATNFQPANPAANPLDIK
                     KPFVTIKRQSYGGMSRTPPRLSSEPISPATSVIETTSPIRREPDAISPVGSAPTTDEK
                     RKYVSHHNHRHRSNSSRRSNSAMVQQQQPRPTSNKSNDKLITTIPAQNDKDHQTVISS
                     SYKSTRNGIVESIITVKGVSKTIIEPASDWDDSKKVTINETENIAEEHNESSSIDSNT
                     TNTHAHPRSPSSRRGSRFSLWSSKSSQNDQDSNAKQLSKSQESFNLESRSKD"
     gene            <364969..>366288
                     /locus_tag="KLLA0_C04004g"
                     /db_xref="GeneID:2892022"
     mRNA            <364969..>366288
                     /locus_tag="KLLA0_C04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452375.1"
                     /db_xref="GeneID:2892022"
     CDS             364969..366288
                     /locus_tag="KLLA0_C04004g"
                     /note="highly similar to uniprot|Q00055 Saccharomyces
                     cerevisiae YDL022W GPD1 NAD-dependent glycerol-3-phosphate
                     dehydrogenase key enzyme of glycerol synthesis essential
                     for growth under osmotic stress expression regulated by
                     high-osmolarity glycerol response pathway homolog of
                     Gpd2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452375.1"
                     /db_xref="GeneID:2892022"
                     /db_xref="GOA:Q6CUL4"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL4"
                     /translation="MIPSSCVIGRSFGYNLIHQNISSKLRGIFKHYTKSSTANTIKIT
                     NTNTISNMSPASDRLKQTSSILSKSVEPQADAPFKVTVVGSGNWGTTIAKVVAENCAL
                     RPNLFVNRVDMWVFEENINGEKLTEIINTRHENVKYLPGIKLPSNLVANPDLVDAAKD
                     ADILVFNIPHQFLPRICSQLKGNVKPQARAISCLKGFDVGKDGVKLLSTYIKETLNIE
                     CGALSGANLAPEVAKENWSETTVAYQIPEDYKGPGKDVDHSLLKALFHRPYFHVNVIE
                     DVAGISVAGALKNVIALGCGYVEGLGWGNNASAAIQRVGLSEMIKFGRTFFPECKVET
                     YFQESAGVADLITTCAGGRNVRVAKHMAITGKSAEEAEKELLNGQSAQGIITTKEVHE
                     WLATCGKTAEFPLFEAIYQITYGNASMEQIPDMIEDFEGIDYNVKKH"
     gene            <367627..>368889
                     /locus_tag="KLLA0_C04037g"
                     /db_xref="GeneID:2892045"
     mRNA            <367627..>368889
                     /locus_tag="KLLA0_C04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452377.1"
                     /db_xref="GeneID:2892045"
     CDS             367627..368889
                     /locus_tag="KLLA0_C04037g"
                     /note="highly similar to uniprot|P22768 Saccharomyces
                     cerevisiae YOL058W ARG1 Arginosuccinate synthetase
                     catalyzes the formation of L-argininosuccinate from
                     citrulline and L-aspartate in the arginine biosynthesis
                     pathway potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452377.1"
                     /db_xref="GeneID:2892045"
                     /db_xref="GOA:Q6CUL2"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL2"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVVAFMANVGQEEDFE
                     AAEKKALLIGATKFVLVDCREEFVKDVLFPAVQVNAVYEDVYLLGTSLARPVIAKAQI
                     DVAKQEGCFAVSHGCTGKGNDQIRFELGFYALKPDVKVIAPWRDPTFFDRFAGRKDLL
                     AYAAEKNIPVFQTASKPWSTDENLAHISYEAGILEDPNQTPPNDMWKLITGPEDAPDQ
                     PQDLDIVFEKGLPVKLTYKDAASGKETTATSPLDIFLTSAKLARANGVGRIDIVENRY
                     INLKSRGCYEQAPLSVLRRAHVDLEGLTLDKEVRALRDQFVTPNYSRLLYNGSYFTPE
                     CEYIRSMIQPSQSTVNGTVRLRLYKGNIIVLGRYSETENLYNPDESSMDILTGFQPTD
                     TTGFIAIQAIRVKKYGESKAAKGEELTL"
     gene            <369331..>371340
                     /locus_tag="KLLA0_C04059g"
                     /db_xref="GeneID:2892314"
     mRNA            <369331..>371340
                     /locus_tag="KLLA0_C04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452378.1"
                     /db_xref="GeneID:2892314"
     CDS             369331..371340
                     /locus_tag="KLLA0_C04059g"
                     /note="similar to uniprot|Q08225 Saccharomyces cerevisiae
                     YOL057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452378.1"
                     /db_xref="GeneID:2892314"
                     /db_xref="GOA:Q6CUL1"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL1"
                     /translation="MSYADKGAPIQMLSAKKYFENLTPKEQHYAHFMSKASHAGTRIT
                     VRQVSPNSEKVFDTILNIHKGLKEYPKDEETTQYLEYASQFLSNLGEFKSFGDVKFIP
                     RCPESTFIKLGELAKVKVDPSLLKEIYHTGDASTLLGFTSEGHTSGYYKGEPISPNDL
                     KLLKEVFADFDVMPENISIEKVSHRLFVVHVASVEEEYAKGYPDRIEEDGIEVLFEFG
                     EHKREMKKIATHLEQAKFYAANEHQEKMLEYYIKYFKTGDSKLHKESQKVWVKDLSPQ
                     VETNIGFIETYREPSGIIGEYESLVAIQNKERTAKFTELVNKAPGYIKMLPWDPAFEK
                     PTFQPPDFTSIEVLTFTGSGIPAGINIPNYDDVRLNVGFKNVSLGNVLNSKTSDDKWT
                     FVQGDDVKAMSKYQSDSFEVQVGIHELLGHGSGKLLCELQDNTFNFDKSSPPLGLDGK
                     PVTTYYRKGETWGSKFGAVAGAYEECRAESIAMYLITNRQLLEVFGFKSKEDQDMIIY
                     TGFLQMCRAGLLALEYWDPKSKKWGQPHMQARFSIMKTLLRYSEDKNFLKLAYTKDDY
                     SDLHIELDKSLIETVGHAAIEDYLTHLHIYKATGDVENGVAYFQDRSDVDEELAKFRD
                     IVLAKKLPRKQFIQANTILSGDEITVKEYDESPIGMIQSFIERDL"
     gene            <371620..>372480
                     /locus_tag="KLLA0_C04081g"
                     /db_xref="GeneID:2891825"
     mRNA            <371620..>372480
                     /locus_tag="KLLA0_C04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452379.1"
                     /db_xref="GeneID:2891825"
     CDS             371620..372480
                     /locus_tag="KLLA0_C04081g"
                     /note="similar to uniprot|Q12326 Saccharomyces cerevisiae
                     YOL056W GPM3 and to YDL021W uniprot|Q12008 Saccharomyces
                     cerevisiae YDL021W GPM2, Homologs of Gpm1p
                     phosphoglycerate mutase which converts 3-phosphoglycerate
                     to 2-phosphoglycerate in glycolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452379.1"
                     /db_xref="GeneID:2891825"
                     /db_xref="GOA:Q6CUL0"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6CUL0"
                     /translation="MRLYVLRHGQSEVNQRNIFGGWVDVHLTEKGLDQARNSAILIKA
                     YCQSQGLELPKLGYTSRLIRTEETMNEILKEFGKQPEFRIVSGELPPQQTSDNGKFPV
                     YQSWRLNERHYGSWQGQSKHKMLEEYGEEQYMYIRRDYLGKPPKADLNREMVQDFDQG
                     DTGYEFKEPNRHVKYLEEEITHDELPNGESLCDVVQRLKPLLENMILPNLKERGDSLI
                     VGHGSTVRSLLKILEGISDTDIKEVNIPNAIPSVIELDDNFRFIRKFYLDPESAKVNA
                     ELVRQEGFKE"
     gene            complement(<372753..>374447)
                     /locus_tag="KLLA0_C04103g"
                     /db_xref="GeneID:2892309"
     mRNA            complement(<372753..>374447)
                     /locus_tag="KLLA0_C04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452380.1"
                     /db_xref="GeneID:2892309"
     CDS             complement(372753..374447)
                     /locus_tag="KLLA0_C04103g"
                     /note="weakly similar to uniprot|Q03465 Saccharomyces
                     cerevisiae YDL020C RPN4 Transcription factor that
                     stimulates expression of proteasome genes Rpn4p levels are
                     in turn regulated by the 26S proteasome in a negative
                     feedback control mechanism RPN4 is transcriptionally
                     regulated by various stress responses"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452380.1"
                     /db_xref="GeneID:2892309"
                     /db_xref="GOA:Q6CUK9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK9"
                     /translation="MSAADLELRRTLTDVVDDELRIHNTNPMSLDMGFGETHYDSFPQ
                     LTRSQVHSFYTGPNFSSGHSQHQYNMGQLMGHDLHLSDDDTASGVFNKYADPNLTTLD
                     KKSGCAVPATGPGPTATTGPAAIVKQVNLNLTPVQPTISLNTITPNPFLQSSARFPNA
                     QQIPQNNPNNHHNGMSNGRLNSVRGFNFQTRINNENGFEDEFLNEGYGDFNNMYEEDE
                     KLTAQATLWDDQNMAGYYWTNDQDTLSRFDQEFNFDDDLSDEEEEEEEEEEREYEENA
                     DGGKNNTELTDKILNDLQDDFSDSEEVSTKSNEESLYMDTQQRLNENQQRDLSQVTVP
                     RIESIKSSVLEENEKLEEEEEEGDDEGDAMFSEDDEDPLYEPALVSPRRKPSMVISQQ
                     NSNKQRQLLTINTRKSHEVSDNKLDPKSTNTTGSRTMTRNRGNHQRGKSVDALLSVDR
                     SYGSSNTHTHIHHSHNQNDEHICMVNNPVTNEPCMKKFSRPYDLIRHQKTIHASKKKI
                     FRCLICIQELGSEGYQRTFSRNDALSRHVKVKHNLQGTEAQRVIQYAKDNVEYQNS"
     gene            <375708..>376982
                     /locus_tag="KLLA0_C04125g"
                     /db_xref="GeneID:2892306"
     mRNA            <375708..>376982
                     /locus_tag="KLLA0_C04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452381.1"
                     /db_xref="GeneID:2892306"
     CDS             375708..376982
                     /locus_tag="KLLA0_C04125g"
                     /note="weakly similar to uniprot|P47124 Saccharomyces
                     cerevisiae YJR075W HOC1 Alpha-1 6-mannosyltransferase
                     involved in cell wall mannan biosynthesis subunit of a
                     Golgi-localized complex that also contains Anp1p Mnn9p
                     Mnn11p and Mnn10p identified as a suppressor of a cell
                     lysis sensitive pkc1-371 allele"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452381.1"
                     /db_xref="GeneID:2892306"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK8"
                     /translation="MQEKEKNVPRPVDLTFLSSHLPMKHLRPRSCLLLSIVSIYLFWI
                     LFHNIPAFQNRDKSVNTPTVPADWSTGSLRHRLLAHFNSQNEIPRDIWQSWKSKQNLD
                     VRFQENVRLWSSQSGFNYHFLDDDEIDEFVRTQFKLFPEIIQTWDTLPRKILKADYFR
                     YLVLLAKGGYYSDIDTSPSVNIDAWLTDGPLATLMAENDLSKTDVGVIIGIEEERDLG
                     TWRGLFNRRINLCQWTLASRPGHPLFVDVVAKIADLALYYYDPSTNVLTFPMGYKNLF
                     DVQPAYNMSKDSANWYEGIIEWTGPASFTDSFFRTINQWYIENFSDHIQGSSNEVLCN
                     NKHMCVLDPNKPLDLISKLENYPLGDNLLGIKLPTSPVGWENFTLLEYPLLYGDVALL
                     PKHFFNSLHTTDFKKGYVHHAFTGTWKWTQDP"
     gene            complement(<377185..>380907)
                     /locus_tag="KLLA0_C04147g"
                     /db_xref="GeneID:2891951"
     mRNA            complement(<377185..>380907)
                     /locus_tag="KLLA0_C04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452382.1"
                     /db_xref="GeneID:2891951"
     CDS             complement(377185..380907)
                     /locus_tag="KLLA0_C04147g"
                     /note="similar to uniprot|Q12451 Saccharomyces cerevisiae
                     YDL019C OSH2 Member of an oxysterol-binding protein family
                     with seven members in S. cerevisiae family members have
                     overlapping redundant functions in sterol metabolism and
                     collectively perform a function essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452382.1"
                     /db_xref="GeneID:2891951"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK7"
                     /translation="MNHKSQKAKTVSVSKPLLKLKLLDCLRQSNFQQLCHLIANEFQP
                     FDEPTVRSVFELILHYAVQVSPASLIKDIVQNWTTKGSSNSQLFIDVNKQDQDGNTPL
                     HLAAFQSRGDVVTVLMNHPDINDCILNDAHLQPIEMCKNLNIAQMMQVARANYVAEIA
                     QEFRQAFNNRDIDHLNSILSNPRNQELLDINGMEPETGDTVLHEFVKKRDILLCRWIL
                     DHGGDPFKRDSRGKLPIDLLKKVSSKEQNDKKNAIDLELKKMLEKAAREQSVIDVTNN
                     LHEPPTYKGYLRKWTNFAQGYKLRWFILSSDGIFSYYKDQADTSNACRGSLNMSTCYL
                     HLDSSEKLKFEIIGGSNGTIRWHLKGNHPIETNKWVWAIQSAIRFAKDREIMTKNGHA
                     VSSTHGSGSSGSQDKSLENKPPSSMPSLHSYDNRQQQPPHRRTTSSASSVSSAELVEL
                     NSNLTESGKDFVSKVRNSRNSNLSVSPLSSIADDQTASFSSDQDNKVDTLRNKSGSGK
                     GFRTNQSIDGEDIEDDAEDDEDDDEDDQGMLETLGGDDDEDVKMVYGPHAQEITILQR
                     AISIELSSLIELINENDPSEEHIKTARKSLGFITKNFSELNQMSQTRDKKLIKMLSKQ
                     RDINNLWIKSVKDLELELLEKGEKLVSLDIERKNLKKLLQKKLSEVNTADFSLDNKTV
                     GDKGNDSAKPLQEIVEFIENHESDEDIDSEVDEFFDAEDLDNEETSIASVDAPTSGNQ
                     TALSPDKENAVSIPSTQDDSNETLEKSQEEPSVTKSTVPEIVISPEGSTVDKGVTEES
                     VETELPLAVTAEQKTKAKVLLEEGSFLGYEDKLRQRLKLGKDDRPSVSLWSVLKSMVG
                     KDMTRMTLPVSFNEPTSLLQRVAEDLEYADLLNQAASFEDSTLRLLYVAIFTVSSYAS
                     TVKRVAKPFNPLLGETFEYSRPDKSYRFFTEQVSHHPPISATWTESPKWDFFGESFVD
                     SKFNGRSFDFKHLGLWYLTIRPDSNGKEELYTYKKPNNQVVGILLGNPQVDNYGDVKI
                     VNHNTGDYCMIHFKARGWRSSSAYEVKGEVYNAKGGKEWIFGGRWNESVSAKKVLKPN
                     SLEEMQVDELKHSVTHTSSGNSVGPKYDGTRFNVWHVNERPEFPFNLTKFAVTLNAPQ
                     PHLLPWLPPTDTRLRPDQRAMEEGRYDEAATEKHRVEERQRSVRKKREEKNITYQQRW
                     FKKEIHPVTKCDYWKFNGEYWKQRRDHKLADEGDIF"
     gene            complement(<381543..>383621)
                     /locus_tag="KLLA0_C04169g"
                     /db_xref="GeneID:2892029"
     mRNA            complement(<381543..>383621)
                     /locus_tag="KLLA0_C04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452383.1"
                     /db_xref="GeneID:2892029"
     CDS             complement(381543..383621)
                     /locus_tag="KLLA0_C04169g"
                     /note="similar to uniprot|P80235 YAR035W Saccharomyces
                     cerevisiae YAT1 Outer carnitine acetyltransferase
                     mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452383.1"
                     /db_xref="GeneID:2892029"
                     /db_xref="GOA:Q6CUK6"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK6"
                     /translation="MPSIKDTNQEVLPRLPIPPLEDTLKRYLARLEPLQDSRSYEKTK
                     RAVAESEQSLRIIDHELRKYDEHLAQREPMSSYIEQFWFDSYLEYDESVVLNLNPYFQ
                     LADDPTMNNVPKVSSRFSHFNRQVKRTSKLVVSMLKFVKAIRTGTLPTDNVRGKSMTM
                     DQYGKLFGSSRLPPSLNDSTLSSCHLQTDPTSHHVVIMYKSQFYWFDVLDINNEPIFQ
                     QPEELEWNLYSIIMDSEQNSLDQNLQNSCPMGVFTTENRRVWSNVRDYISKSEDQTNW
                     RNLKIIDSALFIICLDDSDLEGERDWIKSMICGTSKIDLNDKDEDKTKPSLGLQTGTC
                     TNRWYDKLQLIVDRGGRAGINFEHTGVDGHTVLRMTMDIYTDSIVNFAQGITRNVPKV
                     FEDDDDDRRANRSTKQANLITIPRKLEWSVDSFILSSMHFAETRASDLISQIEFEYLD
                     FKQFGAAHIKNQFKCSPDAFLQMCFQTAYYALYGKFETTYEPAMTKFFQNGRTEAIRT
                     VSDQSKSFVKSFFNTAVSNPDKIKLLQEACKQHSNVTRECSMGLGQDRHLYALYCIWK
                     KVFAKDPKVPLPQLFQDAGWSTLNTNVISTSNCGNPCLKNFGFGPVCSNGFGIGYIIR
                     NDTLSVVVSSRHRQTARFVELMQRFLLEINRIVRNEEQSSKTSMGSLQSDNMKYLLSG
                     YDYFDVSVTG"
     gene            <384198..>386591
                     /locus_tag="KLLA0_C04191g"
                     /db_xref="GeneID:2892038"
     mRNA            <384198..>386591
                     /locus_tag="KLLA0_C04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452384.1"
                     /db_xref="GeneID:2892038"
     CDS             384198..386591
                     /locus_tag="KLLA0_C04191g"
                     /note="weakly similar to uniprot|P27636 Saccharomyces
                     cerevisiae YAR019C CDC15 Protein kinase of the Mitotic
                     Exit Network that is localized to the spindle pole bodies
                     at late anaphase promotes mitotic exit by directly
                     switching on the kinase activity of Dbf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452384.1"
                     /db_xref="GeneID:2892038"
                     /db_xref="GOA:Q6CUK5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK5"
                     /translation="MDNSIAHGTYALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFE
                     DESELNEHMLEIDLLKNLRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLL
                     EDDTVNYVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGIVKLADFGVSTRINRMAMT
                     YAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEY
                     IPPLTLSAECKDFLSRCFQKNMFKRATAQELLAHIWLKKIQKPKSKINLAEYIEKDGK
                     WDVDFVLDSNTDMTPSPTKSPIQEDLAPADFRTLSVDQLFIEHSTDSIVVGLIKTLNE
                     LTAIKADATASGSLSNRTFEILKYDKQFNHTALKEKFIDNGGTPLLISLRFESVLAAF
                     FEKSVKLLIQCGILSHFDSLKNSRLTVLVSYCYRTLTSHDIWNQWCLSHKDKISACVN
                     AELTSTKYIEAEKLLIHVSMIKDFPLSVPKLMLFAKKYKHLQHCIFTSLNNSIKRTIV
                     NVPTSNLIHGKLFYEKSNFPVTIQEWLLEMITHVKRKATDPFVELCFHVCHLNNKSIE
                     LLMKDGHFLALTKTLLKSSNHSSLPWCLNLCSEYTKNLKAEDIGTMIDIGISSLPIAN
                     CLPNSIEILLNCFNVAQQIESPIVLHNESVTIGNHNIPFSLLVASFYQDNGRFDKYIT
                     KYTKLCSLPVGGKICSEVLKQERFIGRIHELFGTFKTSLIIQIDLLKFLKVLVIQTNE
                     QGKSSYFNKLETLAKFLSSNWKNTQTFTPIKQGHQKVGADSVLIHQLCQDIQNLIVM"
     gene            <386815..>387999
                     /locus_tag="KLLA0_C04213g"
                     /db_xref="GeneID:2892166"
     mRNA            <386815..>387999
                     /locus_tag="KLLA0_C04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452385.1"
                     /db_xref="GeneID:2892166"
     CDS             386815..387999
                     /locus_tag="KLLA0_C04213g"
                     /note="similar to uniprot|P22209 Saccharomyces cerevisiae
                     YAR018C KIN3 Nonessential protein kinase with unknown
                     cellular role"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452385.1"
                     /db_xref="GeneID:2892166"
                     /db_xref="GOA:Q6CUK4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK4"
                     /translation="MNRNERQPTYRLLEEIGRGSFGSVRKVVREADNKVMVRKEVRYG
                     HMNAKERQQLISECAILSQLKHDNIVEFFHWDHDAKSNTLFLYMEYCSKGDLSQMIRY
                     YKHQRKYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRD
                     LKPGNIFLTGYDDEFNQNASDVDYSKVIIKLGDFGLAKSLQASIEFATTYVGTPYYMS
                     PEVLRDQPYSPLSDIWSLGCILYELCSLHVPFQAKTYTELQGKVKAGYFEPLPHFYSK
                     NLQDIITRCIQVDFTKRPSTWSLLNDIQCRICRKALDLEKFERHLLNYEHELTQVGEM
                     LEQHATEMKRDFASAVDQRVREILNGTSKPAATPLITGTGPVTMPGRTPFRNANVNRN
                     YR"
     gene            complement(<388102..>389031)
                     /locus_tag="KLLA0_C04235g"
                     /db_xref="GeneID:2892265"
     mRNA            complement(<388102..>389031)
                     /locus_tag="KLLA0_C04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452386.1"
                     /db_xref="GeneID:2892265"
     CDS             complement(388102..389031)
                     /locus_tag="KLLA0_C04235g"
                     /note="highly similar to uniprot|P27616 Saccharomyces
                     cerevisiae YAR015W ADE1
                     N-succinyl-5-aminoimidazole-4-carboxamide ribotide
                     (SAICAR) synthetase required for 'de novo' purine
                     nucleotide biosynthesis red pigment accumulates in mutant
                     cells deprived of adenin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452386.1"
                     /db_xref="GeneID:2892265"
                     /db_xref="GOA:Q6CUK3"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK3"
                     /translation="MNTTSITQTNLDGILPLVARGKVRDIYQVDDQTLLFVATDRISA
                     YDVIMKNAIPEKGILLTKLSEFWFDFLKEDVRNHLKPLGPGETIFDKLPAKLSESKYK
                     VQLEGRSLLVQKHKLIPLEVIVRGFITGSAWKEYKKTGTVHGLPQPEGLLESQEFPSP
                     IFTPSTKAEQGEHDENISPEQAARLVGQDLCDRIEKLAIKLYTKCKDFAKSRGIIIAD
                     TKFEFGIDESTNEIILVDEVLTPDSSRFWNGTNFEVGKTQDSYDKQFLRNWLTDNKLA
                     GVDGVEMPQDIADRTRSKYIEAYEQITGQKWNI"
     gene            <389812..>391875
                     /locus_tag="KLLA0_C04257g"
                     /db_xref="GeneID:2892171"
     mRNA            <389812..>391875
                     /locus_tag="KLLA0_C04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452387.1"
                     /db_xref="GeneID:2892171"
     CDS             389812..391875
                     /locus_tag="KLLA0_C04257g"
                     /note="weakly similar to uniprot|P27637 Saccharomyces
                     cerevisiae YAR014C BUD14 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452387.1"
                     /db_xref="GeneID:2892171"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK2"
                     /translation="MMDLEYPKMSGLAGLGSGLRSRERSKPDLSILTDPTLVEDFDEI
                     MKQMRSLKKDEESLSVNASVVITPTEAHANDVNRQKVDYEGVPDLGDLQLEDEEEEEE
                     GEEELAQDIDNEHDTSFSSRHGNELQDSDYAYSDSDFEDNLEERLRSLETSSQRNSGE
                     HVSSVKGIVANDTSSAIDNNMVADRAKEARNGLEQRSYDDIDDDDDEAEEQDDNDEED
                     LNIGWNTNESDDSDELQPLNPPQELDPSKLYALYPFQGPDPSHCQLEQDEGCTLLNDQ
                     DSYWWLVKRCSDGKIGFAPAELLETFPERLARLNCWKNENISSHSISHKEDSNSSKES
                     NILNKEDSIEAVESPLNAYSKTNKSVSFNNVVSYAERYIDEIEQEPLEDDSGELNGAG
                     EYVHDVESRDGQDGHLHLGTDLGTHLTHVDEIHETLLNDHLSDDVSEVVSDAAFNVHE
                     MAPLMVQKNRPSKPALTDLLSEKQNDLKQVFQAPTMPVAAPRGTSQMTNSNSNCSIST
                     IGEYSPSSSDWTNDSPQLLSEKEFEKSNLNDQIPSSRAIQDISKIVSSQDAPDLNSLH
                     DEDSLQHSESLPKVTHNHQHSISTLNAVDINSSVGTEKTIDIDEENSILPDENTNAYS
                     TVPSSIASSCMDHEHNSPLISEVALHTSTGVVGDYHPVINSLYNPIFSKIDVMMDKIE
                     NAISN"
     gene            <392168..>394822
                     /locus_tag="KLLA0_C04279g"
                     /db_xref="GeneID:2892192"
     mRNA            <392168..>394822
                     /locus_tag="KLLA0_C04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452388.1"
                     /db_xref="GeneID:2892192"
     CDS             392168..394822
                     /locus_tag="KLLA0_C04279g"
                     /note="similar to uniprot|P38217 Saccharomyces cerevisiae
                     YBR017C KAP104 Transportin cytosolic karyopherin beta 2
                     involved in delivery of heterogeneous nuclear
                     ribonucleoproteins to the nucleoplasm binds rg-nuclear
                     localization signals on Nab2p and Hrp1p plays a role in
                     cell-cycle progression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452388.1"
                     /db_xref="GeneID:2892192"
                     /db_xref="GOA:Q6CUK1"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK1"
                     /translation="MPWSPDNEGLTQLCLTLQHAVSTNSDERQQALDALETFKLEPQF
                     ANYLCYILLHLEEMDQLRGTAGILLKNCILGGNIVDLGYVKSEIVRGLCLNNKFIVKI
                     TGIVIAALYSTYYRQHREDPQGLITLAQLIELARDNNEGSLKALSKMMEDGAQFFQLQ
                     WSNNQVPIGELVSLFLTLMVEGKTPVVRSESINCLNNIIPLQCQELSVNLDTLLTNIF
                     SLASSESSYLVKQQICQCLTLNLEFRPDKLMTHLQGIIQFMGHLIVNTDRNDSEEEKV
                     ALGACEFILALVSNTNVPDHLIQPYVQELVPLLLTNMVYSQEEIVVMEASNGDDADSE
                     DKDEDIKPVSAKIQKKNDDDNDEDSDDDENFDHEWNLRKCAASVLDILTGIFPKEVIE
                     TALPLLREHLTSDSWYIREATTLSLGAMAEGGMKYFDGQLPALIPFLVEQLKSPWFPV
                     RRMTCWTLSRFSIWILDDRTEFLMPVLNPIMETLLDKKKGVQEAAITAIATFIENSDP
                     DIVGTVLYEPLLDRFDECFRFYQKKNLIILYDAVSRLSEKCDLDEQAITKLLPHLLNK
                     WSALDDNDKELWPLLECLSYVSTSLGPRFAPMAMEVYNRAWNILCRCVDLEAKSQVDP
                     TIVVPEKDFIITSLDLIDGLVQGLGYDSKALLFPNHDTNMFSVILQCLQDHSHEVRQS
                     AYALLGDIAYYYERQLFTSDFSKRMVETIGNELIQNGENHEAVSTVNNAIWCLGLMAH
                     KIDLGPCIIEISRIVLDLFCSTQLVLPTSIMENLCITIARLAHFHPEIFTQPPFAGET
                     QWHKWCSIASELTDPEEKTVSYTGFIKIMNLMDFNAQGMPSDKTWELFFRGLQQDVDI
                     SIISEDLYALAMRLPDPWQQLLMNSGMF"
     gene            <395294..>396892
                     /locus_tag="KLLA0_C04301g"
                     /db_xref="GeneID:2892271"
     mRNA            <395294..>396892
                     /locus_tag="KLLA0_C04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452389.1"
                     /db_xref="GeneID:2892271"
     CDS             395294..396892
                     /locus_tag="KLLA0_C04301g"
                     /note="similar to uniprot|P32375 Saccharomyces cerevisiae
                     YIR027C DAL1 Allantoinase converts allantoin to allantoate
                     in the first step of allantoin degradation expression
                     sensitive to nitrogen catabolite repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452389.1"
                     /db_xref="GeneID:2892271"
                     /db_xref="GOA:Q6CUK0"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:Q6CUK0"
                     /translation="MIQAVASNHVAFHEGVAPGTIIYSVENGKILDVLQGRVATEREL
                     IGCGWNLESYDIVSPYLIMPGLVDAHVHLNEPGRTEWEGFETGTKAAVAGGVTTVIDM
                     PLNAIPPTTNIKNFKLKLDAAEGQLWCDVGFWGGLVPDNLADLKPLVEAGVRGFKGFL
                     IDSGVDEFPAIDKRYIQQALHLLQGEKTMVMFHAELQLPEPGHEHTIVDYNGELGTDS
                     NAENLLSATKSLSSVEPKYGQVSELIQHHEDHLDSITTPLEAAENEICDHSLSKIDPC
                     EYNSFLLSRPDHFETDAVALIVSCLRNSILQNGIEKSPFVHIVHLASMEALPILKRAK
                     DMGLPITAETCFHYLSLAAERVPKSKTFYKCCPPIRSEKNRKELWRALREGLITSVVS
                     DHSPCIPELKDLAKGDFFSAWGGIASVGLGLPLLYTNGASIAEIIQWCCENTSKQVGL
                     DHRKGFLRTGYDADFVIFDINTYQTVDNDKVYFKNKLTAYDGFKLKGLVRNTYVRGKL
                     AFELDGMGHNKNPPGQTILERRRT"
     gene            complement(<396979..>397698)
                     /locus_tag="KLLA0_C04323g"
                     /db_xref="GeneID:2891899"
     mRNA            complement(<396979..>397698)
                     /locus_tag="KLLA0_C04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452390.1"
                     /db_xref="GeneID:2891899"
     CDS             complement(396979..397698)
                     /locus_tag="KLLA0_C04323g"
                     /note="similar to uniprot|Q12403 Saccharomyces cerevisiae
                     YDL018C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452390.1"
                     /db_xref="GeneID:2891899"
                     /db_xref="GOA:Q6CUJ9"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ9"
                     /translation="MNRNRTLKGELSNKRTFTHKATFMYNLLNMKFTWLWVFSLVIVC
                     QSSPITVQLQKNGKECVYIDVDDSDCKISYYFAVQEGENNAFRVSYELWSPDDTEYPM
                     IYKDDEEQGQWTFPAKHTGEYALCVIGDEYPKIVDLDIVQICFDQIPKPADPRLIGET
                     IDSSLVRTLQDSVNIIEDQLQVLERNLKLYKSRAERNHHTVKSIASRLVTISICSIVL
                     VPTIAVLEIIIMKYILGKFKS"
     gene            <397899..>399326
                     /locus_tag="KLLA0_C04345g"
                     /db_xref="GeneID:2892051"
     mRNA            <397899..>399326
                     /locus_tag="KLLA0_C04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452391.1"
                     /db_xref="GeneID:2892051"
     CDS             397899..399326
                     /locus_tag="KLLA0_C04345g"
                     /note="similar to uniprot|P06243 Saccharomyces cerevisiae
                     YDL017W CDC7 DDK (Dbf4-dependent kinase) catalytic subunit
                     required for firing origins and replication fork
                     progression in mitosis through phosphorylation of Mcm2-7p
                     complexes and Cdc45p kinase activity correlates with
                     cyclical DBF4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452391.1"
                     /db_xref="GeneID:2892051"
                     /db_xref="GOA:Q6CUJ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ8"
                     /translation="MDDIPAEIIQEMDDLYDKVPQLSSRYKLLDKIGEGTFSSVYKAQ
                     DLSNVSGRLYPDHFWDKNSKHVAIKRIYVTSSPNRIENELKLLELLSNSNNVAPLCDA
                     IRYQDQVVVVLPWYPHEEFRHFYRDMPIKGIKKYMFELLSALKYVHSFGIIHRDVKPT
                     NFLYNPILGRGVLVDFGLAEENEELYLPDLNYRVYVNDQGEKVCNCSSPYANNKKTSH
                     LPLISIQNGQLNVRGANELSAAQSENLMKAELSKGYPKHETRRQRRANRAGTRGFRAP
                     EVLMKCSFQTQKIDIWSVGVILLSFISRRFPIFQSMDDIDAFLEICCIFGIKPMQEVA
                     KFHGLGLDMTKVPGFHSEGYPGGLQGFVRALLDKEVEEGTLPEYSIAFETLDYLTQFD
                     KQLTPSLGPDDEEDIDDKIRSYKQAVWDDHFWCFDLLAKCFELNSYKRPSASDLLEHL
                     WFKELNEDLLDRDQRREDHFTGVVE"
     gene            complement(<399631..>400590)
                     /locus_tag="KLLA0_C04367g"
                     /db_xref="GeneID:2892268"
     mRNA            complement(<399631..>400590)
                     /locus_tag="KLLA0_C04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452392.1"
                     /db_xref="GeneID:2892268"
     CDS             complement(399631..400590)
                     /locus_tag="KLLA0_C04367g"
                     /note="similar to uniprot|Q99190 Saccharomyces cerevisiae
                     YDL015C TSC13 ER protein involved in very long chain fatty
                     acid synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452392.1"
                     /db_xref="GeneID:2892268"
                     /db_xref="GOA:Q6CUJ7"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ7"
                     /translation="MSASSSIFIKSRSKSLKDVKLEVPTENTLTYQSVLQQISKSNHN
                     ISVNRLRLSYLKEGKQVAIGPSELNDVGKKNTFDSVNEWYVKDLGPQISWRLVFFIEY
                     LGPILIHSLVYLLSLNATVRDKFHSKNVPYNDFFNKFIYRLIMVHYLKREFETLFIHS
                     FSLETMPLFNLFKNSFHYWILNGLISLGYFGYGFPFANKTLYRVYSALKISDFRVLTA
                     LFGLSEMFNFYIHVALRRWGDEQKRNGVTKRVPLNSGLFKLLVAPNYTFESWAWMFFT
                     LLFKLNLFSVLFLVVSVVQMYLWAQKKNKKYGTKRAFLIPFLF"
     gene            <401421..>402428
                     /locus_tag="KLLA0_C04389g"
                     /db_xref="GeneID:2892085"
     mRNA            <401421..>402428
                     /locus_tag="KLLA0_C04389g"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_452393.1"
                     /db_xref="GeneID:2892085"
     CDS             401421..402428
                     /locus_tag="KLLA0_C04389g"
                     /note="similar to uniprot|P15646 Saccharomyces cerevisiae
                     YDL014W"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_452393.1"
                     /db_xref="GeneID:2892085"
                     /db_xref="GOA:Q6CUJ6"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ6"
                     /translation="MAFQAGSRGGRGGSRGGFGGGSRGGSRGGFGGGRGGFGGSRGGS
                     RGGFGGGRGGPRGGARGGSRGGFGGARGGSRGGPRGGARGGARGGARGGAKVVIEPHK
                     HAGVFIARGKEDLLVTKNIAPGESVYGEKRVSVEEPSTEEGVPPTKVEYRVWNPFRSK
                     LAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGLVYAVEFSHRPGRELI
                     SMAKKRPNVIPIIEDARHPQKYRMLIGMVDAVFADVAQPDQARIIALNSHMFLKDQGG
                     VVISIKANCIDSTVDAETVFAREVQKLREEKIKPLEQLTLEPYERDHCIVIGKYMRSG
                     L"
     gene            <403257..>405080
                     /locus_tag="KLLA0_C04411g"
                     /db_xref="GeneID:2891908"
     mRNA            <403257..>405080
                     /locus_tag="KLLA0_C04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452394.1"
                     /db_xref="GeneID:2891908"
     CDS             403257..405080
                     /locus_tag="KLLA0_C04411g"
                     /note="similar to uniprot|P32828 Saccharomyces cerevisiae
                     YDL013W HEX3 Ring finger protein involved in the DNA
                     damage response with possible recombination role
                     genetically identified by synthetic lethality with SGS1
                     (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
                     role interacts with Slx8p and Lin1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452394.1"
                     /db_xref="GeneID:2891908"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ5"
                     /translation="MTEQGCVIEIDSDPELDAQIREEYAPRRLIPDRRRNRPRDHLSR
                     FVSNAEDRNVAPIAPATDLPVSTDGEDLEITAEVSLRPDGPINDDAEYINLDNYRASN
                     NGTVVVDHREGDDDLMLVEERIQESGRPVLLQLPAGQTLQVDASWNELPVGRSFQNQV
                     YRNPNQLRRLRRHIDHATAMFMGGYNQSGTGDSDFSDNDADYIPPDIVNERNQYTMQT
                     RMREQRERQNQMQRLQRAADETIDSLDPDLRSLFFESQSLSQFREGLARFNFPPARLE
                     QLLGQYRDFRARAMQSWAEGRRTRSMSYQNRNSLRPQRTRSGTQQNHSRGSNGDSRDN
                     ALYQQMLFGMPDDDENMDGNNFTGTTQSLQRIISNTMNRRFGNLPFGVGPEFGFYEDG
                     DDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAP
                     LMSMTMENEGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVS
                     FEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKE
                     KNKLKNSQGPSHPDNYGPKKCPAEGCNSNLRKKGIMREVYF"
     gene            <405523..>406626
                     /locus_tag="KLLA0_C04433g"
                     /db_xref="GeneID:2892082"
     mRNA            <405523..>406626
                     /locus_tag="KLLA0_C04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452395.1"
                     /db_xref="GeneID:2892082"
     CDS             405523..406626
                     /locus_tag="KLLA0_C04433g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452395.1"
                     /db_xref="GeneID:2892082"
                     /db_xref="GOA:Q6CUJ4"
                     /db_xref="InterPro:IPR012404"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ4"
                     /translation="MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFE
                     QPVLQTLQMFIGEISLMFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAI
                     CDICGTTLMNLALTMIPVSIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFG
                     VFLVGYSGNVGVTVDVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEG
                     IYGASITLLTMLIASVTFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNF
                     FGITLTNSMNATVRSTIDTCRTLLVWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGA
                     ITIDKKRLPQWLTKDYPGDDRIINVIDEEVERF"
     gene            <408090..>409448
                     /locus_tag="KLLA0_C04455g"
                     /db_xref="GeneID:2891853"
     mRNA            <408090..>409448
                     /locus_tag="KLLA0_C04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452397.1"
                     /db_xref="GeneID:2891853"
     CDS             408090..409448
                     /locus_tag="KLLA0_C04455g"
                     /note="weakly similar to uniprot|P38277 Saccharomyces
                     cerevisiae YBR138C Cytoplasmic protein of unknown function
                     potentially phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452397.1"
                     /db_xref="GeneID:2891853"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ2"
                     /translation="MEELSRILEPLDTNSLSISGIHSVSADTVLSAKKESVSFDVGRD
                     KEWHKPQETLDHTPLKWRVQRDEFIFNSNSTPSRPGADDGIRFPKRDSSRKRTMGQRR
                     RLVLSGAGPQNMKSHSSLQTQMSKLDLLDDNRLTSFPIVPPPEPVVTKNCRHPTNEYR
                     MKIYSQERRISLNPRSHEIHDNSTNENELFLIEDYIPRETVAEINENVLHSGCKRVSI
                     SDLKSKYYKRKQLDHLPLRLKKSTAILPEVSEVTNESINVLGDIMQPKEFLNQDHYLR
                     DIVVASNLKHCVICEKPLYELSSRLHEMGKDYQEIVCLGCTSKYEEAARLLEDYEFET
                     TLDDTIDTGRNDSMDSMDFIEPTEVLVEPSAKRRKENQFSSQLINTLQVVQSKTDMIK
                     LANPFKQSSLSLIDVNTQLWFHTAKKKLRWRWRVSGLLPKFLTSSFKPSSSHGKHVQS
                     SG"
     gene            complement(<409543..>413304)
                     /locus_tag="KLLA0_C04477g"
                     /db_xref="GeneID:2892176"
     mRNA            complement(<409543..>413304)
                     /locus_tag="KLLA0_C04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452398.1"
                     /db_xref="GeneID:2892176"
     CDS             complement(409543..413304)
                     /locus_tag="KLLA0_C04477g"
                     /note="similar to uniprot|Q08234 Saccharomyces cerevisiae
                     YOL075C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452398.1"
                     /db_xref="GeneID:2892176"
                     /db_xref="GOA:Q6CUJ1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUJ1"
                     /translation="MLENELSFVSLTRVSLNVIELNIHAKDATIVNNVSFSLPNGQLM
                     AIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKADEKVTTAYLTQHDA
                     LAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVGDSINKGLSGG
                     EKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTIIMSIHQPR
                     SDILFALDQVCLLSKGFPMYCGAVVGMVEYFSSMGYTVPERCNPADYLIDICSVDNRT
                     EKSTLDSEGRWNMFASEWQERCSTKYDTSKETAVISVDPSPPSVSILQQTFILTKRNF
                     LLSSRDRLTLFAVQFEPVIVGIVVGWIFYKPDQTSESGLRTIAGALYIVGSIQGYLLL
                     LLETYRLSELDIKIYDRERSEGCVTAFSYLMARRLSNLVQEDILIPLLFAIITYFMFG
                     LEANAGRFFTYFGCTLVSHQTSVAVAYMAVSISRDFSKAGLVGNLTFTLQSMACGFFV
                     NAEKMPVYVRWTKYIAYLWYTFSALMSNTFSNFGCHQINGSEVCTGDQYIDTFGIPKN
                     WISVPIIITFCWAIGFYLVGLLFFQFKTVDVTLAKQVSTKKKNSNEEKDISVDTSNES
                     VIVEEKLSNESITEGSEISIDLQDISLSVRQIQLFEISKKKLIGHSHKDILCSVNASF
                     RPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFNQQPVMKSMFKSVCC
                     YVSQDDNHLLPNLTVYETLKYAARLRLSHHNESRIETRVRTLISDLGLKNCANTLVGN
                     DLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIELLKKLCQQGKTI
                     ILTIHQPRAEVFADFGNVLLLAKGGRVAFNGYPSAMIEYFNKEGFTCPQLTNIADYLL
                     DVISVNIQNYENEVSSKERVNALIEKWRVISSKDVRNVNPTMTHSEFTSLFAQHIRHH
                     ASVLVAYKVCLSRQFKVMTRNIDSCFARLAQVPGMAAILTIYFAPLKNNFTGVMNRLG
                     LTQQYTSLYFCGMLLNLAVYPAERDNFYQEFHDNIYGIGPFLCAYMTLEFPMAVLSAI
                     LFSVLTVMGIGLPRTAQMLFISMYCSFIITTCGEAWGIVVNTLFNRPGFVVNVVSIIL
                     SISSIMSGILSLNMPKFWKGLNYVSPVHYTSMILINYSFPDQMKFTCNDGGRNSDGSC
                     LFNNGRDVIDNYGLHVNTSVYLGVLAAVWVVYRIIPYLILKADLELFKR"
     gene            <413587..>414180
                     /locus_tag="KLLA0_C04510g"
                     /db_xref="GeneID:2892189"
     mRNA            <413587..>414180
                     /locus_tag="KLLA0_C04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452400.1"
                     /db_xref="GeneID:2892189"
     CDS             413587..414180
                     /locus_tag="KLLA0_C04510g"
                     /note="similar to uniprot|P48363 Saccharomyces cerevisiae
                     YGR078C PAC10 Part of the heteromeric co-chaperone
                     GimC/prefoldin complex which promotes efficient protein
                     folding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452400.1"
                     /db_xref="GeneID:2892189"
                     /db_xref="GOA:Q6CUI9"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI9"
                     /translation="MDTLFNSAKTNPRGIPEAPFVEKVEQYVKSPEDFDMCFSKFQEH
                     LSKYKYMQESKLANIKQLKSKIPDIENTLNMCALLKQKRETEVDEDDEEEDDSLLINY
                     QLNETLFSKASVNPKDPELKVGLWLGADVMLEYPLDEAIELLAQKLADAKQNLDISQQ
                     DVEFLRENITTMEVNCARLYNWDVQRRQQMKKEGSSG"
     gene            complement(<414275..>415111)
                     /locus_tag="KLLA0_C04532g"
                     /db_xref="GeneID:2892322"
     mRNA            complement(<414275..>415111)
                     /locus_tag="KLLA0_C04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452401.1"
                     /db_xref="GeneID:2892322"
     CDS             complement(414275..415111)
                     /locus_tag="KLLA0_C04532g"
                     /note="weakly similar to uniprot|Q08232 Saccharomyces
                     cerevisiae YOL073C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452401.1"
                     /db_xref="GeneID:2892322"
                     /db_xref="GOA:Q6CUI8"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI8"
                     /translation="MPSTNSVGVEIPTGLVQFPITKILMICCVGVALTASLFNMKYLF
                     LLQYDPFIVEYGQYWRYFTFQLGSLNESDVAIMTLIWYQFRSLERLFGSRKYLNIVIL
                     SWAYTTVVIFLISNLLNKLLPGIWWDQYTNGPLPVILCLTHFYKQYTPRLYEFNIIIN
                     QPFLLHSNTIVWKLTDQFFIHGLLFLAMVNQGATGLVIGLISWICAILMDNGLLPGTD
                     SFQLAPFKDSWNRSSSTLNRPSAVMTNDMTSEDLNEEEAEEPQDEPQRTLGVQFLDTF
                     RR"
     gene            <415462..>417156
                     /locus_tag="KLLA0_C04554g"
                     /db_xref="GeneID:2892331"
     mRNA            <415462..>417156
                     /locus_tag="KLLA0_C04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452402.1"
                     /db_xref="GeneID:2892331"
     CDS             415462..417156
                     /locus_tag="KLLA0_C04554g"
                     /note="similar to uniprot|Q756P6 Ashbya gossypii AER208C
                     AER208Cp and weakly similar to YGR077C uniprot|P53248
                     Saccharomyces cerevisiae YGR077C PEX8 Required for
                     peroxisome assembly peroxisome associated protein
                     containing a PTS1 signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452402.1"
                     /db_xref="GeneID:2892331"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI7"
                     /translation="MIETESINHLITALNGSSVISSTVGESQVLNNIVYYLPRIRDYQ
                     LLAQLIHASFHWKPQKLTIWQVFEASSAVMKWKLEISEPRLSIHKFVSLWKQELESCS
                     ALNIFQLATLAGLISCRQQLEVLQEQLFIDDSGTASEELKDIKFRHFMPYWNQYMNIS
                     KGDHRLIDDLCILYSMVHMQSDYVASNELLFQSLFNILMTYINNGDTEYHGPNAFAYK
                     HLNLICQTCEHSISNTHNRRLLRSKLEELCRIMGALSDKETLTGRKKYTDKYYINILF
                     IVVILLSGYKPSAEVVHEITMTLFYTSFILQDFGLDGFTKYQELIYSVCGRICQDFDI
                     FDQILKEMISKMQFNMDNKIYHSKLMFILEYLQLNLAELKIPDACYLEERIEPLVRPY
                     LDSSDVKLRESAHLVWLEVFNNETWKADVTNFKLKRLRLYLHDCFRQCSASLMTEKQL
                     IVIWKSILPTIRYLSNYDNDLIRDLIHSTYIRIINTENLQMKSTSIQCLIEQFHNVPD
                     EYLWDWLDACNELARTLPPLMKEHIITKLWEYISHSHNELAIRWWYDRIVPNLSRI"
     gene            complement(<417217..>419001)
                     /locus_tag="KLLA0_C04576g"
                     /db_xref="GeneID:2892335"
     mRNA            complement(<417217..>419001)
                     /locus_tag="KLLA0_C04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452403.1"
                     /db_xref="GeneID:2892335"
     CDS             complement(417217..419001)
                     /locus_tag="KLLA0_C04576g"
                     /note="highly similar to uniprot|Q06218 Saccharomyces
                     cerevisiae YLR276C DBP9 ATP-dependent RNA helicase of the
                     DEAD-box family involved in biogenesis of the 60S
                     ribosomal subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452403.1"
                     /db_xref="GeneID:2892335"
                     /db_xref="GOA:Q6CUI6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAQTSASQGYIDDSSSFDSFHLDSRLSQAIRSIGFKHPTLIQSS
                     AIPLALQEKRDIIAKASTGSGKTLAYLIPVIQTILDHKKADQNDEGATLGVILVPTRE
                     LAQQVLEVVEKLIVFCSQEIKCLNLSSGNVSGNLLKSLLTENPEILIATPAKLVDLLD
                     AQDVNIDRLKFLVIDEVDLVLTFGYQEDLTKISERLPLRKSLQTFLMSATLNDDIQHL
                     KQQFCRSPAILKLNDDEVNKDQTKLIQYYVKVGEFDKFLLCYVIFKLGLIKGKTLIFV
                     NNIDRGYRLKLVLEQFGIKSCILNSELPANSRQHIVEEFNKNVYQLLIATDDTEYIKE
                     EDEDLESEKTEDGLVEVVDDSTVTTKDNAKKQKKPKLNVEKDKEYGVSRGVDFKNVAC
                     VLNFDLPTTAKSYVHRIGRTARAGKSGISISFVVPLKEFGKHKPSMIKSAKKDEKILG
                     RIIKQQAKLGFELQPYNFDIKQVEGFRYRMEDGFRAVTQVAIREARIKELKQELLASE
                     KLKRHFEENPHDLESLRHDKELHPARVQQHLKRVPDYLLPETARKDNKKIGFVPFHKN
                     SHRKNGRVVKKKGNVQRKGKSDPLKSFK"
     gene            complement(<419591..>421885)
                     /locus_tag="KLLA0_C04598g"
                     /db_xref="GeneID:2892326"
     mRNA            complement(<419591..>421885)
                     /locus_tag="KLLA0_C04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452404.1"
                     /db_xref="GeneID:2892326"
     CDS             complement(419591..421885)
                     /locus_tag="KLLA0_C04598g"
                     /note="highly similar to uniprot|Q06224 Saccharomyces
                     cerevisiae YLR277C YSH1 subunit of Polyadenylation factor
                     I (PF I)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452404.1"
                     /db_xref="GeneID:2892326"
                     /db_xref="GOA:Q6CUI5"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /translation="MTQLENEVPDKDHLRFFSLGGSNEVGRSCHILQYKGKTLMLDAG
                     IHPAHQGLASLPYYDEFDLSTIDLLLISHFHLDHAASLPYVMQRTNFRGRVFMTHPTK
                     AIYRWLLNDFVKVTSIGDSPGQDSSNDNLYSDEDLAESFDRIETIDYHSTMEVNGIKF
                     TAFHAGHVLGAAMFQIEIAGVRVLFTGDYSREVDRHLNSAEVPPQSSDVIIVESTFGT
                     ATHEPRQNRERKLTQLIHTVVSKGGRVLLPVFALGRAQEIMLILDEYWQNHKEELGNG
                     QVPIFYASNLAKKCMSVFQTYVNMMNDDIRKKFKDSQTNPFIFKNISYLKNLDEFEDF
                     GPSVMLASPGMLQNGLSRDILEKWCPEEKNLVLVTGYSVEGTMAKYLLLEPEAIPSVH
                     NPEITIPRRCQVDEITFAAHVDFRENLEFIELIGASNIILVHGESNPMGRLKSALLSN
                     FSSLKDTENEVHVFNPRNCVFVDIEFKDVKVARAVGKIIEDLDEFITEEDALKNEKRI
                     TEIHEEDPETEESKTEIVKEENEKIVSGILVSDEKNFDLSLVSLSDLREHYQQLSTTV
                     LTERQTVHLDCKSELVYWHICQMFGDVDVYIDEENVSLKNINPEFKTRKIKKGELEIK
                     IMGDVILNIVDNVATLQWTQNVISDSVADSVMAILLSVESAPASIKMSSKSCGHHHGH
                     DDHTTKIKNISRVFKEQFGDTFTLFLNEEDSKEEIKGTINLGKTTACINFSKMVVEEC
                     NSNPLKGRIESLLKIGSDLVAPLC"
     gene            complement(<422705..>426514)
                     /locus_tag="KLLA0_C04620g"
                     /db_xref="GeneID:2892337"
     mRNA            complement(<422705..>426514)
                     /locus_tag="KLLA0_C04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452405.1"
                     /db_xref="GeneID:2892337"
     CDS             complement(422705..426514)
                     /locus_tag="KLLA0_C04620g"
                     /note="similar to uniprot|Q74ZB9 Ashbya gossypii AGR280C
                     AGR280Cp and some similarites with YLR278C uniprot|Q05854
                     Saccharomyces cerevisiae YLR278C Protein of unknown
                     function localizes to the nucleus potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452405.1"
                     /db_xref="GeneID:2892337"
                     /db_xref="GOA:Q6CUI4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI4"
                     /translation="MGRPPKKVSLENIQRFQLELEMAGQDTNQLLKDKKGRSRACLLC
                     QRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYDGAVGEQSSPQSSVATVTRGSRTGTA
                     NEQDNRHVGATTTEGSTVPVPSNKKSRAKVKQEGSVMDTMPVGGLDTPIPNVNNIKSN
                     INDHNINTVNHSSNLNNNNNDNNTNGNNKNNNSFQHVDSSRLSELASAAGSASPSPSL
                     LRESSHEGKKSKTKRSHKDGKDEYTLFLEKKLKYLEKLVDMKPDTNSYKEKLSKYKKV
                     AHLLDNGEPDQDDITTVLPPTAAQQTAPSNTLAASLSQQPNGAAGVAQDQQITRIRSP
                     ILPPPPKTKFLPLHQQSQNQPQRSGMIKPPHSHERALESLASDSLESIDYSRCIFAKY
                     NLKEFLSYDPAFEFDEQLSRAFLDTYFTRLQFKYPLLDEQEIYTFHNDYINNNVHSYS
                     INEFHFSCGRMWLVFSISAHLHKTTGKYQGLPPNRYFSTAIRHITKCGTNLTFVQQIE
                     VLILLILYIIRTDRDSIGLYEIIKDVTNICKNKLHLNKWNPKDPFAYKKLRLFWCVYL
                     IERMICVAVGKPYTINESEIDLPFFNKDSFYTRETDMAKHEHGVHFINQSLKLRRIES
                     TFVEELNIISQKPGSSSSNIPNQKRMTTAEISKIQAQLPQVKKFFQDLEVWRSKCSIT
                     HVRNFENETLKLYYYRSVRLLLQPYLELLKPHDRLFKECQAAAGQICQLYKVFHQKTV
                     FGHSTPAVHTVFVAGVTSIYCMWLARNWDDERRRKLGDVSKHTRPLVSALLFSTMDDL
                     RACSVCLYVMAERSKFAIIFRDTFDQLMNATIGNLIERCGPDSSELIYVTSSKKGETT
                     PTLISIPDRNADNDETSKDIDRKGMPPAMKRTFGELQVSAHAGFVENSQIDLEEQRER
                     KRKQGVLQKTSVPKSLSHLLVKVEDEDDGIDDSKITTSKASLAHSPDELSKVDTRSTS
                     EMVTPPEQVTARNKYIVKKPANVTESDWEIFQQQAFLQQHQAQQNLQAYLSSLNGAFE
                     NNNAQMMQSANGMGSHVNNRTATTLPPQQNQNSLNPITQNHPSLFSGGADNKASVTSS
                     DMSSPTGWQHGNADIFQKKQPANFVKSPNTPLHPISFSVGPSPRPNDNGIIFNNGTHT
                     MINNISTWTNDSVLDLMNSNHYVDPLNGGNNMGNLNGSLQSSATTNDQKTFVMPNRDN
                     NPGTLNNSLNWRNSSFTNMNMNFNQPDNQQGQRPPQQQQQQQLEAMLSVPVEEFWTVN
                     DDYGFLT"
     gene            complement(<427221..>427727)
                     /locus_tag="KLLA0_C04642g"
                     /db_xref="GeneID:2892330"
     mRNA            complement(<427221..>427727)
                     /locus_tag="KLLA0_C04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452406.1"
                     /db_xref="GeneID:2892330"
     CDS             complement(427221..427727)
                     /locus_tag="KLLA0_C04642g"
                     /note="similar to uniprot|Q05863 Saccharomyces cerevisiae
                     YLR281C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452406.1"
                     /db_xref="GeneID:2892330"
                     /db_xref="GOA:Q6CUI3"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI3"
                     /translation="MFGITVKTIPAVRLAITYRMLSSSIPQTIKKSKMPPRPKFTDDM
                     ERDIEEKFLHGGRGPGGQKINKCNSKVQLRHVPTGIVVDCQATRSRDQNRKIAREKLA
                     LRLAQWENGDQPIERELAKIQWEQQSKRSKERKAKSKHREAQEQRQQQKLQQTIEEKQ
                     LLKSLLEQ"
     gene            <427841..>428791
                     /locus_tag="KLLA0_C04664g"
                     /db_xref="GeneID:2892316"
     mRNA            <427841..>428791
                     /locus_tag="KLLA0_C04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452407.1"
                     /db_xref="GeneID:2892316"
     CDS             427841..428791
                     /locus_tag="KLLA0_C04664g"
                     /note="similar to uniprot|Q05867 Saccharomyces cerevisiae
                     YLR283W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452407.1"
                     /db_xref="GeneID:2892316"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI2"
                     /translation="MPLSIAEHLNRIHYKIETKPSVARSHCPQYPSMFSIFPRRFLPR
                     LVHNYRPLCKYSVLQQPLLPDDFMNKLPEKLISRGNGLKPTTAANQLDTLYLHNKLVQ
                     NGFTSEQGNVIIDLLLDTLDQDFFRTYNDKFLRKMELENQSHLFNAAETELKYAVQNS
                     REQSLNERTLELMQLDRDLNSFNDQLNELIINLLTKDSKVEFNDRKIENTLLHRDINL
                     RLKDCNNKIGTKINGHIKSEIENLRWQTTRSGLLAVLILVFFIMSGVSISKRINTENG
                     KPVEVILHTVDPEESDLESLLSDDEQGNVRSGKNNNASSC"
     gene            complement(<428962..>429795)
                     /locus_tag="KLLA0_C04686g"
                     /db_xref="GeneID:2891907"
     mRNA            complement(<428962..>429795)
                     /locus_tag="KLLA0_C04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452408.1"
                     /db_xref="GeneID:2891907"
     CDS             complement(428962..429795)
                     /locus_tag="KLLA0_C04686g"
                     /note="similar to uniprot|Q05871 Saccharomyces cerevisiae
                     YLR284C ECI1 Peroxisomal delta3 delta2-enoyl-CoA isomerase
                     hexameric protein that converts 3-hexenoyl-CoA to
                     trans-2-hexenoyl- CoA essential for the beta-oxidation of
                     unsaturated fatty acids oleate-induced"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452408.1"
                     /db_xref="GeneID:2891907"
                     /db_xref="GOA:Q6CUI1"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6CUI1"
                     /translation="MVVIAKSPRIEYRKEGIFFIIQFTDQKKLNALDGNDYLYLAHLL
                     VENDKDPETAFTVLQSSGRFFSAGADFSSIRKENTHNSDGTLPKWASAFLSRNTYVTN
                     AFIVHSKPIICCLNGPAVGLSAAIVMICDIVYCMNDKVYLQFPFAKIGLVTEGSTSIT
                     LPLKIGYARAQNTLFFNKPLTYDILEDSVSLRNYQLDDWKQFNEQALSDLKKDVKGLN
                     LTSIIVMKKLIKETWMQHLLRANASEVTDAMPFWIDGIPQSNFLKMLKRAEANRSKSR
                     L"
     gene            <430441..>431253
                     /locus_tag="KLLA0_C04708g"
                     /db_xref="GeneID:2892340"
     mRNA            <430441..>431253
                     /locus_tag="KLLA0_C04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452409.1"
                     /db_xref="GeneID:2892340"
     CDS             430441..431253
                     /locus_tag="KLLA0_C04708g"
                     /note="similar to uniprot|Q05874 Saccharomyces cerevisiae
                     YLR285W NNT1 Putative nicotinamide N-methyltransferase has
                     a role in rDNA silencing and in lifespan determination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452409.1"
                     /db_xref="GeneID:2892340"
                     /db_xref="GOA:Q6CUI0"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSDIESLNGGDLFAEPSDFYKPPPEPHFATYTRDDVPESSTSQQ
                     KDIKLRLVGSSPLWGHLLWNAGIYTAKHMDSHPEEVQDKLVLELGAAGALPTIIAGLL
                     GARKVVSTDYPDADLISNIQYNVDHNIYGGEELFKDEEKRSKQMANRKVVVEGYIWGN
                     DYEPILKHLPQDQQKFDLIILSDLVFNHTEHAKLFKTTKDLLRENGKALVVFSPHRPW
                     LLENDLAFFKDCEEFGLKSDLIELTHWKPMFDEDEETVEIRSSIYAYYLSHI"
     gene            complement(<431651..>433306)
                     /locus_tag="KLLA0_C04730g"
                     /db_xref="GeneID:2891846"
     mRNA            complement(<431651..>433306)
                     /locus_tag="KLLA0_C04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452410.1"
                     /db_xref="GeneID:2891846"
     CDS             complement(431651..433306)
                     /locus_tag="KLLA0_C04730g"
                     /note="similar to uniprot|P29029 Saccharomyces cerevisiae
                     YLR286C CTS1 Endochitinase required for cell separation
                     after mitosis transcriptional activation during late G and
                     early M cell cycle phases is mediated by transcription
                     factor Ace2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452410.1"
                     /db_xref="GeneID:2891846"
                     /db_xref="GOA:Q6CUH9"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR005089"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH9"
                     /translation="MFHPRLLLLSLVQLLLTSAFDINAKDNVAVYWGQASAGTQESLG
                     TYCASDNVDVVVLSFLYQFPDNLAIDFASACSTTFDDGLLHCPSIAADIESCQAKGKK
                     VFLSLGGAIGSYGFTDDSQAEEFATTLWNTFGEGTADNVERPFDTAVVDGFDFDIENN
                     NPTGYASLATKLRSLYAKGSKDYYLAAAPQCVYPDASVGDALANADIDIAFVQFYNNY
                     CNVDKQFNWDTWADFVENTSPNKDIKLYLGLPGAASAAGSGYISDLSLLKSTVQTIGE
                     NSHFGGIMLWDASQGFTNQVDGEPYVAQVKSILEANTDSTSSQSATSSVQSSSSTATT
                     PDSTLITSTSSKASSISQISSTTQQGVEPTTTSGSTSSPDSISSTTTISSTKTVVNGK
                     VSIASSTDVTTSQQAVTQSTAISVTSSTEVTTSQQPTTKSTTTLQPTTTAAPTTIPEP
                     SRTTLQPSTTQSSDSTQSTDSWAVTRAKELNEQFVKGELNGKDSCSDGEISCTADGKI
                     AICNYGAWVYTECAAGTTCFAYDSGDSVYTSCNFTYLKPDVVF"
     gene            <433528..>433932
                     /locus_tag="KLLA0_C04752g"
                     /db_xref="GeneID:2891937"
     mRNA            <433528..>433932
                     /locus_tag="KLLA0_C04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452411.1"
                     /db_xref="GeneID:2891937"
     CDS             433528..433932
                     /locus_tag="KLLA0_C04752g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452411.1"
                     /db_xref="GeneID:2891937"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH8"
                     /translation="MIDSCITGTSSCHCCALYIPEITKYDIELDPSTCFKHSKACKQT
                     HHRKHSQTLAPAHCLCLLCFVSFCFATSKSCSCNMLKHNFVSKKCLGKRILFGRVLRW
                     TKEKKAFTFNVTVNKTQNVNPITPPVVNYFTS"
     gene            <434720..>436681
                     /locus_tag="KLLA0_C04774g"
                     /db_xref="GeneID:2892592"
     mRNA            <434720..>436681
                     /locus_tag="KLLA0_C04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452412.1"
                     /db_xref="GeneID:2892592"
     CDS             434720..436681
                     /locus_tag="KLLA0_C04774g"
                     /note="similar to uniprot|Q12446 Saccharomyces cerevisiae
                     YOR181W LAS17 Actin assembly factor activates the Arp2/3
                     protein complex that nucleates branched actin filaments
                     localizes with the Arp2/3 complex to actin patches homolog
                     of the human Wiskott-Aldrich syndrome protein (WASP)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452412.1"
                     /db_xref="GeneID:2892592"
                     /db_xref="GOA:Q6CUH7"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028297"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH7"
                     /translation="MGGLNSAEKEKVKHALPKASNKIIDVTIARLYIAYPNPEKWVYT
                     GLSGAIALVDDIVGNTFFLKLIDVHGHRGVLWDQELYVNFQYNQDRTFFHTFELEQCN
                     AGLLFTDIGDASHFLKRVQKREKYASKKTLANKNAIALEDQIKKEEESKVIHGPRGES
                     LISDQRVRYRYEPEKHEHRQEHHYEQPSQNYASTENSASDASAAPPSFASKPPPPPVE
                     KQPPPPVSIPSYKYDSIPSFPSSPAPPSVSSTHSPTPDSSYASTPAPSNPPPPINHPV
                     HAVPPPLPAEQYRPLAQSPHPQFQQQHNSPSPAAPPSIPPMQQSVAIPPPPSHPAQQQ
                     NVTNNNTPQFGQYSVAGLQPPPRPTSTRPGIAPPVSRRGPVPPPPPRRSAAPPSIPSR
                     GPLPNAPTGGQHSRTGRGPPPPPPPRRGGQAPSPPASRGTTHNSAIGPPQPQLPPQMQ
                     SPPLQQHNTYNAAPPVQQYQPPQQTAYIPPPPVLPPHSGVSTQYHPSTEPMLAQPQHH
                     IAVPNGTAPPPAPPAPPAPFAPQITNSAPAPPPPPPPPPAPAFNQPEAGSGFVENTGD
                     AGRDALLASIRGAGLNSLRKVDKSQLEKPSPLLQEVRSDAPVSQPTGGSTGGPVGAPA
                     SLADALAAALNQRKNKVARDDDIDNGDDW"
     gene            complement(<436807..>437865)
                     /locus_tag="KLLA0_C04796g"
                     /db_xref="GeneID:2892338"
     mRNA            complement(<436807..>437865)
                     /locus_tag="KLLA0_C04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452413.1"
                     /db_xref="GeneID:2892338"
     CDS             complement(436807..437865)
                     /locus_tag="KLLA0_C04796g"
                     /note="some similarities with uniprot|Q05881 Saccharomyces
                     cerevisiae YLR287C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452413.1"
                     /db_xref="GeneID:2892338"
                     /db_xref="GOA:Q6CUH6"
                     /db_xref="InterPro:IPR026907"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH6"
                     /translation="MSSTLSDDIKRLKTEFPYTSVESLHGIPKKTKLPASSLLEELGK
                     LSKLIKSNATKLGIISTPDKISNNEDAFKTQMVELMNVVFYLLSLVPLFHDSHFADYF
                     INKLDNDIVSLVQSIHKLSDELVEIVNSDAKDFKDPIIAEDEKLAKFLKERLISIGML
                     WSQCEHLELLSNQGNLGLLTEYLSSSVKLLQDSIEELEEWLEDPVINSDPFGMNDKFS
                     DEEGTDLDEEEEEEASESMIEFVKSLSQKSRLLKLLLSSLSKSITIKKDTVTTAAYLS
                     ELNQLHNSIVSNSDTLISSTLVNAEYEVDPEVETSVLAINNDVKKVIKIITQLNGSDE
                     SKLKWIQVWSNKWSSLNN"
     gene            complement(<438318..>439038)
                     /locus_tag="KLLA0_C04809g"
                     /db_xref="GeneID:2892328"
     mRNA            complement(join(<438318..438506,439036..>439038))
                     /locus_tag="KLLA0_C04809g"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_452414.1"
                     /db_xref="GeneID:2892328"
     CDS             complement(join(438318..438506,439036..439038))
                     /locus_tag="KLLA0_C04809g"
                     /note="similar to uniprot|Q12087 Saccharomyces cerevisiae
                     YOR182C RPS30B and similar to uniprot|Q12087 Saccharomyces
                     cerevisiae YLR287C-A RPS30A"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_452414.1"
                     /db_xref="GeneID:2892328"
                     /db_xref="GOA:Q6CUH5"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH5"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRLLYTRRF
                     VNVTLTNGKRKMNPSPSSQ"
     gene            <439585..>440763
                     /locus_tag="KLLA0_C04818g"
                     /db_xref="GeneID:2892343"
     mRNA            <439585..>440763
                     /locus_tag="KLLA0_C04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452415.1"
                     /db_xref="GeneID:2892343"
     CDS             439585..440763
                     /locus_tag="KLLA0_C04818g"
                     /note="highly similar to uniprot|P33330 Saccharomyces
                     cerevisiae YOR184W SER1 phosphoserine transaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452415.1"
                     /db_xref="GeneID:2892343"
                     /db_xref="GOA:Q6CUH4"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH4"
                     /translation="MDRPQSNYFGAGPAQLPLPVLQQAAKDLINFQDEGLGIGEISHR
                     SKAAAKVITDTKAHLKELFAIPDTHEVFFLQGGGTTGFSSVASNLSAAHFGKTGEVGT
                     AAYLITGSWSEKSSQESERLGVPTEVIFNVKKDNGRFGTIPESSTWVQKLDAKKHSYV
                     YLCENETVHGVEWPEQLPRELIDSKVPIVADLSSDILSRKINVADYSLIMAGAQKNIG
                     LAGLTLYIIKKDILDDIAKVSPKQLRDASLPVSPIATDYPTVVKNDSAYNTIPIFTLH
                     IIDLVLQRLLEQGGIESQQKENEEKAKILYEALDKFPEFYNLPVDKKYRSKMNVVFTI
                     KKDGLDSKFLEEATKLNLTGLKGHRSVGGFRASLYNAVELSSVKLLVDFVTKFAENNQ
                     "
     gene            complement(<440770..>441930)
                     /locus_tag="KLLA0_C04840g"
                     /db_xref="GeneID:2892201"
     mRNA            complement(<440770..>441930)
                     /locus_tag="KLLA0_C04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452416.1"
                     /db_xref="GeneID:2892201"
     CDS             complement(440770..441930)
                     /locus_tag="KLLA0_C04840g"
                     /note="similar to uniprot|Q02574 Saccharomyces cerevisiae
                     YLR288C MEC3 Involved in checkpoint control and DNA repair
                     forms a clamp with Rad17p and Ddc1p that is loaded onto
                     partial duplex DNA DNA damage checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452416.1"
                     /db_xref="GeneID:2892201"
                     /db_xref="GOA:Q6CUH3"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH3"
                     /translation="MKLKLSIQAGTEDYSLFRTTLITVSKLRKTCILRFTSSRLVIIS
                     TPNSTGTVIDQGQVWCTVPHDVFDTYVVNSIREDNRVAMECPCDTIVGVLRKFDKCNA
                     TQLTIKLVRLVTVDKESEAAAAAHNTDNTLCGLSFSFQDTRDERTIQHNIKVGVKLLY
                     NAQDEKIVEPTVNYVGILMLQLPSHVSEWGPGFNAFFKRIERYGNVNTLKIHGEQLGE
                     KGSLKVIVDEFDWKLNIAWKGPLDAMLNDMEGDDSHSDPRDDTLRHNGETNAESSPSP
                     VACNEMHIEDSDVLDTGIHGKSIDRHSTMLENASARQSQDKLKGHEVIVRVRDWKVCS
                     KLYESFEEVVLVISHDDSCVFHCSLERGIDRDENNKEKGQIIYYISKCKSLN"
     gene            <442167..>444062
                     /locus_tag="KLLA0_C04862g"
                     /db_xref="GeneID:2892318"
     mRNA            <442167..>444062
                     /locus_tag="KLLA0_C04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452417.1"
                     /db_xref="GeneID:2892318"
     CDS             442167..444062
                     /locus_tag="KLLA0_C04862g"
                     /note="highly similar to uniprot|P46943 Saccharomyces
                     cerevisiae YLR289W GUF1 Mitochondrial GTPase of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452417.1"
                     /db_xref="GeneID:2892318"
                     /db_xref="GOA:Q6CUH2"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /translation="MFNRRLLRHVRYAFQQVRSNHSLQERIDAIPIERYRNFSIVAHV
                     DHGKSTLSDRLLELTNVIKPGGKQVLDKLEVERERGITIKAQTCSMFYQDPRTKLDYL
                     LHLVDTPGHVDFRAEVSRSYASCGGALLLVDASQGVQAQTVANFYLAYSMDLKLIPVI
                     NKIDLDIADIDQAEEQVENMFELPKSDCIKVSAKTGLHVEQLLPAIVDRIPPPTGKVE
                     KPLRALLVDSWYDSYLGVVLLVHIVDGQVKRGDKIITAANGLKYEVRECGIMYPDRVA
                     TNTLKSGQVGYLVPGMKESKDAKIGDTLMHLGKESITEVLPGFEEPKPMVFVGAFPAD
                     GAEFKALDDDISRLVLNDRSVSLQRETSNALGQGWRLGFLGSLHASVFTERLEKEYGS
                     KLILTQPTVPFLIKFKDGEKKIITNPDDFPDLSLRRSNLESLEEPFVEAIMTLPQEYL
                     GKVIQLCDDSHGVQKEITYLNMTGQVMLRYELPLSYLVDDFFGKLKSVSRGYASLDYE
                     DVGYKQSDIVKLELLVNGKSVDALAQVMHRDQTEHIGKEWVKKFKKFIKSQLFEVVIQ
                     ARANNKIIARETIKAKRKDVLSKLHASDISRRKKLLSKQKQGKKNMKTVGNIQINQDA
                     FQSFLRR"
     gene            <444289..>444951
                     /locus_tag="KLLA0_C04884g"
                     /db_xref="GeneID:2892333"
     mRNA            <444289..>444951
                     /locus_tag="KLLA0_C04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452418.1"
                     /db_xref="GeneID:2892333"
     CDS             444289..444951
                     /locus_tag="KLLA0_C04884g"
                     /note="similar to uniprot|P25362 Saccharomyces cerevisiae
                     YCR020C PET18 Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452418.1"
                     /db_xref="GeneID:2892333"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH1"
                     /translation="MKAIKLTLSTMSTTERLINANRALLQSVTNHILPKELCNGTLSD
                     DVLYIYCAQDKKFFVLALRLLAFYSSRAPSEEALLRLCKQVGFLAGEENDYFDQCLQI
                     TERDPLKRFKTQVLPKVQKYLDFLEKMPASVDYGQWVTHMWCAEYVYWKWAHDLPRSD
                     KLEWKHEEWIKLHDGDHFEEWCNFLAGEVDKLQYEDVSRIFVTTLELEKDFFDSCLEA
                     AK"
     gene            complement(<445437..>447611)
                     /locus_tag="KLLA0_C04906g"
                     /db_xref="GeneID:2891817"
     mRNA            complement(<445437..>447611)
                     /locus_tag="KLLA0_C04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452419.1"
                     /db_xref="GeneID:2891817"
     CDS             complement(445437..447611)
                     /locus_tag="KLLA0_C04906g"
                     /note="similar to uniprot|Q08908 Saccharomyces cerevisiae
                     YOR384W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452419.1"
                     /db_xref="GeneID:2891817"
                     /db_xref="GOA:Q6CUH0"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6CUH0"
                     /translation="MQINLLVFLVWCLSLADTASAVPFNLFKPTRWHTNWVHLSSSAC
                     LKDVKDHQWAFELETLASTHGSFLLQRRSLRAACLYEPAMETWVSCARDMLRKKGKYP
                     KSEDDIKLLDVIAERVNSACEQNWGGKNPISPLTGGDILVKIENATSHIQPFPKSEKT
                     TLYAPINGLESKLNYLLMAYYGPVHNLDFSTIGGFILCGYWILVLCIAAIYKLLLRYP
                     RSRDWMKSKFFTIVDGRIVIPALLHNHSTPIGWPFYFGMIPTRLETLAILGYTILHTV
                     LLSVRYFYDVYYLVGDPRVQKVLFITDRAGIYAFAQLPVLFLFGGRNQILEMMTGVKF
                     RSFVTYHKWIGRFMFWDSMIHSIGYTYHAFMEDYWKYAKNSATFQSGRFAMWYIGGII
                     LFSFFFFRNHYYEFFLLSHILLVSLVLVFLWKHCAQIGWNEFLAVTIVFWVLDRLFRL
                     FKIFRFGSQRATLQLFHDKYIRLSIPITANNWHAKPGQYCYIHFITPTLFWQAHPFSV
                     MDSLVHGNNLVIVLAVKEGITRRLSEYIPYNGKVEMRVAVEGPYGEPLEGGLWNNALL
                     IAGGTGVPSSLAFIVKTLEHDVDLRQTSIKLIWSLRDLSILDCYIQELRVLKANDVDL
                     QIHYTGEQELRSIKSMHENSEEDYEGLQLLSSDIPYYGQIIRRRPDIPELFEEFLEIT
                     DELLVVTCGSGPFVDKVREISARKTLEHPHKLINYIEDLQVW"
     gene            <449820..>450344
                     /locus_tag="KLLA0_C04928g"
                     /db_xref="GeneID:2891985"
     mRNA            <449820..>450344
                     /locus_tag="KLLA0_C04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452420.1"
                     /db_xref="GeneID:2891985"
     CDS             449820..450344
                     /locus_tag="KLLA0_C04928g"
                     /note="some similarities with uniprot|Q08907 Saccharomyces
                     cerevisiae YOR383C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452420.1"
                     /db_xref="GeneID:2891985"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG9"
                     /translation="MKFSVAATTLAVATSALAAQTVITATNEGNVYTKTVDVPDSADL
                     GPGEYLSTLVVTRDDVVYTKYLTATSSGVAESSATEESSSTEESSSTEAPTESTSTEE
                     SSSTEAPTESSSSAEESSSTEAETTSEAPVESSSTAAPTETSTADVSTYTGGAALASV
                     GTGLLGVAVAGLLI"
     gene            <452463..>452774
                     /locus_tag="KLLA0_C04950g"
                     /db_xref="GeneID:2891989"
     mRNA            <452463..>452774
                     /locus_tag="KLLA0_C04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452421.2"
                     /db_xref="GeneID:2891989"
     CDS             452463..452774
                     /locus_tag="KLLA0_C04950g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452421.2"
                     /db_xref="GeneID:2891989"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG8"
                     /translation="MHTLNFFYQKKYENANPKMKVYPNATADSSDIFESEREKRTVRG
                     NLADLYVKNLKGSVKWPFELHISVGTLSHGFVKRVEICAESSKGQESDIEFCILIGIL
                     R"
     gene            <453438..>455264
                     /locus_tag="KLLA0_C04994g"
                     /db_xref="GeneID:2891961"
     mRNA            <453438..>455264
                     /locus_tag="KLLA0_C04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452423.1"
                     /db_xref="GeneID:2891961"
     CDS             453438..455264
                     /locus_tag="KLLA0_C04994g"
                     /note="weakly similar to uniprot|Q04433 Saccharomyces
                     cerevisiae YDR534c Mannoprotein that is incorporated into
                     the cell wall via a glycosylphosphatidylinositol (GPI)
                     anchor, involved in the retention of siderophore-iron in
                     the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452423.1"
                     /db_xref="GeneID:2891961"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG6"
                     /translation="MKLSSVVATALAAASSALAAQTTVTATVDGHVYTKTIDIPDADE
                     TAPSGYYLSTIIVTRGDVVYTKVITEQSAVATSETTSSEETTASILTAVDEEAISSAV
                     EETSSAEEASTTEYETITLTLYKNDHWFTKTVTQPVGYVYAGETAAQTSSAEETSSAE
                     ETSSAAEENSTTEYETKTLTLSKNGHWFTKTVTQPVGFVWTGEATTYTGVAPWASSSA
                     EEASTTLDADELETVTLTLSKNGHWFTKTVTQTKGFVWTGEPSRSAATTSAEETSSTE
                     EASTTEYETKTLTLSKNGHWFTKTVTQPVGFVWTGEATTYTGVAPWASSSAEEASSTE
                     EASTTLDADELETVTLTLSKNGHWFTKTVTQTKGFVWTGEPSRSATASSDDSNDDITS
                     YSNSTASATDSTDGQSSVSIETQTVTDKSSTTATITSCSEGVCHTTTLEPSASTVVTT
                     VVDGVTIVTTVPCTTTSTVECTEEQCQKTKETVSTKETVSTKEPESTVFTTVVEGVTI
                     TSTIPCSEGVCQKTTSEHSAVKTSTNGNDQQSAVKTTTAGDNVQPTTTATIIDTVKTT
                     IVKSTSATQSSPAQTVSTYTGGAVMASVGTGIFAAAMGVMLL"
     gene            complement(<456048..>456527)
                     /locus_tag="KLLA0_C05016g"
                     /db_xref="GeneID:2892213"
     mRNA            complement(<456048..>456527)
                     /locus_tag="KLLA0_C05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452424.1"
                     /db_xref="GeneID:2892213"
     CDS             complement(456048..456527)
                     /locus_tag="KLLA0_C05016g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452424.1"
                     /db_xref="GeneID:2892213"
                     /db_xref="InterPro:IPR020337"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG5"
                     /translation="MKFTNSLLISAVAAVAAAVSESSTVKTITATNGGHVYTKVVTDT
                     ADPIITASTTRTTTYTENGASYVKTYTEGPDTTSVKSTTSKVTITNSDNGATYTKTNV
                     VAISTDSDESSSSSSSSSSSSSSAESSTSSSASTSSDAAGSLAVNAGVLAAVAACLL"
     gene            <458924..>459601
                     /locus_tag="KLLA0_C05060g"
                     /db_xref="GeneID:2892488"
     mRNA            <458924..>459601
                     /locus_tag="KLLA0_C05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452426.1"
                     /db_xref="GeneID:2892488"
     CDS             458924..459601
                     /locus_tag="KLLA0_C05060g"
                     /note="weakly similar to uniprot|Q04734 Saccharomyces
                     cerevisiae YMR063W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452426.1"
                     /db_xref="GeneID:2892488"
                     /db_xref="GOA:Q6CUG3"
                     /db_xref="InterPro:IPR009571"
                     /translation="MLVKIVLVVLLTLALVFECFSTISVPITIGLYISEYNGYRFGVF
                     GWCKVDRSVCSPIRIGYSKDDILLFNEQEYLHLPNHAKYALSNLLLVHVLAFVCVTIL
                     WVFGMLTCFRCIKTSRRMLIIAVLWSMLTFMVTLLGFLIDILIFSSHVTWCTWLTLAS
                     AFFTVLSGTVLCVMRRNLTYDKFLESKPEKHGVYVPLCRLNDVEELEIPWCNTMNHQA
                     LTAPTPM"
     gene            complement(<461375..>462445)
                     /locus_tag="KLLA0_C05082g"
                     /db_xref="GeneID:2891981"
     mRNA            complement(<461375..>462445)
                     /locus_tag="KLLA0_C05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452427.1"
                     /db_xref="GeneID:2891981"
     CDS             complement(461375..462445)
                     /locus_tag="KLLA0_C05082g"
                     /note="similar to uniprot|P32502 Saccharomyces cerevisiae
                     YLR291C GCD7 Beta subunit of the translation initiation
                     factor eIF2B the guanine-nucleotide exchange factor for
                     eIF2 activity subsequently regulated by phosphorylated
                     eIF2 first identified as a negative regulator of GCN4
                     expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452427.1"
                     /db_xref="GeneID:2891981"
                     /db_xref="GOA:Q6CUG2"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG2"
                     /translation="MSDINVVIDSFIDRLKRKQVIGSYQASLETLQILMRYVSAIRWT
                     STDELIVQIKKFGNNLEKAQPYEYSCGNVVRRVLSMIRDEIEEEQSSAEPMISSMFNL
                     LQKPMTDTKTRKIQDNKLDVRQTIVQSIRDLIDEIKNIDEGIQQIAIELIHDREILLT
                     PTPDSKTVLRFLLKARERNNRNFTVLVTEGFPNNTTVAHEFAKKLSEHDIETIVIPDS
                     AVFALMSRVGKVIIGAKTVFTNGGTISSTAGVSSVCECAREFKTPVFAVAGLYKLSPL
                     YPFDVEKMVEIGGSQNVLPTTENDRVGTVALETINPIADYIPPENIDIYITNIGGFAP
                     SFIYRVVWDNYKQEDVNLGEKI"
     gene            complement(<462684..>463316)
                     /locus_tag="KLLA0_C05104g"
                     /db_xref="GeneID:2892369"
     mRNA            complement(<462684..>463316)
                     /locus_tag="KLLA0_C05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452428.1"
                     /db_xref="GeneID:2892369"
     CDS             complement(462684..463316)
                     /locus_tag="KLLA0_C05104g"
                     /note="similar to uniprot|P39742 Saccharomyces cerevisiae
                     YLR292C SEC72 Non-essential subunit of Sec63 complex
                     (Sec63p Sec62p Sec66p and Sec72p) with Sec61 complex
                     Kar2p/BiP and Lhs1p forms a channel competent for
                     SRP-dependent and post-translational SRP-independent
                     protein targeting and import into the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452428.1"
                     /db_xref="GeneID:2892369"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG1"
                     /translation="MGQSTGATPPVPITAKNKTMIQYDSNNKQLSIDNDSNTDRLTNL
                     NQINKLTTALVPETNPNFQPQPNNETTNMVKNMFQSGMQQAQNKNIPDALRKVDLAVD
                     MRNKARKPWEPFSFQLQELHMMLRNRTDLELVSQRNLDAWQDLEMLLNCGMVVPEVFI
                     RLTDCLLKLNLVELARPYCERGLSLDPKNGPLLALFQACEKKMLEIEGDL"
     gene            complement(<463657..>464301)
                     /locus_tag="KLLA0_C05126g"
                     /db_xref="GeneID:2892303"
     mRNA            complement(<463657..>464301)
                     /locus_tag="KLLA0_C05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452429.1"
                     /db_xref="GeneID:2892303"
     CDS             complement(463657..464301)
                     /locus_tag="KLLA0_C05126g"
                     /note="highly similar to uniprot|P32836 Saccharomyces
                     cerevisiae YOR185C GSP2 GTP binding protein (mammalian
                     Ranp homolog) involved in the maintenance of nuclear
                     organization RNA processing and transport interacts with
                     Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
                     homolog that is not required for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452429.1"
                     /db_xref="GeneID:2892303"
                     /db_xref="GOA:Q6CUG0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG0"
                     /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV
                     HPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
     gene            complement(<464727..>465506)
                     /locus_tag="KLLA0_C05148g"
                     /db_xref="GeneID:2892363"
     mRNA            complement(<464727..>465506)
                     /locus_tag="KLLA0_C05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452430.1"
                     /db_xref="GeneID:2892363"
     CDS             complement(464727..465506)
                     /locus_tag="KLLA0_C05148g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452430.1"
                     /db_xref="GeneID:2892363"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF9"
                     /translation="MSKKFSSIADAVKYINDELTKKGYLKDDKLQCSASNESSSEKEQ
                     LDRDKLVVNVINKLLQRVDNLQDRLKDQDLQLRKAQDKLIERTHFIKSEHNKSANTPE
                     KERKVTKITKIQYREKDTKYLEAKIRKLRLELEDQSSQLRQYADGDRPNITWGTSLGH
                     LTVGKLMYSRDAVEANQIDMLSDKLSDVIDINTSLSQDLDAATRLISNMNKTIYTKFV
                     LQIPDTTSKTVTVDKSDHHEASSQALNELTRDWEDIKSQLP"
     gene            complement(<465845..>466174)
                     /locus_tag="KLLA0_C05170g"
                     /db_xref="GeneID:2892443"
     mRNA            complement(<465845..>466174)
                     /locus_tag="KLLA0_C05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452431.1"
                     /db_xref="GeneID:2892443"
     CDS             complement(465845..466174)
                     /locus_tag="KLLA0_C05170g"
                     /note="similar to uniprot|Q12349 Saccharomyces cerevisiae
                     YLR295C ATP14 Subunit h of the F0 sector of mitochondrial
                     F1F0 ATP synthase which is a large evolutionarily
                     conserved enzyme complex required for ATP synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452431.1"
                     /db_xref="GeneID:2892443"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF8"
                     /translation="MFRAVPLTLRASRGFSTSFIRRNVIQDLYLKELKAVNLKPITAA
                     DAQGAVKPWTTPAAPKLPELELQSADALKEYASSGVETVSEANEQSAEVEEGDWLVLE
                     ELEDAHH"
     gene            complement(<466506..>467075)
                     /locus_tag="KLLA0_C05192g"
                     /db_xref="GeneID:2892461"
     mRNA            complement(<466506..>467075)
                     /locus_tag="KLLA0_C05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452432.1"
                     /db_xref="GeneID:2892461"
     CDS             complement(466506..467075)
                     /locus_tag="KLLA0_C05192g"
                     /note="weakly similar to uniprot|Q05900 Saccharomyces
                     cerevisiae YLR298C YHC1 U1 snRNP protein required for
                     pre-mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452432.1"
                     /db_xref="GeneID:2892461"
                     /db_xref="GOA:Q6CUF7"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF7"
                     /translation="MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYRNTSLI
                     EESKKLKRTKNRKPHEKEVTESRNAPRCVIHCPTNRRKRMMKITKNKDTLDDLDVLDA
                     IYKGSPGYERIFRPENRIDIGHLLKVSKQPQRGNVNRNSVAKPTLNESTSVLPPPRTL
                     AWNNTYSMKFHDPSLLQKSINHTVKQLKR"
     gene            <467624..>468916
                     /locus_tag="KLLA0_C05214g"
                     /db_xref="GeneID:2892357"
     mRNA            <467624..>468916
                     /locus_tag="KLLA0_C05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452433.1"
                     /db_xref="GeneID:2892357"
     CDS             467624..468916
                     /locus_tag="KLLA0_C05214g"
                     /note="highly similar to uniprot|P02992 Saccharomyces
                     cerevisiae YOR187W TUF1 Mitochondrial translation
                     elongation factor Tu comprises both GTPase and guanine
                     nucleotide exchange factor activities while these
                     activities are found in separate proteins in S. pombe and
                     humans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452433.1"
                     /db_xref="GeneID:2892357"
                     /db_xref="GOA:Q6CUF6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF6"
                     /translation="MSFLAPRFLTTKVFRPMSIGARTFSSSIRVSAAAFDRSKPHLNI
                     GTIGHVDHGKTTLTAAITKTLAERGGADFLDYSSIDKAPEERARGITISTAHVEYETD
                     KRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHI
                     VVFVNKVDTIDDPEMLELVEMEMRELLTQYGFDGDNTPVIMGSALCALEGKQPEIGEQ
                     AIMKLLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEI
                     VGHNTTPFKTTVTGIEMFRKELDQAMAGDNAGVLLRGVRRDQLKRGMVLAKPGTVKAH
                     TKFLASLYILTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPEAVEDHSMQVMPGDN
                     VEMECELVHPTPLEAGQRFNIREGGKTVGTGLVTRILE"
     gene            <469306..>471111
                     /locus_tag="KLLA0_C05236g"
                     /db_xref="GeneID:2892388"
     mRNA            <469306..>471111
                     /locus_tag="KLLA0_C05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452434.1"
                     /db_xref="GeneID:2892388"
     CDS             469306..471111
                     /locus_tag="KLLA0_C05236g"
                     /note="similar to uniprot|Q05902 Saccharomyces cerevisiae
                     YLR299W ECM38 Gamma-glutamyltranspeptidase major
                     glutathione-degrading enzyme expression induced mainly by
                     nitrogen starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452434.1"
                     /db_xref="GeneID:2892388"
                     /db_xref="GOA:Q6CUF5"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF5"
                     /translation="MVLTPFLLLLGFCEALSPHVLNNQPDIALDIDRSPTLTPNQELL
                     KIGSKFAIASDLELCSNMTLHKVFLDFPGSNAVDAAVTVALCIGMINFFNSGIGGGGF
                     AVVSTKEESVTYDFRETAPLLSNNTMYDGLGDFASVVGGLSIAVPGELAGLYDMWSEY
                     GSGKISWQNVLQPVIDLGYHGWEIQEVLGASLGAYEYFLRMNFEDWQFVFNEDGSIKK
                     KGDWLKRPTLAKTLEVLAKNGSVAPFYDPNSYLVKSMVSKIKERGGIITREDFSLYKA
                     EKQKPLSVLIRSGWENMPNNDLTVLTSSGSSSGAALIAALKVLDAFPSVTGGDYSTQQ
                     TYELVEAMKWLASARSRLGDYGGGDELPSRIQKVLNDPWIQHAVLKIKENGNDSNFRT
                     LPNWKDYHPAYEMNEPHGTAHFSVVDDKHNAVSLTTTVNLLFGSLVHDPVTGVIFNNE
                     MDDFSIAGRSNSFGLAPSAYNLIEPGKRPLSSCVPTIILNELGFPDLVVGASGGSRIS
                     PSILQVIVRKYWYQMPLLETIAYPRVHHQLLPDILEVESFPMVGKALIAELVKMGHTP
                     KEMPSRSVVNGICRVNAEWHAVSDYWRKRGIAAAM"
     gene            <471500..>475567
                     /locus_tag="KLLA0_C05258g"
                     /db_xref="GeneID:2892455"
     mRNA            <471500..>475567
                     /locus_tag="KLLA0_C05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452435.1"
                     /db_xref="GeneID:2892455"
     CDS             471500..475567
                     /locus_tag="KLLA0_C05258g"
                     /note="some similarities with uniprot|P21339 Saccharomyces
                     cerevisiae YOR188W MSB1 Protein involved in positive
                     regulation of both 1 3-beta-glucan synthesis and the
                     Pkc1p-MAPK pathway potential Cdc28p substrate multicopy
                     suppressor of temperature-sensitive mutations in CDC24 and
                     CDC42 and of mutations in BEM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452435.1"
                     /db_xref="GeneID:2892455"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF4"
                     /translation="MSEKKPLPQPPFEENTCNYTKEDVRLGKKTKRDGDDADDEFEFF
                     HEFQREKVRSLIHLITNELKLNGFETEYLFLPFRPEQTNEKLLSFLNSIFPLGNGQPV
                     ADEKIQKILNRTEVWTLFQALKYIWCRLPNGEIIGWAAYNEFKTKEAEQNYSQKSFLE
                     IMPKCLDSPNHASIVYDFFDLIVTMASNSKKNKMSARKISKMCAVWAFQMDQDTATNM
                     IFDARRADTNDYKQGLSQWIPAAEAMFHLLLAFIRSFVPTDSTKVKLPKSLRNILFDN
                     AYPPKNSDTFTSETILTVPIVTLMTTKFTRKPWQLIERCNELMDFDEPEKFETREDFA
                     LLKSLFKKKKNIEGISSKMSKESKRLMKCMSTKHSTFQAGWSKGRNLPSSNPDLIEES
                     ISISRVDIDDYFIWAWLSTLSYEQTSQKRKMFGRSLILEFEFDGFKKWLILEECDAVF
                     ESKAYNCVDRTDYINTAVSDTPKDEFLQQTTKGEAKETSRVPKDSAEPVQMSSQSPTP
                     SSVPSLDKTMLPEKEIRTKPLPVPGLIDNVVSKTDQTSVRRPSPLRTQASVPRAGDSE
                     NPLNHEISPSHDKIASVQPRISKSPQLINKPFIEDTTFAERRTESPRPSASPQLDYQK
                     QQHRQQQHRQQQDPSPEQVLQTEQKHVPLFTSPYRKSPSEKAGSLSNYGHYEPQYRKL
                     SPSPTPLARSQAQDASECVRLSSSTYDELTIRGLPVHTDREKSSVTPDSVVKNYSIDD
                     TLPVDSQERIEVEQQVSAKGLGLDETDSKNRISDLANLVDDMTLEMITADPGDAVKDL
                     DASLRTSDEKFETLTMFDKYKSRAQHNQRPEDPLNDSQISIVTPLDISTNSMIPTEAN
                     DDVTTIPSESKIRGKDLPVVPLVVTENTTSNASSEELPKQTPTPRMQPMIAQSALPTS
                     TREQRMTGSPSTPPIRQSDNPYQRTYPPAARQPLINEGSETNVKSSQNHQRGALPANY
                     ESQVRTLAPQTSSGSALPVIARLDPSPERYQSQGTPERYQQNYAENYSNTVESGPNYS
                     LKQYTPPEADQQFKQHQLPPTQPGGHPSEHGRTHFKAQYPQSQPNHQHPYQNANYNGP
                     AYNSSAGFNPPNVQQATYETIAESGDFSSVSQREQYRREGEPRIPQSLPHLEVEGQNS
                     FSNARAPFSPHSNSNMNPHMSAPIDETPTPLGVNDREMRGRIPRHLAQPNLYSRQHGA
                     PRQVSPDYDARTMHPGTMHPGPNAHIPQGTSYGMHQHMPQGKVPVRGPPNGMLQGTVN
                     PQYGVGYGPQRYAPSSAVPPPQTYSSPPPPMQPQQFRPPVNGGRYNQHQSPVPPQPGF
                     IPQGPVTNKLHSGNMDKQTNRKKLYEDIRSGNFGI"
     gene            complement(475717..475788)
                     /locus_tag="KLLA0_C05280r"
                     /db_xref="GeneID:2892508"
     tRNA            complement(475717..475788)
                     /locus_tag="KLLA0_C05280r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2892508"
     gene            <476377..>476808
                     /locus_tag="KLLA0_C05302g"
                     /db_xref="GeneID:2892510"
     mRNA            <476377..>476808
                     /locus_tag="KLLA0_C05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452436.1"
                     /db_xref="GeneID:2892510"
     CDS             476377..476808
                     /locus_tag="KLLA0_C05302g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452436.1"
                     /db_xref="GeneID:2892510"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF3"
                     /translation="MTEVEPNVTREASEQPSTETAAETGKTDEQRKITTTDKTDDKPV
                     EEPAEKKPKTSAQIKASHWKPGSLEIKAFTGYALKLRCWKNVDKEGPITSAVGSQAEA
                     KEDASIEADAETSIEPQEKGDSKPDQDESQSESETSETQPN"
     gene            <478376..>479665
                     /locus_tag="KLLA0_C05324g"
                     /db_xref="GeneID:2892517"
     mRNA            <478376..>479665
                     /locus_tag="KLLA0_C05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452437.1"
                     /db_xref="GeneID:2892517"
     CDS             478376..479665
                     /locus_tag="KLLA0_C05324g"
                     /note="uniprot|Q12628 Kluyveromyces lactis KLLA0C05324g
                     Glucan 1 3-beta-glucosidase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452437.1"
                     /db_xref="GeneID:2892517"
                     /db_xref="GOA:Q12628"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /translation="MLSMQVVSLISLLVSVCLAQPLPLSKRYFEYENYKVRGVNLGGW
                     LVLEPFITPSLFETFRTNEYNDDGIPYDEYHYCQYLGEDLARDRLKQHWSTWITEADF
                     EDISNTGLNTVRIPIGYWAFELLDDDPYVSGLQEAYLDQAIEWARSYGLKVWVDLHGA
                     PGSQNGFDNSGLRDQVEFQQDGNWDVFKNVLAYVIEKYSRDEFTDTVVGVEVLNEPLG
                     PVIDMDKLKELYNWAYDYLRNDLQRDQILVIHDAFQKANYFDDQLTVEQGAFGVLVDH
                     HHYQVFSPEEVGRTIDEHISVVCEQGKETLTEAHWNVVGEWSAALTDCTKWLNGVGIG
                     ARYDGSFVKNQDTSYWIGSCEGSQDISTWTSDKKDNYRKYIEAQLDAYEIRNGWIYWC
                     YKTEDTLEWDYRKLVQSGLFPQPLTNRQFPNQCSSTY"
     gene            <480364..>481104
                     /locus_tag="KLLA0_C05346g"
                     /db_xref="GeneID:2892379"
     mRNA            <480364..>481104
                     /locus_tag="KLLA0_C05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452438.1"
                     /db_xref="GeneID:2892379"
     CDS             480364..481104
                     /locus_tag="KLLA0_C05346g"
                     /note="weakly similar to uniprot|P43582 Saccharomyces
                     cerevisiae YFL010C WWM1 WW domain containing protein
                     interacting with Metacaspase (MCA1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452438.1"
                     /db_xref="GeneID:2892379"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF1"
                     /translation="MASRDLAPQVPEGWKAVYDDQYQTWFYVNLKTEQSQWEEPEGTT
                     WPRGVEQRPAGPPPSASYSSNVPEKAPEPQYVQQQPEQQQSYPAQQPEAQSQPQSYPT
                     ESYPAQSYPQQQPVYQQQQPAYQQPYVATPAQGTAQPQEQQKASKGYGSTVLGGIAGI
                     GTGLLAGSLLSHAMSSHHDKKHNESHFSGSSGSSGFGGFGGFGGSSGGRPNERPFNGP
                     PNNNHGGFGGHGGPGGPGGHGGRGDGRF"
     gene            <481598..>486415
                     /locus_tag="KLLA0_C05368g"
                     /db_xref="GeneID:2892355"
     mRNA            <481598..>486415
                     /locus_tag="KLLA0_C05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452439.1"
                     /db_xref="GeneID:2892355"
     CDS             481598..486415
                     /locus_tag="KLLA0_C05368g"
                     /note="some similarities with uniprot|Q08562 Saccharomyces
                     cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
                     DNA-dependent ATPases plays a role in antagonizing
                     silencing during mating-type switching contains an
                     N-terminal domain that interacts with Sir4p and a
                     C-terminal SNF2 domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452439.1"
                     /db_xref="GeneID:2892355"
                     /db_xref="GOA:Q6CUF0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF0"
                     /translation="MTENGAEIPVVNLTLDAEEEEENEVVSELKRQETPKLFVKREID
                     EIEAEHLQPLVKHFKPMEQDSQVIVVSSEEEADVKPAEGAHVALQHLQERLLVLTKKL
                     RAKKSMTDVLTNKLARRKDAEDTLQVKYRSLLNLYGEDPNMPSQRKLLTDLRQQIRAA
                     EERTVATRTKLHSVKRDHHDLENEIKQLYERIRAISSHNGKEMSLQLQSVSKDIIKDV
                     RKHNLFVETINKVKELLRNTSRSEDNKIYINTLCDRLLAFESEIFYEQPSSVFLKATI
                     YQILTELTSQGIKMPYIFQRFQELKLYDEDLPKSEESLSTDSKFKSHIDQVFSLADKI
                     HRPDKEKHQIKHYASIVLDGYRNRSQYPLQHPGKYNKITHALLRLVQLGVRIPFVLEE
                     MKKLHYNINSAIDSTKVFQEIHAVKSSILEKSLSSDRASKLFKDLDLLIGFLEFTLEG
                     EEVYDPEIVKNIFKLMVHIERLNINIPYTKEAMHKLGLNWDDFIDTEYFLQSITKMKR
                     RLHELKSSRSPADMSRILQSLDCLVFFIEKYHEDKQYKVPTMHSKEREEVCHSAHILH
                     SSGILLLYCYESLTKLGFDWQYYPEESLKVIELAKDMLQKDSSKTIHEKANILTLIQT
                     LEKGIIRAMDMSTFSEMKIESFRLTLSTLQRTGCKMPSVELTYQSIMKGTYLNCLLNA
                     ERQAALVDNARDSQSSTSHSLSSGLKYEKDDKALIGNPPYESKKSTSKLEGHSQLLSL
                     RKLQDEIEEAILTLSTNHSLDKMAQDTIVSALSNILSLLKISEEFNSTTVPSMWRSTV
                     QMSIDVLDRFLYIGTIPGVLDRLFQLGFSIPEQYANDDDLAVIGGKTIKNEEFVTYDS
                     DEDDDIDEVIENYKTRIDHSLRMTNIYNTADASSLRDLLEGLKEIETEVEGEDLTPNE
                     LTVNLLKHQRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALLMANKPEPKSAIKT
                     TLVVAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSWKDLAEYDIVLVSY
                     QTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILD
                     EAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFH
                     SDIGAVLNTKKPYDYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQLPEKHLK
                     ESANKLEGDELEFYQALESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELV
                     KIGESNAKSSKIINGKDFEKDWRPLYFVSKRMGQNQATLNAVNACLDDMTCPVCMEQM
                     DIDSMLVLNSCGHCLCAQCFEPYVDNAKLEPTASFGPKGTNSVNIPCLVCRKMNNDKE
                     AISYQLFDQVNNLNYSIDDLRLEYDKMVAEQKARLKNGYTIDYKSLKESKKVEMCLDI
                     IKKVTDSNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFY
                     QDNNYRVMLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVH
                     RLLIKMSVEDRIVELQNKKKTLVNLAMDPTQIREVNKLGRKELGFLFGLNSLD"
     gene            <486863..>487588
                     /locus_tag="KLLA0_C05390g"
                     /db_xref="GeneID:2892451"
     mRNA            <486863..>487588
                     /locus_tag="KLLA0_C05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452440.1"
                     /db_xref="GeneID:2892451"
     CDS             486863..487588
                     /locus_tag="KLLA0_C05390g"
                     /note="similar to uniprot|Q05905 Saccharomyces cerevisiae
                     YLR301W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452440.1"
                     /db_xref="GeneID:2892451"
                     /db_xref="GOA:Q6CUE9"
                     /translation="MVSLTKRVLFEVIPNPPDETTLTLSSTTNKGHYISVRPFVNAEG
                     KEFPFEWAFGGTSDHIELKKINERANSLNFNFKFDTNVKLNVPETHRGVIKTVFKTWD
                     SGLVEETGSVFPWGTEGTEVKFRELWQPVDPTRLEFVELNNEKDVDQAANSIALSVDN
                     EEYEGLVIVVGRWIQGILFKKGVNTLDGINLFRSQIDEKNSIVSLVKFGADADKFPQE
                     VLLNEGSITTSKGLEWSVIESNL"
     gene            <487927..>488601
                     /locus_tag="KLLA0_C05412g"
                     /db_xref="GeneID:2892505"
     mRNA            <487927..>488601
                     /locus_tag="KLLA0_C05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452441.1"
                     /db_xref="GeneID:2892505"
     CDS             487927..488601
                     /locus_tag="KLLA0_C05412g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452441.1"
                     /db_xref="GeneID:2892505"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE8"
                     /translation="MEPVFSSRISIKWGEQEPHEDTNTWVLTAGNGKFVDARIDLKTN
                     IPQWLITGEEQEIPTKDGYEFSLKFVHELDSVHGNDPERSADFGHFKSLTYSSRLEEG
                     EMYNVSEERVMTYKEIWQTIDPIRSSTDHLVPVESDIYDGSSVTSIVWELSDDAKNNA
                     RGRLISIGKVSQGIVEYNGLFQCIRTWNNSVVYQYGSHVEEIFGQFMKGLSTHNSQFP
                     WQRTYP"
     gene            489024..489095
                     /locus_tag="KLLA0_C05434r"
                     /db_xref="GeneID:2892332"
     tRNA            489024..489095
                     /locus_tag="KLLA0_C05434r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2892332"
     gene            complement(<489363..>490034)
                     /locus_tag="KLLA0_C05456g"
                     /db_xref="GeneID:2892502"
     mRNA            complement(<489363..>490034)
                     /locus_tag="KLLA0_C05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452442.1"
                     /db_xref="GeneID:2892502"
     CDS             complement(489363..490034)
                     /locus_tag="KLLA0_C05456g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452442.1"
                     /db_xref="GeneID:2892502"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE7"
                     /translation="MDLPELINCSDDDDEGEFVDYCYNTLDSYASTLSIHTLNDYNES
                     GFQNYQDENSAMSNNRNDFTVSDSCKKGYQSYNKIFGKNKIGSNLSSVISLLNFQASK
                     ISDQRQCITTKWNLGFNPTIQKFQFLVTELFDIDSSGFEFITISVKLPRNDPKKWHHY
                     ISHSSYQHIMASFHFRNLSTLQRLNNNIVSHEKECILTQVWLLDGTEKEVSTAVHRLD
                     SLVLA"
     gene            <490633..>491040
                     /locus_tag="KLLA0_C05478g"
                     /db_xref="GeneID:2892499"
     mRNA            <490633..>491040
                     /locus_tag="KLLA0_C05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452443.1"
                     /db_xref="GeneID:2892499"
     CDS             490633..491040
                     /locus_tag="KLLA0_C05478g"
                     /note="highly similar to uniprot|P53173 Saccharomyces
                     cerevisiae YGL054C ERV14 Protein localized to COPII-coated
                     vesicles involved in vesicle formation and incorporation
                     of specific secretory cargo required for the delivery of
                     bud-site selection protein Axl2p to cell surface related
                     to Drosophila cornichon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452443.1"
                     /db_xref="GeneID:2892499"
                     /db_xref="GOA:Q6CUE6"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE6"
                     /translation="MGVWLFIFAVIANCVNLFAQVHFTILYADLEADYINPIELCSKV
                     NKLILPEAALHGFISLLFLLNGYWFVFLLNLGILAYNGNKFYKKQQLLDATEIFRTLG
                     KHKRESFIKLAFYLFLFFFYLYRMIMSLIAASE"
     gene            complement(<491305..>492183)
                     /locus_tag="KLLA0_C05500g"
                     /db_xref="GeneID:2892623"
     mRNA            complement(<491305..>492183)
                     /locus_tag="KLLA0_C05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452444.1"
                     /db_xref="GeneID:2892623"
     CDS             complement(491305..492183)
                     /locus_tag="KLLA0_C05500g"
                     /note="some similarities with uniprot|P38313 Saccharomyces
                     cerevisiae YBR211C AME1 associated with microtubules and
                     essential regulator of microtubule stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452444.1"
                     /db_xref="GeneID:2892623"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE5"
                     /translation="MDALKQRHLKLLYRQRGSASRTIDYDVVIEPELREDGDLVTDSQ
                     LTEQDDQSFPDIQVPSPDRVDDFDLNQGDGLMDKATANEDDIDHVIGDEVAAVNAPVE
                     TSDLVIDTTQFDSMTLSQLSTPLTSMATIDVLRRLLETVILVTIEERTSQFNRAGSAR
                     LRLKLKLEIKILTWFLHQSKEDLITISELNLSNNDLLYRLKQISLLKNSLSRSLLDVR
                     SAISSYEGPNNALSEEQVALQNFKRINELILSQRIDTIINNNLPPDTSTFDTESKKGL
                     LPTLKTLNESLQNTIG"
     gene            <494240..>495862
                     /locus_tag="KLLA0_C05522g"
                     /db_xref="GeneID:2892300"
     mRNA            <494240..>495862
                     /locus_tag="KLLA0_C05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452445.1"
                     /db_xref="GeneID:2892300"
     CDS             494240..495862
                     /locus_tag="KLLA0_C05522g"
                     /note="some similarities with uniprot|P32831 Saccharomyces
                     cerevisiae YBR212W NGR1 negative growth regulatory
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452445.1"
                     /db_xref="GeneID:2892300"
                     /db_xref="GOA:Q6CUE4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE4"
                     /translation="MPTIPAPPTTTLQSSNELPRTLWMGDLDPGFDELIIASIWQSLG
                     KSVKVKLIKSKTNALVPINSTSIPNNASSNALEINGVSFIDPNKTNLHHAGYCFVEFE
                     SFEDAQQALTLNATPIPNISCNTTASKRTNDDGKRKFRLNWANGATLHSTILPTPEFS
                     LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNAL
                     IEMNGVQFQGRQLRVAYATPRNNVAQQHLSGNLGQQLHSNIILQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQHEQQLQLQHLQLQHQQQQQQQQQQQQHHHHHQLQFQNHHIQPHQQ
                     QKAPPLINHQVAPMMNQTAPMLLDTANVLVSLQMPPPQANPSVNDVILTGNSNGTTGS
                     STTSNSNSNYSINNKQNNNFDVNNPNGLSVYSPTSSSTTTVNNNAMNAGVSSTTVFVG
                     GLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFIIMGS
                     PIRLSWGRLNSNSASASNATTTTAPPSSYLYV"
     gene            <496583..>497374
                     /locus_tag="KLLA0_C05544g"
                     /db_xref="GeneID:2892146"
     mRNA            <496583..>497374
                     /locus_tag="KLLA0_C05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452446.1"
                     /db_xref="GeneID:2892146"
     CDS             496583..497374
                     /locus_tag="KLLA0_C05544g"
                     /note="similar to uniprot|P15807 Saccharomyces cerevisiae
                     YBR213W MET8 Bifunctional dehydrogenase and ferrochelatase
                     involved in the biosynthesis of siroheme also involved in
                     the expression of PAPS reductase and sulfite reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452446.1"
                     /db_xref="GeneID:2892146"
                     /db_xref="GOA:Q6CUE3"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE3"
                     /translation="MLQLSHKLDGRHILLVGCGEVGYTRVLKLLPTGCKLTIISPEIH
                     PKLTDLVNNDQYQPGQIYKYLARNFEEDDLVMYGNNQVSKVEDLNKPLGFHMVFTCLP
                     DLKLSTRIYQLTKLKLGMGTLCNVADQPPLCDFYFGANLRLGDENFGLSIMISSEGMS
                     PRFTALFKKELLSRYGDYPIKECVGKLSEVRERVRTTSEKYLDQFDNDNAQLIKFRME
                     WLKALTDKMGIECYKLDTDKVIKLFEDMIKTKRFELKDVPENSIM"
     gene            complement(<497877..>499310)
                     /locus_tag="KLLA0_C05566g"
                     /db_xref="GeneID:2892035"
     mRNA            complement(<497877..>499310)
                     /locus_tag="KLLA0_C05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452447.1"
                     /db_xref="GeneID:2892035"
     CDS             complement(497877..499310)
                     /locus_tag="KLLA0_C05566g"
                     /note="similar to uniprot|P21147 Saccharomyces cerevisiae
                     YGL055W OLE1 Fatty acid desaturase required for
                     monounsaturated fatty acid synthesis and for normal
                     distribution of mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452447.1"
                     /db_xref="GeneID:2892035"
                     /db_xref="GOA:Q6CUE2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE2"
                     /translation="MEQVDLVNANVLAAGANKKSVRVVNGLGSLMGSKQMADVDFEND
                     SNMDYLLEQDKKEKEKYKNKRHISELPWTLNNWHLHLNWLNLILVVAIPLYGVYMALS
                     GRVPLRHEILIFSMIYYCIGGISITGGYHRLWAHRAYSAHWPLRLFFAVFGAASVEGS
                     IKWWSHSHRIHHRYTDTVRDPYDARRGLWYSHMGWMLLQPNPKHRARADIADLTDDWI
                     VRWQHRNYIPLMLFSAFILPALFCHYMWNDFWGGLIYGGVLRVCAIQQATFCINSLAH
                     YLGDQPFDDRRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVLIYLT
                     SLFGLSYDLKKFSQNAIQQGLVQQQQKKLDRTRSKLNWGSPLSKLPVWDKDEFMEKLK
                     SNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATKAFNGGVYLHSNAAHNILAT
                     MRIAVVKDNVDQAAKFAARRGEVYEKK"
     gene            <500622..>502178
                     /locus_tag="KLLA0_C05588g"
                     /db_xref="GeneID:2892397"
     mRNA            <500622..>502178
                     /locus_tag="KLLA0_C05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452448.1"
                     /db_xref="GeneID:2892397"
     CDS             500622..502178
                     /locus_tag="KLLA0_C05588g"
                     /note="similar to uniprot|P53172 Saccharomyces cerevisiae
                     YGL056C SDS23 Spindle pole body protein and similar to
                     YBR214W uniprot|P38314 Saccharomyces cerevisiae YBR214W
                     SDS24 Nuclear protein with similarity to S. pombe Sds23,
                     suppresses dis2 mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452448.1"
                     /db_xref="GeneID:2892397"
                     /db_xref="GOA:Q6CUE1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /translation="MQSSGSSASSSRHVSIVELLSTPPNAGVPSNSAAPSSSSRVAAQ
                     AQVQSQSQSPKLSATAAAAAAATADNFGNGNSNFGQAGAGTPAGSHIHHGSDAESISS
                     ISSASTTSMHCPLERTGSGTGSGYVPGPNSDVPISPSLSAVDTLHSHSVSRTNSESSF
                     DTQLSRIHTTKWQLIPLSQLVEQNKLIFIDGSISVEEAFNTLVKYNLTSLPVENSPDD
                     IDCLTFDYNDLNSYLLLVLNKITVNNPEVTRQCQLGHPVPVGEIIKLTPKNPFYKLPE
                     QENLSTAMMILGSGVHRVAITNQENTKITGILSQRRLIKYLWDNARSFQNFEHLFQKS
                     LKDLKIGVLDTHTKPTSRQSRVISIQGDELLIMALFKMHTERISSIAVIDPQGNLLGN
                     ISVTDVKHITRTSQYPLLQNTCLHFISVILDKRGIEMGKDSFPIFHVYPTSSLARTIA
                     KLVATKAHRLWIVQPSGDTPVDSEKDKRSGKLIGVVSLTDILGLLARHQTEFKRVDPL
                     AARRQRGSIV"
     gene            <502744..>503295
                     /locus_tag="KLLA0_C05610g"
                     /db_xref="GeneID:2892601"
     mRNA            <502744..>503295
                     /locus_tag="KLLA0_C05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452449.1"
                     /db_xref="GeneID:2892601"
     CDS             502744..503295
                     /locus_tag="KLLA0_C05610g"
                     /note="some similarities with uniprot|P53171 Saccharomyces
                     cerevisiae YGL057C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452449.1"
                     /db_xref="GeneID:2892601"
                     /db_xref="UniProtKB/TrEMBL:Q6CUE0"
                     /translation="MPRPVPKSLLLRQARRLSPATQAPTPTLGALISQFTLSDNFDET
                     TLEEQYEQLKPLLTSITLTNVPFDTWTSNDINVLKHHLDAKAPLPWKFLTDDEKRVWY
                     LLGFGTWGPRKEFNKVKPNDIQWNANAKVSSNQSDVPKVVTPIPICSSDRIEWEKKKR
                     QLDPLTISVGVFASMITLTAFLV"
     gene            complement(<503484..>503978)
                     /locus_tag="KLLA0_C05632g"
                     /db_xref="GeneID:2892656"
     mRNA            complement(<503484..>503978)
                     /locus_tag="KLLA0_C05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452450.1"
                     /db_xref="GeneID:2892656"
     CDS             complement(503484..503978)
                     /locus_tag="KLLA0_C05632g"
                     /note="highly similar to uniprot|P06104 Saccharomyces
                     cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme (E2)
                     involved in postreplication repair (with Rad18p)
                     sporulation telomere silencing and ubiquitin-mediated
                     N-end rule protein degradation (with Ubr1p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452450.1"
                     /db_xref="GeneID:2892656"
                     /db_xref="GOA:Q6CUD9"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /translation="MSTPARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPA
                     DTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
                     ASILTSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVEKSWEDDMEDMADED
                     EDEE"
     gene            complement(<504568..>505989)
                     /locus_tag="KLLA0_C05654g"
                     /db_xref="GeneID:2892383"
     mRNA            complement(<504568..>505989)
                     /locus_tag="KLLA0_C05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452451.1"
                     /db_xref="GeneID:2892383"
     CDS             complement(504568..505989)
                     /locus_tag="KLLA0_C05654g"
                     /note="similar to uniprot|P53170 Saccharomyces cerevisiae
                     YGL059W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452451.1"
                     /db_xref="GeneID:2892383"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD8"
                     /translation="MSRNSVVRKVLDISQVPDFSRYSATRSINELAPYISSTLSAYPT
                     ESKYINQYHYYHNDNVLVKKYLQKKPHPMSLKQLAQYYDDSSKLTKMKIISSGKFVKE
                     ELCVRIAHKLDLLQNLPFDVVNNFHFNQVYESYYNIFERFRKFPEIKDEKDNLKFCQF
                     LHAILSDFNSLNLPHLIMGALECRILDLYPQDKMDALISDLLRARISRRLIVEEHLSI
                     TSNYLSGKKENTLVLGDIFQKCNAKEYLNGAREVCEAYINNMYFAGIKMPELIINGDT
                     ELEFYFLPSHLKFLLGEILRNSYEVTVKETIRLGLEKAPPVTVTIISNDQSYLFRISD
                     RGGGVPHSDKQIWSFGKSKELAKQSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTS
                     LDRMSENNLTKGKFKVGQPLMELLKRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGY
                     GTDTVLKLGNLMRHTDKLQLDRV"
     gene            <506539..>508074
                     /locus_tag="KLLA0_C05676g"
                     /db_xref="GeneID:2892324"
     mRNA            <506539..>508074
                     /locus_tag="KLLA0_C05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452452.1"
                     /db_xref="GeneID:2892324"
     CDS             506539..508074
                     /locus_tag="KLLA0_C05676g"
                     /note="weakly similar to uniprot|Q01448 Saccharomyces
                     cerevisiae YBR215W HPC2 Highly charged basic protein
                     required for normal cell-cycle regulation of histone gene
                     transcription mutants display strong synthetic defects
                     with subunits of FACT a complex that allows RNA Pol II to
                     elongate through nucleosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452452.1"
                     /db_xref="GeneID:2892324"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD7"
                     /translation="MNEVTASDNNSASSSTSGSTSALTDEQPPTKKMKVVPNIAEELA
                     KNRSPPLSNSHNNVKKQISISSLLSDPQPPKPVIRAPTIILPSQRPGTSNIEETDTND
                     ILIARTKSPVSVLLDRPQSNTQNPTDSHDRGLTIPVTSIDTLLKNGSAMSTAPATDST
                     NAALKINGDGDSTKIEPASSTTSSTKDQKTKGKTKEETNNKVPRTTAKNTKSAASKSA
                     KNSKATTAKNKKEPVKKDSRAKQDNKNKQDNKPKSESSTPGSTIATLSNNTPEVSALN
                     ETKVKLEQTELETADNKEDAKKDKSKKKKVETPRKLVPAPSIKSPKVTSMEVNGKPIV
                     VLDIPLHDVSSNDYLDENGQVVFNVYNLIQEKYGSQLNKAKRNLMVDLNDDVEAAEDN
                     EGEEAADIEHGGEDDDDDDDDDDEEEEDDVAASDPSKNKDNSVSPKKKRPHPLKGKSR
                     IGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRVDGTMKKGGIK
                     NPK"
     gene            complement(<508204..>510312)
                     /locus_tag="KLLA0_C05698g"
                     /db_xref="GeneID:2892447"
     mRNA            complement(<508204..>510312)
                     /locus_tag="KLLA0_C05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452453.1"
                     /db_xref="GeneID:2892447"
     CDS             complement(508204..510312)
                     /locus_tag="KLLA0_C05698g"
                     /note="similar to uniprot|P38315 Saccharomyces cerevisiae
                     YBR216C YBP1 and to uniprot|P53169 Saccharomyces
                     cerevisiae YGL060W YBP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452453.1"
                     /db_xref="GeneID:2892447"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD6"
                     /translation="MPLEVERFKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKG
                     SLEQKYEYLSEVLSLLQQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVI
                     MKCFNEVALFGNPKECFFAGCELMSSLRINDESLVRFIVEEEPVMDPENEDSGDETYT
                     EDEGSSDKTEEEEEKNAVKDSPTPKSANESIPDLKEGYAFYGRLPQEVITELRFYSII
                     ELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIPPS
                     PPPDADKQVSAEELEEIKVSEEVLQRKLLCNILTSALHQLLKARTCISLLNYHSHLQG
                     IPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRIYRSLPKDSEIK
                     SDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILILRSFSNEDFLPPSDAKITL
                     QEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTNNSTHDLMDSLKDLPSYIIT
                     VYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLSCPYEQAKCCA
                     LAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKNSPPPLPSRAYMLLNDDRIATLHSI
                     TLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDSVFLKEICDAVNDKLIKNEKVGD
                     KDEPHYSLLVSTVASISSKL"
     gene            <510735..>511304
                     /locus_tag="KLLA0_C05720g"
                     /db_xref="GeneID:2892360"
     mRNA            <510735..>511304
                     /locus_tag="KLLA0_C05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452454.1"
                     /db_xref="GeneID:2892360"
     CDS             510735..511304
                     /locus_tag="KLLA0_C05720g"
                     /note="similar to uniprot|P38316 Saccharomyces cerevisiae
                     YBR217W ATG12 Protein that becomes conjugated to Atg5p by
                     the E1 enzyme Atg7p a step that is essential for
                     autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452454.1"
                     /db_xref="GeneID:2892360"
                     /db_xref="GOA:Q6CUD5"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /translation="MNSGVLLSESETDTSEVSGRQSELISGDESIKGKLEEFSAKLNE
                     LRLADGNSDGGDEEESLSPDTKSQREESSENSENVSRSTSRPPLTSSIVSSVEREQLK
                     SQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRFLCKRLKRKHIHCYINNAFAPS
                     LDQNIGDLWTQFKVNDELIVSYCETVAFG"
     gene            <511607..>512233
                     /locus_tag="KLLA0_C05742g"
                     /db_xref="GeneID:2891887"
     mRNA            <511607..>512233
                     /locus_tag="KLLA0_C05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452455.1"
                     /db_xref="GeneID:2891887"
     CDS             511607..512233
                     /locus_tag="KLLA0_C05742g"
                     /note="similar to uniprot|Q75ED7 Ashbya gossypii AAR161W
                     DUO1 DASH complex subunit DUO1 and weakly similar to
                     YGL061C uniprot|P53168 Saccharomyces cerevisiae YGL061C
                     DUO1 Essential mitotic spindle protein required to
                     maintain spindle integrity and kinetochore function part
                     of the multisubunit DASH complex which binds microtubules
                     and is transferred to the kinetochore prior to mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452455.1"
                     /db_xref="GeneID:2891887"
                     /db_xref="GOA:Q6CUD4"
                     /db_xref="InterPro:IPR013960"
                     /translation="MVEHKLDASTISKMIPQIFDQMRRQTGSKNFASTPASISTQSLL
                     KEQEQLDKIIPVIQNLNERIKDCKEGDMERIKETCHAMNTILDKFISIQSQASYVNSM
                     MNNEEYLDYVASGKSEEEYISAKQREVEELEKRVKQYTTMHAPSVKPPASKIPVGNDT
                     RKVTKPGQRNGRSGLYSISTRNNSNNSGANGRRPPGNGNNVGRRRVYR"
     gene            complement(<512470..>515991)
                     /locus_tag="KLLA0_C05764g"
                     /db_xref="GeneID:2892373"
     mRNA            complement(<512470..>515991)
                     /locus_tag="KLLA0_C05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452456.1"
                     /db_xref="GeneID:2892373"
     CDS             complement(512470..515991)
                     /locus_tag="KLLA0_C05764g"
                     /note="highly similar to uniprot|P11154 Saccharomyces
                     cerevisiae YGL062W PYC1 and to YBR218C uniprot|P32327
                     Saccharomyces cerevisiae YBR218C PYC2 converts pyruvate to
                     oxaloacetate pyruvate carboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452456.1"
                     /db_xref="GeneID:2892373"
                     /db_xref="GOA:Q6CUD3"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD3"
                     /translation="MSSQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKT
                     VAIYSHEDRLSMHRLKADEAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYG
                     FLSENSEFAEKVAASGITWVGPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETV
                     EEAQAFVDKYGFPVIIKAAFGGGGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFI
                     ERFLDKPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILT
                     DAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQI
                     AAGATLEQLGLMQDKITTRGFAIQCRITTEDPSKNFQPDTGRIDVYRSAGGNGVRLDG
                     GNAFAGSVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLT
                     HPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTT
                     HPTIPHLHNEDGSLVDVSAKPPAGWRDVLLDYGPEEFAKQVRKFNGTLLMDTTWRDAH
                     QSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGGATFDVSMRFLHEDPWERLRTLRK
                     LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGV
                     DAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKIVNSGTHILGIKDMAGTLKP
                     SAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSGADVVDVATNSMSGLTSQ
                     PSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEADLKGPDPEVYVHEIPG
                     GQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKVVGDLAQFMVSNKL
                     TSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRRKLTQRPGLELA
                     PFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVLPTKNFLSPP
                     VIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADRSQKVESV
                     SKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSPADGQV
                     KEVLVKDGENVDASDLLVVLEEAPAKE"
     gene            complement(<517346..>517720)
                     /locus_tag="KLLA0_C05786g"
                     /db_xref="GeneID:2892467"
     mRNA            complement(<517346..>517720)
                     /locus_tag="KLLA0_C05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452457.1"
                     /db_xref="GeneID:2892467"
     CDS             complement(517346..517720)
                     /locus_tag="KLLA0_C05786g"
                     /note="similar to uniprot|P38633 Saccharomyces cerevisiae
                     YGL127C SOH1 Protein with sequence similarity to RNA
                     polymerases; interacts with a DNA repair protein, Rad5p,
                     in the two-hybrid system; may provide a link between
                     recombination in direct repeats and transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452457.1"
                     /db_xref="GeneID:2892467"
                     /db_xref="GOA:Q6CUD2"
                     /db_xref="InterPro:IPR008831"
                     /translation="MSQQASTELTIEEGELPTRFEIELEFVQSLANIPYVTYLLTQLQ
                     LWQDPKFKRYLKYLEYWHEPEYAQCIVYPNSLFVLKLLNTLFEGSTVNENGVLEGCEH
                     VPRILQTQGTQWMNEMVERWRE"
     gene            complement(517949..518069)
                     /locus_tag="KLLA0_C05808r"
                     /db_xref="GeneID:2891845"
     tRNA            complement(join(517949..517985,518033..518069))
                     /locus_tag="KLLA0_C05808r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2891845"
     gene            <518508..>519956
                     /locus_tag="KLLA0_C05852g"
                     /db_xref="GeneID:2892512"
     mRNA            <518508..>519956
                     /locus_tag="KLLA0_C05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452458.1"
                     /db_xref="GeneID:2892512"
     CDS             518508..519956
                     /locus_tag="KLLA0_C05852g"
                     /note="weakly similar to uniprot|Q04712 Saccharomyces
                     cerevisiae YML043C RRN11 rDNA transcription factor CF
                     component which also contains Rrn6p and Rrn7p which is
                     required for rDNA transcription by RNA polymerase I
                     component of rDNA transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452458.1"
                     /db_xref="GeneID:2892512"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="InterPro:IPR016850"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD1"
                     /translation="MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVS
                     SEADNVTNGILTPENSESSEAEAADLEKKHRRKRRLQSVLGNALDSSDEELDGDEDGT
                     DENDPETQFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKL
                     NYQTKKLNMYFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFS
                     ILIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPV
                     FRCGSRTHTPTFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSE
                     IWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSN
                     YEFPENVIEHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPL
                     DTQQYEIENLIPEVESAEFTVPAPIRFGYESD"
     gene            complement(<520079..>521740)
                     /locus_tag="KLLA0_C05874g"
                     /db_xref="GeneID:2891865"
     mRNA            complement(<520079..>521740)
                     /locus_tag="KLLA0_C05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452459.1"
                     /db_xref="GeneID:2891865"
     CDS             complement(520079..521740)
                     /locus_tag="KLLA0_C05874g"
                     /note="weakly similar to uniprot|Q08109 Saccharomyces
                     cerevisiae YOL013C HRD1 Ubiquitin-protein ligase required
                     for endoplasmic reticulum-associated degradation (ERAD) of
                     misfolded proteins genetically linked to the unfolded
                     protein response (UPR) regulated through association with
                     Hrd3p contains an H2 ring finger"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452459.1"
                     /db_xref="GeneID:2891865"
                     /db_xref="GOA:Q6CUD0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6CUD0"
                     /translation="MFGLFNRNPEAGAPGQPQNVFLTQKFIAYSLMSYTAAAWSLHYC
                     VTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIHMLFGQLRLIEYEHILERI
                     SYTVITLLLSCSSMNGLISVMQIHCVLFVCCRTLHWILKDRMEVTFQANDMRLTLKDI
                     LLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYTLFIISQYAILGTDLLQVILR
                     TGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAVAIEEDEDEDEENAGLEGKF
                     IYEKLIDVFISTVKVIIKFASSFSTGRVMMVTVLWEAITTFKSARGLWKNWKSSKSLD
                     ASLMDATDIQIESGEIDICIVCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIA
                     RSPTCPICRLPIFDENGNVMPYQDHSQSTDPNTTAQEISPGIAVETNSQTNINTLETT
                     NQNITLSPDNSTAQNLAFLPTRNTSLIIPIQREDEHKHKFKILTESGKEIEGSLILRN
                     NIDTTKGSVVLPQDLLIDQDASQLKRKIADLESKLEELSKKVKRE"
     gene            <522074..>522550
                     /locus_tag="KLLA0_C05896g"
                     /db_xref="GeneID:2892391"
     mRNA            <522074..>522550
                     /locus_tag="KLLA0_C05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452460.1"
                     /db_xref="GeneID:2892391"
     CDS             522074..522550
                     /locus_tag="KLLA0_C05896g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452460.1"
                     /db_xref="GeneID:2892391"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="UniProtKB/TrEMBL:Q6CUC9"
                     /translation="MSAIALKLGALLVRQVTRPMANVLKRQAKEHAVFKEICIGLAQK
                     MHVADVVLRSKLTPTKFSKTIRPLNDTKAVENGATLLSEGFVFGVTGSVVVWETLRQR
                     QKELDRREQVTQDIAFLQSEIEELRSTTKTQSDQIKSCQSLKEELKLIQSKLSSHK"
     gene            complement(<522995..>523393)
                     /locus_tag="KLLA0_C05918g"
                     /db_xref="GeneID:2891943"
     mRNA            complement(<522995..>523393)
                     /locus_tag="KLLA0_C05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452461.1"
                     /db_xref="GeneID:2891943"
     CDS             complement(522995..523393)
                     /locus_tag="KLLA0_C05918g"
                     /note="similar to uniprot|Q12692 Saccharomyces cerevisiae
                     YOL012C HTZ1 Histone variant H2AZ exchanged for histone
                     H2A in nucleosomes by the SWR1 complex involved in
                     transcriptional regulation through prevention of the
                     spread of silent heterochromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452461.1"
                     /db_xref="GeneID:2891943"
                     /db_xref="GOA:Q6CUC8"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSGKVHGGKGKSGAKDSGSLKSQSHSARAGLQFPVGRVKRYLKR
                     NAAGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DSLIRATIASGGVLPHINKALLLKVEKKHK"
     gene            <524768..>526690
                     /locus_tag="KLLA0_C05940g"
                     /db_xref="GeneID:2892361"
     mRNA            <524768..>526690
                     /locus_tag="KLLA0_C05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452462.1"
                     /db_xref="GeneID:2892361"
     CDS             524768..526690
                     /locus_tag="KLLA0_C05940g"
                     /note="uniprot|O59863 Kluyveromyces lactis KLLA0C05940g
                     PLB Lysophospholipase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452462.1"
                     /db_xref="GeneID:2892361"
                     /db_xref="GOA:O59863"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /translation="MWFLNSVNLLFLVCSVALHLDAVNAWSPTNGYAPGVVDCDENIN
                     LVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSIIDKLLATQDTAPKV
                     AIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAGLSGGNWLVGTLA
                     YNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRWDDISDAVEEKKKAGFN
                     TSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMPFPISVAVGRYPGTQV
                     VNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGKCVAGFDNTGFVMG
                     TSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIWAPNPFYEITNIPSNY
                     SQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQSWPDGFSLTQ
                     TYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPPLVVYMPN
                     TRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQES
                     LNYTLPSECDACFEKYCWNGTVDATTPISSTTSSSASSTSTSDSGNKENSARILAPRS
                     TLSLLIGGLASVFISF"
     gene            complement(<527216..>528316)
                     /locus_tag="KLLA0_C05962g"
                     /db_xref="GeneID:2892444"
     mRNA            complement(<527216..>528316)
                     /locus_tag="KLLA0_C05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452463.1"
                     /db_xref="GeneID:2892444"
     CDS             complement(527216..528316)
                     /locus_tag="KLLA0_C05962g"
                     /note="similar to uniprot|P50105 Saccharomyces cerevisiae
                     YMR005W TAF4 TFIID subunit (48 kDa) involved in RNA
                     polymerase II transcription initiation potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452463.1"
                     /db_xref="GeneID:2892444"
                     /db_xref="GOA:Q6CUC6"
                     /db_xref="InterPro:IPR007900"
                     /translation="MAKSPKRKNSEPEDLSSNKRSKSFEFGKVENGLEPSGSDFGSDL
                     PTPFDTMVTEQPLALPKASSPTTNLASPRNSSTPNLKTTSTTSKQSQKAEQKKNAGGS
                     TGSTTASTTKPQQSDPDKLSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSH
                     PPFLHPKNISDFMKRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHR
                     RKGVKLNTGRRSEVSRSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYR
                     ASNATANLMIAGGNKKKYSWLTAGSKSSSTDLKNQGNVSSAVAARGEMGIKYREAREE
                     PGIVMRDLLLALENRRVGVNNVITKGYARIRD"
     gene            <528906..>530000
                     /locus_tag="KLLA0_C05984g"
                     /db_xref="GeneID:2892494"
     mRNA            <528906..>530000
                     /locus_tag="KLLA0_C05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452464.1"
                     /db_xref="GeneID:2892494"
     CDS             528906..530000
                     /locus_tag="KLLA0_C05984g"
                     /note="highly similar to uniprot|Q08096 Saccharomyces
                     cerevisiae YOL010W RCL1 RNA terminal phosphate
                     cyclase-like protein involved in rRNA processing at sites
                     A0 A1 and A2 does not possess detectable RNA cyclase
                     activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452464.1"
                     /db_xref="GeneID:2892494"
                     /db_xref="GOA:Q6CUC5"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="PDB:3PQV"
                     /db_xref="UniProtKB/TrEMBL:Q6CUC5"
                     /translation="MSSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGL
                     KDYEVSFLRLMEAVTNGSSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPM
                     LYLAPFSKKKFSILFRGITSSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPL
                     GGGEVHLVVDSLIAQPITMHALDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSA
                     SCEVNITADVWRGENSGKSPGWGLTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYH
                     LLEEISKSGVVGRNQLPLTILYMIIGKEDIGRLRITKDQIDERFVWLLRDIKKVFGTE
                     ILLKPVDDNTTDLIATIKGIGFTNTNKKIA"
     gene            complement(<530169..>531707)
                     /locus_tag="KLLA0_C06006g"
                     /db_xref="GeneID:2892476"
     mRNA            complement(<530169..>531707)
                     /locus_tag="KLLA0_C06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452465.1"
                     /db_xref="GeneID:2892476"
     CDS             complement(530169..531707)
                     /locus_tag="KLLA0_C06006g"
                     /note="similar to uniprot|P40959 Saccharomyces cerevisiae
                     YMR004W MVP1 Protein required for sorting proteins to the
                     vacuole overproduction of Mvp1p suppresses several
                     dominant VPS1 mutations Mvp1p and Vps1p act in concert to
                     promote membrane traffic to the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452465.1"
                     /db_xref="GeneID:2892476"
                     /db_xref="GOA:Q6CUC4"
                     /db_xref="InterPro:IPR001683"
                     /translation="MDLEADPWRVNSEENGNNISGSVWEPDNSSVNALKSYSADSLQQ
                     EANKRVNDDYLGVNIFSNGDNIVRGTASNVYQNDVLWDRPNIGSTTQETDIRGVNRFQ
                     ATDTPQYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPEREGLVFKHTNYLVKHLTPL
                     PNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIGSQNADPLFLAKRRKG
                     LSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEFTDKHISSSFMNLW
                     RKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLGQILNAIPDTTE
                     ALYPQSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKAFIDVIIALKG
                     LFERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISRDKRSILDQ
                     MNRSWLIRECILEEFTIFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICKKLRDMP
                     LQRH"
     gene            complement(<532044..>532961)
                     /locus_tag="KLLA0_C06028g"
                     /db_xref="GeneID:2892491"
     mRNA            complement(<532044..>532961)
                     /locus_tag="KLLA0_C06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452466.1"
                     /db_xref="GeneID:2892491"
     CDS             complement(532044..532961)
                     /locus_tag="KLLA0_C06028g"
                     /note="similar to uniprot|Q92328 Saccharomyces cerevisiae
                     YOL009C MDM12 Required for normal mitochondrial morphology
                     and distribution Mdm12p is a mitochondrial outer membrane
                     protein. An Mdm12p homolog exists in S. Pombe which
                     confers a dominant negative phenotype when expressed in S.
                     cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452466.1"
                     /db_xref="GeneID:2892491"
                     /db_xref="GOA:Q6CUC3"
                     /db_xref="InterPro:IPR027532"
                     /translation="MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTN
                     FDLGTMPPNVILKQMDDPLDEFYSYLLQEGDISKEAAKDKNTDVQLLVELDYKGDMSI
                     ELSADLVLNYPSPQFMILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLLEND
                     KLQVDPSGPNFMGKRALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFR
                     NLIRKEAAWPSWIDLDFTPEDPEDPEEEGRENDLVADSSNDGKDIEMKSGTEETLGAG
                     IQESVQHVSPAVTSIDQESRVNSNTSLEE"
     gene            <533200..>533817
                     /locus_tag="KLLA0_C06050g"
                     /db_xref="GeneID:2891948"
     mRNA            <533200..>533817
                     /locus_tag="KLLA0_C06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452467.1"
                     /db_xref="GeneID:2891948"
     CDS             533200..533817
                     /locus_tag="KLLA0_C06050g"
                     /note="similar to uniprot|Q08058 Saccharomyces cerevisiae
                     YOL008W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452467.1"
                     /db_xref="GeneID:2891948"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q6CUC2"
                     /translation="MLTVGTGKIAMILSFSKLTPCPQASALGKRSFFNLTTEASSKDE
                     QHYVLKRNIRGTPNEVYEVVSEVSNYKDFIPYCTESFVNLRDEKNRPVEAGLRVGFQQ
                     YDEKFVCKVQCKELSDLVKSVTAESLSHNLFHVLNSKWVIKAHPGRTDHTEVELILRY
                     QFKSRLYTSVASLFAKSVTELILKAFDRRVYQLKKKGSIETRGMK"
     gene            complement(<534152..>534913)
                     /locus_tag="KLLA0_C06072g"
                     /db_xref="GeneID:2892261"
     mRNA            complement(<534152..>534913)
                     /locus_tag="KLLA0_C06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452468.1"
                     /db_xref="GeneID:2892261"
     CDS             complement(534152..534913)
                     /locus_tag="KLLA0_C06072g"
                     /note="similar to uniprot|Q03673 Saccharomyces cerevisiae
                     YMR003W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452468.1"
                     /db_xref="GeneID:2892261"
                     /db_xref="GOA:Q6CUC1"
                     /db_xref="InterPro:IPR003034"
                     /translation="MSLRKVRSLPSLRVLAEVSNPLVRVPPPSFTYQTRQVHNTKKNE
                     HSPMLSSDSHASFTRMSLKTLKNECRTRGLKVSGKKTELVERILLFEGSSSKKLHTSA
                     IQRAKNDSSHIDSMKIPNVAKLEAEAESRKTDYIVKVPSIVNNAATEPKTKIEKDYEK
                     KLQPADKKPLAENVGTVATPDADNVIQTPSVSDSIKVVNPEEELRSGSSEQGRSYSQQ
                     DEELTSRDKKFLLGFAGTVAAWWSLRFWKKEESKK"
     gene            complement(<535470..>535919)
                     /locus_tag="KLLA0_C06094g"
                     /db_xref="GeneID:2891885"
     mRNA            complement(<535470..>535919)
                     /locus_tag="KLLA0_C06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452469.1"
                     /db_xref="GeneID:2891885"
     CDS             complement(535470..535919)
                     /locus_tag="KLLA0_C06094g"
                     /note="similar to uniprot|Q03667 Saccharomyces cerevisiae
                     YMR002W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452469.1"
                     /db_xref="GeneID:2891885"
                     /db_xref="UniProtKB/TrEMBL:Q6CUC0"
                     /translation="MARSRGSARPVSRPQTRSASTVAAPAPAQHQAPNAYSHPPHTAQ
                     PQQPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSSSAPAEQQQQQVAAPVQADT
                     FQNQQATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAARQY"
     gene            complement(<536524..>538881)
                     /locus_tag="KLLA0_C06116g"
                     /db_xref="GeneID:2892647"
     mRNA            complement(<536524..>538881)
                     /locus_tag="KLLA0_C06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452470.1"
                     /db_xref="GeneID:2892647"
     CDS             complement(536524..538881)
                     /locus_tag="KLLA0_C06116g"
                     /note="similar to uniprot|P04786 Saccharomyces cerevisiae
                     YOL006C TOP1 topoisomerase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452470.1"
                     /db_xref="GeneID:2892647"
                     /db_xref="GOA:Q6CUB9"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB9"
                     /translation="MSITLKDDSSSDDEDVVLKRVSKGDKQTKKKLKRVKKELSDGDD
                     SDEDEEIVHAAKKKQKKLKKEKEDAVLRNTNGNGDSNGKVTGRLKVKKERKEKKEKTK
                     KIKKEEVSNEDDEDKNLADIASETPFQSSARASSIELKESSEDFKWWENGDKEDDTIK
                     WTTLKHNGVIFPSTYEPLPAHVKLYYNGKPVDLPPQAEEVAGFFAAILESDHVKIPTF
                     QKNFLHDFLQVLKENGGARNGVQIKEFGKLDFTKIFEYFQVQKEQKKQLSPQEKKQLR
                     LEKEELEKPYKFCEIDGRVEQVGNFRIEPPGLFRGRGAHPKNGKLKRRVYPEDVVLNL
                     DKEAPIPEPPKGHKWGEIRHDNTVQWLSMWRENISNSFKYVRFAANSTLKGMSDFKKF
                     EKARMLKDHIDKVRTDYKSKMKSPKTLDRQMAVATYLIDVFALRAGGEKADDEADTVG
                     CCSLRYEHVTLRPPNTVVFDFLGKDSIRYYQEVEVDAQVFKNLKIFKRPPSGPGHQLF
                     DRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKILRYNAANR
                     TVAILCNHQRTVTKGHASSVQKATERIEELEWQKVRYKRAILQLDKSERKKNQNYFKE
                     IDDLTKEEELTIHKRIIEREREKYKRKFERENEKRKFSKEDPIPDSQLLEWLAKVDDL
                     EKLYERESTTGKIELRESLQNLEKLKQNVEKLEKRITNCSLQLKDKEDNSTVALGTSK
                     INYIDPRLSVAFCKKFDVPIEKVFTKTLRDKFRWAIESADENWTF"
     gene            <540409..>542535
                     /locus_tag="KLLA0_C06138g"
                     /db_xref="GeneID:2891996"
     mRNA            <540409..>542535
                     /locus_tag="KLLA0_C06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452471.1"
                     /db_xref="GeneID:2891996"
     CDS             540409..542535
                     /locus_tag="KLLA0_C06138g"
                     /note="similar to uniprot|P32562 Saccharomyces cerevisiae
                     YMR001C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452471.1"
                     /db_xref="GeneID:2891996"
                     /db_xref="GOA:Q6CUB8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB8"
                     /translation="MSAPPLQIINDKQLNARSNNIHTPIKAKRVVTELHHIDRLTTNG
                     KPTNNNNNNNNNNINRQQPPQKKKKEKLSSLCKTPPSLIKTRGRDYHRGHFLGEGGFA
                     RCFQMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHPNIVQFTDCFEDDT
                     NVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRRVIHRDLKLGNI
                     FFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHSYEVDIWSIG
                     VMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARP
                     SLYEITDNVWFRNTFPSRLPSTITKEIPNFDHLSFSESLINLKQCMLNSGLLKSSQTH
                     SYDGSKNPIELVRTEIEEERNRAVLPQSLSPGGTKNKYKEVIDLDGHRKFNEMAYQNR
                     LKKAGENLFFKPELVATSTNMIKSEMSLKILASECHMTLRGIKSAEIDKRQSNYPSPD
                     STVQDPIVVTKWVDYSNKHGFAYQLSTDDIGVLFNNGTTVLKLADAEEFWYINYDTKE
                     GWVASHYKLESKPIELTRHLEVVDFFSNYMNSNLSRISTLVRETYHKDDVFLRRYTRY
                     KQFVMFELSDGTFQFNFKDHNKFALSHGGKFLTFISSDRKTITLLLSSVLIDGCVPGF
                     PSIDIFEKLELMKEGLRDKASVLTIH"
     gene            complement(<543239..>543604)
                     /locus_tag="KLLA0_C06160g"
                     /db_xref="GeneID:2892295"
     mRNA            complement(<543239..>543604)
                     /locus_tag="KLLA0_C06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452472.1"
                     /db_xref="GeneID:2892295"
     CDS             complement(543239..543604)
                     /locus_tag="KLLA0_C06160g"
                     /note="highly similar to uniprot|P38902 Saccharomyces
                     cerevisiae YOL005C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452472.1"
                     /db_xref="GeneID:2892295"
                     /db_xref="GOA:Q6CUB7"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB7"
                     /translation="MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGN
                     LIRAELLEDEGVLFAAYKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQ
                     SNFETEWNLQTLATEDYGM"
     gene            <544281..>548840
                     /locus_tag="KLLA0_C06182g"
                     /db_xref="GeneID:2892627"
     mRNA            <544281..>548840
                     /locus_tag="KLLA0_C06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452473.1"
                     /db_xref="GeneID:2892627"
     CDS             544281..548840
                     /locus_tag="KLLA0_C06182g"
                     /note="similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
                     ACL004Wp and weakly similar to YOL004W uniprot|P22579
                     Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
                     involved in transcriptional regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452473.1"
                     /db_xref="GeneID:2892627"
                     /db_xref="GOA:Q6CUB6"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB6"
                     /translation="MSAPWNQQPDGPQQQQQQQQQQIPPSTGMINGVQGQSENSPNLL
                     PQLAPPAVNIQIKPEHDQQQHHVTLPSISTISGSNQPSQGQGQEQVQGQQNARSHSHS
                     HSHVHPHIHGPLSGVSNRMDNINLQNGGTPINSAAGSNGPVSTNSEGAIPTPSINNIV
                     QQPDITHQQQQQQLLQGHNVQVENAMTVGQDPLQQAQYSSYRPLNVKDALSYLEQVKF
                     QFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTFLPHGYKIE
                     CSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQNVENQNIEMQQQVSQPQFNNG
                     DQIQHQQLQDQLQNQSATSAAMLVSQPQSQTQPQQLHSQQSPQQQGQPPQRQAQQQPQ
                     PPQLENQFVNQKIVAAGGGMLGALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQ
                     FLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKFLPDSSVSQQQQEQQQEPQQ
                     QQQDQQQEHQQDQEQQHHEQKQQPLPQDQNQQAMLPPQPYLQQNQSMQGQGFYPQSGV
                     LMQPTNLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIPQHVVTQGMSNQDIPVS
                     EMRSTMNGTYNQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPP
                     EDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSK
                     ELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDE
                     MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQT
                     LETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPA
                     VTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTK
                     QLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSN
                     SDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTL
                     SDEDSYLMKDILRRTKNAKTSNSEENQNSSSVKSNEEDETELLAKEAAKPWLLGSLID
                     EANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQF
                     ASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFK
                     IYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGE
                     SENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQED
                     ISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFT
                     RKSVNKFPSSQSTQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLEIDQ
                     TLTITAKIEEPNEPISKEDVPEKAV"
     gene            complement(<548912..>550045)
                     /locus_tag="KLLA0_C06204g"
                     /db_xref="GeneID:2892046"
     mRNA            complement(<548912..>550045)
                     /locus_tag="KLLA0_C06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452474.1"
                     /db_xref="GeneID:2892046"
     CDS             complement(548912..550045)
                     /locus_tag="KLLA0_C06204g"
                     /note="similar to uniprot|Q12006 Saccharomyces cerevisiae
                     YOL003C DHHC- CRD protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452474.1"
                     /db_xref="GeneID:2892046"
                     /db_xref="GOA:Q6CUB5"
                     /db_xref="InterPro:IPR001594"
                     /translation="MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQ
                     TCQTMIWVSYYLAIYTNPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVL
                     AMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRS
                     TSEIIFICIMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLL
                     AQVIDRLVERRPEILPAKQHEINKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYL
                     WLWPWSKPPTIGTSFAKNELFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIET
                     IVSGGEQVIRDKSVDLRDRLGRNSWYNDWGEDLSDFGVDTELE"
     gene            <550683..>552461
                     /locus_tag="KLLA0_C06226g"
                     /db_xref="GeneID:2892291"
     mRNA            <550683..>552461
                     /locus_tag="KLLA0_C06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452475.1"
                     /db_xref="GeneID:2892291"
     CDS             550683..552461
                     /locus_tag="KLLA0_C06226g"
                     /note="similar to uniprot|P32807 Saccharomyces cerevisiae
                     YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
                     binds chromosome ends and is involved in maintaining
                     normal telomere length and structure in addition to
                     participating in the formation of silent chromatin at
                     telomere-proximal genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452475.1"
                     /db_xref="GeneID:2892291"
                     /db_xref="GOA:Q6CUB4"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /translation="MSFEQPDFLKSQLTQTRDDDKESDHKKWRRYEAHDGIVFCIQLT
                     PTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGCYIYNCSHPNAEDNVYEL
                     IPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIADPNNPIELSPVLIKVRETFLQPI
                     EGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYINFVTFFIGSEDKPF
                     DDSMYADILKWGSKINEAQSWLSSHGPSTNPINASYIKSKVKRTKEIKRIKFRCPLML
                     DERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDAETGEAVDNSQL
                     SKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDNIDVPAFVVP
                     NEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDYNQGFYLY
                     KVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLKNGYRPSDFHNPALQK
                     HFKILREYLLQIEVDKSKPEDEGDETLQKVKQIYARIASSAKSDDVKQQRLVKYLKLW
                     NSFYNRLSNLEVDTKPTKNKKAKLNL"
     gene            complement(<552493..>554043)
                     /locus_tag="KLLA0_C06248g"
                     /db_xref="GeneID:2892569"
     mRNA            complement(<552493..>554043)
                     /locus_tag="KLLA0_C06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452476.1"
                     /db_xref="GeneID:2892569"
     CDS             complement(552493..554043)
                     /locus_tag="KLLA0_C06248g"
                     /note="similar to uniprot|Q03264 Saccharomyces cerevisiae
                     YMR285C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452476.1"
                     /db_xref="GeneID:2892569"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB3"
                     /translation="MAGSTQDTGVKDVPKELVEQAKKLSITDGMDQLKVEGKNKVKDK
                     KSKKKGKALNEITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAV
                     PRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNV
                     DVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLID
                     YDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYE
                     RTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPV
                     EYTGRAKTVIECSTSFTFSKLRDGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQK
                     QLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYL
                     YYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCM
                     IVKLGIIM"
     gene            <554658..>554912
                     /locus_tag="KLLA0_C06270g"
                     /db_xref="GeneID:2892204"
     mRNA            <554658..>554912
                     /locus_tag="KLLA0_C06270g"
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /transcript_id="XM_452477.1"
                     /db_xref="GeneID:2892204"
     CDS             554658..554912
                     /locus_tag="KLLA0_C06270g"
                     /note="highly similar to uniprot|P20084 Saccharomyces
                     cerevisiae YMR286W MRPL33 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /protein_id="XP_452477.1"
                     /db_xref="GeneID:2892204"
                     /db_xref="GOA:Q6CUB2"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB2"
                     /translation="MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIA
                     GAVAQIKELVSVELADKALSKAEQRELRKSNPGFTVEKRV"
     gene            complement(<555112..>555882)
                     /locus_tag="KLLA0_C06292g"
                     /db_xref="GeneID:2892305"
     mRNA            complement(<555112..>555882)
                     /locus_tag="KLLA0_C06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452478.1"
                     /db_xref="GeneID:2892305"
     CDS             complement(555112..555882)
                     /locus_tag="KLLA0_C06292g"
                     /note="some similarities with uniprot|Q03208 Saccharomyces
                     cerevisiae YML119W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452478.1"
                     /db_xref="GeneID:2892305"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB1"
                     /translation="MTEGRRLSNRSSIRNTTHIFNDTSSKTKGTKFKFKNGSGTRQSP
                     NKQHISSSPPILEVQNIADVDTSNTFGQFNRISQPPSKNLNYDTPKINVKLEYHTMQS
                     SKIIYKIDVPISSKSDMEISPVITKLINETHESAEAFKLCNDNRFGYTTLDALPAVLS
                     KYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFFSANDSIELSFDGKAMNKNDIFR
                     IVDSFSVAFDDDEYGEDGDDEYVKQPRNILTREVTGVF"
     gene            complement(<556468..>559419)
                     /locus_tag="KLLA0_C06314g"
                     /db_xref="GeneID:2892673"
     mRNA            complement(<556468..>559419)
                     /locus_tag="KLLA0_C06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452479.1"
                     /db_xref="GeneID:2892673"
     CDS             complement(556468..559419)
                     /locus_tag="KLLA0_C06314g"
                     /note="similar to uniprot|P39112 Saccharomyces cerevisiae
                     YMR287C MSU1 RNase component of the mitochondrial
                     degradosome along with the ATP-dependent RNA helicase
                     Suv3p the degradosome associates with the ribosome and
                     mediates turnover of aberrant or unprocessed RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452479.1"
                     /db_xref="GeneID:2892673"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CUB0"
                     /translation="MSSVFSIRRPRVAARFLAHRRYMHSGVPLFQARQSDTSGTNVTT
                     ESLQEDEEVIFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHG
                     ENTDKDEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAI
                     VSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPT
                     IFNTTELEILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAAVQQL
                     PIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEKSIATAFMKSGLSSDA
                     LYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAVTVL
                     PLTKQHLHYHNIIHKLRQHGGVRINRIAALINENDLASLNKSFPYIVPLLRDYAAGNL
                     EHNDTITSLISSLFRKLDEYKELNISRDVCFDLLKRINPSEPPNPLLINHELQLPVNN
                     ERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKSLGGAKY
                     RIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYARSSDL
                     GQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLHKSTRITYEAVDELLDEPTT
                     KPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVFENSSTGIVSLSPDDNSELVEVSFKD
                     QIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEWVKAKTQ
                     ENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNHLQLHR
                     TLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNNWKL
                     QITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPLVGDQISDCEISNIQCLDGILQFE
                     PTSRSKIQKKK"
     gene            <561371..>562930
                     /locus_tag="KLLA0_C06336g"
                     /db_xref="GeneID:2892105"
     mRNA            <561371..>562930
                     /locus_tag="KLLA0_C06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452480.1"
                     /db_xref="GeneID:2892105"
     CDS             561371..562930
                     /locus_tag="KLLA0_C06336g"
                     /note="highly similar to uniprot|P32340 Saccharomyces
                     cerevisiae YML120C NDI1 NADH:ubiquinone oxidoreductase
                     transfers electrons from NADH to ubiquinone in the
                     respiratory chain but does not pump protons in contrast to
                     the higher eukaryotic multisubunit respiratory complex I
                     which is absent in S. cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452480.1"
                     /db_xref="GeneID:2892105"
                     /db_xref="GOA:Q6CUA9"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6CUA9"
                     /translation="MLSLSQTRNLAVRRLSSVSLAVRHSSTSTVHSAKDGSKVPAGSA
                     SFTTTKLIENNADNKPNVVILGSGWGAISFLQHIDAKKYNVSIVSPRNYFLFTPLLPS
                     TPVGTVDEKSIIEPVVNFALKKKGNVSYYEAEATSINPDRNTVTIKSVSTVSQLYQPE
                     KHLGLSQEDTAEIKYDYLLTAVGAEPNTFGIPGVEQYGNFLKEIPHSLQIRKRFLANI
                     EKANLLPKGDPERKRLLTIVVVGGGPTGVETAGELQDYVDQDLKRFMPSIAEEVQIHL
                     VEALPNVLNMFEKKLTSYAQDVLSKTNINLMLRTAVGKVEKDHLIAKTKDADGNVTEQ
                     TVPYGTLIWATGNKARPIVTDLFKKITEQNASTRALNVDEHLLVKGSNNIFAIGDNAF
                     AGLPPTAQVAHQQAEYLAKVFDKMAKIPGFQQELATRKEKIDLLFEENGFKPFKYVHL
                     GALAYLGAEKAIANITYGKRSFYTGGGLITFYIWRVLYVGMILSARSRFKVIADWLKL
                     AFFKRDCFKEL"
     gene            complement(<563583..>564482)
                     /locus_tag="KLLA0_C06358g"
                     /db_xref="GeneID:2891977"
     mRNA            complement(<563583..>564482)
                     /locus_tag="KLLA0_C06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452481.1"
                     /db_xref="GeneID:2891977"
     CDS             complement(563583..564482)
                     /locus_tag="KLLA0_C06358g"
                     /note="highly similar to uniprot|Q00582 Saccharomyces
                     cerevisiae YML121W GTR1 Cytoplasmic GTP binding protein
                     and negative regulator of the Ran/Tc4 GTPase cycle through
                     its homolog and binding partner Gtr2p involved in
                     phosphate transport and invasive growth human RagA and
                     RagB proteins are functional homologs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452481.1"
                     /db_xref="GeneID:2891977"
                     /db_xref="GOA:Q6CUA8"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUA8"
                     /translation="MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDV
                     EHSHLRFLGNMTLNLWDCGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDV
                     DIFTRALKQLKKYSPDAKIFVLVHKMDLVQLDKRTELFDIMMRKLKQASAEYGFNDLV
                     GFPTSIWDESLYKAWSQIVCSLIPNMNTYNNNLKRLKELMDAKEIVLFEKTTFLVISS
                     SNTASGELLDPKRFEKISNIMKNFKHSTTKLKSSFNTLVLSDLIYVTELSTNMMCFIV
                     LNNNTYPKEFVLQNLHQAQTYFQ"
     gene            <564762..>565322
                     /locus_tag="KLLA0_C06380g"
                     /db_xref="GeneID:2891837"
     mRNA            <564762..>565322
                     /locus_tag="KLLA0_C06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452482.1"
                     /db_xref="GeneID:2891837"
     CDS             564762..565322
                     /locus_tag="KLLA0_C06380g"
                     /note="similar to uniprot|P38876 Saccharomyces cerevisiae
                     YHR189W PTH1 One of two (see also PTH2)
                     mitochondrially-localized peptidyl-tRNA hydrolases
                     dispensable for cell growth and for mitochondrial
                     respiration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452482.1"
                     /db_xref="GeneID:2891837"
                     /db_xref="GOA:Q6CUA7"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="UniProtKB/TrEMBL:Q6CUA7"
                     /translation="MSAQKLLCLSALGNPEPLYRSTRHNAGVIMLRMLKNEFCPDAVL
                     KTSNVSPHIQYCHEPRLNLLMLFNKSQFMNLSGHAMIPVWRKLPHDALHVVLHDELNI
                     PIGNVQLRKPGTSFRGHNGLRDMIKMKGDDKFHKLGIGIDRPNSRDPRIVADYVLANF
                     TKGEMETLQYDSFQKAVEHVRKLLPH"
     repeat_region   complement(565611..566052)
                     /note="solo LTR"
                     /rpt_type=long_terminal_repeat
     gene            566067..566148
                     /locus_tag="KLLA0_C06424r"
                     /db_xref="GeneID:2892617"
     tRNA            566067..566148
                     /locus_tag="KLLA0_C06424r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2892617"
     gene            complement(<566371..>567195)
                     /locus_tag="KLLA0_C06446g"
                     /db_xref="GeneID:2892624"
     mRNA            complement(<566371..>567195)
                     /locus_tag="KLLA0_C06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452484.1"
                     /db_xref="GeneID:2892624"
     CDS             complement(566371..567195)
                     /locus_tag="KLLA0_C06446g"
                     /note="highly similar to uniprot|Q7LHP7 Saccharomyces
                     cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
                     for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452484.1"
                     /db_xref="GeneID:2892624"
                     /db_xref="GOA:Q6CUA5"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /translation="MVAPTALKKSDVSEGTVPVTTTSRIVGVDNTEKIDEDDDDADVL
                     IDQDGDAMLVDEENNEESNKKKEDAGVVLDAEGKPRFTSAASSAQTKVKLESRKVSVP
                     PHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK
                     AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIEN
                     ATRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <567817..>569568
                     /locus_tag="KLLA0_C06468g"
                     /db_xref="GeneID:2892562"
     mRNA            <567817..>569568
                     /locus_tag="KLLA0_C06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452485.1"
                     /db_xref="GeneID:2892562"
     CDS             567817..569568
                     /locus_tag="KLLA0_C06468g"
                     /note="similar to uniprot|Q12171 Saccharomyces cerevisiae
                     YOR147W MDM32 Mitochondrial Distribution and Morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452485.1"
                     /db_xref="GeneID:2892562"
                     /db_xref="GOA:Q6CUA4"
                     /db_xref="InterPro:IPR012571"
                     /translation="MFTVLGRVMNRHCALRAHSRIRMPTPMKVSSLLPLPHNLLRTYA
                     TEKHDMDELNKSTDYMHIQNILLQKEKELSTKHTLLKEATGFYDRFKINTKWFLIRGN
                     RPFSFDELSTLFSWLIISQIIWVILGTTTFVSLVLFTFNTVFAKEMVGKFVGNTLNKY
                     IDSCDVEFQDALVPEWKKGCIRFRSVKVRTVTDGKSDVPSDQLQFDLKFNQVDITLSV
                     RKWMTGHGLIDNLTVLGMHGKVVLNDVNENKLVGWFSNPEYHLGAVKVCDSCFTLRDG
                     NQDYRISIYNMDMNRLRFEWCVSDFFNANVVTGAINHSLFTIHKRQHKLAYLQDLEKD
                     LSPWKRITRLRLDRISVKDLGLDKSSSFNWIEEGSVEIIADLMLPNVEDESQDSDEEK
                     NNKYMVMDLKFNFRDLKAKFPESAPTLSNGETVISFDELKPIINYINNRRVIFNSVAT
                     TETIDPDWNRITPVSIKRQKSYPDTTVIPTSVTWPDGEDEVQINKEIIKYHDQPTTNT
                     NNLILKCRIVKNIDELQNVALFRESGVYDVLAMELYVDLMKIVEEWEFKKKNSWMRLW
                     GTTLASQLLIFGLGAMV"
     gene            complement(<569789..>570358)
                     /locus_tag="KLLA0_C06490g"
                     /db_xref="GeneID:2892634"
     mRNA            complement(<569789..>570358)
                     /locus_tag="KLLA0_C06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452486.1"
                     /db_xref="GeneID:2892634"
     CDS             complement(569789..570358)
                     /locus_tag="KLLA0_C06490g"
                     /note="similar to uniprot|Q02521 Saccharomyces cerevisiae
                     YOR148C SPP2 Required for final stages of splicesome
                     maturation; promotes step 1 of splicing;
                     spliceosome-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452486.1"
                     /db_xref="GeneID:2892634"
                     /db_xref="GOA:Q6CUA3"
                     /db_xref="InterPro:IPR026822"
                     /translation="MNGISISLKSKNKVKKKSGTKKKKKPTVFGIADNDEKATEFKIT
                     SVEERKETIKKPLCITPTEPLRSSLNARPESGSLKSEDEQAVVFPEESESKFDFKGPS
                     ALRNNIPEKTNEEEYEEVPVEGFGTALLRGMGWDPSAENDSSSEKSTLLHEKPHPELV
                     GIGAKLTTASNSLRTAFMPLIRRKKTANE"
     gene            <570575..>571810
                     /locus_tag="KLLA0_C06512g"
                     /db_xref="GeneID:2891905"
     mRNA            <570575..>571810
                     /locus_tag="KLLA0_C06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452487.1"
                     /db_xref="GeneID:2891905"
     CDS             570575..571810
                     /locus_tag="KLLA0_C06512g"
                     /note="similar to uniprot|Q04172 YDR393W Saccharomyces
                     cerevisiae SHE9 Mitochondrial inner membrane protein
                     required for normal mitochondrial morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452487.1"
                     /db_xref="GeneID:2891905"
                     /db_xref="GOA:Q6CUA2"
                     /db_xref="InterPro:IPR008839"
                     /translation="MLVRRIIVRLPSSPRVWTQYNPRIFYSTGPNTNSTLVDTWKQKL
                     GAYWEKSQNKANETANKLREYSVNFKTQWDKAQKSLKDANERLSQMENDSNDSKLNYN
                     AEGKIKDLPSERERHRKKWARKMELYLDSLQETIFTATRALNDVTGYSSIQKLRNTIS
                     SLEEELKDTKKLVNEAKEKYETAIKARSGSQKEVNELLQRKNSWSPTDLDRFTQLYRD
                     DALNSQTEEQSKVKLAELEAKEEELSTNLYRAILTRYHEEQIWSDKIRRTSTWGTFIL
                     MGVNILFFVIFQLLLEPWKRRRLVGSFEDKVKMALDDHQKEQNLAISEMSNTIDNLMD
                     KKLQETQTKPHQEEVPKILTFSNIVADFKIWCSLQWTIYYNKLVTLLPETTVTFTKSC
                     FYSYSTLLLSLGILLGHCI"
     gene            <572219..>573505
                     /locus_tag="KLLA0_C06534g"
                     /db_xref="GeneID:2892644"
     mRNA            <572219..>573505
                     /locus_tag="KLLA0_C06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452488.1"
                     /db_xref="GeneID:2892644"
     CDS             572219..573505
                     /locus_tag="KLLA0_C06534g"
                     /note="highly similar to uniprot|P33298 Saccharomyces
                     cerevisiae YDR394W RPT3 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452488.1"
                     /db_xref="GeneID:2892644"
                     /db_xref="GOA:Q6CUA1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUA1"
                     /translation="MEELGISTPQPVLSVEFGAKNNGLSYGSLLAQLNNDSFAVANGN
                     SDVYLKLKKLEKEYELLTLQEDYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEP
                     IDENTGIVSSTTGMSYVVRILSTLDRELLKPSTSVALHRHSNALVDILPPDSDSSISI
                     MAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGVLLYGPPGTG
                     KTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSIIFIDEVDS
                     IATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRL
                     DRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLSGALIAAIMQEAGL
                     RAVRKNRYVILQSDLEEAYASQVKSGSDVDKFDFYK"
     gene            complement(<573595..>575187)
                     /locus_tag="KLLA0_C06567g"
                     /db_xref="GeneID:2892567"
     mRNA            complement(<573595..>575187)
                     /locus_tag="KLLA0_C06567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452490.1"
                     /db_xref="GeneID:2892567"
     CDS             complement(573595..575187)
                     /locus_tag="KLLA0_C06567g"
                     /note="similar to uniprot|Q04174 Saccharomyces cerevisiae
                     YOR149C SMP3 Protein involved in glycosyl phosphatidyl
                     inositol synthesis most likely an alpha 1 2
                     mannosyltransferase utilized for addition of the fourth
                     side-branching mannose onto the GPI core structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452490.1"
                     /db_xref="GeneID:2892567"
                     /db_xref="GOA:Q6CU99"
                     /db_xref="InterPro:IPR005599"
                     /translation="MSIDIESFPELQKGGTSNTVSFSYNMKLKLYEYLGLIIGLLIAL
                     EPSYIHPDEHFQTLEPIFTAWTGAKGTATWEFLPENPCRSITILRLYYTPLLWLNQHI
                     FHLKPLGLLYLYRLQNYLLYTAVVIFFLEFCEVSITHKTKAKFFIRTSYVTWVFQSHT
                     FSNSLETIILLLFLFTCQYCIYEVRSRHYATFSSCFLLGALISIGTFNRVTFPAYLIL
                     PLLSVFYHCFLSHWIGVAYTAISTALVSALIILFDTKAYSSTDCKSWVIAPLNNLLYN
                     MKVDNIAQHGLHPRYTHLLINLPLICGPIILLFISQKAVLKLPALSCISGILMLSLFR
                     HQELRFIIPVLPLLCASMNLDNFDTFFQAETIITSWLVFNIVMGLIMGVFHQAGIIPL
                     ISYFSGEEFPVHIWWKTYSPPTWMYSNPDLTVSTTNFKENVEFVDNIPWHVVSNHVVD
                     LKGSDIELLNKTLTKFSENTDSIQLIMPNTVLDKLTPLQSQWKFITEWETQQHLDLDH
                     IDMPDWTTIKPGLRLYNVSLIV"
     gene            <575605..>578454
                     /locus_tag="KLLA0_C06589g"
                     /db_xref="GeneID:2892274"
     mRNA            <575605..>578454
                     /locus_tag="KLLA0_C06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452491.1"
                     /db_xref="GeneID:2892274"
     CDS             575605..578454
                     /locus_tag="KLLA0_C06589g"
                     /note="similar to uniprot|Q04175 Saccharomyces cerevisiae
                     YDR395W SXM1 Nuclear protein; has similarity to Cse1p
                     homologs including Nmd5p, Cse1p,Lph2p, and the human
                     cellular apoptosis susceptibility protein, CAS1; also has
                     similarity to the karyopherin Kap95p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452491.1"
                     /db_xref="GeneID:2892274"
                     /db_xref="GOA:Q6CU98"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CU98"
                     /translation="MVNEQLTLQLFSQTMTSDARSIKAAEQQLFELQKEPGFLSFLLN
                     TTNNAQLEIPIRMSCAIYMKNMIQRSWNSRKTVIISPEEKDAVKPALINALITNYENN
                     HIRPHITESIGAILKWNDDWVFTNQVVELLQSGKQEYIYPGLLLIFEVCINHRWDMYG
                     NRQYIDAFIDSVFPVMEQIAGQLVNQESHKSNEMLYLILKSFKYGCLNNFPSYFTNID
                     KLNSWIQLHLFLCSKPMPSETMALDLADRSLDKRVKVNKWAFGNLYKFIAKYSRTTKA
                     INQEMVDYVFQNIVPTILQEYFKVIELWGANKGTLWLSESALHYLIQFLEKCAIENTL
                     WSMIQPHFESIINHVIFPCLCASDASVELFEEDPEEYTRRYFDINKESSTADVAATDF
                     IFVIGHKRMEEVNKLLPLINQVFLQYQQNDVIQAAYQEEGALRMLSTLSSFLTSETDN
                     AINLESIFSHFVLPLLSDKKHSFLVARALETISIYQSPFSDMGILSQIFESVYGNFVQ
                     NSSLPIQIVSADALKTLVISNPDIHSHIKSQAPQIMERLLKLSKEFEIDTLTEVMEAF
                     VERFAEELTPFANDLAQNLVDQFMQLGQSLIQNSNSNSISDQDQEFQASGMLQTMTTM
                     AMSMNKVCLVSKFLPVVKFVIVNAQIIFLTEIVDLMDSLALSSKSLFNEFTPEVWEMI
                     HDVLDSFQTYALDYFESYKIFFETVINFGFVQDQTYLPAFLSILTEVMGSGVDYDIQC
                     AVELLISYALSLKEIPLFASFCDAAVDEEIGLDDALIVKMFMAGLYCKPLETLQICES
                     KGLLLGLLNKWVSSNPRTVFSIKLQMFGIMSMFQLPELPSCVTGFMKPLANKLVKLVQ
                     ELPDAMSRRTKIGNGEFDAEDDNDNEGLDFYDEIDDDFNDSPLDDIDPFSKLHEFFVS
                     LQQYNPERYHIVMQSMDSDSQDALKTILEFVTSSL"
     gene            complement(<578756..>579217)
                     /locus_tag="KLLA0_C06611g"
                     /db_xref="GeneID:2892687"
     mRNA            complement(<578756..>579217)
                     /locus_tag="KLLA0_C06611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452492.1"
                     /db_xref="GeneID:2892687"
     CDS             complement(578756..579217)
                     /locus_tag="KLLA0_C06611g"
                     /note="similar to uniprot|Q04176 Saccharomyces cerevisiae
                     YDR397C NCB2 Beta subunit of the NC2 dimeric histone-fold
                     complex represses RNA polymerase II transcription through
                     binding to TBP and inhibition of TFIIA and TFIIB
                     homologous to the Dr1 subunit of the mammalian NC2
                     (negative cofactor2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452492.1"
                     /db_xref="GeneID:2892687"
                     /db_xref="GOA:Q6CU97"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6CU97"
                     /translation="MVGEVDDVTLPKATVQKIISEVLDSDLTFSKEAREIIIECGVEF
                     IMMLAGSASEIADKELKKTIAPDHVIKSLQDLEFDEFIPPLEEILHQHKENQKIRERR
                     DAKFKKSGLSEEELLRQQEELFRQSRSRLQQTSVSDASSNDPEVGVKAEEF"
     gene            <580349..>582244
                     /locus_tag="KLLA0_C06633g"
                     /db_xref="GeneID:2891882"
     mRNA            <580349..>582244
                     /locus_tag="KLLA0_C06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452493.1"
                     /db_xref="GeneID:2891882"
     CDS             580349..582244
                     /locus_tag="KLLA0_C06633g"
                     /note="similar to uniprot|Q04177 Saccharomyces cerevisiae
                     YDR398W UTP5 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452493.1"
                     /db_xref="GeneID:2891882"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CU96"
                     /translation="MATASPVVLSQYDPTGQYFAYVSTALDKQRVSVEPTTASKSGLV
                     NDNFLYLEGKDVCCTCIQWITYNDTPLVVLGLNLGEIWLYSPLSNEIVAKLNTGSSLA
                     VLDFQLFSSKDKAWCLTGDDTIFLFDMVSQNVSKKFKIDECKDLKKLCIVDSNRILVA
                     SHQIYLIDVISKKLLLQYPGHISPVSFLQVTTDGTAFLSASQDDRFLNIYDLDTTKTK
                     SVLVADSNVISISISEDWSHVSATTEDGDIAIFEEPLVSINSGNKRRSGKISKQKNKT
                     ITLLRSNSATRLPIIKSFINKDLINFSWLENATTPYFDQVQLGNLTDSVTTLSKPLPS
                     AKSTQTRNNQNSDISSAKLYKEGNATVTSGDNFKHVESIVQSLDDIEGEGISETLQDR
                     LNIISPPSRKPKERRRANAGTSSVVLAQALKSNDHALLETVLNTRDEKVIQATITRLS
                     PQLATILLERLAERIARQTHRQGALNVWVKWCLIIHGGYLVTIPNLINSLSSLHATLR
                     KRADLLPTLMALDTRITRSLDELNSKRAVQYGKDQLDSELVAPYQDDESNQNEDEEEE
                     VEYIEELDDAGLIDDGEDSAEYSEDDDEHSEADNQELTYTEEGFDDDDEMRVDVEEGY
                     SDEEVQH"
     gene            <582949..>583596
                     /locus_tag="KLLA0_C06655g"
                     /db_xref="GeneID:2891881"
     mRNA            <582949..>583596
                     /locus_tag="KLLA0_C06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452494.1"
                     /db_xref="GeneID:2891881"
     CDS             582949..583596
                     /locus_tag="KLLA0_C06655g"
                     /note="highly similar to uniprot|Q04178 Saccharomyces
                     cerevisiae YDR399W HPT1 Dimeric hypoxanthine-guanine
                     phosphoribosyltransferase catalyzes the formation of both
                     inosine monophosphate and guanosine monophosphate
                     mutations in the human homolog HPRT1 can cause Lesch-Nyhan
                     syndrome and Kelley-Seegmiller syndrome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452494.1"
                     /db_xref="GeneID:2891881"
                     /db_xref="GOA:Q6CU95"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6CU95"
                     /translation="MSSDDKQYISYNNVHQLCQESAERIKKFKPDIIIAIGGGGFIPA
                     RILRTFLKEPGIPTIRIFAIILSLYEDLFTVGSEQEAVGVTVQRTQWIDYEQCKLDLV
                     GKNVLIVDEVDDTRTTLHYALHELEKDAEQQAKAKNIDLDKQPEMRTKFGIFVLHDKV
                     KPKKADLPEEIVNDEDRYIAGRKVPDKWYAYPWESTDIVYHTKMAMEQGNDVFLP"
     gene            complement(<583672..>585093)
                     /locus_tag="KLLA0_C06677g"
                     /db_xref="GeneID:2892658"
     mRNA            complement(<583672..>585093)
                     /locus_tag="KLLA0_C06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452495.1"
                     /db_xref="GeneID:2892658"
     CDS             complement(583672..585093)
                     /locus_tag="KLLA0_C06677g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452495.1"
                     /db_xref="GeneID:2892658"
                     /db_xref="GOA:Q6CU94"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CU94"
                     /translation="MKLQEQDIINKEATACSVESLTDSSEDDYNKISVPDGGYGWVVV
                     FSSFVFNFCTWGATSGYSVYLSYYMTSDKYETGTDLDYAAIGGLSFGVGLFLAPLFNY
                     LLIKSSAKKVLLLGIVVQNVSVLLAAFATKLWQVYLTQGVAISFGLGAICFPNTTIVA
                     PWFRKKRSLALGISAGGSGLGGIVFNLSMQKIIDGKNVRWALISQCIICSVLSTIALI
                     LVRTRKEEVEKHSEEPSRVIEWGMFKYPVVWLLIGWVCFTMLGYVIQLYSLFSFTVSL
                     GYTSRQGSIVSSMICLGALLGRPMVGFLSDKFGPVTTAMFCHLLVGILCYAMWIPCRN
                     YATIIVFALFEGMMMGTIWPLLTSIITRLVGLRKLESVYSVIWMFIGACSIVSPVIGL
                     KLKKDHYKEGENAYIFTAVYAGAAYLCAALSLCLMRGFLIARDKISMKEKTAYDDGEL
                     HFRPDLRDALQGTLCWKNLYRKV"
     gene            complement(<586603..>587634)
                     /locus_tag="KLLA0_C06699g"
                     /db_xref="GeneID:2892651"
     mRNA            complement(<586603..>587634)
                     /locus_tag="KLLA0_C06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452496.1"
                     /db_xref="GeneID:2892651"
     CDS             complement(586603..587634)
                     /locus_tag="KLLA0_C06699g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452496.1"
                     /db_xref="GeneID:2892651"
                     /db_xref="GOA:Q6CU93"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q6CU93"
                     /translation="MSNNPLQTIDISEVEGVTATKLLDAAMKQGFLFVDGHGFTQEEV
                     DMLFDLSKRFFTTTAHDEKLKYYFDATNNFGYTDFSSEQLDLTKGRDFKECYNFGAVN
                     FTKGTYNTPNPEAKVKYTEQNETPGCLKDEDGLIVTVLQKYHKVATEILRLVTIALGI
                     EDKNFFTEKMRPDQKNGCVMRFLRYPLVRDDDLTEDPTLDPTIRAGAHTDYGALALLM
                     QKQGQQGLELQIDKNSKEWVKVPFVASKYEGKAPPLVVNFGDMLSYWTNGVLRSTNHR
                     VKFSPGETRTSDRYSIVFFVHPDANTTLDPVPSKIVEDAWDGKKTPTLTAFQYLQKRL
                     RETYDWQNN"
     gene            <589402..>590418
                     /locus_tag="KLLA0_C06721g"
                     /db_xref="GeneID:2892094"
     mRNA            <589402..>590418
                     /locus_tag="KLLA0_C06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452497.1"
                     /db_xref="GeneID:2892094"
     CDS             589402..590418
                     /locus_tag="KLLA0_C06721g"
                     /note="similar to uniprot|Q04179 YDR400W Saccharomyces
                     cerevisiae URH1 uridine nucleosidase (uridine
                     ribohydrolase)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452497.1"
                     /db_xref="GeneID:2892094"
                     /db_xref="GOA:Q6CU92"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:Q6CU92"
                     /translation="MTGNSVIPIWVDCDPGHDDAVAILLSCFHPSIRLLGISASYGNA
                     SPENTLYNTLSLLTAFGKQDEVPVYKGAQRPWVRDVAYAPDIHGETGLDGTTLLPKPK
                     RSFVDADYIKAMENAILANGGNIALVSTGTLTSIATLFKEKPYLKEQVRYISIMGGGL
                     HAGNRNDNDSAEFNIWADPDAADFILNDEDIKHKCILSPLDLTHTCIATEYIDKTILG
                     DGSCKLRKLFYELFLFFAKTYKNKQGFEAGPPVHDPVTLMPLLYLYGHISNDILRFKY
                     GRFDLSIDKNQDSINYGRTIVTQEYPSDSNFGLMVGLQINVDFFWNQVLNAIDVAENY
                     PGSL"
     gene            complement(<590585..>592126)
                     /locus_tag="KLLA0_C06743g"
                     /db_xref="GeneID:2892641"
     mRNA            complement(<590585..>592126)
                     /locus_tag="KLLA0_C06743g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452498.1"
                     /db_xref="GeneID:2892641"
     CDS             complement(590585..592126)
                     /locus_tag="KLLA0_C06743g"
                     /note="similar to uniprot|P21595 Saccharomyces cerevisiae
                     YDR402C DIT2 Sporulation-specific enzyme required for
                     spore wall maturation involved in the production of a
                     soluble LL-dityrosine-containing precursor of the spore
                     wall homologous to cytochrome P-450s"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452498.1"
                     /db_xref="GeneID:2892641"
                     /db_xref="GOA:Q6CU91"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6CU91"
                     /translation="MLSLVLGIISSGILLSFLCLVCFPIGLPWSLPTIPIYVSFLPIL
                     TDMDQLEIFERYIRHPMEKYGAVKIFFANRWNILTSKPEFLNIMFRDEDTFAKSGNQK
                     KIPYSLLAKYTGDNVISAHGKVWMKYRSCIQNQLNVFDSKPLIDNAQLFVKLLKKSIE
                     DNTEGTVLLPPLIQRLTLANIAKIALGFDIGTLKFDEHDNICRSRLHEKLNQVKQQIF
                     KPVFLSFPFLDLLPIKSRQRAKIDIIQFRDMLLDTVYKNLIHNYKFEQTNNAAAGLIR
                     EWKLQGITDEQLKDNLVIILVAGHENPQLLLSTLFYLLAKHQNWQYAIREELLSVDRN
                     EDILNSFKLTAFIYEALRMFPPLGQIINRRTTRKCQLGPGIIIDKDVYCGYNVYGTGT
                     ATSVWGETAKQFIPERWGENSNELANNWKKHKYDASMSAFHGGRRSCLGEKLALMEMK
                     YVLYYVLMNFHIELHPQWKEKMTPAGPICPKMLKVKLTILKDPQDQRSDSLYSSAGET
                     LSENI"
     gene            <592993..>594582
                     /locus_tag="KLLA0_C06765g"
                     /db_xref="GeneID:2892448"
     mRNA            <592993..>594582
                     /locus_tag="KLLA0_C06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452499.1"
                     /db_xref="GeneID:2892448"
     CDS             592993..594582
                     /locus_tag="KLLA0_C06765g"
                     /note="similar to uniprot|P21623 YDR403W Saccharomyces
                     cerevisiae DIT1 Sporulation-specific enzyme required for
                     spore wall maturation involved in the production of a
                     soluble LL-dityrosine-containing precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452499.1"
                     /db_xref="GeneID:2892448"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:Q6CU90"
                     /translation="MTNDTLPIIKEAHHPYFDVDISHGQTENDMSTYSKFLCLYTRNL
                     YSYELYCIQDKQNCQFTENWEELSNILKQKTGKINEHGVTEVEITAEESHRMTPFHNV
                     AIKVSEYQIGDENQIRGVITTVENENSFNTWFIYHILCKIHVGYSSEPSVQSEVDYAE
                     LFTQYFERNLKNTIQGDEWITMNGRQYFKERVCYFTSRHKRIECILPAFPCKSSNLKK
                     VHGDVPDKGEELAFVNLINATKEISKFYPPGMKLWIVSDGHVFSDCIGVDDDVVDSYT
                     AHLHGLYRSLAEPGTDAIGFAGLKDLFFEGESSESFDPRWVEEIELPHYTGTKICPDS
                     ELSRKILMKGCDTENGRLKKQLNIPDHPRLHLFRGFSKFMTEDLCLLPFFQGISRKGF
                     KKVVAKVAFEMIKRNDAYSNLVELVFPHHMRLSIHAHTNSGPKFGIKIISPLQCKTIR
                     SLDNEEEPTFEDLLHIPTPWHNCVVKIEENERFYLTKTKTVMDAIENGNYEGTWVKTD
                     VETGVGGHYLLRRVRKINKIN"
     gene            complement(<595180..>595695)
                     /locus_tag="KLLA0_C06787g"
                     /db_xref="GeneID:2891921"
     mRNA            complement(<595180..>595695)
                     /locus_tag="KLLA0_C06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452500.1"
                     /db_xref="GeneID:2891921"
     CDS             complement(595180..595695)
                     /locus_tag="KLLA0_C06787g"
                     /note="highly similar to uniprot|P34087 Saccharomyces
                     cerevisiae YDR404C RPB7 RNA polymerase II subunit B16
                     forms two subunit dissociable complex with Rpb4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452500.1"
                     /db_xref="GeneID:2891921"
                     /db_xref="GOA:Q6CU89"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q6CU89"
                     /translation="MFFFKDLSLNITLHPSFFGPQMKRYLMTKLLQEVEGTCTGKFGY
                     ILCVLDCENIEIERGRILPTDGSAEFTVKYRAVVWKPFKGEVLDGIVSSCTNLGFEVE
                     VGPLSVFVSPFLMPEDLTFNSGSNPPSYQSSEQIITKGSRVRLKIVGARSEVNSIYAI
                     GSIKEDYLGVI"
     gene            <596252..>596680
                     /locus_tag="KLLA0_C06809g"
                     /db_xref="GeneID:2891941"
     mRNA            join(<596252..596309,596442..>596680)
                     /locus_tag="KLLA0_C06809g"
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /transcript_id="XM_452501.1"
                     /db_xref="GeneID:2891941"
     CDS             join(596252..596309,596442..596680)
                     /locus_tag="KLLA0_C06809g"
                     /note="similar to uniprot|P19956 Saccharomyces cerevisiae
                     YMR225C MRPL44 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /protein_id="XP_452501.1"
                     /db_xref="GeneID:2891941"
                     /db_xref="InterPro:IPR019716"
                     /db_xref="UniProtKB/TrEMBL:Q6CU88"
                     /translation="MITKYFTKAVVKFNPLGKEAKTARLFLSAIPPSQRTSGLQLQNE
                     VLVSGSNKKPTVKVTFKDKTELEADPSSMNFMELGNYFDRHSRKLALKESIESQ"
     gene            <597029..>598027
                     /locus_tag="KLLA0_C06842g"
                     /db_xref="GeneID:2891877"
     mRNA            <597029..>598027
                     /locus_tag="KLLA0_C06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452503.1"
                     /db_xref="GeneID:2891877"
     CDS             597029..598027
                     /locus_tag="KLLA0_C06842g"
                     /note="similar to uniprot|Q12481 Saccharomyces cerevisiae
                     YOR287C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452503.1"
                     /db_xref="GeneID:2891877"
                     /db_xref="GOA:Q6CU86"
                     /db_xref="InterPro:IPR009292"
                     /translation="MSFYFKNIKPDLHSGNEDEEDDIASIIRINDTSDAEGSQSEDEL
                     KTLSFGSLKKADEMMDNEEQTSRKSKSKANGEKKHLNKPKSRELTEKQRKLDDGQRRQ
                     SGLQEEEAQQKSQSIKMFAEESFGEESDSDSDGGFFDEESNDEANQNGKKKKGKRKHA
                     PTESSSKKKVRSMRKIPGLEDNKSKSIYQDVRFDKAMGKSEDLAKIRQRYKFLDEYRE
                     KEINELDSMLHDRKFLSKISDREKSEMEQQVRRMKSRLETVQVMEMEQKIVKDYEAEI
                     NKNNKNKYHLKDSEKRKVIQKWKFEHMKGKQREKVMDRKRKKRLGKEFKQFEFHKR"
     gene            complement(<598412..>598834)
                     /locus_tag="KLLA0_C06864g"
                     /db_xref="GeneID:2892066"
     mRNA            complement(<598412..>598834)
                     /locus_tag="KLLA0_C06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452504.1"
                     /db_xref="GeneID:2892066"
     CDS             complement(598412..598834)
                     /locus_tag="KLLA0_C06864g"
                     /note="similar to uniprot|Q12305 Saccharomyces cerevisiae
                     YOR285W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452504.1"
                     /db_xref="GeneID:2892066"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6CU85"
                     /translation="MLRSAFKGSFPAKVGGFRTFSTVPAKIYQFEDIQKLVAKPDPHK
                     VLVDVREPSEVKEFALPTAINLPLKTAPGALSLDNEEFQKVFHIPKPSADKELIFFCA
                     AGIRAQAAEELARSYGYEKTGVWPGSINEWLQRTQPKK"
     gene            complement(<599236..>599709)
                     /locus_tag="KLLA0_C06886g"
                     /db_xref="GeneID:2892047"
     mRNA            complement(<599236..>599709)
                     /locus_tag="KLLA0_C06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452505.1"
                     /db_xref="GeneID:2892047"
     CDS             complement(599236..599709)
                     /locus_tag="KLLA0_C06886g"
                     /note="similar to uniprot|Q12305 Saccharomyces cerevisiae
                     YOR285W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452505.1"
                     /db_xref="GeneID:2892047"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6CU84"
                     /translation="MGIWEKIHVAWKGENTADSQPVTSGDQTNTEPKETHVNEGKNYD
                     FDDIVSLIKTKPDNVILLDVREPEEFAIVQIPGSVNMPYKSAPDALAYGDEEFKGKFG
                     FPKPSKDQELVFFCAAGRRALGAQSKAVEEGYTNASIYSGSTNDWVAKGGDKLQL"
     gene            complement(<599885..>600571)
                     /locus_tag="KLLA0_C06908g"
                     /db_xref="GeneID:2892028"
     mRNA            complement(<599885..>600571)
                     /locus_tag="KLLA0_C06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452506.1"
                     /db_xref="GeneID:2892028"
     CDS             complement(599885..600571)
                     /locus_tag="KLLA0_C06908g"
                     /note="similar to uniprot|Q12040 Saccharomyces cerevisiae
                     YOR283W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452506.1"
                     /db_xref="GeneID:2892028"
                     /db_xref="GOA:Q6CU83"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6CU83"
                     /translation="MTADIPYYESNNDKNVLRLFVIRHGQTEENLKKILQGHMDTELN
                     ETGQDQASKLGEYLANDRHLKFDKIYSSDLKRCQQTINTALEHFNTPTKLVTTDKLRE
                     RCMGVIEGMYLKDAEEYADSMGKPTFRDFGEPAEEFQQRLSNVLENIVSENKSSKNIG
                     IVSHGGSIRQLLKLLDYKELNVHKIIVFNTSVTIIDYIKNEKAYVVRRVGNTQHLGSG
                     EFIVSDLQLR"
     gene            <600876..>602960
                     /locus_tag="KLLA0_C06930g"
                     /db_xref="GeneID:2892523"
     mRNA            <600876..>602960
                     /locus_tag="KLLA0_C06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452507.1"
                     /db_xref="GeneID:2892523"
     CDS             600876..602960
                     /locus_tag="KLLA0_C06930g"
                     /note="similar to uniprot|P32829 Saccharomyces cerevisiae
                     YMR224C MRE11 Subunit of a complex with Rad50p and Xrs2p
                     (RMX complex) that functions in repair of DNA
                     double-strand breaks and in telomere stability exhibits
                     nuclease activity that appears to be required for RMX
                     function widely conserved"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452507.1"
                     /db_xref="GeneID:2892523"
                     /db_xref="GOA:Q6CU82"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CU82"
                     /translation="MEELNSLPAVDTIRILITTDNHVGYNENDTITGDDSWQTFHEIM
                     SMAKDYNVDMVIQGGDLFHVNKPSKKSMYQVIKSLRTYCMGDKPCELELLSDPAECFR
                     FSDFPNVNYEDPNLNISIPMFSISGNHDDASGDGLLSPMDILQVSGLVNHFGKVPETD
                     NIEITPLLLKKGNTRLALYGLASVRDERLFRTFKEGKVRFNVPESQDDDWFNLMCVHQ
                     NHTGHTNTAFLPETFLPDFLNLVIWGHEHECIPHLVHNPIKGFDILQAGSSVATSLCD
                     AETKPKHVFLLEISKGSKPSLVPIPLKTVRPFIMKDISLRDFPQLKPLDKDSINEFLY
                     SKIEEMIKEALEKDTNITASEVDTEGVLPLVRLRVNYSGDIGSQVDYQVENPRRFSNR
                     FVGRVANANNVVQFYKKKTPSASTRKKIKFDPSDTALLSEQEDGDLQVQTLVNDFLNK
                     MKLSLLPELGLNEAIRQFVDKDDKNALKLFIDTEISHEVDILAQNKDVVNTEDVTNLK
                     RLLKEVKSTNNTTTTNSYTSSRSKTSKILPSLSIVHSEDDENYSHSDDSMATNETRKK
                     NMRSRKTADTASNNGLPAPRRTRSVRKRTHVDSDNEIDSSQSEVDEDKSAKNVESNGS
                     DDVEFLDEPTSPTIRKIASDENEELAKSATRNKSTTKSRQQAKAKSNQRSKSTRTPKT
                     DALSELLARRSK"
     gene            <603325..>604182
                     /locus_tag="KLLA0_C06952g"
                     /db_xref="GeneID:2892282"
     mRNA            <603325..>604182
                     /locus_tag="KLLA0_C06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452508.1"
                     /db_xref="GeneID:2892282"
     CDS             603325..604182
                     /locus_tag="KLLA0_C06952g"
                     /note="similar to uniprot|Q12017 Saccharomyces cerevisiae
                     YOR281C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452508.1"
                     /db_xref="GeneID:2892282"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:Q6CU81"
                     /translation="MQNEPMFQVQVDETEDTEWNDILRAHGVIPERPPSPTAQLEEAL
                     EEALAKQHENRLDGKDLSDLEDLEDEEDEEFLQFYKQKRLNEIKKLQEKAKFGSVYPI
                     SKPDYNREITECSKGTKKSQYVDDGSSEFEGGVYVFVHLTCQAKLESRLLSSIFEKAA
                     AKFPQIKFVEIPGNRAIENYPDNNCPTLIVYYKGDVVKHLVTLLELGGKDTKLEDFER
                     LMVDIGAVDEKDGRLLMNHEDDYTKQEKKQRYGHNSIRSGIKGKFNVGVGRNGRNGAD
                     DDDDDDFFD"
     gene            complement(<604344..>605684)
                     /locus_tag="KLLA0_C06974g"
                     /db_xref="GeneID:2891924"
     mRNA            complement(<604344..>605684)
                     /locus_tag="KLLA0_C06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452509.1"
                     /db_xref="GeneID:2891924"
     CDS             complement(604344..605684)
                     /locus_tag="KLLA0_C06974g"
                     /note="similar to uniprot|P50102 Saccharomyces cerevisiae
                     YMR223W UBP8 Ubiquitin-specific protease that is a
                     component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
                     acetylation complex required for SAGA-mediated
                     deubiquitination of histone H2B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452509.1"
                     /db_xref="GeneID:2891924"
                     /db_xref="GOA:Q6CU80"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CU80"
                     /translation="MVCPHMNQVVSNQKLGDAVLKECETVRYLLRHADFKNRTMRTMR
                     CMDCGEISCGSTFICLQCGFCGCWNNNHFLDHSQKLGHIFGVNSSNGLVFCFRCGDFM
                     ADLVAEIPASQWDTVMEKTELPASLHRDGLQGLVNMGSTCFMSSIIQTIIHNPYFVED
                     LLSHKHCNNCDIKSGTKCVSCALDEIACDFYGNGPGTGKSSSVSKGFVNLLSASWHIN
                     HHLVGSSQQDAHEYWQFLLNQLHTDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQ
                     CGFSKTTIDPIMDLSLEIKNNPKLEDCLDHFQREETLTDFHYECQSCKQNQGVVKQLT
                     LHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLL
                     NVVSHQGTVDQGHYTTVSKTEDGQWFKFNDSVVTSVTEEQVLEQQAYLLFYIIR"
     gene            <606430..>607086
                     /locus_tag="KLLA0_C06996g"
                     /db_xref="GeneID:2892635"
     mRNA            <606430..>607086
                     /locus_tag="KLLA0_C06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452510.1"
                     /db_xref="GeneID:2892635"
     CDS             606430..607086
                     /locus_tag="KLLA0_C06996g"
                     /note="similar to uniprot|Q05015 Saccharomyces cerevisiae
                     YMR222C FSH2 and similar to uniprot|Q99369 Saccharomyces
                     cerevisiae YOR280C FSH3 Serine hydrolases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452510.1"
                     /db_xref="GeneID:2892635"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CU79"
                     /translation="MSKKVLMLHGLAQSGPYFESKTKGFRRVLEPLGYEFFYPTAPIN
                     LSPADLPSDVADIGAASGDDYHAWLQPDPLHGEYRLPDVTLKFLKEYVVENGPFDGIC
                     GFSQGAGVTGYLMTDFNNLLGLTEEQQPAIKFFIAFSGFRFRPEIYQEQYIQHPITVR
                     SLHVQGQLDTVTESSQVKGLYTSCKEGTSTFLEHSGGHFVPNSKGFVLKIADWLQNSE
                     "
     gene            <607384..>608169
                     /locus_tag="KLLA0_C07018g"
                     /db_xref="GeneID:2892604"
     mRNA            <607384..>608169
                     /locus_tag="KLLA0_C07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452511.1"
                     /db_xref="GeneID:2892604"
     CDS             607384..608169
                     /locus_tag="KLLA0_C07018g"
                     /note="similar to Saccharomyces cerevisiae and to YMR222C
                     uniprot|Q05015 Saccharomyces cerevisiae FSH2 Serine
                     hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452511.1"
                     /db_xref="GeneID:2892604"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CU78"
                     /translation="MSTSKKVLMLHGYSQSDVIFRAKTAGMRKQLQKKGYELIYPCGP
                     YKLHSKDFNDSEVDLRDSEKSTGMYGWFLKDPETHSYTLEPELLEYLAQYIKENGPFD
                     GIGGFSQGAGLAGYLSTDLWSILPLNKEEQPPFKFAMYFSGFKFEPEQFQAPYETHPI
                     QLKTLHIVGELDSLVTEERSMKLFEACDPSTRTMVKHSGGHYIPNTKPFINMILSWLH
                     AQADENLRELSGSEESAMKNTVNNSDPQLDDDLLDMIDSFGKI"
     gene            <608643..>610190
                     /locus_tag="KLLA0_C07040g"
                     /db_xref="GeneID:2892565"
     mRNA            <608643..>610190
                     /locus_tag="KLLA0_C07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452512.1"
                     /db_xref="GeneID:2892565"
     CDS             608643..610190
                     /locus_tag="KLLA0_C07040g"
                     /note="similar to uniprot|Q04991 Saccharomyces cerevisiae
                     YMR221C FMP42 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452512.1"
                     /db_xref="GeneID:2892565"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CU77"
                     /translation="MRSSLIGCFDIRIIQLLCAVTWCLLSAGLIFGFAALKPVLIAQH
                     VYEDLCYINVAEDPVVELPCTKQDLRLNKMFAVGAVVTNIAALPVGWVLDNYGPRICG
                     IVGALFLFSGSFIYISAKHISFLDPYLTGYISLAIGGPFVFISSFQLANTFPKYSGSI
                     LAVITGAFDSSSALFLFYRIYYEKVDPDFNLKKFFTLYLVVPVFIVLCQLFIMPFESY
                     KTLGAVHKLEVEGLDEDGNLPEGQDASMVIPDADECSSLLSGTGPQIQPVLSHGSRRK
                     SVLENYVEARLEKRTRGIFGVLHEKSALEQIKSYWFILMLLFTIVTMLRINYFVATVR
                     SQEEYLLRDSKLAALMNSIFDVALPLLGILSIPIIGIILDNLETYSVLLLVCGLSVFI
                     GIMGLIPSFYPNLLGILLLVAFRPFYYTVVSDYCSKIFGFETFGVVYGSMICVSGCLN
                     FFQTYLDKLTHTTFDMNPTPVNVGLLATTVVISVALLGYIRTQSKRRATLIDDALKSP
                     VATYNST"
     gene            <610600..>611568
                     /locus_tag="KLLA0_C07062g"
                     /db_xref="GeneID:2892576"
     mRNA            <610600..>611568
                     /locus_tag="KLLA0_C07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452513.1"
                     /db_xref="GeneID:2892576"
     CDS             610600..611568
                     /locus_tag="KLLA0_C07062g"
                     /note="weakly similar to uniprot|Q12192 Saccharomyces
                     cerevisiae YOR279C RFM1 DNA-binding protein required for
                     repression of middle sporulation genes specificity factor
                     that directs the Hst1p histone deacetylase to some of the
                     promoters regulated by Sum1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452513.1"
                     /db_xref="GeneID:2892576"
                     /db_xref="InterPro:IPR020318"
                     /db_xref="UniProtKB/TrEMBL:Q6CU76"
                     /translation="MVSSPIVLSPFTPNTIGNGRDDSVDKDGPYTEPVVDPINGTYTV
                     DQGQASNEIVYWKDAKSTPVVGFGKHINQIKERRQKVYDVLKQLEREIKPREFESYAE
                     YYLIKTFKVGKSASGKVNVDGLRSRGSGGPYRRLKRSSQRTNTSSSRNESKSSSDSSI
                     EGDHAASDSDPGLAAKESDTDYKPSNPWKINRDITTASIIEENKSGPIRRSSRLTRKE
                     REKQLNRKKQEGKEGVIDNATESLPDSSSAVIQHLYENLITKVQEPARRSDWLLPPKQ
                     RYIPEKNQPVKHEPEQIKINELARNLRIKKILSRFDGGLAGVRTGM"
     gene            complement(<611642..>612979)
                     /locus_tag="KLLA0_C07084g"
                     /db_xref="GeneID:2892044"
     mRNA            complement(<611642..>612979)
                     /locus_tag="KLLA0_C07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452514.1"
                     /db_xref="GeneID:2892044"
     CDS             complement(611642..612979)
                     /locus_tag="KLLA0_C07084g"
                     /note="similar to uniprot|P24521 Saccharomyces cerevisiae
                     YMR220W ERG8 Phosphomevalonate kinase an essential
                     cytosolic enzyme that acts in the biosynthesis of
                     isoprenoids and sterols including ergosterol from
                     mevalonate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452514.1"
                     /db_xref="GeneID:2892044"
                     /db_xref="GOA:Q6CU75"
                     /db_xref="InterPro:IPR005916"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR016005"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CU75"
                     /translation="MRSFSAPGKALLAGGYLVLKPEYGSYVVALSSRMHAVVKQDELI
                     GPSSSSSITVKVRSTQFNDDEWQYKMDSSSNYSPQELQENKNPFIEKVLSTVFNYFQP
                     DLKLQGNIVIDIYSDAGYHSQAGTKLRSNGVKSFLFHSKSITEVPKTGLGSSAGLVTV
                     LVTALVSCFKQNLDVSSKDDMRLIHNLSQVAHCQAQGKIGSGFDVAAAVYGTITYNRF
                     DPVLIEQLPSPLSSAYHFALVSLIDETDWKIKASRVSLPPRLRLIMGDVNNGSETTKL
                     VAKVNEWYNGNGQAAFKIYKAIDQANTEFVESLRELTALCDQSTSEYEALIETINDKG
                     RKTHPLLQKIVHSVHTIREHFRLITEQSGADIEPEVQTHLLNAAISLPGVLTGVVPGA
                     GGYDAICLITTDSCNIANETKNDPTFRNVTWLDLNQQDLGIIEEKPSTYQNLN"
     gene            complement(<613222..>617508)
                     /locus_tag="KLLA0_C07106g"
                     /db_xref="GeneID:2892279"
     mRNA            complement(<613222..>617508)
                     /locus_tag="KLLA0_C07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452515.1"
                     /db_xref="GeneID:2892279"
     CDS             complement(613222..617508)
                     /locus_tag="KLLA0_C07106g"
                     /note="weakly similar to uniprot|Q03661 Saccharomyces
                     cerevisiae YMR219W ESC1 Protein localized to the nuclear
                     periphery, involved in telomeric silencing; interacts with
                     PAD4-domain of Sir4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452515.1"
                     /db_xref="GeneID:2892279"
                     /db_xref="UniProtKB/TrEMBL:Q6CU74"
                     /translation="MHENSNSLRFGKNGASKSFRRFASPFSSKRRVQLTKQKQSNATH
                     QLTAYRRKDQDDFKRRLLSHDTNATVSMVESLIEKGKKLLKSVSKEETLLRNELESEL
                     RNEQLRLQYVNEIMEDNMKPMDQTDSKGVRVSDGIQMKDEADSCLESEDSIVILSDNE
                     GSENIHTMNKNASVSILQGQTSEYSEGDSINLSERRDSSHSESIIEQAEPSDDEDDDL
                     FNEYSDNDLSENIASTPRLKQTFMQAYAQKPGNKTTDSVTPRDTSMAGVELEDNDFLS
                     DNNSEDNIEHEEDVMLSDYQSSDIRESKPSGIFSHQTLNDKDNLEESEGSPEYYSTDD
                     EKLTNDALASNYDESKTNGKSEEELPSDQESDLMQDQSSEIEDFDDGEISQQISSLSD
                     EFSIANQAIAQLNSHATDSDQSVDDVSDKDIYSEESYNKDEAEEAYEDETEKVINKEY
                     QTSSEAPEIITDEEDITQLSATNTHELRSDGIGELGEYSYQLDTNNNGYGLITDNDHS
                     LILKTLHERSVPKNVEYSENNVNTTGSGNSEELSETSVQDIDFASNAIDLPQTTLSKT
                     EKEVFAEPKEPCMVTKEATSVERQERNVGQSEPRYCLTFSDSFSEDDNPQNNANAHQT
                     EENSEYQSVFASDPFHLDYNEDTDKTDFLHDLLLNTLDDPASDVTQNPTCSQQVEHPF
                     DHELNAENMKGTVEEASEDFQTYNVSSESPSDDIFHDALDIKHSFPISSDFFASKNVQ
                     VSPEKKAGHSSMTIDHSINENKPNIPLFIDKETIRLTTSPVRVNQSEKVSGDASIKNS
                     RRRKLENNLNSTLFQKPSQHHNIPLFNLNSSQTTTNNLPNNSDGTDSHEKAGSTSHVT
                     YPKPLEPSKAISDHDLSNSSREHESELLASEALPDDKPVIRIPLLVHRTEVHEAASPF
                     EDTAQAKRSTELSEYVESLMEDPTQEELAEPIVMEPADMRVRVRTTSYIEIEEIITED
                     INNSEIEKITTEPEVSFRESPEPVHRTVELEELAVEQKINAETQKILHFTDEESLDLQ
                     ADELSIEVNENESKNELQQSNIQLSISNTDITLNIPHNSATASDQIPYHPSVTSVPDI
                     SETGQMGYPNNENDLLNSGYQGSPSVISSSSKENAYELHADFNSDEPSLAVSGDVVVA
                     TNHDLSDGKVNKPSSSLLYQSEISSTQDSLKSPSPEPTLGKRILASPLKMLNKLAEGV
                     RSIGDAATEFASLVDPILTESDSDSANSNHSENNSAPSEPEHNQDHEENKSENHSGEE
                     SYVSEEVHSVKESNELHDAEALQTLEMINKTTDKIKHYGGMDLPKDTPDEDVDTTPTS
                     VIIDDTTELHLAPSDANPITSPGQKLETSTRAGSIPIEIENEESDAADIPVTIEKAET
                     PQQRTPVKKRPRATENSSPKPSKRKRSKKRKQARKITSVARNLRSKSKKR"
     gene            <617725..>620925
                     /locus_tag="KLLA0_C07128g"
                     /db_xref="GeneID:2891975"
     mRNA            <617725..>620925
                     /locus_tag="KLLA0_C07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452516.1"
                     /db_xref="GeneID:2891975"
     CDS             617725..620925
                     /locus_tag="KLLA0_C07128g"
                     /note="similar to uniprot|Q756B5 Ashbya gossypii AER352C
                     AER352Cp and weakly similar to YMR218C uniprot|Q03660
                     Saccharomyces cerevisiae YMR218C TRS130 Component of the
                     targeting complex (TRAPP) involved in ER to Golgi membrane
                     traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452516.1"
                     /db_xref="GeneID:2891975"
                     /db_xref="InterPro:IPR022233"
                     /db_xref="UniProtKB/TrEMBL:Q6CU73"
                     /translation="MSLQTTIGMIPRVQVSYFDPFHVFDGLRNEIEQRLPLTNLHWKS
                     KGGALKTISSLNVKFISSTGEENSDDLVLKPFINCVVISCESVEEYRSKIRPLIKNWL
                     PSQGDLYCANIVVLHSNKEVLDSNIFKSVSLIEKFNKDFPSLKTLETKTVYRSNDERE
                     TFWNGLINKLKHYLLEVFENRIESYSSALQREISPSKAVVLHENSLKMYLSFQLIEEA
                     STEISRLDELLNNHETFLLIAGDLRTPLFNQEEFAINSISTLISKDKITYFGVQKCIL
                     QAELELYMVSSNANNSERKLNAAFHKFLSRLHVSFHSDKRWLQFKYSAYDEFINLTTF
                     DDIKSDTWKLVLCDMKNEQRECWIQLACSRMGYKIPLKDFRKEVTPEVNPSMEESFRT
                     LGVFYENIIQKTKDLLKEYSSFTSKRQRVMDWLSIEIAFLYFEQGDYSNCMLILQSSY
                     DFYMESGWSVIGSWLLEYYIECIKNCPNITEIDVDGDLVPKSIVLSNSYLNLLTSNSK
                     NPRKWWIEFLNNNIENNDNLIYPLDNLFLVEITRKVFPVKPNSYGIDISFSKNFKLDD
                     INISSITLLMKNYEDEFLPFKIADVILNNDNCIYTLISNSVLWSTFELVALEVVIGST
                     VFKKEFDSFETEDSLKLQPCQSFDAFKVTIEKSIEHICGKTYLRLKFENKEDIDEFTF
                     SIHSTDQDDICFEGNDSSVTVASFGTFRVPFERKSALTTSFFIKTVLSFSKGNEQYIE
                     KSVHEIDYNLPLDVSVDDVYLNDRLVFDFSLKSFANEAILIFGTGLETENTETYSISE
                     AESFAEPVLMNPAVKTPYHVYFQILNKQGLFSPVDKFRFSVKYLRVQQYFGELVQKII
                     PPKEQNIVDYNYWQNYIVPNLKLSDKAFESSRKVAIILEEPNILESLELIGSSAFKVQ
                     IKSILKKLKSGIPIDELPQFKTASMLHELVLPVNIPTLSLFYSVHFRQIDTNKELKAG
                     VPSSFKIEITNLSGTWDLQESQENAILTIANNSDWIIGGKRRFELDTKRIDATVNLIP
                     LRRGYLNYPSIELTGLNGERTGQMDYLASNDKLLIF"
     gene            complement(<620958..>621740)
                     /locus_tag="KLLA0_C07150g"
                     /db_xref="GeneID:2892123"
     mRNA            complement(<620958..>621740)
                     /locus_tag="KLLA0_C07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452517.1"
                     /db_xref="GeneID:2892123"
     CDS             complement(620958..621740)
                     /locus_tag="KLLA0_C07150g"
                     /note="similar to uniprot|P06174 Saccharomyces cerevisiae
                     YOR278W HEM4 Uroporphyrinogen III synthase catalyzes the
                     conversion of hydroxymethylbilane to uroporphyrinogen III
                     the fourth step in the heme biosynthetic pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452517.1"
                     /db_xref="GeneID:2892123"
                     /db_xref="GOA:Q6CU72"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:Q6CU72"
                     /translation="MSKVILLKNKTVPSDPYEQKFAANGFLPIFVPLIRHFHLPEEAL
                     QLFKNRQYLLSLKYIIITSQRTVECLNESILPQLTPDEQNILKQKTIYTVGPATSAFL
                     KKSGFLCIRGGVEVGNGALLADLILQSHINESIDHFLFLVGEIRRDVIPNRLNSHGYK
                     VNEVVTYRTENLEDNIGTFVASCESNGDNVSTDRNNTWVVFFSPQGTEEIISFLKERP
                     GYKFASIGPTTKQYLLEKGLVPDVVSNKPEPVSLFNAINNYK"
     gene            complement(<622165..>623739)
                     /locus_tag="KLLA0_C07172g"
                     /db_xref="GeneID:2892690"
     mRNA            complement(<622165..>623739)
                     /locus_tag="KLLA0_C07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452518.1"
                     /db_xref="GeneID:2892690"
     CDS             complement(622165..623739)
                     /locus_tag="KLLA0_C07172g"
                     /note="highly similar to uniprot|P38625 Saccharomyces
                     cerevisiae YMR217W GUA1 GMP synthase an enzyme that
                     catalyzes the second step in the biosynthesis of GMP from
                     inosine 5'-phosphate (IMP) transcription is not subject to
                     regulation by guanine but is negatively regulated by
                     nutrient starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452518.1"
                     /db_xref="GeneID:2892690"
                     /db_xref="GOA:Q6CU71"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /translation="MSPVEVSNVFDTILVLDFGSQYSHLITRRLREFNVYAEMLPCTQ
                     KIADLHWKPKGVILSGGPYSVYEKDAPHVDKAIFDLGVPILGICYGLQEIAWINNTEV
                     GRGEKREYGPATLRVEDKSCPLFANVDHSTVWMSHHDKVHNLPAGFKITATSENSPFC
                     GIANEDKQIYGIQFHPEVTHSTQGKTLLRNFAVDICKASQSWNMENFIDTEINRIREL
                     VGPDAEVIGAVSGGVDSTVAAKLMDRAIGDRFHAIMVDNGVLRLNEAATVKKTLGEGL
                     GINLTVVDASDEFLDKLKGVTDPEKKRKIIGNTFIHVFEREAAKIQPKNGKEIEFLLQ
                     GTLYPDVIESISFKGPSQTIKTHHNVGGLLENMKLKLIEPLRELFKDEVRELGELLGI
                     SHELVWRHPFPGPGIAIRVLGEVTREQVAIARKADYIYIEEIRKAGLYNNISQAFACL
                     LPVKSVGVMGDQRTYEQVIALRAIETTDFMTADWYPFEHSFLKKVASRIVNEVDGVAR
                     VTYDITSKPPATVEWE"
     gene            <624694..>625587
                     /locus_tag="KLLA0_C07194g"
                     /db_xref="GeneID:2892553"
     mRNA            <624694..>625587
                     /locus_tag="KLLA0_C07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452519.1"
                     /db_xref="GeneID:2892553"
     CDS             624694..625587
                     /locus_tag="KLLA0_C07194g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452519.1"
                     /db_xref="GeneID:2892553"
                     /db_xref="GOA:Q6CU70"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CU70"
                     /translation="MSDRNTVHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKS
                     IPYAFVEYESSHDAENAIRSCDGTPFEMNKSFSLRVQFARSKPRRDFGDSRDPRDGMR
                     QRDYRDRRDPRDRDPRDYRDPRDRMRSYRDQDDRRGGPGQGVRGYDDRRSGNPRPYGP
                     PRMSGSAQPPRRYDERLGEPKPYEPVLGTPISLERKLRDPPVQVSKATEQNNEQEQEQ
                     KQEQKQETDPVQDAGNESDGSNYDPNENLTVAEAAVPKPDDTSAKPEEHQQEQEQEHE
                     ETKPPFDAVNQPTENVSEQEQ"
     gene            <626227..>628278
                     /locus_tag="KLLA0_C07216g"
                     /db_xref="GeneID:2891939"
     mRNA            <626227..>628278
                     /locus_tag="KLLA0_C07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452520.1"
                     /db_xref="GeneID:2891939"
     CDS             626227..628278
                     /locus_tag="KLLA0_C07216g"
                     /note="similar to uniprot|Q03656 Saccharomyces cerevisiae
                     YMR216C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452520.1"
                     /db_xref="GeneID:2891939"
                     /db_xref="GOA:Q6CU69"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CU69"
                     /translation="MGSSLNGFITKNTGGSKHSGGSIFQREPVAKSHSSTKSNLSLAI
                     QTQINSEEHIPIPIPGSNSSKDADALLLGSNKNSVDNDDDDDDDYSSCDEKNEESAKD
                     YKPGGYHPAYKGETYKEGRYVLVRKLGWGHFSTVWLAKDTETGSHVAMKIVRSDKVYT
                     ESALDEIKLLQGVNPLQNQSFSEHKGSAHILRLLDNFIHSSVNGEHVVMVFEVLGENL
                     LALIKKYEHKGIPIVYVKQIAKQLLLGLDYMHRKCGVIHTDIKPENVLMEIGDVEAIV
                     RIVEEMDQVKREQRKLQRRASRAHLENISRHNSFNTAFDNPSISASSSSTTIRSRRPR
                     RATIVTGSQPLPSPLASSSFLELKSHMFGNTTASISRQQSFCGKSGQPTLQNNNCNTT
                     NTLLTEQTLTNNTNATSAATTTLTSPVGQNSNASISRLHNLLSTENKDVNSSSEQLAH
                     SFSSMEIVDNKVPGDESTKEAAFNTSINENRPDVIQVKIADLGNACWYDEHYTNAIQT
                     REYRSPEVILDCSWGASADIWSFACLIFELLTGDFLFEPQNGHSYTKDDDHIAQIIEL
                     LGNIPESLMTTGRAVRTFFTSRGELRNISRLKYWPLKSVLIEKYNMAPKEAEEISDFL
                     LPMLSIDPRKRADAGGMLNHPWLSDTLGMEDITIPDRKLYQSGADIPGWYKEVQGHPK
                     H"
     gene            complement(<630279..>631778)
                     /locus_tag="KLLA0_C07238g"
                     /db_xref="GeneID:2891804"
     mRNA            complement(<630279..>631778)
                     /locus_tag="KLLA0_C07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452521.1"
                     /db_xref="GeneID:2891804"
     CDS             complement(630279..631778)
                     /locus_tag="KLLA0_C07238g"
                     /note="similar to uniprot|Q03655 Saccharomyces cerevisiae
                     YMR215W GAS3 Putative 1,3-beta-glucanosyltransferase has
                     similarity to Gas1p localizes to the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452521.1"
                     /db_xref="GeneID:2891804"
                     /db_xref="GOA:Q6CU68"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CU68"
                     /translation="MVLPSILLSALISSSLVDALLPIHTKGGRFIQPSSPKNDASDNT
                     VFFVRGIDYQPGGSSSYSSKSGKDALTDEELCARDAFVFQQLGINTIRIYSLNPDLNH
                     DKCMTILNNAGIYVILDVNSGEWGESLNRADPSGSYKDYYLERVFKFIEAFKNYPNVI
                     GFFSGNEIINDDEDYAEIDPPYIRAVQRDMKQYIEKHSNRSIPVGYSAADNVDLRVAT
                     YDYLQCNSLNGSRVDEALQTSRSDFYGLNTYEWCSGISDWTSSGYDKLESSFKNGSIP
                     AIFSEFGCITAGERSFDEVSEGLYDGLLDTFSGGLVYEYSEEANNYGLVKIDDDGNIE
                     FKDDFENLKSQYEKLDLPTIKESDVEDVEVLTCDASKIKDENSKFGTNDFEIPDQPSE
                     ITDLIKNGVEVENAGKILTDYDAPTTFNYTIKDAQGKVVDATITYPASNTVNELSATA
                     TSSSSSSSSSTSASSTTSSSSKSSGGAIGTFQMNTGLLTVVAGVISALL"
     gene            complement(<632987..>634093)
                     /locus_tag="KLLA0_C07260g"
                     /db_xref="GeneID:2892549"
     mRNA            complement(<632987..>634093)
                     /locus_tag="KLLA0_C07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452522.1"
                     /db_xref="GeneID:2892549"
     CDS             complement(632987..634093)
                     /locus_tag="KLLA0_C07260g"
                     /note="similar to uniprot|P25303 Saccharomyces cerevisiae
                     YMR214W SCJ1 dnaJ homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452522.1"
                     /db_xref="GeneID:2892549"
                     /db_xref="GOA:Q6CU67"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CU67"
                     /translation="MVKLSTLLSLVWLPFVIAQDYYAILGVDKQASEKEIKSAYRQLS
                     KKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIYDRHGADALKNGHPGGPGGGNG
                     FHDPFDLFEQMFGSNMYNRARGKPRGQNLQVNHDISLKTFYLGTEFEFTLNLNDICDA
                     CDGSGSEDGKTETCPDCGGSGQIMKVFRAGPIEQRVRQPCSRCQGRGQLIKHVCKKCK
                     GVKVVQKSKVFTAKVEPGMERNHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRR
                     RGNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMP
                     IPSATDKFGDLIIDYVILLPGEWSTSSKGYDDEL"
     gene            complement(<634695..>635138)
                     /locus_tag="KLLA0_C07282g"
                     /db_xref="GeneID:2892209"
     mRNA            complement(<634695..>635138)
                     /locus_tag="KLLA0_C07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452523.1"
                     /db_xref="GeneID:2892209"
     CDS             complement(634695..635138)
                     /locus_tag="KLLA0_C07282g"
                     /note="similar to uniprot|P12962 Saccharomyces cerevisiae
                     YOR276W CAF20 Phosphoprotein of the mRNA cap-binding
                     complex involved in translational control repressor of
                     cap-dependent translation initiation competes with eIF4G
                     for binding to eIF4E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452523.1"
                     /db_xref="GeneID:2892209"
                     /db_xref="GOA:Q6CU66"
                     /translation="MIRYTEEELLQLRPTEPVKPNFDVDEFNAIIEKVKEIQEAHEEE
                     FSHFRRRSSHHHAKPKFKHLKPKITTDEEGWSTLETAPAVRRKSVAEEEEPTIVIAQE
                     TLKVKPNKHISSSRPADARDIVADKPSKAFNAFAALESDEEEEQE"
     gene            complement(<635351..>636982)
                     /locus_tag="KLLA0_C07304g"
                     /db_xref="GeneID:2892559"
     mRNA            complement(<635351..>636982)
                     /locus_tag="KLLA0_C07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452524.1"
                     /db_xref="GeneID:2892559"
     CDS             complement(635351..636982)
                     /locus_tag="KLLA0_C07304g"
                     /note="similar to uniprot|Q03654 Saccharomyces cerevisiae
                     YMR213W CEF1 Essential splicing factor associated with
                     Prp19p and the spliceosome contains an N-terminal c-Myb
                     DNA binding motif necessary for cell viability but not for
                     Prp19p association evolutionarily conserved and homologous
                     to S. pombe Cdc5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452524.1"
                     /db_xref="GeneID:2892559"
                     /db_xref="GOA:Q6CU65"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /translation="MAPVPIYVKGGIWTNLEDQILKAAVQKYGTHAWSKVASLLQKKN
                     ARQCQSRWNEFLNPSLNFKPFSQQEDDKLLDLAKRIPNQWKSIGEMMGRPAQTCIDRY
                     NILLAIDKDDLELAATTGVQIGEINPNNESLPAKADKDELLDEEREMLAEARARLLNT
                     QGKKATRKIRERMLEESKRVAFLQKRRELKQAGVDSKIKAPRKKYSSQMDYNEDIAYE
                     QQPLPGIYDTSKEDEQTEKLLKSFEKLVERKGLLDRKSDEKKTIPQKRRQGEQITSSV
                     TKLDSVLTDEYKKPKLELTPATLKGSKRKINKTTSILHLFESLPSPKNDFEIVLDDLD
                     EEMESTDAFNTESSYVNGKYPLEALISSTEHQSENKAMEIMEYIPTVFQIKTELQVPS
                     PIVDPKNEIDRELNRIISAKENGNPIYNSTEVNNYLEEIINSASTTEVPSTVLHPKLE
                     TSLKTITPATEHELLGMERKVHELRTALEDSVKSHREAVSQLSQDFEEKLHPTVSGLA
                     YQYYTDYMKYRNDHKTMQEETQSLAEQIKLAQRSQ"
     gene            <637629..>639821
                     /locus_tag="KLLA0_C07326g"
                     /db_xref="GeneID:2892486"
     mRNA            <637629..>639821
                     /locus_tag="KLLA0_C07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452525.1"
                     /db_xref="GeneID:2892486"
     CDS             637629..639821
                     /locus_tag="KLLA0_C07326g"
                     /note="similar to uniprot|Q03653 Saccharomyces cerevisiae
                     YMR212C EFR3 Non-essential protein of unknown function
                     exhibits synthetic lethal genetic interactions with PHO85
                     green fluorescent protein (GFP)-fusion protein localizes
                     to the cell periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452525.1"
                     /db_xref="GeneID:2892486"
                     /translation="MGFLFTPKHQKLVNQCYPPGRTPDKKPKGSETSYLLYYVNSRRP
                     KLEKVSSYLVKRSTTDLNRRRSGNVSVTLELLAKIVENCNENMNIFIKDFIHIMTLVL
                     NNNNFNNDPTIVGLIERVLEAICNHLDGSLVSGDSEFLELFKNFVTLYFKVANTKLND
                     TDLVLKGCLDFSKISNLGSIHQWSATAKNCVSIALTKFQERHPIYSEATIDSSFSEPG
                     SPALKKKLTRTQTKVMGLDDVSNTGDYSILALNTFFNTTETDKLTIGLHALIEHLLET
                     PNKELLQFICNGIPVQLRYIVILLFVRPLGTSSEKNMLLILKLISSLLTSAVSIIGLS
                     VIDILRRLITVQLAKSDSTTVVKQIAVTIKDLNRKTYYKQQSSDMFAELSFKFIESGK
                     PHHLELFQLDLDSLISVTSDQCLDLDLFGEFLPYVTDKTQLSKLLYPEAPHQVIFIRF
                     FEKVSTLSKQDTEIAISTSFAYYKAASLLSGLAYYVNNNRPSDGYYAYHHHASKFLGL
                     ADYQTQVEFKRKDNDIFTKEDLLNYYSDAGSNIYSEKGRDILLVDHSDQNGTDIDQDT
                     VRYSTPIPLPQISIPPTTTNGIGIKKSSPANDTYVTRSLKHNPVPNVKDLKNLVSSKK
                     DKSNTKTLRGSQSVKSKVTNITFLLDELKNDGDEIKIADPDEEDIIGMEKQDLARSYS
                     LRMNTISSTNSRTLIPSVENAEEHGDDFRDAHEDIEVSSSTRGRLFMV"
     gene            <639956..>641914
                     /locus_tag="KLLA0_C07348g"
                     /db_xref="GeneID:2892561"
     mRNA            <639956..>641914
                     /locus_tag="KLLA0_C07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452526.1"
                     /db_xref="GeneID:2892561"
     CDS             639956..641914
                     /locus_tag="KLLA0_C07348g"
                     /note="similar to uniprot|Q12033 Saccharomyces cerevisiae
                     YOR275C RIM20 Protein involved in proteolytic activation
                     of Rim101p in response to alkaline pH member of the
                     PalA/AIP1/Alix family interacts with the ESCRT-III
                     subunits Snf7p suggesting a relationship between the
                     response to pH and multivesicular body formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452526.1"
                     /db_xref="GeneID:2892561"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /translation="MNDIFAIPFKRALQINLKDAFTVVINNTFYQTAASVEADLTQLD
                     KYRDVLFHLDVCQADLNMLKQYYMALKAIAVKLPDDQVEFTWFNTLGLKSSGMTRNSL
                     RFETFNVLYNIGAMYSSLAVEQRLESTEGLKESCRLFKLSAGCFKFIYEHEVSNNFKF
                     FDEYTLNALVSMMLAQAQQMVWKKACFDDIERHSILSRLALQVALFYQTASKNSNCSP
                     YIRTDWVKSLTSKSHYFMAIAYYRSGLHQVQKQNYAQGICDFQYALTWINKLSLDDEL
                     TEWRGEVQALLESAERDNDLIYLQASVQNPSKVKPVMMVQADLFDEIEKKDGNIFKNL
                     LPIDVLESCNAFNERVETYVKEHISNPLESMNKLLISNTPQYMDFKSYYISEQEWNSY
                     SDSLQDLEQLRAYVAGELKLSESILQKDIQENEQMIREHGLLRWKIPSKDKKIESLLA
                     DLTNIRNYIENGMKVDTETASLFKTLDHDLVTNVSQPPESSDPIMKEASLILQGRKNH
                     ILAAERKIIENRLLPKIVSYYKKTGSKDFEPVFQEHIRMFDGDLLQVQKEKAKNKEML
                     TKVTLSSPEQVQISRNDPRTLYLEELKHSSNVLSELKENIISGKQFYQDLITALESKL
                     KEIEDYVNERKLQRTELNDTLLCDTNES"
     gene            complement(<641901..>643196)
                     /locus_tag="KLLA0_C07359g"
                     /db_xref="GeneID:2892048"
     mRNA            complement(<641901..>643196)
                     /locus_tag="KLLA0_C07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452527.1"
                     /db_xref="GeneID:2892048"
     CDS             complement(641901..643196)
                     /locus_tag="KLLA0_C07359g"
                     /note="similar to uniprot|P07884 Saccharomyces cerevisiae
                     YOR274W MOD5 Delta 2-isopentenyl pyrophosphate:tRNA
                     isopentenyl transferase required for biosynthesis of the
                     modified base isopentenyladenosine in mitochondrial and
                     cytoplasmic tRNAs gene is nuclear and encodes two isozymic
                     forms"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452527.1"
                     /db_xref="GeneID:2892048"
                     /db_xref="GOA:Q6CU62"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CU62"
                     /translation="MLRLLIKSPMMSRPKVIVIAGTTGVGKSDLSIQIASKFNGEIIN
                     SDSMQMYTGIPIITNKHPIEQRMGIKHHLMNHVPWNEEYYIHRFERECMETIEDIHSR
                     GKIPIVVGGTHYYLQTLFNKRVESKVRQPTESEKSILDSNNPDLIYNTLKEVDLSIAN
                     KFHINDTRRVKRMLEIYYTTGEKPSVTFQQQNTSLKFDTLFFWIYSDPAVLDVRLDNR
                     VDKMMKIGAMEEIMELYEYYKQHNYGQEQCENGVWQVIGFKEFLPWLEESSECDLNEC
                     VEKMKVRTRQYAKRQVKWIRKMLIPDVDGKVYILNATDLLEWDVSVSARANAILSDFT
                     KGKDIEAPLAQPDLEKLLAYKSSNSPKSDMDWKQFSCSLCKDKEDKNLVAIGSRNWEI
                     HLKSRRHKTNINRQHKKKSYEKWQKKKLLEMDSSSINSH"
     gene            complement(<643441..>644847)
                     /locus_tag="KLLA0_C07381g"
                     /db_xref="GeneID:2891914"
     mRNA            complement(<643441..>644847)
                     /locus_tag="KLLA0_C07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452528.1"
                     /db_xref="GeneID:2891914"
     CDS             complement(643441..644847)
                     /locus_tag="KLLA0_C07381g"
                     /note="similar to uniprot|Q03652 Saccharomyces cerevisiae
                     YMR211W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452528.1"
                     /db_xref="GeneID:2891914"
                     /db_xref="GOA:Q6CU61"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR019605"
                     /db_xref="InterPro:IPR029209"
                     /translation="MREIINVSVSHRSNHLITQFYNCLEPLLHDADQENDVFLNPNID
                     KVSKTVSYTPRALLWDAKLGNGSLGTYQYVSENDYADTLDSEQGATAKTAHRVQTHDR
                     IRKSPYQLALDQGATVLPKINDEIAKYWSDYSKLIYDPSSFNTLQDWYHDAANQQKAP
                     NFQNLRQVYFDNYETGSNQFRENYSNEFFDSNLHQQLEKCDSLQGFNIITELDNGWGG
                     FSSSMLLELKDELPKVSYHTYGWNQDDVCSLKEPVHSTKTKFQMLCNKIRATIALSQE
                     SDLFFPLYANTKEAFWRSTGETVLLFDSVNSVFHGSRKQAATNSNMRKMSHLTNALTL
                     GESKRNIVSKLNVDEYNSFSFYDRMPLYKNSKKPSHTFTQCEIDRVNHKESSMFHFTT
                     YPWTNSDTIPDTHHSCAESVIGVTEKPRDVLKTWEDLVSRYFRYDSDREEIKDHLGTL
                     SLEYEHGWYDDDDSDLDL"
     gene            <646269..>647555
                     /locus_tag="KLLA0_C07403g"
                     /db_xref="GeneID:2891833"
     mRNA            <646269..>647555
                     /locus_tag="KLLA0_C07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452529.1"
                     /db_xref="GeneID:2891833"
     CDS             646269..647555
                     /locus_tag="KLLA0_C07403g"
                     /note="similar to uniprot|Q03648 Saccharomyces cerevisiae
                     YMR209C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452529.1"
                     /db_xref="GeneID:2891833"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR016853"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CU60"
                     /translation="MNSVFNSILIIILSLGMASFTRNKAFKNWLVSKLEKSLTTLQSY
                     PPVSANFKLVDSPYFTKQQSLKDIAASLSQLCEYKIRALRQNGIVYQRTSNVTPSDIE
                     QLNQIGYFDKIVAVNKSIDVNYDTLSKIIEYTLKEILVNNDFNSAIESVLRDAGYTWD
                     KENDTLVRDSINSIRFSKKSNQSRVNEAMCHIVRDWCDVYDLERKPLVDFIEESFGNC
                     DIDEDTLIVVPGSGCGRLAYEAANRFPKAKVTSIEYSSLMYLCNEYVLGTTDNITVDP
                     FYQIYSGQQSMEAQTRHFRMDLDKFQKPENLTVLFGDFCCYKPEKKYKNIIVCSAFFI
                     DTAANMFDYFNAIEMLSNNCTGRLHWVNVGPLKYGTRPLVQFTYDELARLRKLRGWED
                     HSNQVDVKNLNGYLTDYESLFQGFYGLAKFHSELKR"
     gene            complement(<647673..>649007)
                     /locus_tag="KLLA0_C07425g"
                     /db_xref="GeneID:2891805"
     mRNA            complement(<647673..>649007)
                     /locus_tag="KLLA0_C07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452530.1"
                     /db_xref="GeneID:2891805"
     CDS             complement(647673..649007)
                     /locus_tag="KLLA0_C07425g"
                     /note="highly similar to uniprot|Q12024 Saccharomyces
                     cerevisiae YOR272W YTM1 microtubule-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452530.1"
                     /db_xref="GeneID:2891805"
                     /db_xref="GOA:Q6CU59"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /translation="MSTDKTQVKLRFFTREEDETLHVNDAPIYAPVSLKRYGLSEIVN
                     HLLELPKSMPFDFLIDGELLRTSLQDYLIKKGLSSETFLNVEYTRAVLPPSYLSSFDN
                     EDWVSSLDVGSNYIYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVHYISSTRLVSAG
                     NDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTV
                     SLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGSIRRRAPLALFESHSAPVEA
                     VIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSA
                     RHITLHDPRVNSSSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSN
                     TAMYTITREDKNVVKGVNDKVFAVKWAKGVGIISGGQDKKIQINKGDNIFSN"
     gene            <650118..>651101
                     /locus_tag="KLLA0_C07447g"
                     /db_xref="GeneID:2892412"
     mRNA            <650118..>651101
                     /locus_tag="KLLA0_C07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452531.1"
                     /db_xref="GeneID:2892412"
     CDS             650118..651101
                     /locus_tag="KLLA0_C07447g"
                     /note="highly similar to uniprot|Q12029 Saccharomyces
                     cerevisiae YOR271C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452531.1"
                     /db_xref="GeneID:2892412"
                     /db_xref="GOA:Q6CU58"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:Q6CU58"
                     /translation="MASSVPGPIALPESRYDLSTYWGRVRHCAEISDPTMLLTSSDDL
                     QQARKIISAYRHGELKETTPEFWHAKKQLDSTVHPDTGETVFLPFRMSCCVPSNLIVT
                     AGMLTPNMGTAGTLFWQWANQSLNVAVNGANANKSHPMSTTQLITNYTMAVTASCGVA
                     VGLNKLVPRLKHLSANTKMILGRLVPFAAVVSAGIVNVFLMRGGEIRKGISVYDSNGD
                     EVGKSKKAAFIAVAETAFSRISNATPIMVIPPLILVKLQKTVLKGKSMAVQTAANLGV
                     ILVTSFIALPFALAVFPQYQSISVSSLEPELKNKVDSNKKPIETVYFNRGM"
     gene            complement(<651446..>652705)
                     /locus_tag="KLLA0_C07469g"
                     /db_xref="GeneID:2892302"
     mRNA            complement(<651446..>652705)
                     /locus_tag="KLLA0_C07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452532.1"
                     /db_xref="GeneID:2892302"
     CDS             complement(651446..652705)
                     /locus_tag="KLLA0_C07469g"
                     /note="similar to uniprot|P07277 Saccharomyces cerevisiae
                     YMR208W ERG12 Mevalonate kinase acts in the biosynthesis
                     of isoprenoids and sterols including ergosterol from
                     mevalonate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452532.1"
                     /db_xref="GeneID:2892302"
                     /db_xref="GOA:Q6CU57"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CU57"
                     /translation="MTVTSAVPTPFIVSAPGKVIIFGEHSAVFNKNAIAASVSSLRTY
                     LLIEQSKDGDGVELDFPDINYDSKWSTEELKTIDSEVVKQAAGLKHLCPKLKEQLNLL
                     LEGLKDSLNYYAALSFLYLYLSLCPNVKGLKFTVKSTLPIGAGLGSSASISVCLALAM
                     ARMGGHISCDKSISQEEKEFINHWAFIGECCIHGTPSGIDNAVATYGNAVKFKRQEDG
                     STKFDQISNFPQLPMVLTNTRIKRSTKILVSGVGDLVNRKPLITEPILEAMNQVALRG
                     SELLSDISKDIHYDELLELIRINHGLLVAIGVSHPGLEVIKQLSDELKIGQTKLTGAG
                     GGGCAFTLLNKDVDHSSVRKFHEKLHSNYGYQIFETGLGGVGCCFVDLKNEQYESLKH
                     LFIDSATVQEVSLALLPSPDGSLTWTA"
     gene            <653352..>655841
                     /locus_tag="KLLA0_C07491g"
                     /db_xref="GeneID:2892421"
     mRNA            <653352..>655841
                     /locus_tag="KLLA0_C07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452533.1"
                     /db_xref="GeneID:2892421"
     CDS             653352..655841
                     /locus_tag="KLLA0_C07491g"
                     /note="similar to uniprot|P32563 Saccharomyces cerevisiae
                     YOR270C VPH1 Subunit of vacuolar-ATPase V0 domain one of
                     two isoforms (Vph1p and Stv1p) Vph1p is located in
                     V-ATPase complexes of the vacuole while Stv1p is located
                     in V-ATPase complexes of the Golgi and endosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452533.1"
                     /db_xref="GeneID:2892421"
                     /db_xref="GOA:Q6CU56"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:Q6CU56"
                     /translation="MSESVEKQEAVFRSAEMSLVEMYIPQEISRDAVYSLGHTGLVQF
                     RDLNRKVKSFQRTFVSDIRRLDNVERQYRYLVSLLQKFDIPLYQEPLSEEVSASPVPP
                     STSVIADHVENASILETRMQQLVESSDGLETKKTDLEQFRAALLAADKFFTGESDLST
                     LNHPPTQDELLELGEGQSLAHRACFVAGVIPRTKVGTLEQILWRAVRGNLYFKHLELD
                     EPFYDPKSKEKVFKNAFIVFSHGDMIIQRIQKIAESLDASIYDVNESSDLRSNQLKET
                     NSRLQDIYTVLDSTNTTLESELFAISKELDGWYRDISHEKAMYEVLNLFAYDSSRKIL
                     TAEGWCPTDELTVVQNKLKETCVRLGIASPAIVNVIETSRTPPTFHRTNKFTQAFQDI
                     CDCYGIAAYQEANPGLATIVTFPFMFAIMFGDMGHGALMAMAAAVLVLNEKKIGNMKR
                     DEIFDMAYSGRYIVLFMGLFSVYTGFIYNDMFSKSLTLFKSGWKYPESWEVGESITAH
                     QVGVYAFGIDSAWHGTENALLFANSLKMKLSIIVGFIHMFYSYMYSLANDFYFNDMVN
                     IYCNFIPGLLFLSSIFGYLVICIIYKWSVDWVADGKPAPGLLNMLINMFLSPGTIEDE
                     LYPGQAKVQVFLLLLALVCIPWLLLAKPLHFKYTQDKHQHQPIALSEDDQVPNSGQVE
                     EYDNEQIEDEDDDEEAGHGENMGDVVIHQVIHTIEWCLNCVSHTASYLRLWALSLAHA
                     QLSTVLWTMTIEIAFGMSGFVGVVMTVALFAMWFVLTCVILVVMEGTSAMLHSLRLHW
                     VESMSKFFKGEGIPYEPFKFVHLELEPEASS"
     gene            complement(<656060..>657379)
                     /locus_tag="KLLA0_C07513g"
                     /db_xref="GeneID:2892206"
     mRNA            complement(<656060..>657379)
                     /locus_tag="KLLA0_C07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452534.1"
                     /db_xref="GeneID:2892206"
     CDS             complement(656060..657379)
                     /locus_tag="KLLA0_C07513g"
                     /note="similar to uniprot|P39946 Saccharomyces cerevisiae
                     YOR269W PAC1 Protein involved in nuclear migration part of
                     the dynein/dynactin pathway targets dynein to microtubule
                     tips which is necessary for sliding of microtubules along
                     bud cortex synthetic lethal with bni1 homolog of human
                     LIS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452534.1"
                     /db_xref="GeneID:2892206"
                     /db_xref="GOA:Q6CU55"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017252"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MLTYKQRQSLNHAICDYVRQNEGSDELLVQLESVLLPNGSDVIP
                     QDPNLLERKWNSIVRLQSKIMELEKNCEELQKSIDEQQSSTNQISNASSDWCPRDTPS
                     FQITLDASITALCLHPSLPIIFIGLDSGKLLRYDILNVELPLQSTMAHMDGITSISIS
                     LPNENGRPAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLL
                     ATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGN
                     GLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHVASASRDGTIRLWKVSLPKFIP
                     HRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSCSDDGSVKCWSLDWTNLSTT
                     TCKKSWDLSNKGFQNCLTLDNIAFTGLPSRKLLFSGSSEGTLTSFMR"
     gene            <658746..>660620
                     /locus_tag="KLLA0_C07535g"
                     /db_xref="GeneID:2892584"
     mRNA            <658746..>660620
                     /locus_tag="KLLA0_C07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452535.1"
                     /db_xref="GeneID:2892584"
     CDS             658746..660620
                     /locus_tag="KLLA0_C07535g"
                     /note="some similarities with uniprot|Q07224 Saccharomyces
                     cerevisiae YOR267C HRK1 Protein kinase implicated in
                     activation of the plasma membrane H()-ATPase Pma1p in
                     response to glucose metabolism plays a role in ion
                     homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452535.1"
                     /db_xref="GeneID:2892584"
                     /db_xref="GOA:Q6CU54"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CU54"
                     /translation="MPSLLGLSFHRKKTHSSSQLSLASGATAEQERGHGRSSPSSGSP
                     NSHHHNNNSNNSSNKPHHTESFTHSVAAFLEPGHNFTPSSGHSDRRGTTVTAVTAAGP
                     VQSVSASTQQLLHDNGSSNNHSHNANGSCANPHQQSQQHKLTRFFRPGMKKRPSGGSL
                     MSSTKLTDLISPDQTNNLDHNSHAFSAIPPSTDSTLSLSNKTNIYHDDSILAQKYGKL
                     GKVLGSGAGGSVKVLVRPSDGAMFAVKQFRSRKPNEPIRDYARKCTSEFCVGSMLHHP
                     NIIETLDIFSDAKQTQYYQVMEYCPVDFFAVVMSGEMSRGEINCCFKQLVEAVNYLHS
                     KGYAHRDLKLDNCVMTKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPEVL
                     VHSNGYDAPMVDIWSMGIIFCCMMLKRFPWKVPKDSDVNFSLYCMPDDVEHDYVKSAQ
                     EHEALMKTKREERQKVKQMKDSKPREITEEAPQHREHEEHGSSSTQVNQITSTPEQKT
                     EVVEKKASQVTHEEPINPKADPTSSEYQVPQRKQKKVIHGPYRLLRLLPHASRPIMSK
                     ILEVNPAQRATMKDIYADGWFANIPYCTLDDKKNVIRGAGHSHTIVTEENAHLEKYKV
                     "
     gene            complement(<661000..>662187)
                     /locus_tag="KLLA0_C07557g"
                     /db_xref="GeneID:2891854"
     mRNA            complement(<661000..>662187)
                     /locus_tag="KLLA0_C07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452536.1"
                     /db_xref="GeneID:2891854"
     CDS             complement(661000..662187)
                     /locus_tag="KLLA0_C07557g"
                     /note="similar to uniprot|P38969 Saccharomyces cerevisiae
                     YOR266W PNT1 Involved in targeting of proteins to the
                     mitochondrial inner membrane Pentamidine resistance
                     protein involved in pentamidine resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452536.1"
                     /db_xref="GeneID:2891854"
                     /db_xref="UniProtKB/TrEMBL:F2Z6A5"
                     /translation="MTVANRVGYIVKRGYSTQRTPIDISSNSAFKESLASNALLNRLY
                     QLNQNGKIAIKVYSDKCPETNLNVSATLPVTHIPTTKITDAVKQDDSISNWRKPLVKW
                     FRLGKFVLGMYKVGVKSTWSTYFDSKGFKYTVNELTKLIEFKEIESRVLKQNKFDEID
                     LTRKQYLQWLRRKEFWKIPRFLIAFIMFEEVTPLLCYIFPSLSPWNCLMPGLYRRISD
                     SRSKKLVDNFEIEKSYISPYELDKTAVSQFLTKQNIMPSWRMGIYNITKEFKIPLLKV
                     VETNQKIMIDDWLLLRELLRDSEEPTILSDRELVDAIARRQLYQKGEDLNKMVENIEQ
                     QKVLKLRLLLYLSFKFEGTVAADIFGGKLLAERWGVNNMAIFNFPGSNELLKAEHLKN
                     IGL"
     gene            complement(<662466..>664325)
                     /locus_tag="KLLA0_C07579g"
                     /db_xref="GeneID:2892418"
     mRNA            complement(<662466..>664325)
                     /locus_tag="KLLA0_C07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452537.1"
                     /db_xref="GeneID:2892418"
     CDS             complement(662466..664325)
                     /locus_tag="KLLA0_C07579g"
                     /note="similar to uniprot|P40053 Saccharomyces cerevisiae
                     YER080W FMP29 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452537.1"
                     /db_xref="GeneID:2892418"
                     /db_xref="GOA:Q6CU52"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /translation="MLRIGSRCVRSVPKSSLRVSSTKIGKLFVRSVSDKPEEVFTKLS
                     DENDPQRDAFFKYSWGTWLKNDKQEKEKRITKFSLEGLNSVIDDLYKQSIENAKRLSK
                     SSIPPPAYLPNLTVSLPHNVKIENIGTVNPNEKIRIVSMASIHEGKHHRIYKIDTNAE
                     KSFVLRIPYALDDENTLAYRLKSEVATMDFADLKLGLKVPKVYSFGVNALNPVRQPFI
                     LEEYIEGTLLMRSWTPLENDAEDGKSHKDKLNAVINPISKFQAKLAEVKFNAFGSLYF
                     AKDYKTSEESAYEGETNEELKDRWRIGPSVERCLWRKKSTLNFDDRKQYLGPWDISSP
                     LDIVKCTGLLEAENARARLGLVQAHASPEVVAEDILKDQIKTFDNLAKVAPDLINTKT
                     TSIPKMENLLKPRLHHPDLDPMNVILKEDDDVPYLLDFEGSSIKPYILQNTPQFVAYD
                     GPKIYDLEKDIEGYKDMEESEKAKLEFMYKRTRNQFLWEFALNENLPELISSVAPPIK
                     VLRNPYVAAIERKSDEEYLLIEEALLQLAEVWPIFANNKLVNAAEYPLKYSEEEVKKH
                     ADALNAYHEKLISQPFAATQGWMPQDMFDNLVQGGILVKNEKGDYVISRTEDA"
     gene            complement(<665141..>665833)
                     /locus_tag="KLLA0_C07601g"
                     /db_xref="GeneID:2892128"
     mRNA            complement(<665141..>665833)
                     /locus_tag="KLLA0_C07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452538.1"
                     /db_xref="GeneID:2892128"
     CDS             complement(665141..665833)
                     /locus_tag="KLLA0_C07601g"
                     /note="weakly similar to uniprot|P40052 Saccharomyces
                     cerevisiae YER079W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452538.1"
                     /db_xref="GeneID:2892128"
                     /db_xref="UniProtKB/TrEMBL:Q6CU51"
                     /translation="MPESTLSLGSKDLYSNLSLNDQSMDNSSMKAIYEADMADTDDNG
                     YQDEERDEHLVPTISRPLSRSSVTSGLSMTATKDGVEGRRVQRYGIPQYSLNLLNSMS
                     QSYWKPKKNNGSNVADELDSPIGPPMTLREKIKLLSTDALSRTGVEDSRLDSVSLNGM
                     SRESLTPSKLQQQPRELQENLLNDFNNPNVIPRVNSELETNLSTMGDDMSYLHDMKNI
                     PSVLVAADSDND"
     gene            <666694..>668439
                     /locus_tag="KLLA0_C07623g"
                     /db_xref="GeneID:2892198"
     mRNA            <666694..>668439
                     /locus_tag="KLLA0_C07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452539.1"
                     /db_xref="GeneID:2892198"
     CDS             666694..668439
                     /locus_tag="KLLA0_C07623g"
                     /note="similar to uniprot|P20050 Saccharomyces cerevisiae
                     YIL072W HOP1 Meiosis-specific DNA binding protein that
                     displays Red1p dependent localization to the unsynapsed
                     axial-lateral elements of the synaptonemal complex
                     required for homologous chromosome synapsis and chiasma
                     formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452539.1"
                     /db_xref="GeneID:2892198"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR016573"
                     /db_xref="UniProtKB/TrEMBL:F2Z6I2"
                     /translation="MSTIQKVREKNEVSTKNVISQDQSQKLVQTMITMCFGCLAFLRG
                     LFPDDNFVDQKFVPEKCTKDYDKNSASSIRIKTLVRDKSDEANLFLDWLENGVFQTLR
                     KGYLKAISLGVFIDESNPNDLIETYLFSFDYSHDSITININGQADKVSLLDSRKMVQQ
                     LMRRFIIITQSLDPLPEKRFLTMRLLFNDLAPKEYQPQLFKDATKDPKTIITVPQENG
                     LDTFSVGSLNTSVHKVGIKVLSLADNTIQEQLASGITTQLDPFDLLNDNIELPQDTPF
                     NSQVNEPSQTTTMLQKYLRSSPANFHPTQAIPGDLTLNQNDTNFQGTVSQKLKHIRCL
                     RCKKMVPAVCYGNHAGSSIPVCIECLNNNRIDMNSVTMQRFIMTRKIYRYMAKKPDFP
                     KSISEFYSIFYGDSATDFDKQRIDDALSVLLMDEVFVVEPDVRVSSTGTQLRSSGYIN
                     VDSNSIFYPKGTLPKGTCAWTFVLRASKARPFYTEPYAKTEAQLQKLLEQCENTFKNL
                     KKLSVDDSLTLHELSINDTTNSMGYQGKSKKRVHSDNENDYISPEKSYLDTQNCHADK
                     VRRISVSKKTLKSAW"
     gene            <668726..>670249
                     /locus_tag="KLLA0_C07645g"
                     /db_xref="GeneID:2892296"
     mRNA            <668726..>670249
                     /locus_tag="KLLA0_C07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452540.1"
                     /db_xref="GeneID:2892296"
     CDS             668726..670249
                     /locus_tag="KLLA0_C07645g"
                     /note="similar to uniprot|P40051 Saccharomyces cerevisiae
                     YER078C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452540.1"
                     /db_xref="GeneID:2892296"
                     /db_xref="GOA:Q6CU49"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q6CU49"
                     /translation="MFKNNILTSIICRNFHVQSGLKKFVNRQRLPINCGQPIHETRPY
                     LLKAGELTPGITALEYFKRRVKLADKLAAKSCAIIAGSQVKYASGAVFYPFQQNNDMY
                     YLTGWNEPDSVMIIEKPNNNPEDVVLHMMVPPKDPFAEKWEGFRTGVDGVKEIFNADE
                     ATSNKNLERYICNIIRRCDYVYFDHTKDAKNSTAFFSSFFSMNDNNQKELTILNLIKN
                     TTPSRQLRPLKGIVAELRSTKSPAELRIMRRAGQISGRAYNQAYARRFRNERTLGSFL
                     EYKFIEGGCDRSAYIPVIGTGDNALCIHYTRNDDVMFDDEMVLVDAAGAIGGYCSDIS
                     RTWPVSGKFTDAQKDLYEVVLAVQKKCIELCAAHNVISLHQIHEKSLQFFKQELKNIG
                     LSSLSNWDINEIYPHYIGHNLGLDVHDVPEISRHQPLQEGQVITIEPGLYIPNDPKYP
                     EYFRNIGIRIEDDIAIGLNSYTNLTVEAAKEVIDIENIVQHGVSTKIDHDIPRPLDF"
     gene            complement(<670325..>671494)
                     /locus_tag="KLLA0_C07667g"
                     /db_xref="GeneID:2892139"
     mRNA            complement(<670325..>671494)
                     /locus_tag="KLLA0_C07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452541.1"
                     /db_xref="GeneID:2892139"
     CDS             complement(670325..671494)
                     /locus_tag="KLLA0_C07667g"
                     /note="some similarities with uniprot|P40512 Saccharomyces
                     cerevisiae YIL071C PCI8 Possible shared subunit of Cop9
                     signalosome (CSN) and eIF3 binds eIF3b subunit Prt1p has
                     possible dual functions in transcriptional and
                     translational control contains a PCI (Proteasome-COP9
                     signalosome (CSN)-eIF3) domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452541.1"
                     /db_xref="GeneID:2892139"
                     /db_xref="GOA:Q6CU48"
                     /translation="MTQGRLFYPLAVLQDRHFRSKYPNYNESRELKTWSVVSKRFPAW
                     EQKLVSMLLDNKYAESIIFINSDVSMSSVGVFKRTKLLIRTHILNSHYKAVIDFESRL
                     NTQPITSEPTELADFIECKLLLILNWFLRGEYHQCLQRFIQLIIDIPNLVELMVTLPK
                     DDIFISNETMFYIITVSALVSIPLDNLDTFIHLEELEQFHKHFDVLAGKGKLIINSKF
                     MKFFDWWHNDMERLCKQDYFLEKKWDIISKTMRQKMYAFYLRIATKIQISYLSERVGI
                     SREIVTQEITQLISEACLNFQIHDDLILYQKFDPQMALNDLMMTEDITLDNKLSQLRR
                     QNHNLRVIVDEHLALRKSRIQRRSKASDEEPMNEEEVFALSENELCNETADTFND"
     gene            <671623..>673776
                     /locus_tag="KLLA0_C07689g"
                     /db_xref="GeneID:2891945"
     mRNA            <671623..>673776
                     /locus_tag="KLLA0_C07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452542.1"
                     /db_xref="GeneID:2891945"
     CDS             671623..673776
                     /locus_tag="KLLA0_C07689g"
                     /note="weakly similar to uniprot|P40050 Saccharomyces
                     cerevisiae YER077C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452542.1"
                     /db_xref="GeneID:2891945"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q6CU47"
                     /translation="MSRVMQLTLFLVLVQIWLFCILCQFFQYDSVVGKILITVESLST
                     TSSQTPQEQFRQDSQSASIRICMSIGRTVIHVPCAQRFVRAFHATRVPYGSPLKVKLD
                     LLQKTQTLVKRTEKENGKQRDIARREARKARKYGYSIKKANEILKGRHKITNLDKSIK
                     VGPTSDDDTSILSVANDKRLMYTILGISRPQLKNSILVERDVAKFCKRGQLQKALFLI
                     KLAGPNGAAGMNTLMTHYLEVEKDSHSAVDLYSWRKKWQIPPNEYTETNLFKGLARLP
                     EPISVKVAERVVKIVLKLVEDERLNNINFNAALSALANSNDPSYLFKCFDLRPKGIKK
                     DAIAYTQLLIGCAKITDAVEAIQRADDIMNSADPKVIDSQMFFHYLNVWHSRRDLRFS
                     NCVLPLLDIFYDFKVPNVRFKKEIPEFVKLPALKNWNIKSKMRLTPHVAHLLMENCFK
                     TGQYEYGIAFFEHYLGKRPNLFNNRTINAALNLIIKADPENCGERCYELLRKMMDDGM
                     LREPLQHVVLTYKAFERQATKKLNNSDPVKATELVKSCLALMKDNEAKTSIQNDEYKS
                     YLSWKPWMFLLRIVMSCKDALPLTFKKTIIDEFITTMLCDPVMLLKQRGSTRESMRFV
                     YLEAVRFIKSLESSLNLTDEELKEVQAEAEDSNSLLKRKFLFRRHLIRLRKRILEVVD
                     NLEHDRDSNSPEIEKLFRQYCETILDTNIDDFSPT"
     gene            complement(<674146..>674925)
                     /locus_tag="KLLA0_C07711g"
                     /db_xref="GeneID:2891906"
     mRNA            complement(<674146..>674925)
                     /locus_tag="KLLA0_C07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452543.1"
                     /db_xref="GeneID:2891906"
     CDS             complement(674146..674925)
                     /locus_tag="KLLA0_C07711g"
                     /note="similar to uniprot|P40513 Saccharomyces cerevisiae
                     YIL070C MAM33 Acidic protein of the mitochondrial matrix
                     involved in oxidative phosphorylation related to the human
                     complement receptor gC1q-R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452543.1"
                     /db_xref="GeneID:2891906"
                     /db_xref="GOA:Q6CU46"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q6CU46"
                     /translation="MSLRLITRVASRVAARPASIQVARNVIARPTFITSSRQLSYTAT
                     TFNQHTTKVAQVLNSEVELETSQQIVDLPEELATFLSKYGFEPVVQEGRNLAHIRRQL
                     NDETINVFFDVAQVANLPVEPAALEQSEEQLEEDFDSMSDNFANVNIVVVKNSDNTAI
                     SFELLMNMQEGSFYVDSVTPYESAEDALNESAEAEIKRELGYHGPPFSNLDESLQESL
                     ESYLESRGITTDLTSFISNYSEFKENNEYIQWLSKMKKFFE"
     gene            <676715..>679666
                     /locus_tag="KLLA0_C07733g"
                     /db_xref="GeneID:2891831"
     mRNA            <676715..>679666
                     /locus_tag="KLLA0_C07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452544.1"
                     /db_xref="GeneID:2891831"
     CDS             676715..679666
                     /locus_tag="KLLA0_C07733g"
                     /note="similar to uniprot|P40048 Saccharomyces cerevisiae
                     YER075C PTP3 Phosphotyrosine-specific protein phosphatase
                     involved in the inactivation of mitogen-activated protein
                     kinase (MAPK) during osmolarity sensing dephosporylates
                     Hog1p MAPK and regulates its localization localized to the
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452544.1"
                     /db_xref="GeneID:2891831"
                     /db_xref="GOA:Q6CU45"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CU45"
                     /translation="MEYIDTMGTNKQQEEIQLKEPLSFSRPLARPPSISGCTEYKDRD
                     SIQSSSFTSESSSVLSSSSTLIDDKSSNSSLASPALSANYKRNSTEVLPEKILIHAST
                     FPSASEPSYSTCTPSPLSASHRSSLSFSRSRSRSIAMKSNSLPAIPTICPKDLRFPKH
                     KDCSFISPADLHHYIENMDQNPNEKLIIFDTRPFIEFNKNHIRSAMHLCLPSTLLKRK
                     NFNLERLIGNLPSPGRETLSEYLLGSDSATANAKVVIYDNVANQTDYAVSLACFGISS
                     KILDHVSDKQKPSVFILAEGFESFNAAYPDDVEVGTMDLEDSYTLDSPSSPHQADNIS
                     PVQPQLKHSGRSHSHSCSPLKQPPQTGNSRTLSGSPISTSSPLSSLFGFKLPAPINNQ
                     HLPTFKLPQIEHDISDLDNYVKAVEINERSQRNSFLESENDLRSFKFPASPSKQFSTD
                     ATSSSFTSTQTALSPADPSSGHNSSKLNFQVKYDNLYHRFASEEINQVVPSWFCQLMD
                     IPKLHFISKFQRLELLERKRLQRLLGPSSSASIVSTQSRSTVAGNDRCVEDGHYDVDE
                     DDAEENLQSITISSGVEFGTKNRYKDIFPYEHTRVKLSHSSICSAGCENSTPSPRSSA
                     YSSCASGLPTQDEQEDVWNTYINANYLVNPFAQLQQSSTADIKSVRYIATQAPLKETI
                     SDFYTCILNNNVPIILTLTDEFENGVEKCCNFWANGNYDGINVKLLDEFSTMLQDKPM
                     KAESNHEEDMFASKFWRHLKLNKTSDNNNEIIIRRIELSYNNDRSKFQLLQLQIKDWP
                     DLGTLLKPNEILQIINLKNFVIDSLFAHNVYSPNYTPTVLVHCSAGCGRTGTLCTVDS
                     ILSNLKKFDTDENPSLYGAFAVPLTPNLSPTTKSNSFSATKPPTSLMFDPIVTTVNQF
                     RRQRISMVQNINQFLFIYDCLLFYFTLNLETSPTDPEKRNNWQSMTDENSHLDILHKF
                     IDGKVNELQQV"
     gene            complement(<679857..>680503)
                     /locus_tag="KLLA0_C07744g"
                     /db_xref="GeneID:9487422"
     mRNA            complement(join(<679857..679984,680200..680331,
                     680413..>680503))
                     /locus_tag="KLLA0_C07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999312.1"
                     /db_xref="GeneID:9487422"
     CDS             complement(join(679857..679984,680200..680331,
                     680413..680503))
                     /locus_tag="KLLA0_C07744g"
                     /note="highly similar to uniprot|Q3E834 Saccharomyces
                     cerevisiae YER074W-A YOS1 Integral membrane protein
                     required for ER to Golgi transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999358.1"
                     /db_xref="GeneID:9487422"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:B5FV60"
                     /translation="MIFGLGRLFYVVLLLINSIAVLSEERFLRRKTTTHHYLPVGLGS
                     QSNQAVFGQQENTTKSKLVQLIGAVQTLLRKIVRNINNLYWWQFRFIMMLVVLLITII
                     KQLFKVSINVLSTS"
     gene            complement(<680963..>681943)
                     /locus_tag="KLLA0_C07755g"
                     /db_xref="GeneID:2892298"
     mRNA            complement(join(<680963..681367,681941..>681943))
                     /locus_tag="KLLA0_C07755g"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_452545.1"
                     /db_xref="GeneID:2892298"
     CDS             complement(join(680963..681367,681941..681943))
                     /locus_tag="KLLA0_C07755g"
                     /note="highly similar to uniprot|P26782 Saccharomyces
                     cerevisiae YIL069C RPS24B and highly similar to
                     uniprot|P26782 Saccharomyces cerevisiae YER074W RPS24A
                     proteins component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_452545.1"
                     /db_xref="GeneID:2892298"
                     /db_xref="GOA:Q6CU44"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:Q6CU44"
                     /translation="MSDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKL
                     AEAYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVEK
                     ASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD"
     gene            complement(<682962..>684506)
                     /locus_tag="KLLA0_C07777g"
                     /db_xref="GeneID:2891931"
     mRNA            complement(<682962..>684506)
                     /locus_tag="KLLA0_C07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452546.1"
                     /db_xref="GeneID:2891931"
     CDS             complement(682962..684506)
                     /locus_tag="KLLA0_C07777g"
                     /note="highly similar to uniprot|P40047 Saccharomyces
                     cerevisiae YER073W ALD5 Mitochondrial aldehyde
                     dehydrogenase that is activated by K and utilizes NADP as
                     the preferred coenzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452546.1"
                     /db_xref="GeneID:2891931"
                     /db_xref="GOA:Q6CU43"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6CU43"
                     /translation="MLGRTQVTTLRRFIRLYSQLPLKVPVQLPNGITYEQPTGLFING
                     EFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIAVAAAKKAFNNGWSTAEPEDRAK
                     CLLKLADLIDQHAETLASIESLDNGKSLFCSRGDVALVAKYLRSCAGWADKIYGKVID
                     TGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPALATGNTVVLKPAEATPLSALY
                     ACQLVQEAGVPKGVVNIIPGFGKIVGERICTHPDIKKVAFTGSTATGRHIMKTCADSI
                     KKVTLELGGKSPNIVFGDADLDKAVKNIAFGIFYNSGEVCCAGSRIYVQDTVYEEVLE
                     KFKQYAESLKVGNPFEENVFQGAQTSQMQIDKILSYVDVGTSEGARVITGGERIGNKG
                     YFIKPTIFADVKEDMQIVKEEIFGPVVTVSKFTTVDEVVAKANDSEYGLAAGIHTKDV
                     NKAIDVSNRVKAGTVWINTYNNFHQNVPFGGFGQSGIGREMGAEALDNYTQTKAVRMA
                     IDHPNY"
     gene            complement(<686756..>687145)
                     /locus_tag="KLLA0_C07799g"
                     /db_xref="GeneID:2892014"
     mRNA            complement(<686756..>687145)
                     /locus_tag="KLLA0_C07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452547.1"
                     /db_xref="GeneID:2892014"
     CDS             complement(686756..687145)
                     /locus_tag="KLLA0_C07799g"
                     /note="highly similar to uniprot|P40046 Saccharomyces
                     cerevisiae YER072W VTC1 Protein involved in vacuolar
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452547.1"
                     /db_xref="GeneID:2892014"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:Q6CU42"
                     /translation="MSAPLLQKAPGKRIALPTRVEPKVFFANERTFLSWLNFTVMLGG
                     LGVGLLNFGDKVGRISAGLFTLVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRFGPTL
                     LCFFLLVAVIVNFFLKLKYQGDTQQSD"
     gene            <687809..>688165
                     /locus_tag="KLLA0_C07821g"
                     /db_xref="GeneID:2892492"
     mRNA            <687809..>688165
                     /locus_tag="KLLA0_C07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452548.1"
                     /db_xref="GeneID:2892492"
     CDS             687809..688165
                     /locus_tag="KLLA0_C07821g"
                     /note="weakly similar to uniprot|P40045 Saccharomyces
                     cerevisiae YER071C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452548.1"
                     /db_xref="GeneID:2892492"
                     /db_xref="GOA:Q6CU41"
                     /db_xref="InterPro:IPR005334"
                     /translation="MTSSIKITDNSRELNGPVSREKLSSILNEIFNKDEPIPSSVELV
                     LAQLNELSSKHKFIVNVTKLNANNVNTADFSVDSYIGSSWNDKSDGAFHYQIPLGSGQ
                     PDTKRILLVSVYWILL"
     gene            complement(<688312..>690696)
                     /locus_tag="KLLA0_C07843g"
                     /db_xref="GeneID:2891880"
     mRNA            complement(<688312..>690696)
                     /locus_tag="KLLA0_C07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452549.1"
                     /db_xref="GeneID:2891880"
     CDS             complement(688312..690696)
                     /locus_tag="KLLA0_C07843g"
                     /note="similar to uniprot|P32844 Saccharomyces cerevisiae
                     YIL068C SEC6 Essential 88kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which has the essential function of mediating
                     polarized targeting of secretory vesicles to active sites
                     of exocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452549.1"
                     /db_xref="GeneID:2891880"
                     /db_xref="GOA:Q6CU40"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="UniProtKB/TrEMBL:Q6CU40"
                     /translation="MPSSEIERISQLLKDDVSTESIRKVRENLIKEKSTVEYQLNKQS
                     KARFQDAQSCLQLMTQAQRNMKSLKDDLRKVDSLSKENRSSIERYDIINDATRLHELM
                     ENTTAIHQKIIQYNDFLNELETLLDHELSHDPLESGCPSLLKIHFMITAARDFHDQMI
                     TLASISSIDVQTTMSKVFQRVPGCIEKFNKLLRDITYDIIEAVRTENQSLLIRLFKVI
                     HVEECEDIKIIATRNIIKAKELESESKKSKKVSDKMSAFDTNNKKYTEYPTALGIATE
                     INKGTIQTRTLPRGYKTFFLSTIHKGIQEMFTEVRNEYSGDKKFDVLNNLDWVFNELM
                     VVRDHVTPLGPAHWKLFERYFEFYYDEIHKLITELVDSEPETIIILDILEFDKNFQSV
                     LKKEFGFNKDRIKSIIGDSEKEQLLSDYLTLILNKMREWIGNLEKTEVVIFTERSSPP
                     HVDSDNWLFLDGTKTCFQMFNQQVEVAAGSGQAKILVGVVERFCNLLLSRQEIWVQTI
                     NDQLEKCIEFNHRYEMNPESFTKENEFPGGLVEYLVAVANDQMKAADYAVAISQKYGS
                     YVSKVHERAITAQIEKTLDGFAYVAKCATSGICKVIFDDLRTPYSEIFDKSWYGGNQT
                     QQIASTVQEYLNDIKEQMNPFIFFSLVETTVEDALLKYVQCLKYEHSIKNKGNKFLDC
                     IRRDFKIFYQLFVEYVPAEEKAMLDDKFKFAEYFIDLCCDTSDAVIESWKLCLETYWD
                     CPLAVLQHILKSRKDVDKSDMKRMLAQAEAIQTSPQRIAQLKSMDLPATFISRF"
     gene            complement(<690987..>692966)
                     /locus_tag="KLLA0_C07865g"
                     /db_xref="GeneID:2892395"
     mRNA            complement(<690987..>692966)
                     /locus_tag="KLLA0_C07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452550.1"
                     /db_xref="GeneID:2892395"
     CDS             complement(690987..692966)
                     /locus_tag="KLLA0_C07865g"
                     /note="similar to uniprot|P40514 Saccharomyces cerevisiae
                     YIL067C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452550.1"
                     /db_xref="GeneID:2892395"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="UniProtKB/TrEMBL:Q6CU39"
                     /translation="MGTGPYPSAEELNAPLICDDEEAQAYEMRDMLPAQDTTSNLTET
                     GDDIRELRYSDNRPIWEKIWCGPINPEDEPPKFHLRWKTLKYLDGLPKRLFNSNLGNK
                     ALVRYGILIIYVSIWFSIVSSILFPYLLRAPVFSQNGSGEDITIMPLTCTQSLKSWKG
                     ENNACGTNAEFCTTTDNDFFVRCPALCDRAWIYSAQTVGNQRVKYREFNIGGGPTKDN
                     AILSHPYRGDSAICSSAYHSGLISGLSGGCVRVSSQGPQAKFLSVNGKSGLSVGFDSF
                     FPLSFAFTEMQDGIASGCYDPRSLVMALNIVFSLPIFFLYEAVIGYWTVTLAGFWTLL
                     LIFDPPMLTDPTDLTTVAELISVGFERLLPLSFILYVIWKASVKRTLDNGSPLVKATL
                     WFPMFWLGVMNNVTFDRLPVDRLTLKDLKELAGALLAVGSIISTILICAVIQTYSIWK
                     SGRFAKYFKVLITVIMGVIALTLIPGLNLRIHHYILGMTLVMFCSTRGASAYLFQGIL
                     IGLVISGVGTWGFASIVETDLSLLRGEAGAAFMPPIFDFNESQPLTISWHPRNETAIP
                     SELDGYSLLINDVERYVGPSSQIDLDLLLDGNLAFARLVLDSQQKSENNSIPLYIRVA
                     HANTKNPIDKRGDYTNAAILQFPEGLWQDPSPGVS"
     gene            complement(<693437..>696064)
                     /locus_tag="KLLA0_C07887g"
                     /db_xref="GeneID:2892088"
     mRNA            complement(<693437..>696064)
                     /locus_tag="KLLA0_C07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452551.1"
                     /db_xref="GeneID:2892088"
     CDS             complement(693437..696064)
                     /locus_tag="KLLA0_C07887g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
                     reductase (RNR) and to YIL066C uniprot|P21672
                     Saccharomyces cerevisiae YIL066C RNR3 Ribonucleotide-
                     diphosphate reductase (RNR), large subunit; the RNR
                     complex catalyzes the rate-limiting step in dNTP synthesis
                     and is regulated by DNA replication and DNA damage
                     checkpoint pathways via localization of the small
                     subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452551.1"
                     /db_xref="GeneID:2892088"
                     /db_xref="GOA:Q6CU38"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:Q6CU38"
                     /translation="MFVYKRDGHKEPVQFDKITARVSRLCYGLDAKHIDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTIHPDYATLAARIAISNLHKQTTKQFSQVVDDLY
                     QWVNPRTGIHSPMISDEVYKIVMDNKDTLNSAIVYDRDFQFNYFGFKTLERSYLLRID
                     GKVAERPQHMIMRVAVGIHGNDIERVLETYNLMSQRYFTHASPTLFNAGTPHPQMSSC
                     FLVAMKEDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGIIPMI
                     RVFNNTARYVDQGGNKRPGAFALYIEPWHSDIFDFIDIRKNHGKEEIRARDLFPALWI
                     PDLFMKRVEKNQDWTLFSPNEAPGLPDAYGEEFEEMYERYEREGRGRKTVKAQKLWYA
                     ILEAQTETGTPFMLYKDACNLKSNQKNLGTIKSSNLCCEIVEYSDPTETAVCNLASIA
                     LPAFIERSTDGKTQTYNFEKLHSIAKVLTRNLNRIIDRNYYPVETARRSNMRHRPIAL
                     GVQGLADAFMMLRLPFDSEEAKKLNIEIFETIYHGACEASMELAKEEGHYETFPGSPA
                     SQGQLQFDLWGKTPTALWDWNTLKEQIKLNGMRNSLLVAPMPTASTSQILGYNECFEP
                     YTSNMYSRRVLSGEFQIVNPYLLHDLVDLGIWDEAMKSHIIADNGSIQNLPNIPQELK
                     DLYKTVWELSQKHIIDMAADRAAYIDQSQSLNIHIRAPTMGKLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTIDKSVAEQAANSVVDLSKLNRPVYIPHKASVNDQSVTPAVEA
                     FKEVSPAPSSEESIVNSVASLKIDDTQPVTPVTPAESAKDAEDVKQAPTDASEFDIFN
                     SKVIACAIDNPEACEMCSG"
     gene            complement(<697288..>697755)
                     /locus_tag="KLLA0_C07909g"
                     /db_xref="GeneID:2892080"
     mRNA            complement(<697288..>697755)
                     /locus_tag="KLLA0_C07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452552.1"
                     /db_xref="GeneID:2892080"
     CDS             complement(697288..697755)
                     /locus_tag="KLLA0_C07909g"
                     /note="similar to uniprot|P40515 Saccharomyces cerevisiae
                     YIL065C FIS1 Mitochondrial outer membrane protein involved
                     in membrane fission required for localization of Dnm1p and
                     Mdv1p during mitochondrial division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452552.1"
                     /db_xref="GeneID:2892080"
                     /db_xref="GOA:Q6CU37"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR016543"
                     /db_xref="InterPro:IPR028058"
                     /db_xref="InterPro:IPR028061"
                     /translation="MTNIHYLPELEDSYSALNSDQIEILRQQVLNEGGEISSIQSRFN
                     YAWGLVRSTNKEDQMLGVKLLTDIYKESPMRRRECLYYLTIGCYKLGEYSTAKRYVDA
                     LVHHEPENKQALMLQTAVENKITSQGLKGIALISAGIAIGATTIGLLIRGRRR"
     gene            <698086..>698784
                     /locus_tag="KLLA0_C07931g"
                     /db_xref="GeneID:2892054"
     mRNA            <698086..>698784
                     /locus_tag="KLLA0_C07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452553.1"
                     /db_xref="GeneID:2892054"
     CDS             698086..698784
                     /locus_tag="KLLA0_C07931g"
                     /note="similar to uniprot|P40516 Saccharomyces cerevisiae
                     YIL064W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452553.1"
                     /db_xref="GeneID:2892054"
                     /db_xref="GOA:Q6CU36"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR026635"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CU36"
                     /translation="MEDTTKLNTSKLGTKEYWDDFYSLEKQNFEENPEDTGECWFADN
                     DAEEKMVEFLLDNLGEYNIKEDSSMIDLGTGNGHLLFTLLEEGFKGEMIGVDYSEKSV
                     EFAAEILKTKYSQNDNVTFATADIFNEQWAPGKFDVVLDKGTLDAIALSGIKFENNET
                     VVDVYPKVIEKILGENSILLITSCNFTEEELIKIIETETLKKWKSVNYPIFEFGGVKG
                     TTICSVAFLKSSAK"
     gene            complement(<698867..>699907)
                     /locus_tag="KLLA0_C07953g"
                     /db_xref="GeneID:2892003"
     mRNA            complement(<698867..>699907)
                     /locus_tag="KLLA0_C07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452554.1"
                     /db_xref="GeneID:2892003"
     CDS             complement(698867..699907)
                     /locus_tag="KLLA0_C07953g"
                     /note="some similarities with uniprot|P40517 Saccharomyces
                     cerevisiae YIL063C YRB2 Ran-GTPase-binding protein
                     involved in nuclear export nuclear protein interacts with
                     Gsp1p and Crm1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452554.1"
                     /db_xref="GeneID:2892003"
                     /db_xref="GOA:Q6CU35"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CU35"
                     /translation="MPETLNDSNKRALPEVNSELESTETPVKKVKLNDKDEAKPSEET
                     DKFITENDTANEEANSVERPKNIETAETTETAVTKEEDTNNKKEEEAKEKDEGAKAEI
                     EGKKTEPKPEKDVEKPSFTFGQSSSFVSGFGVATKPFGAANAFSAGLPAAKTTEKDGN
                     KDTVKVEPGFSFGSGLSFGAGFKAAKVASKDSVAKDKQTVESEKKESTPAQSREPTVK
                     LTKQDVKSGEETEESIFQTNAKLYQLTDIKDGWKERGIGVLHLNKDEVSEKSRIVMRS
                     RGLLKVILNLPLVKGFSIKKGFPGSLNGEKFVRILAVDENKNPVQYALRTGKAEIADE
                     LYEKVNAHILEN"
     gene            complement(<700213..>700674)
                     /locus_tag="KLLA0_C07975g"
                     /db_xref="GeneID:2892161"
     mRNA            complement(<700213..>700674)
                     /locus_tag="KLLA0_C07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452555.1"
                     /db_xref="GeneID:2892161"
     CDS             complement(700213..700674)
                     /locus_tag="KLLA0_C07975g"
                     /note="similar to uniprot|P40518 Saccharomyces cerevisiae
                     YIL062C ARC15 Subunit of the ARP2/3 complex which is
                     required for the motility and integrity of cortical actin
                     patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452555.1"
                     /db_xref="GeneID:2892161"
                     /db_xref="GOA:Q6CU34"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="UniProtKB/TrEMBL:Q6CU34"
                     /translation="MEDWRRIDIDAYDPESGRLTADDLKPPYSHTVSLQELQPTIQQL
                     RSYTSSGDFAAAVELFTTDPPYNADEQAKSQYFSGILEVLTQVRQVDIANIVKRLDRK
                     QQDALIKYLYKGMSIPEGQKHGGILLAWFEKLTQVAGVNPIVHYLSDRRTV"
     gene            complement(<701021..>703591)
                     /locus_tag="KLLA0_C07997g"
                     /db_xref="GeneID:2892056"
     mRNA            complement(<701021..>703591)
                     /locus_tag="KLLA0_C07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452556.1"
                     /db_xref="GeneID:2892056"
     CDS             complement(701021..703591)
                     /locus_tag="KLLA0_C07997g"
                     /note="highly similar to uniprot|Q01217 Saccharomyces
                     cerevisiae YER069W ARG5 6 Bifunctional enzyme with
                     acetylglutamate kinase and
                     N-acetyl-gamma-glutamyl-phosphate reductase activities
                     catalyzes the second and third steps in the biosynthesis
                     of the arginine precursor ornithine forms a complex with
                     Arg2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452556.1"
                     /db_xref="GeneID:2892056"
                     /db_xref="GOA:Q6CU33"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:Q6CU33"
                     /translation="MSVPSARLLMSTKGLNPSRLSKVASILARCSPSIPKRVGYSKRF
                     VSSANGVGSTGTRSTVIQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIISDNL
                     QELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQGIEPDYIDGIRITDDHTMAVVRQC
                     FLEQNLKLVTALEQLGVRARPITSGVFTAEYLDKDKYKLVGDITSVARDPIEASIKAG
                     VLPILTSLAETPSGQMLNVNADVAAGELARVFEPLKIVYLNEKGGIINGSTGEKVSVI
                     NLDEEYDELMKQSWVKFGTKLKIKEIKDLLDFLPRSSSVAIINVQDLQKELFTDSGAG
                     TLIRRGYKLIRRSTLQEFPSSDALRDILQSDPDIQSGAQSVASYLRDLNESDFTSYAD
                     EPLDVLAIVKKDSVVAKLDKFLCSQTGWLNNVTDNVFKALKRDFPALQWVINEDDANI
                     AWHFNKSDGSYLKNGKVLFWYGVKDLNTVSELISEFIKTSPESGTAPSFSGSSSGVFS
                     SGQSSRSYSTRARSAPKVEGTNKSPAKVALIGARGYTGQNLISLIDSHPFLELSHVSS
                     RQNAGKKLEGYNKSEIIYSNLQIDDIKKLESEGAVDVWVMALPNKVCEPFVEAIESVA
                     NGKSKIVDLSADHRFVPETEWSYGLPELNNREAIANAKKIANPGCYATGAQVAIAPLS
                     EYITGLPTVFGVSGYSGAGTTPSPKNDPKFLNNNLIPYSLTNHIHEREISTRLGLEVA
                     FVPHVAQWFQGISHTISIPIKKNSLSSEQIKALYTEFYANEKLVHVADDIPLVKDVSG
                     THGVVVGGFKVNDAKDRVVVCATIDNLLKGAATQCLQNINLALSYGEYDGIPDNKIIQ
                     "
     gene            complement(<704199..>705104)
                     /locus_tag="KLLA0_C08019g"
                     /db_xref="GeneID:2892112"
     mRNA            complement(<704199..>705104)
                     /locus_tag="KLLA0_C08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452557.1"
                     /db_xref="GeneID:2892112"
     CDS             complement(704199..705104)
                     /locus_tag="KLLA0_C08019g"
                     /note="weakly similar to uniprot|Q00916 Saccharomyces
                     cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452557.1"
                     /db_xref="GeneID:2892112"
                     /db_xref="GOA:Q6CU32"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="UniProtKB/TrEMBL:Q6CU32"
                     /translation="MKPQTRKYNRHNGFHTLTKLPSSVSKLFTQGPPLPPSRVRVRRN
                     QNKKYALTGVSAVLQHVSEYKKATHPVSENQHLKVYDEAMNESHKEQEELMKKIQEWH
                     PESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFV
                     QFTSYEDSKQCFRELGVRKGIEIMGRTSIVDIERGRTVKFFKPRRLGGGLGGRGYQRK
                     DLVNKLTGASTRPMHEHARRPIRRHDTFERRGPPQGHSHSYQPTSPISSPASNFQKTA
                     SSSYRSRRDRSRNDTSNGSTDTLMY"
     gene            complement(<705516..>707240)
                     /locus_tag="KLLA0_C08041g"
                     /db_xref="GeneID:2892194"
     mRNA            complement(<705516..>707240)
                     /locus_tag="KLLA0_C08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452558.1"
                     /db_xref="GeneID:2892194"
     CDS             complement(705516..707240)
                     /locus_tag="KLLA0_C08041g"
                     /note="similar to uniprot|P34909 Saccharomyces cerevisiae
                     YER068W MOT2 Component of the CCR4-NOT transcription
                     regulatory complex which represses transcription at least
                     in part by inhibiting functional TBP-DNA interactions and
                     also aids in transcription elongation interacts with
                     C-terminal region of Not1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452558.1"
                     /db_xref="GeneID:2892194"
                     /db_xref="GOA:Q6CU31"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6CU31"
                     /translation="MNATATENPHVHQNQHEIQKALSNYDTSFLSDDEEDLCPLCIEP
                     LDVMDKHFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLSPEELK
                     MERSKQARKERDRKQRERERRENDTHNRKQLAGMRVIQKNLVYVIGLNPPYPYEELPS
                     ILRSDKYFGQYGKINKIVINKKTGHEHHSVSNSSSHINSGYGIYVTFSRKDDAAKCIQ
                     AIDGIYIDGHQVKAAYGTTKYCSSYLRGQPCPNPNCMFLHEPGEEADAFNNARKEHAH
                     HSHAPPTLAKPSTSASSTPKLAHASLRTDDSTVPAAATSSSKQTAPVLTPAPVPSGSN
                     PWGISQAPTPVSTIFNKTSTSTTFPTLSSSLGETLNSPGPGTPTTTGSAPTANSSSNV
                     SSKKKGEKTYEDPYDPMATCVKFLDQTFKFLSDIPERSYTFNSNLLDDETYQSYPSLF
                     SFEKIGCSEQSEGVLGAKLCDLLTIKPVDHMSSLLPFIQNKATPTMLPPGIAVQQPQL
                     VQQQKQQLQQQQLQQQQQQLSLQMQLQAQQGMAQQGMAQQVMSQPQSNSSDLLNQLIH
                     GKKQTAAV"
     gene            complement(<707966..>708457)
                     /locus_tag="KLLA0_C08063g"
                     /db_xref="GeneID:2892131"
     mRNA            complement(<707966..>708457)
                     /locus_tag="KLLA0_C08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452559.1"
                     /db_xref="GeneID:2892131"
     CDS             complement(707966..708457)
                     /locus_tag="KLLA0_C08063g"
                     /note="highly similar to uniprot|P40188 Saccharomyces
                     cerevisiae YIL057C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452559.1"
                     /db_xref="GeneID:2892131"
                     /db_xref="GOA:Q6CU30"
                     /db_xref="InterPro:IPR022554"
                     /translation="MTKKDKGPKFANVTTKSGEVVKVFEDLNDFETFIKNETEDEEFD
                     HVHCHLKYYPPFVLHESHEDPEKIKDSANSHSKKFVRHLHQHIEKHLLKDIKERIKLP
                     DLKFKDKAKEESFEHIVWKYNDVTQYHGKDFEIHITVECHNDSAIVDVDYLTKPLTAA
                     VEA"
     gene            709414..709495
                     /locus_tag="KLLA0_C08085r"
                     /db_xref="GeneID:2891992"
     tRNA            709414..709495
                     /locus_tag="KLLA0_C08085r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2891992"
     gene            <710617..>712245
                     /locus_tag="KLLA0_C08107g"
                     /db_xref="GeneID:2892560"
     mRNA            <710617..>712245
                     /locus_tag="KLLA0_C08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452560.1"
                     /db_xref="GeneID:2892560"
     CDS             710617..712245
                     /locus_tag="KLLA0_C08107g"
                     /note="highly similar to uniprot|P28240 Saccharomyces
                     cerevisiae YER065C ICL1 Isocitrate lyase catalyzes the
                     formation of succinate and glyoxylate from isocitrate a
                     key reaction of the glyoxylate cycle expression of ICL1 is
                     induced by growth on ethanol and repressed by growth on
                     glucose"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452560.1"
                     /db_xref="GeneID:2892560"
                     /db_xref="GOA:Q8NJ72"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /translation="MVSVKASAAEKKEFLQSQIDEIEKWWSEPRWKDTKRIYSAYEIA
                     KRRGSVKPNTFPSTVMSQKLFKILGEHAKNGTVSKTFGALDPVQVTQMSKYLDTIYVS
                     GWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHDRKQWERICDGTIEESEI
                     IDYLTPIVADGDAGHGGLTAVFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRCVIP
                     VQEHINRLITCRMAADVLGSDLILVARTDSEAATLLSSTADSRDHYFILGASNPAVKG
                     KPLNDLLNKAILDGATIDDLQTIEKEWLAKADVKLFHEVFADAAKAAGKDQSVIDQFN
                     SKVNPLSETSIYEMQALAKELLGTELFFDWDLPRGREGLYRYQGGTQCSVMRARAFAP
                     YADLCWMESNYPDYEQAKEFAEGVTAKFPGKWMAYNLSPSFNWTKAMSVDEQETFIQR
                     LGDLGYIWQFITLAGLHTSGLAIEQFSKNFAKLGMKAYAQDIQKKELDNGIDMVKHQK
                     WSGAEYIDGLLRLAQGGLAATAAMGQGVTEDQFK"
     gene            <714910..>716832
                     /locus_tag="KLLA0_C08151g"
                     /db_xref="GeneID:2892174"
     mRNA            <714910..>716832
                     /locus_tag="KLLA0_C08151g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452562.1"
                     /db_xref="GeneID:2892174"
     CDS             714910..716832
                     /locus_tag="KLLA0_C08151g"
                     /note="weakly similar to uniprot|P40522 Saccharomyces
                     cerevisiae YIL056W Hypothetical ORF and to uniprot|P40041
                     Saccharomyces cerevisiae YER064C Non-essential nuclear
                     protein; null mutation has global effects on
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452562.1"
                     /db_xref="GeneID:2892174"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:Q6CU27"
                     /translation="MNKVHKPSGTTHRIREQLNFSDDKKWKQFSSRRLELIDKFNLSE
                     RKASEQDENIRQIAHILRTEFGYPTITSSEFEKLVTAAVQSVRRNRKRSTKTRSKRSE
                     MSSATSDEDWLISRTTSPVHSHHSGASSLASSSTTHAASNPSSVPASQVAPHATLQPS
                     QNHTPQMPLLSGSSLPIHSSTSSTNNINSPAPIIQPKPIRMVYKSSTSLHQQLNNSNT
                     FKQSYDEFMRDVIKDLTTNPINVQQENEQKSQANLADLALSTHDFSLLNLALTKNKSN
                     NAGNDQTDQQHPQQQPQQQQQDTIPFFLKEKLMHFIQNSKTLIDLSSNLNTQENNNLL
                     KLGQHVILSSISFVLEKFFSNLSVNSVDYLHDKLSSCDSLSEMCIKLIGSGTKRNLNQ
                     LPLEWRVKLLNFILGGVVKDFGFDPCVYPLAEIFHDSILKKYPLVCKDGKSSGTSSFK
                     NAVIASLPLKPEFANKDMNKKVVIKFGDKEQRFVFHLLSNGAPTIHEILENSSILFQI
                     NKEKISSLVIVHRNEIVKDDAQLASLLNGFSNEEIVLEINDHSKLTNSNSSSMNGLQI
                     LSSVSQVAAENTASSPSCITALDNIISRIASPISSIKKEESSSLPPLLHPPSIPNKHG
                     KNFVNGLPQPVFQPLL"
     gene            complement(<717235..>718728)
                     /locus_tag="KLLA0_C08173g"
                     /db_xref="GeneID:2892464"
     mRNA            complement(<717235..>718728)
                     /locus_tag="KLLA0_C08173g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452563.1"
                     /db_xref="GeneID:2892464"
     CDS             complement(717235..718728)
                     /locus_tag="KLLA0_C08173g"
                     /note="some similarities with uniprot|P40523 Saccharomyces
                     cerevisiae YIL055C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452563.1"
                     /db_xref="GeneID:2892464"
                     /db_xref="UniProtKB/TrEMBL:Q6CU26"
                     /translation="MTHYTGHPYMELMPPELMSVYIRIDNIPQGKDWKQIRYFLSKFI
                     LRNQILNIKVLPSMPTMTPPFIPITSCICVLQPSLDWNNLLLQLNGFQWEYHTLGAIL
                     LPPPSLPAPLPHPAHGSVGTPLQSGIPQPQHQSQHSVRSHLHHMGVPGTGPGPGLIPG
                     SVPGVRQRSHYSSQQHQQQHQQQHQQQQHQQQQQQQPRKLKQLFNEMSFRKQMSSRSM
                     YQIKFTNFPPCLHWDEIVKFKTTGIAGQHVTRASSVPSLIVKTTEPETYGKLKWTMLK
                     DFIKSNCPELFENTSSFEFYVGVYESGELDVEIQLVQGENEEVIVSQAPSEIKTDTIS
                     KKSEGSDKTKGVTETTRDDTKEPIKEIPSKDDDENSAPLSVGLSQETKEDGKEEVKPE
                     LSEQSTKGESKTPETKERDTEKVEDVQETQEAEKIEQQENGEETQEAEKTNGSIEKYM
                     VKATNYEAVVGFVNYDKFLKCLHTFQGKEFGLHHKLVLEALESIEPN"
     gene            complement(<719857..>720588)
                     /locus_tag="KLLA0_C08195g"
                     /db_xref="GeneID:2891903"
     mRNA            complement(<719857..>720588)
                     /locus_tag="KLLA0_C08195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452564.1"
                     /db_xref="GeneID:2891903"
     CDS             complement(719857..720588)
                     /locus_tag="KLLA0_C08195g"
                     /note="weakly similar to uniprot|P40040 Saccharomyces
                     cerevisiae YER063W THO1 Suppressor of the Transcriptional
                     (T) defect of Hpr1 (H) by Overexpression (O) (putative)
                     involved in transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452564.1"
                     /db_xref="GeneID:2891903"
                     /db_xref="GOA:Q6CU25"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:Q6CU25"
                     /translation="MLTFDICIRILETTYWHARLPRQLESKTSSFPDPNYSKTYSPLF
                     AMSYSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDDSTKNSATNEPSSIAEVEATA
                     SATAAAAPTITSSIPDAVPADASAAVPENENVPSTEEDKLEKTPPATPAPKNPELSQD
                     QLKQAAIDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGP
                     DAAVGKPDRKSFQKKNRNKSNNKRR"
     gene            <721753..>722523
                     /locus_tag="KLLA0_C08217g"
                     /db_xref="GeneID:2892181"
     mRNA            <721753..>722523
                     /locus_tag="KLLA0_C08217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452565.1"
                     /db_xref="GeneID:2892181"
     CDS             721753..722523
                     /locus_tag="KLLA0_C08217g"
                     /note="highly similar to uniprot|P41277 Saccharomyces
                     cerevisiae RHR2 and to YER062C uniprot|P40106
                     Saccharomyces cerevisiae HOR2, two redundant
                     DL-glycerol-3-phosphatases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452565.1"
                     /db_xref="GeneID:2892181"
                     /db_xref="GOA:Q6CU24"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CU24"
                     /translation="MSAATASNTAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFG
                     KDKPYFDSQHVIDISHGWRTYDVIKQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGA
                     SKLCGELNKLPKEKWAVATSGTYEMAHKWFDILGIKRPSNFITANDVKNGKPHPEPYL
                     KGRNGLSYPINKENPAASKVIVFEDAPAGILAGKAAGCKIVGIATTFDKEFLIEKGCD
                     IVIKDHTKLRVAAYHPETDEVEFIFDEYLYAKDDLLEW"
     gene            <723077..>724366
                     /locus_tag="KLLA0_C08239g"
                     /db_xref="GeneID:2892681"
     mRNA            <723077..>724366
                     /locus_tag="KLLA0_C08239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452566.1"
                     /db_xref="GeneID:2892681"
     CDS             723077..724366
                     /locus_tag="KLLA0_C08239g"
                     /note="similar to uniprot|P39525 Saccharomyces cerevisiae
                     YER061C CEM1 homology with beta-keto-acyl synthases
                     Protein homologous to beta-keto-acyl synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452566.1"
                     /db_xref="GeneID:2892681"
                     /db_xref="GOA:Q6CU23"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:Q6CU23"
                     /translation="MSLKRVVVTGLGAYTPLGSTVSKSWAGLLAAKQSLIPLDAFYNR
                     EDFAKVKKLVPLDTAVSRLHADPLDTFPEYDQRRMTPAHQIVLEKTKEALLQANLIAD
                     ENLNTLTEDIDKTKVGCVIGTGMPSMPDLESTISTLFTKPKVSPFLIPRVLPNMAMGN
                     VMIKYGIQGPSSCPSTACATGNSSIIEGFNSIQLGLADVMICGSYEFSIDPISIAGFY
                     RSKTISKKHQTRPFDVERDGFIMGEGCGILTLESLESALKRGSPILAEISGVGLSNDG
                     YHITSPLPDGSGGKLAMQNALKRANIAPQQVGYINAHATSTQLGDVAESTAITELFGT
                     KSTGTAPYVSSNKGHIGHLLGASGSVESIFTVLSLKYGRFPHTLNLKTVDETSIINEL
                     NLIKNESMIDNSIEYALTNSFGFGGVNTSILFRKYHQ"
     gene            complement(<724399..>725100)
                     /locus_tag="KLLA0_C08261g"
                     /db_xref="GeneID:2892001"
     mRNA            complement(<724399..>725100)
                     /locus_tag="KLLA0_C08261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452567.1"
                     /db_xref="GeneID:2892001"
     CDS             complement(724399..725100)
                     /locus_tag="KLLA0_C08261g"
                     /note="similar to uniprot|P40526 Saccharomyces cerevisiae
                     YIL049W DFG10 Protein of unknown function involved in
                     filamentous growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452567.1"
                     /db_xref="GeneID:2892001"
                     /db_xref="GOA:Q6CU22"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q6CU22"
                     /translation="MDIFQILLYSTFYVGIISVFVAEFYIPQLLKYGKTWEASNNFWY
                     SLTCPKSNFGHFYLLSSIFSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQSKIH
                     LSHYLVGIWFYTTLNLGIMLYHGETQYSLISVILFIMSSLDQATNHDYLSKLKKYSQP
                     SYGLFKYICSAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQE
                     KFGYRSRWYLIPYVF"
     gene            complement(<725563..>727122)
                     /locus_tag="KLLA0_C08283g"
                     /db_xref="GeneID:2891962"
     mRNA            complement(<725563..>727122)
                     /locus_tag="KLLA0_C08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452568.1"
                     /db_xref="GeneID:2891962"
     CDS             complement(725563..727122)
                     /locus_tag="KLLA0_C08283g"
                     /note="similar to uniprot|P17064 Saccharomyces cerevisiae
                     YER056C FCY2 and similar to uniprot|P40039 Saccharomyces
                     cerevisiae YER060W FCY21 and similar to uniprot|Q12119
                     Saccharomyces cerevisiae YER060W-A FCY22, Purine-cytosine
                     permeases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452568.1"
                     /db_xref="GeneID:2891962"
                     /db_xref="GOA:Q6CU21"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:Q6CU21"
                     /translation="MSSSSSKEEYVLHDVEKQELSKTQFDEVLEEEPVIVETTEVTKL
                     SWVDHLASKLHAETKGIEPITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFG
                     LNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIA
                     CVGWGAVNTIASASLLHIVNPSGPDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSW
                     VPNFAVFLVIIARLAKAGTFTAGSWGSGSTTAGGVLSFGSSVFGFATGWTTYASDYTV
                     YMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELYDKYSVGGLCYA
                     ILIEDSLWGFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPRVAWTIIGNL
                     VTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNVDDWDRWD
                     KLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAFITYNI
                     FRPLEKKYVGR"
     gene            complement(<728996..>730225)
                     /locus_tag="KLLA0_C08305g"
                     /db_xref="GeneID:2892571"
     mRNA            complement(<728996..>730225)
                     /locus_tag="KLLA0_C08305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452569.1"
                     /db_xref="GeneID:2892571"
     CDS             complement(728996..730225)
                     /locus_tag="KLLA0_C08305g"
                     /note="similar to uniprot|P40186 Saccharomyces cerevisiae
                     YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms a
                     functional kinase complex with Pho85p which phosphorylates
                     Mmr1p and is regulated by Pho81p involved in glycogen
                     metabolism expression is cell-cycle regulated and weakly
                     similar to YER059W uniprot|P40038 Saccharomyces cerevisiae
                     YER059W PCL6 Pho85p cyclin of the Pho80p subfamily forms
                     the major Glc8p kinase together with Pcl7p and Pho85p
                     involved in the control of glycogen storage by Pho85p
                     stabilized by Elongin C binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452569.1"
                     /db_xref="GeneID:2892571"
                     /db_xref="GOA:Q6CU20"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6CU20"
                     /translation="MSYLRNTTSSSYAETEPIEIPVNRTETEPYSSSLQGSQVNSEAI
                     TTSTRLIDSSSSSIDKYGSGGLTPQDMNHGVTSSYFDSNYNNNIASNNHTDTNFNKHA
                     GISSSFIDNTSGVSSSLDSGSNLRHSNLSGNFLPNDTQSNSNVLIPVKAVSELRIDDE
                     QTGSSSTSQPDHHSNDETQHSLNNNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLG
                     STPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFD
                     RIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKF
                     ISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEELQRYADLLYKFWDKE
                     KHLYQSVSQPTNSSLIA"
     gene            complement(<730884..>731195)
                     /locus_tag="KLLA0_C08327g"
                     /db_xref="GeneID:2892049"
     mRNA            complement(<730884..>731195)
                     /locus_tag="KLLA0_C08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452570.1"
                     /db_xref="GeneID:2892049"
     CDS             complement(730884..731195)
                     /locus_tag="KLLA0_C08327g"
                     /note="similar to uniprot|Q02771 Saccharomyces cerevisiae
                     YER058W PET117 Protein required for assembly of cytochrome
                     c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452570.1"
                     /db_xref="GeneID:2892049"
                     /db_xref="UniProtKB/TrEMBL:Q6CU19"
                     /translation="MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQR
                     VAEKKLARQNGVDPEKERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELIEQK
                     K"
     gene            <731629..>732051
                     /locus_tag="KLLA0_C08349g"
                     /db_xref="GeneID:2892186"
     mRNA            <731629..>732051
                     /locus_tag="KLLA0_C08349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452571.1"
                     /db_xref="GeneID:2892186"
     CDS             731629..732051
                     /locus_tag="KLLA0_C08349g"
                     /note="similar to uniprot|P40185 Saccharomyces cerevisiae
                     YIL051C MMF1 Mitochondrial protein involved in maintenance
                     of the mitochondrial genome and similar to YER057C
                     uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
                     Member of the p14.5 protein family with similarity to
                     Mmf1p, functionally complements Mmf1p function when
                     targeted to mitochondria; heat shock inducible; high-
                     dosage growth inhibitor; forms a homotrimer in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452571.1"
                     /db_xref="GeneID:2892186"
                     /db_xref="GOA:Q6CU18"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="UniProtKB/TrEMBL:Q6CU18"
                     /translation="MFRQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVS
                     GQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFN
                     SVYAKYFNVHKPARSCVAAKALPLNVDLEMEVIAVEKD"
     gene            <732878..>733822
                     /locus_tag="KLLA0_C08371g"
                     /db_xref="GeneID:2892551"
     mRNA            join(<732878..732914,733482..>733822)
                     /locus_tag="KLLA0_C08371g"
                     /product="60S ribosomal protein L34"
                     /transcript_id="XM_452572.1"
                     /db_xref="GeneID:2892551"
     CDS             join(732878..732914,733482..733822)
                     /locus_tag="KLLA0_C08371g"
                     /note="highly similar to uniprot|P40525 Saccharomyces
                     cerevisiae YIL052C RPL34B Protein component of the large
                     (60S) ribosomal subunit, nearly identical to Rpl34Ap and
                     has similarity to rat L34 ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L34"
                     /protein_id="XP_452572.1"
                     /db_xref="GeneID:2892551"
                     /db_xref="GOA:Q6CU17"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="InterPro:IPR018065"
                     /db_xref="UniProtKB/TrEMBL:Q6CU17"
                     /translation="MAQRVTFRRRNPYNTKSNKIKVVKTPGGALRSQHVKKLATRPKC
                     GDTGVPLQGVSTLRPRQYATVSRTKKTVSRAYGGSKSANAVKERIVRAFLIEEQKIVK
                     RVIKEQTEAAKKAEKKDAKKSKK"
     gene            <734655..>738101
                     /locus_tag="KLLA0_C08393g"
                     /db_xref="GeneID:2892145"
     mRNA            <734655..>738101
                     /locus_tag="KLLA0_C08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452573.1"
                     /db_xref="GeneID:2892145"
     CDS             734655..738101
                     /locus_tag="KLLA0_C08393g"
                     /note="highly similar to uniprot|P40527 Saccharomyces
                     cerevisiae YIL048W NEO1 Protein involved in the retrograde
                     transport from the Golgi complex to the ER and the
                     endosomal membrane traffic putative aminophospholipid
                     translocase member of the highly conserved Drs2 family of
                     P-type ATPases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452573.1"
                     /db_xref="GeneID:2892145"
                     /db_xref="GOA:Q6CU16"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6CU16"
                     /translation="MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALE
                     SLQLPEHSHRRENSTVFEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNSD
                     RNAQNTNNITVWSKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVEREI
                     HPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLR
                     IGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVG
                     DIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLL
                     NNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGR
                     ETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRY
                     LILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKT
                     GTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQSMNSRTSNSTPTTTRKNISDRVIDL
                     VTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSG
                     MKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETS
                     NMATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELL
                     GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVT
                     KVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTP
                     QQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQ
                     FCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMV
                     GYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGC
                     VIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIY
                     LGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVVPVWAAKSIYRRLNPPNYAKVQQFS
                     MV"
     gene            complement(<738306..>739271)
                     /locus_tag="KLLA0_C08415g"
                     /db_xref="GeneID:2891843"
     mRNA            complement(<738306..>739271)
                     /locus_tag="KLLA0_C08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452574.1"
                     /db_xref="GeneID:2891843"
     CDS             complement(738306..739271)
                     /locus_tag="KLLA0_C08415g"
                     /note="highly similar to uniprot|P50278 Saccharomyces
                     cerevisiae YNR034W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452574.1"
                     /db_xref="GeneID:2891843"
                     /db_xref="GOA:Q6CU15"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q6CU15"
                     /translation="MTTTVPKIFAFPEFAGVAEAVADHVVHSQNMALKDTANGSSNTR
                     QSSTHIANQLSARSSTSMARVSSTRSLRNNSTGGVSSGGKLKKPKERRFKIAISGGSL
                     IQVLHEGLLKRTDVQWGKWDIYFADERLVPFESNESNYGQAKRQISDQINTEKYGTPN
                     VFHIDESLINDPQECADDYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNF
                     QENLREKFAWVVPVEKAPSGPSNRISLTIPVICHSHQVTFVVEGATKAPVIKTIMERP
                     EKGLPSSIVNEGAAGRVAWFVDDDALSDVLVTKKKYKFLITEDDI"
     gene            <739541..>739984
                     /locus_tag="KLLA0_C08437g"
                     /db_xref="GeneID:2892017"
     mRNA            <739541..>739984
                     /locus_tag="KLLA0_C08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452575.1"
                     /db_xref="GeneID:2892017"
     CDS             739541..739984
                     /locus_tag="KLLA0_C08437g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452575.1"
                     /db_xref="GeneID:2892017"
                     /db_xref="UniProtKB/TrEMBL:Q6CU14"
                     /translation="MYLLLDPQIPVNATTISISSSYSISSKNPCIYFSMTFLCHISLP
                     TLYNYQTVISDTFSYIRPSVKKNKMRIGAILDRPELCKSYTNRLEVLKRSHRCRQFSV
                     IFFIFLYLHKLLTYMEVYLHEESIARQVITVANIESGFENLQCTF"
     gene            complement(<739952..>742228)
                     /locus_tag="KLLA0_C08448g"
                     /db_xref="GeneID:2891819"
     mRNA            complement(<739952..>742228)
                     /locus_tag="KLLA0_C08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452576.1"
                     /db_xref="GeneID:2891819"
     CDS             complement(739952..742228)
                     /locus_tag="KLLA0_C08448g"
                     /note="similar to uniprot|P37254 Saccharomyces cerevisiae
                     YNR033W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452576.1"
                     /db_xref="GeneID:2891819"
                     /db_xref="GOA:Q6CU13"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR010117"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CU13"
                     /translation="MTFSVLFVDSYDSFTYNVVELIKEQGQDIEVITIHNDTFQSYNE
                     LKPFLRLFDAIVIGPGPGNPVNGPTDIGIIASLFNDSDVIPILGICLGFQVMCHANGA
                     SVEQLGNVRHGQVFQVNVTDNSIGLYNGYPIAFNSVRYHSLHVIADPNSSTIIPLSET
                     IDDGKKVLMGGRISGKPWYGVQYHPESCCSELGGKLIANFIELAKDYNETTGRKSNII
                     SKIYENGIGQQNTDIDNMTTLSRKIDRDPIVPKTSANEGKEPDIDVEVHSMDITNETD
                     LTLQLCESFEQNNLPFFLMASSTINANRGEISIIALPNSKSKVFTHYSQLNKTTIHDW
                     RPKSLTVEKYYENLISGQSDSITTVLSEDRNRFWGTIGSFMNDKSCPDQWPELSFIGG
                     FVGILGYEMGQFTSPDLEDQLKPDAKLCFVDNTILIHHTKGKLYTVGLNTNFSAEVTK
                     LINIVLSTKRNLDWPMELPKGITYGITLPSQEAYKKAFGLSQKYLHQGDSYEICLTSQ
                     TKIEPSEVISPWRIFQTLIQKNPAPFSSFFQFDDIEQNKFDLCLISTSPERFLKYTND
                     TCELRPIKGTVKKGPDMDLEKATCILKTPKEFGENLMILDLIRNDLYELLPKVTVDEI
                     MSVEEYKTVYQLVSVVRGHHLKDSKYSGLDVLKHSLPPGSMTGAPKKKTVELLQAQIE
                     PLLGSSTRGVYSGVTGYWSANMNGDWSVNIRCMYSYDQGNSWQIGAGGAVTVLSTCDG
                     EWEEMFTKLESALQVFKT"
     gene            <742530..>742754
                     /locus_tag="KLLA0_C08470g"
                     /db_xref="GeneID:2892667"
     mRNA            <742530..>742754
                     /locus_tag="KLLA0_C08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452578.1"
                     /db_xref="GeneID:2892667"
     CDS             742530..742754
                     /locus_tag="KLLA0_C08470g"
                     /note="highly similar to uniprot|Q6Q546 Saccharomyces
                     cerevisiae YNR032C-A HUB1 Ubiquitin-like protein modifier"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452578.1"
                     /db_xref="GeneID:2892667"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /translation="MIEVLVNDRLGKKVNVKCLSEDTVGDFKKVLSVQLGTASASKIV
                     LQKGGSVLKDHITLEDYEVHDGTNLELYYV"
     gene            complement(<742889..>743923)
                     /locus_tag="KLLA0_C08503g"
                     /db_xref="GeneID:2892664"
     mRNA            complement(<742889..>743923)
                     /locus_tag="KLLA0_C08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452579.1"
                     /db_xref="GeneID:2892664"
     CDS             complement(742889..743923)
                     /locus_tag="KLLA0_C08503g"
                     /note="similar to uniprot|P32838 Saccharomyces cerevisiae
                     YNR032W PPG1 Putative serine/threonine protein phosphatase
                     required for glycogen accumulation interacts with Tap42p
                     which binds to and regulates other protein phosphatases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452579.1"
                     /db_xref="GeneID:2892664"
                     /db_xref="GOA:Q6CU10"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CU10"
                     /translation="MELDWCLEQLYEGKLLPAETIRALCFKLKELLVRESNVVHISTP
                     VTVVGDIHGQFHDLLEIFHIGGPLPSTNYVFLGDYVDRGLYSVETITLLITLKLRYPS
                     RIHLIRGNHESRQITQSYGFYTECLNKFGEGSQVWQYFTDLFDYLILACIIDDTIFCV
                     HGGLSPNIQSIDQIRIIDRIREIPHDGAMADLVWSDPEDDRNDITSSQFKVSPRGAGY
                     TFGKAIVDKFFSINGVTKMLRAHQLCNEGYQDYFGGKVTTVWSAPNYCYRCGNKASIL
                     ELYSPTDFHFNVFDEAPENKLLTDPMLNDKTLHSFFEEDDDAHMGQYDVFSDEHQAKY
                     ALKRQVDYFL"
     gene            <744554..>749209
                     /locus_tag="KLLA0_C08525g"
                     /db_xref="GeneID:2892671"
     mRNA            <744554..>749209
                     /locus_tag="KLLA0_C08525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452580.1"
                     /db_xref="GeneID:2892671"
     CDS             744554..749209
                     /locus_tag="KLLA0_C08525g"
                     /note="similar to uniprot|P53599 Saccharomyces cerevisiae
                     YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
                     kinase kinase kinase activator of Pbs2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452580.1"
                     /db_xref="GeneID:2892671"
                     /db_xref="GOA:Q6CU09"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017240"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CU09"
                     /translation="MSQNNDSRDEAYVREQFQRYTTKMASNKNSNTDSKCRSTSHLNS
                     LASISSDTSNETLKGNLSAASPTFSSDSTLSTKKLPVLQTLPTSLPNGQHQQGQLFPA
                     SSSSSSAISSRKPSVSGSFGTQTPTTAQLKTITSPKLSGALSTRSRSNSLTSSKLFAL
                     NQSNDSPSSTSVYPVPPNVASLNSQTASSMSVSTSADQYFPAQQNGSTTTVNLTPTLS
                     SPSIRSLNNSTTSTTKSFKPLQKQYVLNEQLYLSSMKNKKADDYYTRGITSSGNEDDD
                     DFRVDGENDDVDNDLSKLNNGLGSAIFGNNIATTTDKGFHSIDDDELVLMNDKILLER
                     MEWLRSVEPNNPLIENSLNLLNKTGGSTDSLESFSNIETQLALEQLSNNHLVRERLEW
                     QTMLSSVLNGDIVKSEKTKLAKRKPDEILLNHNDLIWLELKAWLNGRTVEDQRKSLEY
                     SKTTADEVFEEILNYKNEKEENPEVVIEEAKILLNKYYKVVGYWKNLPNMNLEKPVTK
                     TSNFVSRIEALNSLINSYEGLQYEIEALKQWTQNDDLDVTFTKDSLDTEGIFKNDRSF
                     AEQIMKEKDIEGIFQKKIFFKHAPWMFKSKLVFLKQQNSIHEMRLPLPVDKLHSLLTF
                     PLRLIQEIISIRLEYARKLKKPTMMMIDQMIDDFSTYIKLSVQIKHTLMEYRSGWSLK
                     VEISDAFDAKVVEAIEFLFKLLHLKLIDSSKNSFKTFKEPDILFAHWENLKNFGCYIS
                     GASKVIAQGFVNITIRLLNRLHLYIMEEQRNSVDLVTSDDARKWVVEVIENVGAFKRK
                     TNRFSNVLTKAFQNSVLYNIKDHSMLLERLRNSGHFLIYTGGILEQNGIYLIASEELL
                     GCSDDEIMDIIKSTKIGSDLIPKVEINNSLTIYNPPEDLTLPEAMFVQKERRNGVSYY
                     HLKQDDLTQRVGIRGKGGSSTAPEEEGEELVQLENKLKMLGYVLVFCPTKPMVWNGEM
                     YNLTSEEPLTMEEFGLSVEEDVIVMLNQGSTYALDYQVDRFQHFAGDAISIREKKCAI
                     NSIETALQRINKSYFRMTYIVLKNFGSVQKNVTLQTNESVFFNIAYLFVKDFAKNFLL
                     LNVATPETKAIIIRLMIQISIDWLTFVLDECDPANPETFRWCVPAMEFAMRMTNGWNI
                     LGIEEKEFKLLKEKIARCMSLLISHFDITGARSREAERIDAQQTRPNFDIDDADDDMI
                     LAVNSEMRMNAITDMEKVVKVKRHYSVGKVIDDTDNQSKLLKSLASSISNLSIRWQKR
                     SFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNI
                     VQYYGVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSG
                     VVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMY
                     MAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFP
                     TKSEISSAGRKFISRCLIQDANKRATAMELLLDPWISQIRNIAFGGNAESFNNETHN"
     gene            <749737..>751284
                     /locus_tag="KLLA0_C08547g"
                     /db_xref="GeneID:2892662"
     mRNA            <749737..>751284
                     /locus_tag="KLLA0_C08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452581.1"
                     /db_xref="GeneID:2892662"
     CDS             749737..751284
                     /locus_tag="KLLA0_C08547g"
                     /note="highly similar to uniprot|P25382 Saccharomyces
                     cerevisiae YCR072C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452581.1"
                     /db_xref="GeneID:2892662"
                     /db_xref="GOA:Q6CU08"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CU08"
                     /translation="MATLLPPPSKKQRREAQAERGVDLIPKDLPNVLIKFQAFDSGET
                     VGGSLRVPGGISEQQLEELLNQLNGDSADPVPYTFSCLVSNKKKDADEEMVDIRDNLY
                     QSILKPGLKTTEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMV
                     TGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKG
                     KPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCG
                     HTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYAL
                     RLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKST
                     KPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQV
                     AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDK
                     MVRIWTH"
     gene            <751571..>752104
                     /locus_tag="KLLA0_C08569g"
                     /db_xref="GeneID:2892297"
     mRNA            <751571..>752104
                     /locus_tag="KLLA0_C08569g"
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /transcript_id="XM_452582.1"
                     /db_xref="GeneID:2892297"
     CDS             751571..752104
                     /locus_tag="KLLA0_C08569g"
                     /note="similar to uniprot|P25642 Saccharomyces cerevisiae
                     YCR071C IMG2 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /protein_id="XP_452582.1"
                     /db_xref="GeneID:2892297"
                     /db_xref="GOA:Q6CU07"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="UniProtKB/TrEMBL:Q6CU07"
                     /translation="MLTRVTRSFAAMSPRSFRICTRLQSTQAQQPQQQENSEIELLNE
                     LKSEMDKLGPLSDAESAELSALFDSQSPFTVFPKLEDVSPEEVVGAAPFGKKTYFIQR
                     SINGNLPVYTDYKNSNKIVTEIRKIQGDPVQLRNDLQERLPFIPKKYWKVILQSNKII
                     IEGDATKHVKRALATTF"
     gene            complement(<752256..>753881)
                     /locus_tag="KLLA0_C08591g"
                     /db_xref="GeneID:2892071"
     mRNA            complement(<752256..>753881)
                     /locus_tag="KLLA0_C08591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452583.1"
                     /db_xref="GeneID:2892071"
     CDS             complement(752256..753881)
                     /locus_tag="KLLA0_C08591g"
                     /note="similar to uniprot|P53730 Saccharomyces cerevisiae
                     YNR030W ECM39 Alpha-1 6-mannosyltransferase localized to
                     the ER responsible for the addition of the alpha-1 6
                     mannose to dolichol-linked Man7GlcNAc2 acts in the
                     dolichol pathway for N-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452583.1"
                     /db_xref="GeneID:2892071"
                     /db_xref="GOA:Q6CU06"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:Q6CU06"
                     /translation="MDGIFDLTTVLTCAVSLHLWYSPYTKVEESFTLQAVHDILTYGV
                     FDVSNYDHVTFAGAVPRSFVGPLILSALTYPFNLTISKDPFRTQMLVRFLIGLTNTVA
                     LNRFIVAAKKALTKDQEQKSGKEETTSTTKYTISASDLTNWFGLFTATQFHLMFYSSR
                     PLPNFVMALPLSLLGLSWALEENYRWSIILLSFTAIVFRLEIAVLAVGVALGAFFYEK
                     ISLTSIVRTGFIGAGAGIFLSIQVDSYFWNRLTVPEIEAFIFNVVHGESSKWGTQPFF
                     AYLTGYLPMMFIPPTALLLNHLGFKIGPNSFRVVGIAAYFHVLVMSLQPHKEWRFIIY
                     SNPPITLLGATAAAYLFKNIDNKSVTGVAVRFVLLLTPLLSLFISIAFSYISTMNYPG
                     GVALENFNEIIKSQNITDAVVHLDVPVCMTGATLFGQLDDSWNITYDKTEDGTLSSKW
                     PSFNYLITPIDNSSLIPTEDGNRWELISKSQGFGGINTEYLVKTFTEQYANGLDLYVT
                     WERSRDFTFIKEIFDNALAMKDVFYTYQKVPIL"
     gene            <754098..>755366
                     /locus_tag="KLLA0_C08613g"
                     /db_xref="GeneID:2892149"
     mRNA            <754098..>755366
                     /locus_tag="KLLA0_C08613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452584.1"
                     /db_xref="GeneID:2892149"
     CDS             754098..755366
                     /locus_tag="KLLA0_C08613g"
                     /note="similar to uniprot|P53729 Saccharomyces cerevisiae
                     YNR029C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452584.1"
                     /db_xref="GeneID:2892149"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CU05"
                     /translation="MSALKDFSFKEDEDGELPVLVTGNEPDLKKILDTYKPDGGKHIV
                     SDKKIALANRQLDEDFDRQQRIPVTIITGYLGAGKSTLLEQIALKGSNKRLAVILNEF
                     GDSSEIEKSITIKNKGEVYEEWLDLGNGCLCCSLKDVGVKAIEDMVARSPGKIDYILL
                     ETSGIADPGPIAKMFWQDKGLNSNVYIDGIITVLDSEHIITCLDDISPTAHWHGEKVT
                     VDDESKTTIAHLQIAMADAILVNKSDKIEGDESKKYDLENVVRSINTVAPIYYTKFGD
                     INLDLVLDLNAFESTKFLQKDYTTTFHDHRISTITLAFPFFQTEDQLDTFIKDFLQVL
                     LWKDFGVDTGSGLQSAHHENPDFEVHRTKGVIMVGNECKVIQGVRDTYDIIPGEKLPN
                     ITENKIVLIGKHLDENYIRHLLNKAISSQK"
     gene            complement(<755556..>756476)
                     /locus_tag="KLLA0_C08635g"
                     /db_xref="GeneID:2891859"
     mRNA            complement(<755556..>756476)
                     /locus_tag="KLLA0_C08635g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452585.1"
                     /db_xref="GeneID:2891859"
     CDS             complement(755556..756476)
                     /locus_tag="KLLA0_C08635g"
                     /note="similar to gnl|GLV|DEHA0G11220g Debaryomyces
                     hansenii DEHA0G11220g and weakly similar to YCR069W
                     uniprot|P25334 Saccharomyces cerevisiae YCR069W CPR4
                     Peptidyl- prolyl cis-trans isomerase (cyclophilin)
                     catalyzes the cis- trans isomerization of peptide bonds
                     N-terminal to proline residues has a potential role in the
                     secretory pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452585.1"
                     /db_xref="GeneID:2891859"
                     /db_xref="GOA:Q6CU04"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6CU04"
                     /translation="MISKLFRLFCAVFVLASVTAGALVEDFKTLYEPNPPVTKRVLFG
                     INYTDPSTNQPKAVDVGIELYGTVVPLTVNNFNELARGVKGQLGDKIIDISYKKTIFH
                     RIIPGFMIQGGNVLPHVGPFSIYGYAFDDENFNLKHDRPGRLSMANSGPNTNACQFFI
                     TTSETPLEHLDGKHVVFGQVISGLEDLMKYVQHVETDDKDKPVNDVSITYTYTEELRI
                     ADIEKMHEEYIKKVEQFRNGDTSVGITLEEELKEGAKNEVELENDYYYSQHPYAKFVF
                     AFLFIGALVTVYANRRSIIPRAKNIVSVRS"
     gene            <757100..>759268
                     /locus_tag="KLLA0_C08657g"
                     /db_xref="GeneID:2892236"
     mRNA            <757100..>759268
                     /locus_tag="KLLA0_C08657g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452586.1"
                     /db_xref="GeneID:2892236"
     CDS             757100..759268
                     /locus_tag="KLLA0_C08657g"
                     /note="some similarities with YDR520c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452586.1"
                     /db_xref="GeneID:2892236"
                     /db_xref="GOA:Q6CU03"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CU03"
                     /translation="MSTGQNKIAKKTPAKRGTRGVKACDYCKKLKAKCVPSPVPGEVR
                     CLRCDSLKRHCSFEDLFTDSPVHAPAHDGTSTQFNNNGSSSDNETAHAELLKAFLKSG
                     SASPSVLNINLKYTKMIHDNVLKVLALLENSVDAGSERVTETEQTPLEKEAMTLMKEK
                     EPGISSSLVDAVSMITRDGPARAAIQDVSSGKPEVSPSMARNFDDQNHAYLSSSYTLM
                     SQLVPRDHLPLLIRKLHDHKFNELERYLTEDIVTMNIITLEESYMLMQSFRNRYSDWC
                     SFPKSIPNEKLVDNIRSKNSSFLLTVVCTLALRYTDDYHDLKTRCYKNLLLKLRSDVE
                     VSLSYVPQSKEFLQAIVILSLYASSFSSDFLCVDAWYLSAVGSQHLITRGVAGSLVKK
                     NKNSVNTLASTINLLDPVMQPDLDTFNNSVFEETEEFEQLSSARLWNHLCHCHINNCV
                     ASGRMCTIDDRSLEMCKLTLELPHSTNFDGRMVAEIELTRIVYKFIRSLEFFDISDQQ
                     PLNTVLSKLKGWLEQWNYLFTQPVTQFVEFNYHYSICLVHYSWYHKHYVTTHPPDNLP
                     LFNSATNSTKTAIADYLNLTYPLKKVVASILPAQVSFILEHAHLGLTAIVNCPFEKFK
                     FLSDHLVFSGVHLALMCLLLLDESHSLSKDIDAVAILTDVKKLSQRLQKIREGELKSF
                     WVEEVDLRIPSVILQYHKALEAYLIGKFSAYDIQIDPNYS"
     gene            complement(<759288..>760883)
                     /locus_tag="KLLA0_C08679g"
                     /db_xref="GeneID:2892241"
     mRNA            complement(<759288..>760883)
                     /locus_tag="KLLA0_C08679g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452587.1"
                     /db_xref="GeneID:2892241"
     CDS             complement(759288..760883)
                     /locus_tag="KLLA0_C08679g"
                     /note="similar to uniprot|P25641 Saccharomyces cerevisiae
                     YCR068W ATG15 Lipase required for intravacuolar lysis of
                     autophagic bodies located in the endoplasmic reticulum
                     membrane and targeted to intravacuolar vesicles during
                     autophagy via the multivesicular body (MVB) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452587.1"
                     /db_xref="GeneID:2892241"
                     /db_xref="GOA:Q6CU02"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /translation="MKPGIKISKRYSARNASVITVLLLLIYLIYINKETIQTKYQGSR
                     INHDSGGDSTKDKTHTFTIKEIHFRPLDEKTQSYGSLQVTPEFVNMAKSEFEQNVAVA
                     SGDNEDLYDKQLWSASIKSNPWTHQFTLKQGSIKMKRMVNRDPDYVESFLDYAHENPE
                     MARKVHLDWVDESVLAPNVTDKETVISLALMSSNAYVRLPYEGDWRNLSDWNNDLNPD
                     LSVGIGWDSDGVRGHIFSNDDSSVIVIALKGTSAQGLPGSGEDETTDNDKLNDNVLFS
                     CCCARVSYLWKTACDCYVKSYTCDEKCLEQELVRKDRYYQAVLDIYRSVVTAHPNSAI
                     WITGHSLGGALASLLGRTFGAPAVAFEAPGELLATKRLHLPMPPGLPAYQEGVWHIGH
                     TADPIFMGTCNGASSSCSIAGYAMETSCHSGKVCVYDVVTDKGWHVNMLNHRIHTVID
                     GILTDYDTVAKCKTPDACHDCFNWNYVKGRDVPKKHKSSSSTASSTSAETSTLTVGPS
                     PPEKTTTSCIGRNWIGICTEYGI"
     gene            complement(<761257..>762171)
                     /locus_tag="KLLA0_C08701g"
                     /db_xref="GeneID:2892235"
     mRNA            complement(<761257..>762171)
                     /locus_tag="KLLA0_C08701g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452588.1"
                     /db_xref="GeneID:2892235"
     CDS             complement(761257..762171)
                     /locus_tag="KLLA0_C08701g"
                     /note="similar to uniprot|P53727 Saccharomyces cerevisiae
                     YNR027W BUD17 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452588.1"
                     /db_xref="GeneID:2892235"
                     /db_xref="GOA:Q6CU01"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6CU01"
                     /translation="MVSGKKVLSIQSHVVHGYVGNKAATFPLQCKGWDVDALNTVQFS
                     NHPAYGFLSGFKSRSEDLERIIQDGLLSGLKIHYDAVLTGYLPDTQGLKKIGALLVKL
                     CNDDPSLKWILDPVLGDNGKLYVPEDTVDIYKQILKDGSVYLATPNQFELEVLTGTVI
                     ADLNSLKNALNKFHVLYPKVRYLVVTSVNWPSSADDDSFVSACTDFTEYWYFNIPKIN
                     AHFSGSGDLFSAIIMDLLLSSETVELPLALNSALSLVDGVLRRTYDLTSKPAQSDDTP
                     FKINDLKIIQCKDLFRSYPVPNFVAHKL"
     gene            <762625..>765501
                     /locus_tag="KLLA0_C08723g"
                     /db_xref="GeneID:2892239"
     mRNA            <762625..>765501
                     /locus_tag="KLLA0_C08723g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452589.1"
                     /db_xref="GeneID:2892239"
     CDS             762625..765501
                     /locus_tag="KLLA0_C08723g"
                     /note="similar to uniprot|P11655 Saccharomyces cerevisiae
                     YNR026C SEC12 Guanine nucleotide exchange factor (GEF)
                     glycosylated integral membrane protein of the endoplasmic
                     reticulum important for the initiation of transport
                     vesicle budding from the endoplasmic reticulum through
                     activation of the GTPase Sar1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452589.1"
                     /db_xref="GeneID:2892239"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:F2Z657"
                     /translation="MGKEVDSTIYNIGYPVYGAKFLDNSTLLVAGGGGEGNNGIPNKI
                     SALKVDFQKKKIVKRFRELSLDDNDDSPTTLDYANNVILIGCNEGSEKIKSGKGNNHL
                     RKYVFHNEHLKFVASIDLDGSSKPEEYTKLTYLSPDASVAAIASSKVPTVICIVNPTN
                     LRETYEVETGNDVKDLHFSPDGKVLSYITASTLEVMSVVTGNFIVRKTDFDSNWKMSK
                     IRFIDQDNVIIAATLAKGTGVVLIKVSLKSGVAKIVKSKIITSKFKGVTSLDVDPSGN
                     LVALAGNENSVVIVTLRNFRIVKFFKQVHNFAITRLVFSPDSKLLASVSAANTVHILK
                     VAPNLATSRSLMESFLTFLTNSVLVVIIAAAAYYVHEHNLHLKALDFMQEKYKKYTEK
                     NDSSDYFVLHEYPQQTTLIGVINTDSSTSGHSESTTISFHSENTVGPMDTSADDFISY
                     TTDTSLMDSGYTVTAEILDDNIVTKSEQYLSLESTEKVSFTSIIDEPSSGIIYEKIND
                     DSLDHTDDITTHETEPETIAEGPSEMKDEEESNIADEPSLEKSNIEEPVTVVVKQAKT
                     RTDLDLTPENIDKGSSEFSIEIEDIVPEEIIIHERTDKEETEVAIEKTEPSIDILPEE
                     ATQQEQTDHEENNIGIENNVEVALDITAEEVVSQDKTADEGPDLEIENEAEIAADIIA
                     EKVTENRTDDEENDFGIENEAELSTEQSSEELDTEATSETLLVITTSEESNAIEQDDE
                     KQTETSSELLMVSDTTEATSSVEASISFSEFSDDDIDNVSSLSELIEETSNTETVETT
                     SLLVEDESEPSLYTKDNVSDTATATEILASSVAEELESVESEIASEDHIYVAHEVQSE
                     DHYPGTSLQAEEDTATHIDQIKSNLDVELVTSTVVVTEIELSVATDKTELEESDISSA
                     EKDTEAKSSFSSSTTISSSITKTADQESEFIVTVSEELTTSGSS"
     gene            complement(<765847..>767130)
                     /locus_tag="KLLA0_C08756g"
                     /db_xref="GeneID:2891860"
     mRNA            complement(<765847..>767130)
                     /locus_tag="KLLA0_C08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452591.1"
                     /db_xref="GeneID:2891860"
     CDS             complement(765847..767130)
                     /locus_tag="KLLA0_C08756g"
                     /note="similar to uniprot|Q75EN0 Ashbya gossypii AAR049C
                     RAD18 Postreplication repair ubiquitin-protein ligase E3
                     RAD18 and weakly similar to YCR066W uniprot|P10862
                     Saccharomyces cerevisiae YCR066W RAD18 Protein involved in
                     postreplication repair binds single-stranded DNA and has
                     single-stranded DNA dependent ATPase activity forms
                     heterodimer with Rad6p contains RING-finger motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452591.1"
                     /db_xref="GeneID:2891860"
                     /db_xref="GOA:Q6CTZ8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004580"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /translation="MKLSVPETISNPRDFLHTSVPQLTDLDSLLRCHICKDFLKASVL
                     TPCGHSFCSICIRKYLQKESKCPLCLSDLTESMLQKEFLVQEICSSYVKLRGSLQKHL
                     TISSQEEEKDNEIIISDEADTSVGTKRGTPDSPSLSSVSTKKRKHDGITTLLMKKKTD
                     HPQRQEKKAQCPICSKHLPLSELEGSHIDECLNKGSSLERSDSFEILDERTPSPSMES
                     SHQPLEEKTSLPSSHLLEVKEKKDITYHNERYLNSGLLQQKENRLPRLDFQSLSMTQL
                     KQKLASLALPSNGTKQQMVARYKHYEMLWNSNFLDSIDPVDENELKRRLSSWEAKHNT
                     DHSSDSNSITNLLRGNKRTNAISAMIKLFKSDRFDRKGWMRHHTSTFKALKLEAQRSD
                     KLAKMKKEELSQKSDANSEVSSEPILKIDQTSENN"
     gene            complement(<767642..>769303)
                     /locus_tag="KLLA0_C08778g"
                     /db_xref="GeneID:2892572"
     mRNA            complement(<767642..>769303)
                     /locus_tag="KLLA0_C08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452592.1"
                     /db_xref="GeneID:2892572"
     CDS             complement(767642..769303)
                     /locus_tag="KLLA0_C08778g"
                     /note="weakly similar to uniprot|P25364 Saccharomyces
                     cerevisiae YCR065W HCM1 Forkhead transcription factor
                     involved in cell cycle specific transcription of SPC110
                     encoding a spindle pole body (SPB) calmodulin binding
                     protein dosage-dependent suppressor of calmodulin mutants
                     with specific defects in SPB assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452592.1"
                     /db_xref="GeneID:2892572"
                     /db_xref="GOA:Q6CTZ7"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ7"
                     /translation="MSRTETQRQPLKDVALNRKKLHSEAAAVWNEKDAEQYELDQGAL
                     TPPHSFTHRSSISESRTPNYKMRKINPLSPELSSPIKPQRAKRMKSDQGRSSGVNTVE
                     EFLEHLSDDSRVVVLQDPNKKPPYSYAMMIVLSILQSDTGKLTLSQIYYWISSHFPYY
                     KREDAGWQNSIRHNLSLNEAFVKGGKSLDGKGHFWEIKPGYESKFFKNDESFSIDDFK
                     VKLQRFKSVNLDDGYEAGSTTSSFNGSSIASYNKSKRKNKSFSISTMDDKSSDIGDAG
                     DTSLDQSSDGDEESTSITNIPSSPRLGDHAEAAGHGSHQFPATDKDFLYYEDENMVKR
                     QDSSHLVGPLKFNHRSVSAHNHEYDDLMVAAVSSPKFKKYSCSFNTSFEPVSPMNKLQ
                     LPSVNQQNSKTPIRESSVTPLKFNIFSTPKDFNKDGLNPPASTRTWQSPSRLFEDYYA
                     SSPVFFRNVINQSIDDCMIQYDTEKKCIDSPRKLSLRDQTSPKESSQSGLIDHSKYSS
                     NILFGVDVCSVWKRAIAHCNSNDEVDSYREEVTKNDLDPPFDGMN"
     gene            complement(<770303..>770776)
                     /locus_tag="KLLA0_C08800g"
                     /db_xref="GeneID:2892457"
     mRNA            complement(<770303..>770776)
                     /locus_tag="KLLA0_C08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452593.1"
                     /db_xref="GeneID:2892457"
     CDS             complement(770303..770776)
                     /locus_tag="KLLA0_C08800g"
                     /note="highly similar to uniprot|P25337 Saccharomyces
                     cerevisiae YCR063W BUD31 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452593.1"
                     /db_xref="GeneID:2892457"
                     /db_xref="GOA:Q6CTZ6"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ6"
                     /translation="MPRIRTHATKKAPEGFDKISPTLNEFAIQLKEAESEKGSKLSTK
                     NTESTWQVFQIHHERSRYVYNLFYKRKAISRELYEWLLREKYADKQLIAKWKKKGYEK
                     LCCLQCIQSNETTNGKTCICRVPRATLEANAAKKKEPVTFKQCIHCGCSGCASSD"
     gene            complement(771124..771217)
                     /locus_tag="KLLA0_C08822r"
                     /db_xref="GeneID:9487350"
     tRNA            complement(join(771124..771169,771180..771217))
                     /locus_tag="KLLA0_C08822r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:9487350"
     gene            complement(<771719..>773653)
                     /locus_tag="KLLA0_C08866g"
                     /db_xref="GeneID:2891810"
     mRNA            complement(<771719..>773653)
                     /locus_tag="KLLA0_C08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452594.1"
                     /db_xref="GeneID:2891810"
     CDS             complement(771719..773653)
                     /locus_tag="KLLA0_C08866g"
                     /note="similar to uniprot|P25639 Saccharomyces cerevisiae
                     YCR061W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452594.1"
                     /db_xref="GeneID:2891810"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ5"
                     /translation="MKISNWLLVFFATVSSASAVDRRDMNMNMGEVESHVHPSITTTT
                     DLSTVTPVAHEVMHMHGLPILETELTPAEKLYWESYNSTTFFTTDKGNRGAFWTHVIT
                     LTIAAVFIYPICIALNNIDSGWYLPLLSIYDMVLLTSLISLSIFSSSFPETWYPKNAY
                     RPMSYILFVMTIVHFVSAVVVRTSKWISGHDYSRDLRFELDDYTAEGSLTPLQNYNDT
                     HSDDDEEQHRQDKRMSYDPRDSVGSPTTTLFDPHGKHHDDLRNGKYRDDSNSFDMGEE
                     DLSKNLDLEQRLLESEGFQLRHQSKSSIKRDTYLAKLFKSSALQSVARNFSRVFSFLF
                     HCTNYPMLLFFFVYIPTGLAVGNLLGEGNRVFNLLAHWIKGGVFVSLGILSLARYCGF
                     GVNNGWAWNKIIIFKNQIDSNSLWFKIAPQGGITMEFFESFLIAFYGCTNVFLEHLSN
                     PGGEWAAKDLQHVSIAFMFIGCGFCGLLAEIKLSDWRFNHVLKHTNIQPNVIHSGFPG
                     YSPNPFPAFTIFWTGILMSQHEQASATSTNIHVQWGYLLSYGSFFRIFTFILLMLVPN
                     QNLNPSRPFTELITSFCLICGGLVFMESTDQIVEAMEYRGFTPMFTFNLSVGFVTIFM
                     AWEMAIFMWKDWLKNRMNNR"
     gene            <776287..>781614
                     /locus_tag="KLLA0_C08888g"
                     /db_xref="GeneID:2892501"
     mRNA            <776287..>781614
                     /locus_tag="KLLA0_C08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452595.1"
                     /db_xref="GeneID:2892501"
     CDS             776287..781614
                     /locus_tag="KLLA0_C08888g"
                     /note="similar to uniprot|P40989 Saccharomyces cerevisiae
                     YGR032W GSC2 or uniprot|P38631 Saccharomyces cerevisiae
                     YLR342W FKS1 or uniprot|Q04952 Saccharomyces cerevisiae
                     YMR306W FKS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452595.1"
                     /db_xref="GeneID:2892501"
                     /db_xref="GOA:Q6CTZ4"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ4"
                     /translation="MDFAQDYVNYEGFWGKQDTGSKNEAPNSSRKPIKKSKVAVDYLA
                     ELSIIFDDLVHAFNFQKDNGRNMQDYFIVMWESRNARTCTNDEQKLSSESLISIYEEY
                     IWGTHSNFTKWYRFVYGLDAMPAWFTSSGPELLITREIMTQIALWLLIWGESNNLRVM
                     PELLCFIFDMMMTEYKFYSRAKEEVLPKTTDNESISPPCFLQHVVNPLYEFCQFQITW
                     NKSNDHSHIIGYDDINQCFWSLKTINQFKLKDGTNYADLPRDMKYSKFTQIEWSKSLR
                     KTYIESRTWYHLITNFHRIWTIHVATFWYFSVINLKPLFTKHYIQTLDNDPELFVLFS
                     VMSLAGTFSCLITISAIIGEMFFVPRDSNLRKPTKSRLFILIFMLLLNIIPPSGILSL
                     FHISRKRLINENILTIISFISLTVSIVTTIFLSIVPLSKIDTIFCYITRAYSPKTRGI
                     NSPDFGTGSRIGGCNSTDWNLNSNVGSCDSINPFTENWSQFDSSDANLCSVGLWFVIW
                     TSKLVETYFFLCTSIKNPARDLFQSNLNCSGTDTILQSALCRHWTKFLLLLLVATNFV
                     LYLLDTYLWYVIYNSIFSLTRSIYMGMSHLTPWKNCFVSLTNKIKLKILPSNEEWNIS
                     IISELWNEIIYSMYRENLICKEHVERLIFHLTNDDNLLKPSLLLSTDDHFFRSRVFKK
                     SKEVRRRLTFFAQSLHCPLPDAESIENMPTFSVLIPHYKEKIMLSLKDIIKAETDNSS
                     ITLLEYLKLIYPTEWDSFIEETNKLMDSVEAGVSDESNTASADREEEEKQTDVSDNEE
                     VARNITMNLCKSKNEGVNLFKFTGFKLEVPEQTIRTRIWASLRTQTLYRTISGFMKYL
                     DAIKSLHILEDTKDTKHSVLNRNVKHRTKDQHCDFQQLRSNSKKNPDYKSCAKSFKQR
                     TDSADDKSTSIALKKFHMICSMQRMSEFTDDEKADRNVLLTAFPSLKIAYIVSELDKA
                     SGRKIYYSCVIDGYCDIDGDGEYIPKYKIELSGDPILGNGKSDNQNHSIIFTRGEYIQ
                     LIDANQDNYFEECLKIKNILKEFDDTSANSDIENVKYTAPVAIVGTREHIFSENNGVL
                     GDIAAGKEKVFGTFFARTLGYINSKLHYGHPDFINAIFITTRGGVSKAQRGLHLNEDI
                     YVGMNVLMRGGRIKHAEYYQCGKGRDLSFNSILNFTTKIGSGMGEQLLSREHFYIGTS
                     LPLDRFLSFYYAHPGFHLNNVFIYISLCLFLIIILNLAVLVDSSVLCVYDPAFKQTDP
                     WEPDGCLQLVPVLYWLRRSTITLLFISMFSFVPLFLQQMNDKGVLSATKRLLKQLASG
                     AIFFEIFSNRIASQALMTDIIIGDAKYLSTTRGLSFERIPFVTLFTRFASESAYFAVM
                     ALVILGYASIVMWDVSLLFFWIYFISLLLSPFIFNPSQYHWIEFITDYRRTLSWFLKW
                     QRRVSWLKYTRGQNSMTQWDVEDKTNWFNIAFINVWCHILPQGVLTVFTVIPFVLANI
                     NNAEDSRVNVLLRLIIVVSSTVTVNALTLMTIFILSSIYGIVVLQGKQQWFPRFLTRL
                     TIFISLLSMIVAFILLSFFQRWDVKTIILGLLSSLMIHKLFYQIICGVIMPTKWNNDR
                     RNESWWTGKWFRRNHSFFSPLIEFIQKVLELSIFNLDFVLVHIILLLQVPILMIPNVD
                     TLHSLMLFWRKADIDARPIIFKKKGKSKFNANIYALVFIIILAIITVVFSLPLILNQL
                     VVIDSDNLRETTRILIQPEMSIALRSEIGLKAYHNMMRAMFNKPRVSNT"
     gene            complement(<781726..>782073)
                     /locus_tag="KLLA0_C08910g"
                     /db_xref="GeneID:2892495"
     mRNA            complement(<781726..>782073)
                     /locus_tag="KLLA0_C08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452596.1"
                     /db_xref="GeneID:2892495"
     CDS             complement(781726..782073)
                     /locus_tag="KLLA0_C08910g"
                     /note="similar to uniprot|P25638 Saccharomyces cerevisiae
                     YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
                     Rvb1 and Rvb2 contains a single TPR domain with at least
                     two TPR motifs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452596.1"
                     /db_xref="GeneID:2892495"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ3"
                     /translation="MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNC
                     AMALIKLNNYADASQMCQRGLFYVNEQTDNDNKVRKKLQWRLNVCSEQLKDDLISVQI
                     HEVDKLPSKYQDL"
     gene            <782424..>783239
                     /locus_tag="KLLA0_C08932g"
                     /db_xref="GeneID:2892686"
     mRNA            <782424..>783239
                     /locus_tag="KLLA0_C08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452597.1"
                     /db_xref="GeneID:2892686"
     CDS             782424..783239
                     /locus_tag="KLLA0_C08932g"
                     /note="similar to uniprot|P25637 Saccharomyces cerevisiae
                     YCR059C YIH1 piecemeal microautophagy of the nucleus
                     (PMN)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452597.1"
                     /db_xref="GeneID:2892686"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ2"
                     /translation="MVLNDDVNDEIDAINAIYPDLLTVVNNDRIKIKVPQHEDFTLHL
                     SFPEHYPETEPPHLLEVSLSAKISALYDVKYLNHLFTEVLESVFNPGLVCIFDFLTEL
                     DGVLYTEEGEEASGSDEVDISDKFENLKIDPFEGWYVSDPITDRKSTFIAFATKANSE
                     EEAFDKLELLRTDNKIARANHLMVAWRIKGENGVSFQDCDDDGETAAGGRMLHLITVM
                     DAWNVIVAVGRWFGGVHIGPDRFKHINSTTREVILKGHFTEAATSTSSKKRSK"
     gene            complement(<783356..>783883)
                     /locus_tag="KLLA0_C08954g"
                     /db_xref="GeneID:2892675"
     mRNA            complement(<783356..>783883)
                     /locus_tag="KLLA0_C08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452598.1"
                     /db_xref="GeneID:2892675"
     CDS             complement(783356..783883)
                     /locus_tag="KLLA0_C08954g"
                     /note="similar to uniprot|Q75EM3 Ashbya gossypii AAR056C
                     AAR056Cp and weakly similar to YNR024w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452598.1"
                     /db_xref="GeneID:2892675"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ1"
                     /translation="MSGQKRHEVTGKLSNRVMNMKFMKHAEQADKVKQTEETIKKLVD
                     SSEWRIGDNVKLLTKLANKSKVVQNVGFSAIKSLNDEDSKIDTNDLSTSTLRTSVNAG
                     RRIFGNKLGRATPGSDGSSNDKKRSFEEKDEDDVSTTDLEKLWEAETQTKKQKKSNGN
                     GNTERNKKKSKRNRN"
     gene            <784536..>787271
                     /locus_tag="KLLA0_C08976g"
                     /db_xref="GeneID:2892246"
     mRNA            <784536..>787271
                     /locus_tag="KLLA0_C08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452599.1"
                     /db_xref="GeneID:2892246"
     CDS             784536..787271
                     /locus_tag="KLLA0_C08976g"
                     /note="highly similar to uniprot|P25636 Saccharomyces
                     cerevisiae YCR057C PWP2 part of small (ribosomal) subunit
                     (SSU) processosome (contains U3 snoRNA) Eight WD-repeats
                     with homology with G protein beta subunits flanked by
                     nonhomologous N-terminal and C-terminal extensions
                     regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452599.1"
                     /db_xref="GeneID:2892246"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:Q6CTZ0"
                     /translation="MKSDFKFSNLLGTVYRQGNVLFSQDGSKLLSPVGNRVSVFDLIN
                     NTAFTFEYEHRKNVAVVDINKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEKVYDL
                     KFSPDGKLFALACGRFLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRF
                     IISTSKDLTARIWSVNSEEKNLASTTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQW
                     EYTKKPGEGEDNDEDEEDVDLSKYSWRITKKNFFHANRAKVKCSAFHAASNILTVGFS
                     NGEFRLYELPEFIMIQQLSMGQNAVNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYI
                     LKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFA
                     KKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFD
                     IFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGRSQQVEPF
                     EVFSDVLSISMKPDGQQIAASTLAGQILFFDVAEGKQVGNIDGKRDIISGRHLEDRFT
                     SESSARSKYFTTIHYSFDGLSLVAAGNNNSICLYDIPNEVLLRRFTVSKNMMLNGTME
                     FLNSSRMTEAGSLDLIDQDAENSDLEDRVDNSLPGSNRGGDLSTRRVRPAIRVTSIRF
                     SPTANAFAAGSTEGLLVYSVDNTILFDPFDLDVDVTPQNVIQSLDDKEYLNAILMAFR
                     LNEGYLIHRVYENIPIKDIPLIAHELPVVYVSRILKFIGEYALESQHLEFNLLWIKSV
                     LTAHGKYISTNKHQFSSALRAVQRFIGRMANDVVQTYKRNKYTLDFLTNTDGSSTNAV
                     DEDMNLLGNDSDNESEDKEDINMDDDLDGGEWVGFEEKTINLPVNDEDSDDEILL"
     gene            <787601..>789214
                     /locus_tag="KLLA0_C08998g"
                     /db_xref="GeneID:2892320"
     mRNA            <787601..>789214
                     /locus_tag="KLLA0_C08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452600.1"
                     /db_xref="GeneID:2892320"
     CDS             787601..789214
                     /locus_tag="KLLA0_C08998g"
                     /note="weakly similar to uniprot|P25355 Saccharomyces
                     cerevisiae YCR054C CTR86 Essential protein of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452600.1"
                     /db_xref="GeneID:2892320"
                     /db_xref="GOA:Q6CTY9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /translation="MSEIRWSKLHSLIHDAPSDSGEYITIIDSLNDLIKETTIEDRRN
                     EIASSKDIFFQLRESAILGKSVDLKQACSSQYMRIVKGIVIIARNLSVANQVIPQNIL
                     LPNTFLAWYLSISRQTVCTPGDLKQLYGLVCQFYFNCTRTNVVFDESCFDDHMNFMVE
                     MLRFIDDDGIVNAYSLWLSNIMKSDAFISSLLNDIRSLEVIDKLLLRGIIAQKTEIDL
                     LVEEEDEDKNLSSLATIQLKILKQLVTHECFGSYMKTLRKEYGFASFNKMFKIVTMLV
                     TSSERWDLYQLTAILSWTFDIFEEYTYLVDAFFKSESTPEATDAGPLFAILSSVLDIL
                     TTLAKYQHAQKYMISYDGVHKIIKLFDILERNCLKIHFNKSSGAKNVDSSAHPVRATD
                     HVGNVITDAVILKKRIHNNRINDSNFPGIKCFLVELLGFMSYEQKDVQDSVRELHGLE
                     LVLSNCIIDDNNPFIKERCIICIRYLLANNSTNQEFISQLEAKKAVDGDVLKKAGYKV
                     DIDGKGNIKLTADKRNAASEEQLFEDVQK"
     gene            complement(<789284..>790816)
                     /locus_tag="KLLA0_C09020g"
                     /db_xref="GeneID:2892244"
     mRNA            complement(<789284..>790816)
                     /locus_tag="KLLA0_C09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452601.1"
                     /db_xref="GeneID:2892244"
     CDS             complement(789284..790816)
                     /locus_tag="KLLA0_C09020g"
                     /note="highly similar to uniprot|P16120 Saccharomyces
                     cerevisiae YCR053W THR4 threonine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452601.1"
                     /db_xref="GeneID:2892244"
                     /db_xref="GOA:Q6CTY8"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY8"
                     /translation="MSQSYRSTRSSDPATKTFEEAIIQGLASDGGLFIPSIIPQVSKS
                     ELFDKWSKLSFQDLAFEIMKLYVSSDEIPEADLKDLITRSYSTFRSHDVTPLAKNVTG
                     SNENLHVLELFHGPTYAFKDVALQFVGNLFEYFLQRHNDGLPADQRKKITVVGATSGD
                     TGSAAIYGLRGKKDVAVFILYPTGRISPIQEEQMTTVPDKNVQTLSVKGTFDNCQDIV
                     KAIFGDKEFNSKHNVGAVNSINWARILAQITYYFYSYFKATTGKEEKVKFVVPSGNFG
                     DILAGYYAKKMGLPVEKLVIATNENDILDRFLKNGVYERSDDVAATLSPAMDILISSN
                     FERLLWYLAREYVASGDDLKAGETVNNWFQELKSKGKFDVPASLIDGAKKDFDSERVS
                     NEETTATIKQVYEQSVNPKHYIIDPHTAVGICATKTQITKDNDNTINYISLSTAHPAK
                     FADAVNEALSSFDGYSFEKDVLPEELKKLSTLGKKLKLVEKADIELVKQTIEEELVKM
                     EV"
     gene            complement(<791144..>792529)
                     /locus_tag="KLLA0_C09042g"
                     /db_xref="GeneID:2892208"
     mRNA            complement(<791144..>792529)
                     /locus_tag="KLLA0_C09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452602.1"
                     /db_xref="GeneID:2892208"
     CDS             complement(791144..792529)
                     /locus_tag="KLLA0_C09042g"
                     /note="similar to uniprot|P53628 Saccharomyces cerevisiae
                     YNR023W SNF12 73 kDa subunit of the SWI/SNF transcription
                     activation complex homolog of Rsc6p subunit of the RSC
                     chromatin remodeling complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452602.1"
                     /db_xref="GeneID:2892208"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY7"
                     /translation="MSAAQSGATVEHQQAQTVPVAQPTDMYIQPYLKKLIPELDGLSK
                     LQEAEKRIDIYLSRKKIDLHQNITQWTHSKYTDPANNQFVRVFISNISENQPWQTNDE
                     TMELDQASWTLRIEGRLLDNGKADDPNRPKFSSFIESVAIDFKPVEEDQDDETDQEMG
                     DPLLEGTQEPSAKKPKNEQTVFEWHVDPNTPVEFDGVDVSRKGTENVNCTITIQPKGY
                     TGEFLQYSPELSCIVGFSKGTFHEAIYSLYKYILLNSLLTNNDEAGPKDSTNGEKVLV
                     KMDASLAKLVSPERLAAGIVSLKLADLPSLVKDHVKPIPPIRLDYTIRVDQSSTFGDL
                     VFDMEVPKSTSVKGDQKLSKDELLLLNEYNTLSTAIEPQIQELNQKTQLLQLQLNSSA
                     KKYQFFDKLAKDPVPMLQDYMESSSQALKVLSGDAGFNEDTVRRSQFYQDNDSILFEN
                     IGVLLSSGRMK"
     gene            <793079..>793483
                     /locus_tag="KLLA0_C09064g"
                     /db_xref="GeneID:2891864"
     mRNA            <793079..>793483
                     /locus_tag="KLLA0_C09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452603.1"
                     /db_xref="GeneID:2891864"
     CDS             793079..793483
                     /locus_tag="KLLA0_C09064g"
                     /note="similar to uniprot|P53724 Saccharomyces cerevisiae
                     YNR022C MRPL50 Mitochondrial ribosomal protein of the
                     large subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452603.1"
                     /db_xref="GeneID:2891864"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY6"
                     /translation="MFRPTSSCLSALTKRTKRVQVQLLKDFPQFQFHTGEVVNVKPSL
                     MRNFLHNYNGARYILKETDIDQALLTSAKRSRASAAALLKTTESTVKKTEQNVKKAKQ
                     VSKEENKTPETPKSALNEEITIENVKIPGLDL"
     gene            complement(<793869..>795095)
                     /locus_tag="KLLA0_C09086g"
                     /db_xref="GeneID:2892256"
     mRNA            complement(<793869..>795095)
                     /locus_tag="KLLA0_C09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452604.1"
                     /db_xref="GeneID:2892256"
     CDS             complement(793869..795095)
                     /locus_tag="KLLA0_C09086g"
                     /note="similar to uniprot|P53723 Saccharomyces cerevisiae
                     YNR021W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452604.1"
                     /db_xref="GeneID:2892256"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY5"
                     /translation="MSAILAPLAKAIDYVNALNKDFYILSVEEQKELGLWGRVTAYNW
                     TFELACIGLMAILFFISYYGKTLNNKYADKIFGTLNTFLLTKLSFTKVGFSADGKKMP
                     YIEEQNNTWFTSFATGRSTIESVIVKAHLTARHNPLALLTQKALALFLPTLVANDIEE
                     FISVTITPNGQFVSTEDAKLTANSAETLSKLKFITSIVNKAVMTKARDSNYFLSLTHT
                     AENESLPADYVFMSESNKLNGFIPHYAGEDFKVLLSKSAKFLKFISFTDLPEEKPITD
                     KLWESSQLPRCVIYLSLVTSDKDIELLEELITKVVEIYDNVTKDIQTNSSNSFITTDI
                     LKKGIQLRKEELGKIVKVMQQVEREMALEKKQEAERQKRKDMRDKLTDQELDKMELKK
                     REKRERRLRNKQKMRI"
     gene            complement(<795433..>796059)
                     /locus_tag="KLLA0_C09108g"
                     /db_xref="GeneID:2891822"
     mRNA            complement(<795433..>796059)
                     /locus_tag="KLLA0_C09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452605.1"
                     /db_xref="GeneID:2891822"
     CDS             complement(795433..796059)
                     /locus_tag="KLLA0_C09108g"
                     /note="similar to uniprot|P25631 Saccharomyces cerevisiae
                     YCR051W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452605.1"
                     /db_xref="GeneID:2891822"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY4"
                     /translation="MNIWIAASNGETELVEKFIKQGQTANDKDENGYTPIHAAAAYGH
                     IDLLKKLVQEHNGDVNIKDSDNDTPLHHCEDATTARSLIEQLGADRELLNNEGKTCFQ
                     VWQETCDDNLDLLRYAEEVLGETIFNTSLGIDKEQLNQFKDNIRYTLENDPVDETDPE
                     SLERRKKLESIIQGENAEEELEKYIRDLIHNQFFSNNNDSSENNKRVK"
     gene            <796544..>797287
                     /locus_tag="KLLA0_C09130g"
                     /db_xref="GeneID:2892006"
     mRNA            <796544..>797287
                     /locus_tag="KLLA0_C09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452606.1"
                     /db_xref="GeneID:2892006"
     CDS             796544..797287
                     /locus_tag="KLLA0_C09130g"
                     /note="similar to uniprot|P53722 Saccharomyces cerevisiae
                     YNR020C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452606.1"
                     /db_xref="GeneID:2892006"
                     /db_xref="GOA:Q6CTY3"
                     /db_xref="InterPro:IPR019165"
                     /translation="MSVPPPPKEDLIKPNPPKSESAVSGFNWWRRTFQYKTGLGLTPE
                     EETQYENDYKFVLQRKQCSKCYEYRDWLLNYSPTVIFMTQQIAKLNNKNTNADVFKFD
                     ESKIICDVCPDWKSGGFHPDLGILICQNRIKDKWHLEDTLAHELVHYFDNLKWEVDWL
                     NLRHHACSEIRASSLSGECRFFQEFARRGFNTGFKVDRGHQACVKRRAAISVSGNPNC
                     RDKEHAERVVDEVWDSCFNDTRPFDEIYR"
     gene            complement(<797422..>799209)
                     /locus_tag="KLLA0_C09152g"
                     /db_xref="GeneID:2892270"
     mRNA            complement(<797422..>799209)
                     /locus_tag="KLLA0_C09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452607.1"
                     /db_xref="GeneID:2892270"
     CDS             complement(797422..799209)
                     /locus_tag="KLLA0_C09152g"
                     /note="similar to uniprot|P53629 Saccharomyces cerevisiae
                     YNR019W ARE2 Acyl-CoA:sterol acyltransferase isozyme of
                     Are1p endoplasmic reticulum enzyme that contributes the
                     major sterol esterification activity in the presence of
                     oxygen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452607.1"
                     /db_xref="GeneID:2892270"
                     /db_xref="GOA:Q6CTY2"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY2"
                     /translation="MSGSSDSSHDTTVKDITEDEQFLRIRRLNDNNHGKRKSLHEEQL
                     EDAVLDELGSPDVLFNTVQPNDTVIFKTRTTSEQGDKHLHVFMQKLKVKEKNRYKKDT
                     NEMQSMTRDVDWGSRGSIMDEMVNNPLRSHFNGPAIDEKYSRVKATARSNTVRIDDNN
                     TIEIANETIATDFSGFYVLFWMAVAFTICKVTLQYYEEHGDFSQSIILRYMTMNLWKV
                     ALYDIAMYLTSYFAFVIQYLCRKNVISWRRTGRDIISVYEVVFLFSNIYLPKKTFHFN
                     WIAQIFLFLHSLVYLMKIHSYSFYNGYLWDISSELDYATSTLKKLKKLSSPQPELDIL
                     QKSIDFCEFEIRSQSSTVRFPFNVSVKNFFEFSSFPTLVYQIEYPRTKRIRWFYVFEK
                     CCAIFGIIFVMMVVAQQFMLPVILKAKILADANLTLWEKNLVWPKLLLDLAPGFIMMF
                     LLVWYLIWDAILNCVAELSCFADHHFYSDWWNCCSWYDFSRLWNRPVHSFLLRHVYHS
                     SISAYHMSKVQATLFTFLLSSVFHELAMFVLFNKFRGYIIILQMSQIPFTALSNIPLL
                     RDKKLFNNVTFWIGICLGPSMTGLLYLIF"
     gene            <799820..>800701
                     /locus_tag="KLLA0_C09174g"
                     /db_xref="GeneID:2891816"
     mRNA            <799820..>800701
                     /locus_tag="KLLA0_C09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452608.1"
                     /db_xref="GeneID:2891816"
     CDS             799820..800701
                     /locus_tag="KLLA0_C09174g"
                     /note="similar to uniprot|P40509 Saccharomyces cerevisiae
                     YIL076W SEC28 Part of a heptameric protein complex that
                     regulates retrograde Golgi-to-ER protein traffic in
                     eukaryotic cells coatomer forms the COP I vesicle coat
                     whose functions are essential epsilon-COP coatomer subunit
                     Sec28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452608.1"
                     /db_xref="GeneID:2891816"
                     /db_xref="GOA:Q6CTY1"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6CTY1"
                     /translation="MDYFTVKQQFYTGNYEEALNEVSKFNKTEDEALTYYRNRSLIAL
                     SQFSEGSADSGSLGPVFEAYYKFLSKPTGSITALEQTVEKAGRSPFALNLLASALTIK
                     GEFKTALEVAVEGIDSDETRGTPELLLTAIQITLLDNQPTIASTMFENFQALQEQSND
                     DEIILNLAESYINFNQGKEITGSNFYFFEELSQTFPSWKTQLGLLNLHLQQSHLPESK
                     AIIDLLESEFYDIKQEAQTYKPDLLANKITYTILSGGNANELRSELQQLKPSHPLCVA
                     DLENNKTFDQIVAKYTA"
     gene            <801012..>801962
                     /locus_tag="KLLA0_C09196g"
                     /db_xref="GeneID:2892018"
     mRNA            <801012..>801962
                     /locus_tag="KLLA0_C09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452609.1"
                     /db_xref="GeneID:2892018"
     CDS             801012..801962
                     /locus_tag="KLLA0_C09196g"
                     /note="similar to uniprot|P40056 Saccharomyces cerevisiae
                     YER083C RMD7 Required for Meiotic nuclear Division
                     functions in DNA replication and damage response Protein
                     involved in cell wall function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452609.1"
                     /db_xref="GeneID:2892018"
                     /db_xref="GOA:Q6CTY0"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /translation="MATELSDAEKRKLLRERRQQKFSNGGASSRLNKITGQQQNSFLS
                     STSVLDEPKVTPSGNKKSSNVSDEEVEKSTKEIQDLLSSIPGNKDNSETDAAETNPEV
                     ALFQQLLKMQQQGGGFQNGSPDASTPDLFSSLLNNDTNTTASATQMLPNFVDEKVLKY
                     YKFKVSKLKSYIILIKWALLAPYVYFIMHPNPTVLQASNLLSQIVERSNFFSIFTGLE
                     IVFISIYYQMLKKLQRDNNVTATQNAGGILKYLTMIPEGILPIRNIQGKIGLALEYFD
                     VASMYVTDICFVLVLFGVMKYYHSSFPISVPIEPPIAGIQ"
     gene            complement(<802178..>802699)
                     /locus_tag="KLLA0_C09218g"
                     /db_xref="GeneID:2891869"
     mRNA            complement(<802178..>802699)
                     /locus_tag="KLLA0_C09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452610.1"
                     /db_xref="GeneID:2891869"
     CDS             complement(802178..802699)
                     /locus_tag="KLLA0_C09218g"
                     /note="similar to uniprot|Q8PPU9 Xanthomonas axonopodis pv
                     XAC0586 Hypothetical protein XAC0586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452610.1"
                     /db_xref="GeneID:2891869"
                     /db_xref="InterPro:IPR025870"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX9"
                     /translation="MYISTALFASQELYNLIPLNSNFVVAIGKSLSSFSENQTISYTA
                     IMFSHVTFGSNDLEKARKFYDAVLGVIGVAPAQDDSDGNGHKRLFYAKGDFFLLVTQP
                     INDQAATPGNGYTIGFKCDSEEEVTKFHDVAVANGGTSIEDAPGYRPSGLFLSYVRDV
                     DGNKLCALYQPPK"
     gene            complement(<803446..>804783)
                     /locus_tag="KLLA0_C09240g"
                     /db_xref="GeneID:2891871"
     mRNA            complement(<803446..>804783)
                     /locus_tag="KLLA0_C09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452611.1"
                     /db_xref="GeneID:2891871"
     CDS             complement(803446..804783)
                     /locus_tag="KLLA0_C09240g"
                     /note="some similarities with uniprot|P28272 Saccharomyces
                     cerevisiae YKL216W URA1 The enzyme catalyzes the
                     conversion of dihydroorotic acid to orotic acid;
                     dihydroorotate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452611.1"
                     /db_xref="GeneID:2891871"
                     /db_xref="GOA:Q6CTX8"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /translation="MNSGFPRILSKKLFTLNQSQFFVKNGMVPLKAGISGPKLLKYTV
                     GIAIGSFAGFYFSNSRSAFHEYVLCPMLRLVTPDAEDGHKLGIWFLKNGLAPRLWFDN
                     DDKVLNVNIFGKKLTNPIGCAAGLDKNGDAIDGILSGGFGYIEIGSVTPLPQPGNPRP
                     RFFRLPLDDAVINRYGFNSSGHDTVVNTLQSRITSFINSYMFKDNSVENLSLYKDKLL
                     GVNLGKNKTGDEVQDYLKGVESFQKYADVLVINVSSPNTPGLRSLQKESILTDLLTQV
                     VAKRDSLVTSGNALGAKTHKPPVLVKVAPDLVEEEIKSIAEAAKKSKVDGIIISNTTI
                     QRPTTLITEDSDLVSQAGGLSGKPLKPLALKALKTMAKYTKGSGLVLVGCGGISSGAD
                     AIEFAKAGASMVELYTAYAYKGPGLIAKIKDETTELLKKENKTWSEIIGEDIK"
     gene            <805512..>807188
                     /locus_tag="KLLA0_C09262g"
                     /db_xref="GeneID:2892674"
     mRNA            <805512..>807188
                     /locus_tag="KLLA0_C09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452612.1"
                     /db_xref="GeneID:2892674"
     CDS             805512..807188
                     /locus_tag="KLLA0_C09262g"
                     /note="highly similar to uniprot|P40055 Saccharomyces
                     cerevisiae YER082C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452612.1"
                     /db_xref="GeneID:2892674"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX7"
                     /translation="MVAKKGSKSQYSDLQRRDNQDKFERSNNDDDANGSHKMQKKTKD
                     KKLKAGLKRIDQKYKEAVLSTAATEYLLPEEHGYLEAEDEMEKTFKFTQAEIKHHVDA
                     SMANKALDLKLNDFGPYRVNYSRNGTHMLIAGRKGHVASLDWRKGELRGELNLGETVQ
                     AATYLQNEQFFAVAQKKYTFIYDHEGVELHRLKQHIEVKHLEYLPYHYLLATAGQTGF
                     LKYQDVSTGQLVSEIRTKLGPTTAMAQNPWNAVMHLGHSNGTVTLWSPSMPSPLVRLL
                     SSRGSITGIAVDRQGYYMATTGSDKSLKIWDIRNFKEVHSIENMPTPGTNVAISDTGL
                     LAVSRGPHVTIWKDTLKSGKAARPYFTSSGYKDRNTPYMSHLFAGNKIENFQFAPFED
                     LLGVGHQKGITNLIIPGAGEANYDALEANPYETSKQRQEQEVRSLLNKLPADSITLNP
                     NTIGTVDSRASQVRLNAKDLAIISNAEQEKSKLNKDIPDARPDVKGKNSGLRAFLRKK
                     TRNVVDERKLRVQRQLEKEKSSRQRKEKIKKGELADDHKDLVDEALSRFS"
     gene            complement(<807377..>810178)
                     /locus_tag="KLLA0_C09284g"
                     /db_xref="GeneID:2892008"
     mRNA            complement(<807377..>810178)
                     /locus_tag="KLLA0_C09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452613.1"
                     /db_xref="GeneID:2892008"
     CDS             complement(807377..810178)
                     /locus_tag="KLLA0_C09284g"
                     /note="similar to uniprot|P32565 Saccharomyces cerevisiae
                     YIL075C RPN2 Subunit of the 26S proteasome substrate of
                     the N-acetyltransferase Nat1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452613.1"
                     /db_xref="GeneID:2892008"
                     /db_xref="GOA:Q6CTX6"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016642"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX6"
                     /translation="MSVTSALPLLALLKESDNTVKTHALQSIKDVVDQQWSEISNDIT
                     EIEALYDDVSFPDRRLAAIVASKVYYNLGEYQLAVKYALAAGEYLNIDEQSQYVETIV
                     SQSIEMYIEFASSNYESEPVEIDPHLVSIFERMLKKCVSSGEYKLALGIALESYRLDV
                     VEKLLTSQDTSTNALKLCSYTLAVCTTALTNTRFKLSVLKKLYEIVMNMPAPDYFIIS
                     KIIVQLNDIEFAKELFFKLNSTKSYDVSYQIAFDLVNSASQGLLKDLSNSLDANVYDP
                     KLLEILSGIPTCDLQNTFLFENKTIDKALLNKMKSSLDGKFSLFHTAVSVSNAFMHAG
                     TTDDSFIRQNLQWLGKAQNWAKFTATASLGVIHQGNLSDGRKIMEPYLPGNGSKSRYI
                     KGGSLYGLGLIFAGYGKESTDYLKEQIQANSSSVGEEDVDVLLHGACLGIGLSGMGSD
                     DVNVCEMLKEVLYGDSAKSGDAAALAIGLILLGSGNQTVIQDLLTYAEETQHGNITRS
                     LSIALALINYGKEELADDLIDKLLASENALLRYGGAYTIALAHAGTGNNKAVKKLLHV
                     AVSDSDDDVRRAAVTALGFVLIREYTTVPRIVELLSKSHNAHVRCGTAFALGVSCAGR
                     GLQAAVDVLEPLLKDPVDYVRQAAMIATSMILIQQTEKTNSKVKEVNEQFMSVIGNKH
                     QEGLAKFGACIAQGIMNAGGRNVTIELENTEMGTLNSRSIIGLMMFSQFWYWFPLSHF
                     LSLSFTPTTLVGLRASDLAIPKFAFKCHTKEGIFTYPRMYEEEVDKNIEKFAAAVLST
                     TAKAKARAKKGKKGEHEKVKEKDAEKVNEEKQEVELEEKKKEEAKNTEEAKIKYTTTS
                     YDVENLTRVLPQQLKFISFAKDSRFVPVRKFRGNSGVIIVEDKTPEEPLELIKTVRQT
                     KDIYAPLPSSFKVEDSLEF"
     gene            complement(<810584..>811996)
                     /locus_tag="KLLA0_C09306g"
                     /db_xref="GeneID:2892263"
     mRNA            complement(<810584..>811996)
                     /locus_tag="KLLA0_C09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452614.1"
                     /db_xref="GeneID:2892263"
     CDS             complement(810584..811996)
                     /locus_tag="KLLA0_C09306g"
                     /note="highly similar to uniprot|P40510 Saccharomyces
                     cerevisiae YIL074C and to uniprot|P40054 Saccharomyces
                     cerevisiae YER081W SER3 3-phosphoglycerate dehydrogenase,
                     catalyze the first step in serine and glycine
                     biosynthesis; isozyme of Ser33p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452614.1"
                     /db_xref="GeneID:2892263"
                     /db_xref="GOA:Q6CTX5"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029015"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX5"
                     /translation="MAFGQQINNLQDSFEAALNLSSSPGAVSTSPTQSFMNTLPHRIN
                     AAKQQKALKPFSTGDIKILLLENVNQTAIEIFNKQGYQVEFHKSSLPEAELIEKIKDV
                     HAIGIRSKTKLTPEILKHAKNLVVIGCFCIGTNQVDLDFAAKHGIAVFNSPFSNSRSV
                     AELVIAEIITLARQLGDRSIELHTGTWNKVSAACWEVRGKTLGIIGYGHIGSQLSVLA
                     EALGMNVLYYDIVTIMSLGTAKQVSTLNELLNNSDFVTCHVPATPETKNLLSGPQFAA
                     MKDGSYVINASRGTVVDIPALIQAMRAGKIAGAALDVYPNEPAKNGAGAFSDNLNTWT
                     TDLVSLPNVILTPHIGGSTEEAQSSIGIEVATALTKYINEGNTVGAVNFPEVSLRALD
                     LDQENTVRVLYIHQNVPGVLKTVNNILSNHNIEKQFSDSNGDIAYLMADISNVNQSDI
                     KQIYDELNETDYKISIRLLY"
     gene            complement(<812817..>815795)
                     /locus_tag="KLLA0_C09328g"
                     /db_xref="GeneID:2891964"
     mRNA            complement(join(<812817..815638,815744..>815795))
                     /locus_tag="KLLA0_C09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452615.2"
                     /db_xref="GeneID:2891964"
     CDS             complement(join(812817..815638,815744..815795))
                     /locus_tag="KLLA0_C09328g"
                     /note="similar to uniprot|P40511 Saccharomyces cerevisiae
                     YIL073C SPO22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452615.2"
                     /db_xref="GeneID:2891964"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013940"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX4"
                     /translation="MMCELSSTFKNTIIEFDDALNWITTKISSAKCLTEDDYQLIESK
                     IRIFIPIIDKHARTLRSTKILLEEALLFSLEDSATKLWNSVAILTKLEGDASEKRTIA
                     NCKLFVSLLLGLHEAIVIDPKCKLRSFRCILNTTRYAIDYQIQSELKTQIQNYCDSCF
                     QQLEQYYETSNCSGNESQDEYKRLKVEMFMVYLQNAMEESDLKMARFYEEKAEIEKNA
                     CALDADTVIEICRTVYNAALHLIENKKAETNFSDLVHIMENLAKYLTLKVPGLEVHPD
                     LLQLKYTILLFVANLAIEDNANTELCERRISDMINHYPQKLESYKLAIKFHELHKPGD
                     YVYLEDILMQMLSTINVSANIEGIIGFINHQAELDTASALRCLDYIFFNKMNSTIDSN
                     VLELCLATRFFIISQSKALTNDIKIRDMTQTLNNVQKMMTKRLSKSCAAGIITLLFNE
                     GKQLYKTGKQAESVEWFNLALNELFSTEHIDTGKIQRALQFAMVDLGDFDSVEQIYFE
                     MSPSDQRNALTQLNMFRVYAHRNDFDGAKKCLDTLKESNNDKSVDALIIAVSECKRST
                     DWGVYGMLSMFDKIQHMENKIAHTRGASVICSLRYTIQMLLKMTEKDGIQDVGKYLPT
                     LHMLLNKGSEFIKTAKTLKQLAGKVQNPGIYDEAISIDDIEWFASACYNLVRKLLNEG
                     RITYLDHLISDCKLYLEYIPKEELDDHKKLYYRYWEIRTDVLSLELLHRTSNWISLKE
                     SSLALIAQNKDFFNTSKDKEQSVLTSEEVHNTFIDIIVRSFEAAMNLGDLLLLKHILD
                     ATATNPDYKVDELVWDVFTNTQKIMSDAFATELLKCLIDRNMGNTSISDDILSQWIRS
                     LLEVSQGTDEQNCLTILSQFQIRIKHANNYCTTEIEWLTTVIWNRGISYIITDNKSQG
                     IMWCQKALEISKMSPSEALQNQLKQFWSELSSKINLSNIVLND"
     gene            816018..816090
                     /locus_tag="KLLA0_C09350r"
                     /db_xref="GeneID:2892231"
     tRNA            816018..816090
                     /locus_tag="KLLA0_C09350r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2892231"
     gene            <816494..>817378
                     /locus_tag="KLLA0_C09372g"
                     /db_xref="GeneID:2892257"
     mRNA            <816494..>817378
                     /locus_tag="KLLA0_C09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452616.1"
                     /db_xref="GeneID:2892257"
     CDS             816494..817378
                     /locus_tag="KLLA0_C09372g"
                     /note="similar to uniprot|Q75FB1 Ashbya gossypii AAL180C
                     AAL180Cp and weakly similar to YKR011C uniprot|Q02209
                     Saccharomyces cerevisiae YKR011C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452616.1"
                     /db_xref="GeneID:2892257"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX3"
                     /translation="MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQL
                     RAVETITGNLKIKSNSHSDDTDDHDKPFYILEYCVAEDTYSLWKSRSEWKLSSAIATL
                     YGSNTLTDLPDRLVEALKDSQHIFMVRNLLKEFNIRDTMKIDWDSIATDLMIFFEARE
                     LKKPIDPYELKTSMALSLLRSMVDLNKRELGSTLLSYDVKVHQDNSPVSSPPSASTKA
                     NKNITFQSDYTHMPSTQLQSNFNTFFQSMAENFETYDTERQPSTRSLRLPSFAKNKKT
                     PAGQVHKPARKGNGMSIN"
     gene            <817925..>821479
                     /locus_tag="KLLA0_C09394g"
                     /db_xref="GeneID:2892238"
     mRNA            <817925..>821479
                     /locus_tag="KLLA0_C09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452617.1"
                     /db_xref="GeneID:2892238"
     CDS             817925..821479
                     /locus_tag="KLLA0_C09394g"
                     /note="weakly similar to uniprot|P47035 Saccharomyces
                     cerevisiae YJL076W NET1 Core subunit of the RENT complex
                     which is a complex involved in nucleolar silencing and
                     telophase exit stimulates transcription by RNA polymerase
                     I and regulates nucleolar structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452617.1"
                     /db_xref="GeneID:2892238"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX2"
                     /translation="MFKLQVVLVPAGANRSFNFGLPSVSSESSQFILPVQQQVLQQGG
                     NAPQLANNIPAQNGIGALDPNVSTNTAYLSSFMTSHITRPKLKKFLIFTKPTNTLYQL
                     SQEILDKCNKIYPNLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDL
                     ESNPDRQESLYSSKRRKLNNGNSQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPL
                     AHQIYPPPSQRNPKQVNSDYEEDEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRL
                     KINGSEDTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRI
                     NSTPVVTNKRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPD
                     EHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDATKR
                     MNVKVADLPPQRKSSLEAKVEKLAKNASELVADNHLSSNTTRKEGFSESESENAESEN
                     EANDTVCIHPTDRMDGSFQKSELLELLKGSKFDVPPAFRRAAGALQENDINKRSRKPY
                     LTVLNKDIDNSEPDPRNILPSKLPRQAAQKAAQFISTGTSRRPLQSSSSSSSSSAVVS
                     EEPSSDSDIETENSDNSMDEVNLKRLNVHPLRPVMVPVEETQDTNELNKTNSANSSSS
                     SSEESESADEPGNEEGKAAGSENPQKSESKVDQMKSVSQPAKVTSSRLITLKPVDTPK
                     EVTPSPSMQLHDKIDRQLSPSPTRNKKDYISPEFIEDSDGDAENENITLSQRSQNNKE
                     NTEPSFNKENSEDIKLKKITPSVLKKKQEAEQRRLQREAARKAKEEEKERRRADREAA
                     RRAKQEEQERKRAEREAAKRARQEEIARKKAESTTKKGPKETKKNGDITPKVIERAET
                     ESSANGTPAKKAAESGVQSPDSPSRASKLDELRNKFAVGKASITGPPKKTINKPIKLQ
                     LSSTSTSNTSSDSDGSSGSESSTSSENETSMTKKTRRGIVDTPKGLIGSISKSAIDKG
                     TSDLENAPQSTQQSNSSPIKVPVTKMMEYASPTANKSSAKSVLVSPPSKATKVNRQTL
                     SRNSLSSLSDLVSRGVPEVKEKSAAKTVPQPESSSLSEEDELQSGTDDSSDSDSDSDS
                     SDDGSDTNFINAKSASKALGKKKTDSGFSSLIKDSKKI"
     gene            complement(<821606..>822820)
                     /locus_tag="KLLA0_C09416g"
                     /db_xref="GeneID:2892254"
     mRNA            complement(<821606..>822820)
                     /locus_tag="KLLA0_C09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452618.1"
                     /db_xref="GeneID:2892254"
     CDS             complement(821606..822820)
                     /locus_tag="KLLA0_C09416g"
                     /note="similar to uniprot|P38355 Saccharomyces cerevisiae
                     YBR287W ZSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452618.1"
                     /db_xref="GeneID:2892254"
                     /db_xref="GOA:Q6CTX1"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX1"
                     /translation="MMEVTARHISFLQLSWTTFQSVLIVFIIAVSGFLSAYAGILPKE
                     GQKIVSMLNVSLLTPCLIFSKLARSLSFGTLIQLYVVPIFYTALVSTSYFSASLVSKI
                     LKLDGDETNFVIGTSVFPNSNSLPVSLMMSLAYSLPQLKWPELPNDSGDNIASRGVLY
                     LIIFQQIDQTLRWSWGLNKLLRWSTEIELSIEDTMEQNADRLLTRGSEDEANNLTKVG
                     SKLRYHWNNLLSCMNGPLYSIMFSILVASIRPLQEQLFESNGFLKNTLTSAIDQMADV
                     SIPLILVVLGANLCPSSTTPLGTHNRKRIVLASIISRMILPALILLPLLAFTVKKLRK
                     SILTDPVFILVSFLLTASPPAIQLTQLTQLNEFFEFEIVNVLFWTYVVMTLPVTILMV
                     TIALRVMDWASQ"
     gene            823593..823665
                     /locus_tag="KLLA0_C09438r"
                     /db_xref="GeneID:2891829"
     tRNA            823593..823665
                     /locus_tag="KLLA0_C09438r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2891829"
     gene            complement(<823980..>824297)
                     /locus_tag="KLLA0_C09460g"
                     /db_xref="GeneID:2892249"
     mRNA            complement(<823980..>824297)
                     /locus_tag="KLLA0_C09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452619.1"
                     /db_xref="GeneID:2892249"
     CDS             complement(823980..824297)
                     /locus_tag="KLLA0_C09460g"
                     /note="highly similar to uniprot|P48606 Saccharomyces
                     cerevisiae YOR265W RBL2 Protein involved in microtubule
                     morphogenesis required for protection from excess free
                     beta-tubulin proposed to be involved the folding of
                     beta-tubulin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452619.1"
                     /db_xref="GeneID:2892249"
                     /db_xref="GOA:Q6CTX0"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="UniProtKB/TrEMBL:Q6CTX0"
                     /translation="MAPTQLEIKERALKRLCKEEHFYQEELEQQKLHVKKLQSDPSVD
                     PYDLKKQVEVQQDTERLLPELYKKIKQFRDDLDKYLSSYEGTEDLESAKAALETADEL
                     LKN"
     gene            complement(<824667..>825980)
                     /locus_tag="KLLA0_C09482g"
                     /db_xref="GeneID:2892247"
     mRNA            complement(<824667..>825980)
                     /locus_tag="KLLA0_C09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452620.1"
                     /db_xref="GeneID:2892247"
     CDS             complement(824667..825980)
                     /locus_tag="KLLA0_C09482g"
                     /note="weakly similar to uniprot|Q08729 Saccharomyces
                     cerevisiae YOR264W DSE3 Daughter cell-specific protein may
                     help establish daughter fate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452620.1"
                     /db_xref="GeneID:2892247"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW9"
                     /translation="MVRRFSGQRIVSEIDFAPPSSMLLTEEDLSNIPDAFEQLNLRES
                     ETKSNKYGALQSGGMKLSRKFGGTLRLKQRLSSVPELLLRGIEQQKVNPTNSKTMDPK
                     VIKNSGVSSGSMRRLMPSVMEKDEIGDRLLPKTAIRYQNFKRKASSPLSQEPIINVRK
                     ENSYIVMPVTTEIIAPSAVLGSATSTNPEDFDNRPFLKYRERNSNSDLLLDEIMNLYT
                     NRDVSTEDSPIIKKRIDDFIDTIHESLQNHKASREKDRTHKAVDMSPIIINKSSPGYV
                     DCLKLPNTPELSPTENLEANISTPEYVTSGGSDQSSGGEEFSDLDSLALGFKSPVSVS
                     DESFYSCSEEITKDINSPSTTSETSLMSRHFSIRNAGLTAINPKVLNITDMLGFSDEE
                     VEEVTVTDSPSAEYIDISDNYSTKIVDDTTSSIYSLQSATSNQFE"
     gene            complement(<826607..>827650)
                     /locus_tag="KLLA0_C09504g"
                     /db_xref="GeneID:2892245"
     mRNA            complement(<826607..>827650)
                     /locus_tag="KLLA0_C09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452621.1"
                     /db_xref="GeneID:2892245"
     CDS             complement(826607..827650)
                     /locus_tag="KLLA0_C09504g"
                     /note="highly similar to uniprot|Q08726 Saccharomyces
                     cerevisiae YOR262W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452621.1"
                     /db_xref="GeneID:2892245"
                     /db_xref="GOA:Q6CTW8"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW8"
                     /translation="MPFGQIVIGPPGSGKSTYCHGCSQFFNAIGRHVQVINMDPANHR
                     LPYPCSVDIRDYITLEEIMSEQHLGPNGGLMYAIESLNESIDLFILQIKSLVQEEKAY
                     LVFDCPGQVELFTHNSALFKIFKRLEKDLDIRLCVVNLIDCIYITSPSQYVSILLLAL
                     RSMLMMDLPHINVFSKIDMLKGYGELPFRLDYFTEVQELEYLNPLIEKEGSGVLGRKY
                     SRLTETIGEMVSDFNLVSFEVLAIDDKQSMINLQSVIDKANGYIFGSSEIGGDTVWAE
                     ASRQGAAMVNYDVHDRWIENKETYDKLEKEARDQQLKEREMQAKEIDVNEDDEWESAL
                     REWEEKQGTNYVR"
     gene            <828109..>829110
                     /locus_tag="KLLA0_C09526g"
                     /db_xref="GeneID:2891966"
     mRNA            <828109..>829110
                     /locus_tag="KLLA0_C09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452622.1"
                     /db_xref="GeneID:2891966"
     CDS             828109..829110
                     /locus_tag="KLLA0_C09526g"
                     /note="highly similar to uniprot|Q6Q5I7 Saccharomyces
                     cerevisiae YOR261C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452622.1"
                     /db_xref="GeneID:2891966"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW7"
                     /translation="MSVPYEQVSVAPLVLLSVLDHHQRTNTPENKRCLGVILGDSSTA
                     TVRITNSFALPFEEDEKNPDVWFLDHNYIETMNEMCKKINAKEKLIGWYHSGGKLRAS
                     DLKINELFKKYSTNNNPVLLILDVKQEDIGLPTNAYVAVEQIKDDGTSTERTFIHIPS
                     TVEADEAEEIGVEHLLKDVRDQAAAGLSIKLTNQLNSLRGLQRKLKDIVAYLEKVANN
                     ELPVNHIILGKLQDIFNLLPNLGTPDKDEMIGSSHVLDNVTNNLEKALTVKTNDELMI
                     IYISNLVRAIVAFDNLIENKIQNKKLLEKHSKVEVEQKEDATNDGIPAESNSVPTKN"
     gene            <829526..>830884
                     /locus_tag="KLLA0_C09548g"
                     /db_xref="GeneID:2892678"
     mRNA            <829526..>830884
                     /locus_tag="KLLA0_C09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452623.1"
                     /db_xref="GeneID:2892678"
     CDS             829526..830884
                     /locus_tag="KLLA0_C09548g"
                     /note="similar to uniprot|P21592 Saccharomyces cerevisiae
                     YPL172C COX10 Heme A:farnesyltransferase catalyzes the
                     first step in the conversion of protoheme to the heme A
                     prosthetic group required for cytochrome c oxidase
                     activity human ortholog is associated with mitochondrial
                     disorders"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452623.1"
                     /db_xref="GeneID:2892678"
                     /db_xref="GOA:Q6CTW6"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /translation="MSLVIQPLLMRALNPNLSSILISGRGFSLIQHRRFAFRAGSGNN
                     NSEQNQVHINTAPIEFTANLLAGKNETEAETEGLKGTALKALRCNDTTSDSEPQHNME
                     NLPFKVKLVDKGQRKQIKESKARVEPRPEVSLKKTYIEPYLQLSKPRLTVLVMLSAIC
                     SYALSPYPATVLQLLSLTVGTTLCSASANAINMGREPDFDRQMIRTQARPVVRGIVSP
                     NQAFKFATAAGTLGTSILWLGVNPTVAFLGFSNIALYAWLYTSLKRKHIINTWVGALV
                     GAIPPLMGWAASSPLSHPGAWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGYVMTAWKN
                     PKLNARVALRYSLLMFPLCFGLSYFNVTDWYYQLDSAFVNAWMSLWAFKFYFQQKRNY
                     SKEIYNNKTEFNKGLAMANVYARRTFWVSVLHLPAVLILAILHKKDRWDWLFEDKKQL
                     SA"
     gene            complement(<831137..>832621)
                     /locus_tag="KLLA0_C09570g"
                     /db_xref="GeneID:2892473"
     mRNA            complement(<831137..>832621)
                     /locus_tag="KLLA0_C09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452624.1"
                     /db_xref="GeneID:2892473"
     CDS             complement(831137..832621)
                     /locus_tag="KLLA0_C09570g"
                     /note="similar to uniprot|P09032 Saccharomyces cerevisiae
                     YOR260W GCD1 Gamma subunit of the translation initiation
                     factor eIF2B the guanine-nucleotide exchange factor for
                     eIF2 activity subsequently regulated by phosphorylated
                     eIF2 first identified as a negative regulator of GCN4
                     expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452624.1"
                     /db_xref="GeneID:2892473"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW5"
                     /translation="MDFQAFIFCGRGAKLTPFSNVRGDTGVPKALLPVANRSMIEFVL
                     DWCEQAQFKEVNLVIDASDADELEESLKKYREVRGHYFGLLSQSVGSNHAHYLKKPSP
                     INIIPSKCENTGECLKNELLDKITGDFVLLPCDFITDIPPQVFLDQYLNKDPENLAMA
                     VYYHNGFENIDKKHLKQFLTVYSENLESVSKPVLLDVYSKDDVDKTKYLQIRSQMLWR
                     YPNSSVSTKLLNSFIYFCSHELVNLLKDETEKGAGELDSDSEAVDSLATSFQNTSFLK
                     GKKKLIKDPINCNKSLGKLFRDLSRRSWQHVKPRETIGIFVLPEIGLFIRSNSLSAYM
                     ESNRYVLKIKQTAIQQRTTDGSSAIGADSMVGNNCAILEKTNIKRSVLGDNCKVGKRC
                     RIVGCVVLDNVEIDDETQLENVIIGRNAKIGKKSKLTNCYVEGSYIVNEKSTLKGETL
                     TSIYIDDEDYASSLLDSDSSGSESDYTDEYYDDEDYVDDGLFDR"
     gene            <833061..>834365
                     /locus_tag="KLLA0_C09592g"
                     /db_xref="GeneID:2892259"
     mRNA            <833061..>834365
                     /locus_tag="KLLA0_C09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452625.1"
                     /db_xref="GeneID:2892259"
     CDS             833061..834365
                     /locus_tag="KLLA0_C09592g"
                     /note="highly similar to uniprot|P53549 Saccharomyces
                     cerevisiae YOR259C RPT4 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates required for
                     spindle pole body duplication localized mainly to the
                     nucleus throughout the cell cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452625.1"
                     /db_xref="GeneID:2892259"
                     /db_xref="GOA:Q6CTW4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW4"
                     /translation="MSQEQDPLLAAMEENDGDDTNGAGTNSNSGENNAAAPETVEPVD
                     PEQAAKEKAMLHFKKRLMEHRRYDDMLKQRRETIRVLEAEYERTEQDIKALQSIGQLI
                     GEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRET
                     DPLVYNMTTFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLY
                     GPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIF
                     MDEIDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPAL
                     LRPGRLDRKIEISLPNEAGRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCI
                     TEAGFFAIRDDRDYINQEDLMKAVRKVAEVKKLEGKLEYQKL"
     gene            complement(<834462..>835433)
                     /locus_tag="KLLA0_C09625g"
                     /db_xref="GeneID:2892498"
     mRNA            complement(<834462..>835433)
                     /locus_tag="KLLA0_C09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452627.1"
                     /db_xref="GeneID:2892498"
     CDS             complement(834462..835433)
                     /locus_tag="KLLA0_C09625g"
                     /note="similar to uniprot|Q08702 Saccharomyces cerevisiae
                     YOR258W HNT3 Member of the third branch of the histidine
                     triad (HIT) superfamily of nucleotide-binding proteins
                     similar to Aprataxin a Hint related protein that is
                     mutated in individuals with ataxia with oculomotor
                     apraxia"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452627.1"
                     /db_xref="GeneID:2892498"
                     /db_xref="GOA:Q6CTW2"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW2"
                     /translation="MDECGPIYVIEWKESPGDQWTISDKSGFTTHLFKLNEDANKDIV
                     YCKHCRKQFIGKNRDLIGFHMNKIHPQITTGMTYNQYLQIFKPTYVPNAHGDEKNREN
                     SFSIGLRPYVLCPERLPEVLYFDDIATIIHDKFPKSEEHFLVLPRSHKISNSHPTTID
                     NGIKVQLQWHIDWAKRFCWTQFIKKYDIKDISLKEKEAFLANFVQSGVHSTPSMANTH
                     IHVMTRDFHSKKLKHKKHFNSFNSPFFIPWDELPVLDLPGDKELSERYIKNFEMICPY
                     CSTNFKNRFAKLKEHLADEFNMRFVSKKGLITADRAISSFNRFTNDS"
     gene            complement(<835665..>836555)
                     /locus_tag="KLLA0_C09647g"
                     /db_xref="GeneID:2891873"
     mRNA            complement(<835665..>836555)
                     /locus_tag="KLLA0_C09647g"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="XM_452628.1"
                     /db_xref="GeneID:2891873"
     CDS             complement(835665..836555)
                     /locus_tag="KLLA0_C09647g"
                     /note="similar to uniprot|P36534 Saccharomyces cerevisiae
                     YPL173W MRPL40 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="XP_452628.1"
                     /db_xref="GeneID:2891873"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW1"
                     /translation="MSSYKHLSKAGARFLEQVQAKNSNIAKQFAKYEGLTMPEFLKPS
                     LPRVEESEKYKSVKQWKYMPGDRVVIVNGKFKGNVCAITQHDVHTNGYILDENGPTNT
                     VPVPKQFWQQGQNSHMVSFPVPVSQADIKLVADLDDPETPGVAKTVAVRDIEFKGSYY
                     DSDYKKIMPYRVVVGENNMVVPWPKPEFKPDGALATRSEIARQQTFWVESVVKNPVPE
                     AALSTIRNPKSKYRRGTLTTKEISRLVAPKMPLTEAKKRYIEQRKELAALPKRKLTDE
                     DQELIGDKVYQHFKKSFELQ"
     gene            complement(<836857..>837360)
                     /locus_tag="KLLA0_C09669g"
                     /db_xref="GeneID:2892242"
     mRNA            complement(<836857..>837360)
                     /locus_tag="KLLA0_C09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452629.1"
                     /db_xref="GeneID:2892242"
     CDS             complement(836857..837360)
                     /locus_tag="KLLA0_C09669g"
                     /note="similar to uniprot|P06704 Saccharomyces cerevisiae
                     YOR257W CDC31 Component of the spindle pole body (SPB)
                     half-bridge required for SPB duplication in mitosis and
                     meiosis II homolog of mammalian centrin interacts with
                     Kar1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452629.1"
                     /db_xref="GeneID:2892242"
                     /db_xref="GOA:Q6CTW0"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6CTW0"
                     /translation="MNNRRPSGRVAKSVDKSTLQKELLEEQKQEIYEAFSLFDMNNDG
                     YLDYHEFKVALRALGFELSKGDILELIDRYDADGRRLIQYEDFYLVVGEKILQRDPLD
                     EIKRAFRLFDDDNTGKISLKNLKRVAHELGENLTDEELRAMIDEFDLDDDGEINEEEF
                     IAICTDN"
     gene            <837629..>840094
                     /locus_tag="KLLA0_C09691g"
                     /db_xref="GeneID:2891813"
     mRNA            <837629..>840094
                     /locus_tag="KLLA0_C09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452630.1"
                     /db_xref="GeneID:2891813"
     CDS             837629..840094
                     /locus_tag="KLLA0_C09691g"
                     /note="weakly similar to uniprot|P33420 Saccharomyces
                     cerevisiae YPL174C NIP100 Large subunit of the dynactin
                     complex which is involved in partitioning the mitotic
                     spindle between mother and daughter cells putative
                     ortholog of mammalian p150(glued)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452630.1"
                     /db_xref="GeneID:2891813"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV9"
                     /translation="MDLELGDRVVLRSLAGTVRFIGETQFAAGIWIGVELDEPLGKND
                     GSVKGVRYFELSEGRKGRMYGIFSRREGIYKNSAPNSQQFQDPDTTNSNSSDPERLKK
                     IIGRLEVKLKSVNDKCISFEKELGLRSKELEKVQFLEEQLEKLTLGRDEAEQRNDSLI
                     FELESLTIAHESALKELNDYKEEILIRRKADVDVNTDQIESVESDALIKQNRLLTVAL
                     QKLQSDLTEIQKQCNGLKNSNEELQTQAETYLRTISALESKLFETTKTLDELKQHFSA
                     NSNSNNIIESLTTENHQLSTELDCLKSELLKLKQTQLADEELEALYKEVESELNSQIA
                     KLQETLSTDESIINALKENNKTLKNELQSLQNKSGQYSQEMSPEVEELQAELTSLQLR
                     NNELQFQNEVSSAKLSHLKVDNKVELLSQIKIIYLRDQLLSQDAVSICTSQLILFIYY
                     AMIKYDAGVTYLKEKINLDLLLESVKNSHPIKVQLSLLENADITLSDPRVLFTAIQMF
                     LEASVERLLSDTEHLSKESDQQRIRSLYNTFHTINTFVTTKLEELYEFNGTLKSDVNL
                     FSIYVHFATSVLSLQEKPNELSVCLEEIKQIPVDMLENKERNTSVEKNVIQSQAQVEV
                     LQQTISEKDQIIQDLILKIEVLESKYARNKEMEGSLSSLKNELLEVKSRNSSLQDELV
                     NMEAEYQQYRNNREQEIKNANNLFHTKALNNIQSLRENNDKLSLIAEISDLQRIILRK
                     EQESRLKLSIPLFDTHRKQFSSRNMFNDFNNMANILSTCIELADPIISNEFTSIRKHR
                     LAKLKETHELCVTYTYEMLKGEY"
     gene            complement(<840112..>841452)
                     /locus_tag="KLLA0_C09713g"
                     /db_xref="GeneID:2891867"
     mRNA            complement(<840112..>841452)
                     /locus_tag="KLLA0_C09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452631.1"
                     /db_xref="GeneID:2891867"
     CDS             complement(840112..841452)
                     /locus_tag="KLLA0_C09713g"
                     /note="similar to uniprot|P32363 Saccharomyces cerevisiae
                     YPL175W SPT14 UDP-GlcNAc-binding and catalytic subunit of
                     the enzyme that mediates the first step in
                     glycosylphosphatidylinositol (GPI) biosynthesis mutations
                     cause defects in transcription and in biogenesis of cell
                     wall proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452631.1"
                     /db_xref="GeneID:2891867"
                     /db_xref="GOA:Q6CTV8"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV8"
                     /translation="MAEQKYNIAMVCDFFYPQLGGVEFHIYHLSQKLIKMGHNVCVIT
                     HAYGDRTGIRYLSNGLKVYYVPYLVLYRQTTFPTVFGSFPIFRNILIREQIDVLHSHG
                     SVSSFAHEGILHANTMGIQTVFTDHSLYGFDSLGSILVNKLLKFTLCNIDAVIAVSHT
                     CKENIILRANLDPDNVSVIPNAVVSSSFKPRDSTIKKKSNRITVVVICRLYTNKGADL
                     LTHLIPKVCTNNDNVDFIVAGDGPKFIAFQQMIENNRLQERVQLLGSVRHEHVRDVMC
                     QGDIYLHASLTEAFGTVLVEAASCGLLIVTTSVGGIPEVLPEYMTVYAQETSVSSLIK
                     AMNKAIHRIGHSKVNTTQFHETIAQMYDWMNVAERTVQVYDRISLDVRSLNKNWVVML
                     KKYYRQDGNWARLLYVLCAIVEYILLYILEILYPAGDIDRVVKWNSRICRDPHI"
     gene            <841867..>844221
                     /locus_tag="KLLA0_C09735g"
                     /db_xref="GeneID:2891815"
     mRNA            <841867..>844221
                     /locus_tag="KLLA0_C09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452632.1"
                     /db_xref="GeneID:2891815"
     CDS             841867..844221
                     /locus_tag="KLLA0_C09735g"
                     /note="similar to uniprot|Q08693 Saccharomyces cerevisiae
                     YOR256C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452632.1"
                     /db_xref="GeneID:2891815"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV7"
                     /translation="MPRAQGRYQGVSQDEDVSLPDVSSENVVDLDESLLPPNPPEYDI
                     ESRPDILPMELDIEQEDTISSVGRFQRLKTRIEDNLIFPMKNNVVDPLVQVYQMASAK
                     VDLYLSKLGNPLILRRFVYILFMSVIVYTVVMSGLMPNSKSTATIGMFSDKNQLIYYA
                     RRSIDYAKLEEDMEYLSSMPHLAGTKGDYAITNYIRESFKNNGLKLMKEVPFQGYMNF
                     PNEVEFSVTTSDNKVHEFALSKENFNPLSSNGNIQNADIIYANYGTVADIQSLKENGL
                     LSDNTVLVMKYGNLPSEQILVAEKHGIKGIIFISKPFGNDGDVIQKLSVAIPQYGTGD
                     ALSPGWSTLSPKKIGLEKSQLVPHIPTIPISYNQGLKLKSILNDGSPSIKFEDSWFSG
                     RKDDVKCNLRLANAEKTLQPSWNVLGKIEGKEQKDKAIIIAASHDSTCKGTLYPNFGT
                     SSLMALLQLFQQTKYKYDWRPLRNIYFISYDGAQYNHVGATELMETEMNQLKSEVYAF
                     IDISQLSVDPKARRALDVQATPLLQSLFKNTKQFDVTVRNIAQYGDWTAYLANGIPTA
                     VLSSPFVLNQTPPISTCSDDFQHWSEEIKGTEGAWEQVADTLIYTYEMLLRLIDEPLL
                     PFNVRDYVSNLDILFQDLQKQGGNNFDYASIQQGLKAWKKISDEWNAWVHTWNNIVMM
                     EDEGVEPSLVSVHRWTWNKKIMNIMKRQSLSSGIPDREFYKNVLFGPTLWTQTNGYDS
                     WSFPGVRDALTSGNLKEAQKQINIAGNLLISSAQSFIDETANSF"
     gene            <844760..>845218
                     /locus_tag="KLLA0_C09757g"
                     /db_xref="GeneID:2891823"
     mRNA            <844760..>845218
                     /locus_tag="KLLA0_C09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452633.1"
                     /db_xref="GeneID:2891823"
     CDS             844760..845218
                     /locus_tag="KLLA0_C09757g"
                     /note="highly similar to uniprot|Q12091 Saccharomyces
                     cerevisiae YPL170W DAP1 Heme-binding protein involved in
                     regulation of cytochrome P450 protein Erg11p damage
                     response protein related to mammalian membrane
                     progesterone receptors mutations lead to defects in
                     telomeres mitochondria and sterol synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452633.1"
                     /db_xref="GeneID:2891823"
                     /db_xref="GOA:Q6CTV6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV6"
                     /translation="MSFIKNFLTGAVKTTADPTGLTQSGSGNEGASSKSNDPIVEGKF
                     YPRTLSKFNGHDDEKIFIAVLGKVYDCSQGRQFYGPSGPYSNFAGHDASRGLATNSFD
                     LDTVRHWDQPIDTLQDLNEQERGALEGWAAHFQKKYPCIGSLEAEPGVNN"
     gene            complement(<845329..>845979)
                     /locus_tag="KLLA0_C09779g"
                     /db_xref="GeneID:2891933"
     mRNA            complement(<845329..>845979)
                     /locus_tag="KLLA0_C09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452634.1"
                     /db_xref="GeneID:2891933"
     CDS             complement(845329..845979)
                     /locus_tag="KLLA0_C09779g"
                     /note="weakly similar to uniprot|Q08692 Saccharomyces
                     cerevisiae YOR255W OSW1 Protein of unknown function
                     required for the construction of the outer spore wall
                     layers"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452634.1"
                     /db_xref="GeneID:2891933"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV5"
                     /translation="MRSIPEPRQSKYNRFRRLFNKVHNCVTLKRLKRRWNLHKLKKSS
                     RNTNQRSAIPIDRIANLPTGMSHKSSNMKPLLLVSFNKGQENSPKVRILETNGHLRSW
                     ISGRKFSMKRIVNNASVERDPYQNSRHTVRQEVAKHADLKVNYSEQGIVKTVDIPCCY
                     TEDPKLINIGQEHTFRIRDYPSLNPSQRTTRNGFRSRNQPEPVSRFFFEEVAETMS"
     gene            complement(<846302..>848068)
                     /locus_tag="KLLA0_C09801g"
                     /db_xref="GeneID:2891834"
     mRNA            complement(<846302..>848068)
                     /locus_tag="KLLA0_C09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452635.1"
                     /db_xref="GeneID:2891834"
     CDS             complement(846302..848068)
                     /locus_tag="KLLA0_C09801g"
                     /note="similar to uniprot|Q99257 Saccharomyces cerevisiae
                     YPL169C MEX67 Poly(A)RNA binding protein involved in
                     nuclear mRNA export component of the nuclear pore ortholog
                     of human TAP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452635.1"
                     /db_xref="GeneID:2891834"
                     /db_xref="GOA:Q6CTV4"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV4"
                     /translation="MQVSGFGNVNQIGALAQQNQLDNLVSVSIRGWTNATQQDLLNFI
                     SRKTRISVRNSVVQGDTIVGYVTPQEADQLVKFSGYRFAGNSLKIHKAAGGNTNPNTN
                     DTITVLRNVLLRRYNVQTRMLDLGNLFNDPELVQRGMAPKNVNTQSKMFPAMMKVASK
                     EPSMVVESINLSDNNLRDVNGVTTLAQTFPHLKNLCIANNSISRFHSLEVWKNKFKEL
                     RELLMMNNPITSDRLYRTEMLRIFPKLVILDNVVVRDEQKLLSIYSLPVQQTQFFFED
                     NGLASSSTDFITNFLNLWDSNRMQLMGLYTPQSQFSLSVDSSVPAATVPNAQTTPTFG
                     HYLPFSRNISKISSDKTIQERLRIGPEAIYEVFGSLPMTKHFLQEQPDAYSVQAWTFP
                     QVQGFVITLHGHFDETAKPEIDKSKTSQGSSASRGRRYNHGFTSTPNIKLSQKSFDRT
                     MVLVPSPNGSVIIASDSLTIRPFCDSAWSKPPSPPHLQAQSVQHQPQMNVPLSQTPPN
                     TSSIPGQIPGVLGSTPLQFSPEVQAKLSPVQLELLQKLHLETKLNAEYTYMLAEQSLW
                     NYDNAIQGFRNSANNLPREAFI"
     gene            <848641..>850650
                     /locus_tag="KLLA0_C09823g"
                     /db_xref="GeneID:2892218"
     mRNA            <848641..>850650
                     /locus_tag="KLLA0_C09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452636.1"
                     /db_xref="GeneID:2892218"
     CDS             848641..850650
                     /locus_tag="KLLA0_C09823g"
                     /note="similar to uniprot|P14906 Saccharomyces cerevisiae
                     YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
                     Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP and
                     Lhs1p forms a channel competent for SRP-dependent and
                     post-translational SRP-independent protein targeting and
                     import into the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452636.1"
                     /db_xref="GeneID:2892218"
                     /db_xref="GOA:Q6CTV3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV3"
                     /translation="MPQNYDYDEASTTWPFFVLTVLFVAVTPVTLIELYRLIVGDSSD
                     KSSSSEWSQLHEKYTSEEVRKYRLANKKKRSKKGIYFITVGWVLISMLIYHIRSNDAI
                     YQIAAAAFDPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFV
                     MINKAYKALTDEITKENYRKYGHPDGPQSTSHGIALPKFLVEGGTSPFVVFAYFILLA
                     FVLPMVVSKWWSTSQEYTKHGIHSETASHFVDKMFNFKPSYVVVPDLIIKWISEAKEF
                     QLKFPELSSVDIANIIHSHVNREKTENEYARNYVLTKSSLLFHQLIEIASTFRNTEVA
                     LMALDTYKTVVQATPLSPHSQIFQLPNVDKEHFLDSTTDDICALGKLFTYPDDKIGKM
                     LGIKDETALNETLKVASRIPKLKLVKGSFKVRGSSLNTAEPGSTPHIQVKVLVRSPRH
                     KLFPNSLIPAEKIAGDDPLLLEQDPFEKLLEQPLLPETFAPLLPTKRRTCWYALVVSQ
                     KDGKIIQTPSLAQRLSLENLDVNFDKRVIKDLDKEFNAEDWTIGTFSIPFAQPAPKEE
                     GTYFFRVVIKSPDYFGSDLDFTVPLTVKNTPIETDPKKEILEELDSDDSGNEGEENTG
                     YSSEDFDESDGDDLEEDSDFTDIDTDTEDEHEATEETTEKSSKTD"
     gene            complement(<850737..>851228)
                     /locus_tag="KLLA0_C09845g"
                     /db_xref="GeneID:2892220"
     mRNA            complement(<850737..>851228)
                     /locus_tag="KLLA0_C09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452637.1"
                     /db_xref="GeneID:2892220"
     CDS             complement(850737..851228)
                     /locus_tag="KLLA0_C09845g"
                     /note="similar to uniprot|Q08689 Saccharomyces cerevisiae
                     YOR253W NAT5 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat- shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452637.1"
                     /db_xref="GeneID:2892220"
                     /db_xref="GOA:Q6CTV2"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV2"
                     /translation="MGRALVTIDNVYANNLGTFRKIIDVVLPVQYPGEYFEEVVDKNA
                     KGVFYAQLAYYGEIAIGAVKSRLIANKTGGVKPAGMYIEVLAVLEAYRGKTAGSLMLK
                     YIEDKCKESFQHDIYVHVATDNETAIEWYEKNGFSRDGDILENYYKNTTGSNDAFVYK
                     KSV"
     gene            <851501..>852649
                     /locus_tag="KLLA0_C09867g"
                     /db_xref="GeneID:2892228"
     mRNA            <851501..>852649
                     /locus_tag="KLLA0_C09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452638.1"
                     /db_xref="GeneID:2892228"
     CDS             851501..852649
                     /locus_tag="KLLA0_C09867g"
                     /note="some similarities with uniprot|Q12467 Saccharomyces
                     cerevisiae YPL168W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452638.1"
                     /db_xref="GeneID:2892228"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV1"
                     /translation="MLKCINYHKRTFHTTYFQLAKGNVSWNMALDPAIPKDRSVKAFK
                     TSLQHTIANNAWPSDSSRERRVLLELIAKFSIPHDTLKKQIKRLQLLILQKRISDDDI
                     HNAITKVNSNQIINVVTPKPINLQKELKNLEKTATFHEPRQRPKLQRPLHPTPSQHEV
                     GVKSSNNNVAHPKKDTETETITDKDIEALKKFLERAETQEKQIKKFVLEQQRKYKWSS
                     NQGPASRISSGSLLFQEHLPSVRLRKNSSVGSYLSKCERYIHPFAPTEVREILLYDVT
                     KSKEKIEPPESTILVHVQKKDLFAVVNGGRIAPDQLLAVINQYENGGWKLIGDVNRDT
                     YKIVFQKNYMRPALIETKGKIAITLFGITLGYIAVVQPLIDYINYFNR"
     gene            complement(<852807..>853379)
                     /locus_tag="KLLA0_C09889g"
                     /db_xref="GeneID:2891836"
     mRNA            complement(<852807..>853379)
                     /locus_tag="KLLA0_C09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452639.1"
                     /db_xref="GeneID:2891836"
     CDS             complement(852807..853379)
                     /locus_tag="KLLA0_C09889g"
                     /note="similar to uniprot|Q08687 Saccharomyces cerevisiae
                     YOR252W RBF17 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452639.1"
                     /db_xref="GeneID:2891836"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:Q6CTV0"
                     /translation="MPVTKSLGKIQKGLKGKKFTVHPKGRKFQQLNRATLREEKVQAK
                     KRAHNEKRSNELARMTFVQSAIKTDSLKEKEVFDYKETAVLIQEFIARDDNELNELKS
                     KRRQNRPPTGRQQLLQHKRDLEMEEFKSGFLCPDLTDPENVIFLRAWNQTFGGLSTLK
                     LIRINDKGEKVLGGTKPVKPIGELKDIEMN"
     gene            complement(<853608..>857963)
                     /locus_tag="KLLA0_C09911g"
                     /db_xref="GeneID:2891858"
     mRNA            complement(<853608..>857963)
                     /locus_tag="KLLA0_C09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452640.1"
                     /db_xref="GeneID:2891858"
     CDS             complement(853608..857963)
                     /locus_tag="KLLA0_C09911g"
                     /note="similar to uniprot|P14284 Saccharomyces cerevisiae
                     YPL167C REV3 Subunit of DNA polymerase zeta which is
                     involved in DNA repair required for mutagenesis induced by
                     DNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452640.1"
                     /db_xref="GeneID:2891858"
                     /db_xref="GOA:Q6CTU9"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU9"
                     /translation="MSDIFGSLDSSLDSNEINIQINNSDSYQCFPTLLDCKTSKSLPG
                     LRFVQVPVLRFYGCLSTGHKVLIHCHGIFPYIFIKYDGHSNDKASVIRNRCTSLHKIL
                     ETRMIETFTKTDFKEKLTSLKYIANVSVVKGVPFYGYHVGYEPYYKITLLNGSYSNKL
                     SELLRDGRIFTSKVDVFEAHIPYLLQMMADYNLFGCGWLKLSKCYFRQPVLLTDLDMN
                     EILHTDSLERFLKKHLHPNQNVLDIDPFHRIGKTFLEMDIIPQFILNREEIQFRDLHH
                     DFVELKKDLQTSDQGYVNSTKDIWKEIQLLRKRKGLAEYEGLKEIFRESQLQYNWKED
                     ERLVKHFDEAKKRMSSLFNKEKALNFDNFVDPFINENFFASTKDALQELWPKIPRNAS
                     SKVFCWSEVEFKLNNQYTSVREQKVASTNTKNIPILLNISSNESHSSHVSSKRAEESS
                     CHDDIANEAIARKLAKRKTSAIRKSTFRPMIRPSVTHANIKESLSANQIEEVQYNDPF
                     FSNPLDCKRLQTEMAGRVFKLSSDHILFKRSIRSNDTTATLTSSGSVYARSRWKYIRP
                     KPSFKRIANAMKPFKGKFSMVEGKTPELPFGYKFKSNKIEKNNNASNRMTHFTMEIHV
                     NTREDKFPDPKYDAVRMIFWKVQDGTFPFDLDITQEGVLIFLDDVSTENSWKTADPSV
                     HITAYYDELEMIYALEDLVRFFDPDILSGYEIHSSSWGYLIDRCHKGHDYDVEDELSR
                     VDYNQSSKKKDRWGYTHATAFSITGRQMLNIWRPLRSSLNLLDYTLENIAFHVLHQRL
                     PFYSYKTRTEFYESMDETSKRCLLFYWITRLRVNFKLLETQNIIGKTIEQARLIGIDF
                     YSVLYRGSQYKVESFLIRLCKSEQFILISPSRMQVRNQKALECIPLVMEPSSAFYKSP
                     LLVLDFQSLYPSIVMAYNYCYSTIIGRVESLNTKNNEIGITRYDIPEDLLTLISDYIT
                     ISPNGIVFVKKELRKSVLAKMLKDILDTRFLMKSTMKELNDEHNLINMLDNRQEALKL
                     LANVTYGYTSASFSGRMPCSDIADSIVQTGRETLERAIEVIETTKEWGAKVVYGDTDS
                     LFVYLPGKSKDEAFVIGRQIAEEITRQNPKPIELKFEKVYHPCFLVTKKRYVGFSYES
                     EYQKEPKFDAKGIETVRRDGTPAQQKIVEKALRIMFETTDLSMVKEYLIGEFDKIITG
                     RVNIQDFCFAREVKLGHYKSEKTAPPGAQIAMQMMEEDARTEPQYKQRVPYVVKMGKI
                     GETLSSRCLSPEAFLRSKTSRLDYTYYIVKNIIPPLQRFFQLVGVDIMDWYISMKHTL
                     NPLKVDSDDGSHEGRSLTSIVKGKSCLRCRKKVHPKFISPICGECRIDKSNTTLFLEE
                     SVRLKQSKMHSVMRTCQTCSYKFHKDAMAPLDQIALKCQSKDCPVYFSKFKYMNGLKD
                     NDMRDLLMGLIDLDY"
     gene            <858405..>858869
                     /locus_tag="KLLA0_C09933g"
                     /db_xref="GeneID:2891821"
     mRNA            <858405..>858869
                     /locus_tag="KLLA0_C09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452641.1"
                     /db_xref="GeneID:2891821"
     CDS             858405..858869
                     /locus_tag="KLLA0_C09933g"
                     /note="weakly similar to uniprot|Q12092 Saccharomyces
                     cerevisiae YPL166W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452641.1"
                     /db_xref="GeneID:2891821"
                     /db_xref="GOA:Q6CTU8"
                     /translation="MNNDNTKVYVRVAGKRPENFVETKPFIWDSRRDKILWTKISKID
                     SLEDMDWQELGADLGAPEPFLKKRSYTLFQNQLKVLSNQIDVTSNTRSSSESRNSVDN
                     NILQNLQASRIMNHKLDKTDNLANNQESSSELSNLSVSKSALEDALMDCLQL"
     gene            complement(<858858..>859961)
                     /locus_tag="KLLA0_C09944g"
                     /db_xref="GeneID:2892091"
     mRNA            complement(<858858..>859961)
                     /locus_tag="KLLA0_C09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452642.1"
                     /db_xref="GeneID:2892091"
     CDS             complement(858858..859961)
                     /locus_tag="KLLA0_C09944g"
                     /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
                     YPL165C SET6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452642.1"
                     /db_xref="GeneID:2892091"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU7"
                     /translation="MNAEVYINDKIEVKRTAYGGRACFASNSMLKGTHLLDLSQWIGS
                     SISHEFRKEVCHFCLKYDGGKPMKVRISWADLLKLDLNLLNHKLEKKYKGSGLWFCTE
                     ECKNFFLSGPNIVDLILNYEMILTHFQSIQGKSLCVETDTELYKDYDNKRMHQEIESC
                     WMDLESTWMPRVSKMKLAKATNQLPVIDEDHYSCIRFVIECLFNMTHLDRNSVKWNTW
                     EKLQSNEVEKIMRFPVLLEFQIKVFKWVYTLAPQYRYIMTTSVFRHILGSEYGNSFGI
                     WETSESDDDREYLGYMVHPEASYFNHSCVPNVEKKRVERVFQYILQTDVQKGEELCID
                     YKGILHLDVNRRRAILKDNWFFECKCSRCLSEL"
     gene            <860413..>861312
                     /locus_tag="KLLA0_C09966g"
                     /db_xref="GeneID:2892099"
     mRNA            <860413..>861312
                     /locus_tag="KLLA0_C09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452643.1"
                     /db_xref="GeneID:2892099"
     CDS             860413..861312
                     /locus_tag="KLLA0_C09966g"
                     /note="similar to uniprot|Q08686 Saccharomyces cerevisiae
                     YOR251C catalyzes transfer of the sulfane atom of
                     thiosulfate to cyanide to form sulfite and thiocyanate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452643.1"
                     /db_xref="GeneID:2892099"
                     /db_xref="GOA:Q6CTU6"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU6"
                     /translation="MTLYKLLTPKAFAELLSKETKRRIIPVDSTWYLPNLNRSGKQEF
                     LDEERLKGAVYFDIDGVKDMKSEYPHMLPDLSTFNKSMSELGLKKDDILVVYDRIGNF
                     SAPRCAWTLAVLGHDPVYLLNNFPALKLSGYPVETSKVTSFTPYEMSEYVSDVDLAEK
                     ETVSFEDMQKLVSTGDIKNYQVLDARSLQRFTGEAPEPRPGLSSGHIPGVQPLPFLEV
                     LNSDKTFTSDREEMLKKIQDFVSQTGNEFETDKPTIAMCGTGVTGVIIKTALEISGVK
                     NVRLYDGSWTEWVMKDGEVAKGS"
     gene            <861625..>862938
                     /locus_tag="KLLA0_C09988g"
                     /db_xref="GeneID:2892097"
     mRNA            <861625..>862938
                     /locus_tag="KLLA0_C09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452644.1"
                     /db_xref="GeneID:2892097"
     CDS             861625..862938
                     /locus_tag="KLLA0_C09988g"
                     /note="similar to uniprot|Q08685 Saccharomyces cerevisiae
                     YOR250C CLP1 cleavage/polyadenylation factor IA subunit
                     interacts with Pcf11p in the 2-hybrid system
                     cleavage/polyadenylation factor IA subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452644.1"
                     /db_xref="GeneID:2892097"
                     /db_xref="GOA:Q6CTU5"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="InterPro:IPR029007"
                     /translation="MEFVEFSEVSETTKTSSLPQGHEWTVQVPAGSKLTVIVKYGIAE
                     ILGTELANDVPYTFQGVIVNIYAIERSMIEWKCLEELEPKVSENKSYHAYIYNLNFAL
                     ERLRLSSFNGPRVLIVGNASTGKSSLAQMLCSYALKIRHYQPLLVNLNPQDGVFSLPG
                     SITATPISELLDVESSIWGQSITTGATKLHNKQPLVKNYGLENIRDNRPLYLSTITQL
                     ASGVQQRLKNDPIVRRSGVIIDTPKLSHLDTEDWSEVGHMIEQFDINAIVVCAESDDL
                     AIELSEVFRTKIGSIVRIPPPGSIIAIDDIMRRALQRVQIREYFYGTTETVLSPYTMG
                     AGFEELTVFRPRNISEYGEDKKDVDLTVFDKIEVNSSNLQHAIIAITNISRKESQDKL
                     NTASIIGYGLITEVNDSKKKLRVLLPVPSRIPDRAMILTEYRYLE"
     gene            <863101..>864906
                     /locus_tag="KLLA0_C10010g"
                     /db_xref="GeneID:2892227"
     mRNA            <863101..>864906
                     /locus_tag="KLLA0_C10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452645.1"
                     /db_xref="GeneID:2892227"
     CDS             863101..864906
                     /locus_tag="KLLA0_C10010g"
                     /note="weakly similar to uniprot|Q08683 Saccharomyces
                     cerevisiae YOR249C APC5 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452645.1"
                     /db_xref="GeneID:2892227"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU4"
                     /translation="MTVEFQKIRVVTGYDPYDLSCVALLVLYCLGEINLSLHNITRIL
                     QIVPNDELDSVGLPTLENLVLYLRKNEDSQTKASFKLINLIFSISSFNHIQELIHHLR
                     DAIIVSPDQQGVLSKFRRILCRSSVICELLPRVIIDSNISEFFVEDIHQIVESFQAFK
                     TRFLSCDISNIYREDINNSSNLTSRIFSHTHTNDCFPESPFITNQGIGNSLPWLIVSA
                     DKFKVILNYALQISMKDINLGSELAETIIRYTNLNDRTRFPDILLLEIVLLRKSKNYQ
                     GTIDKMYQYFDYCRNSNVSVSSSTNFSHICQTFTLSSLYQDHGSPEFALKTLHELIDT
                     IREKSDVHGLSHLWDILIHHLLLYPDESRVLQKSIYELLRPFNDKKNTSPEMLQYWYT
                     FQVAMNLHQNGYIPDILELATKVSALSNYGLMDHMNRVSTEVLLMTWSFVGFDDMACC
                     FGKPFLNNVKKHRQLTNVEKLLEDKYYSEAIKKVEALLNEVNAKNFSISFKFACTQMS
                     IRIMLAAGNAARAQPIIRQYIDKCRETKNDHELSKAILCMVRMLNGWQQYQDSYKLMN
                     SNLSILLQYSGSMKEEAKQLYKETSLALENKVGSE"
     gene            complement(<864922..>867036)
                     /locus_tag="KLLA0_C10032g"
                     /db_xref="GeneID:2892630"
     mRNA            complement(<864922..>867036)
                     /locus_tag="KLLA0_C10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452646.1"
                     /db_xref="GeneID:2892630"
     CDS             complement(864922..867036)
                     /locus_tag="KLLA0_C10032g"
                     /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
                     YPL164C MLH3 Protein involved in DNA mismatch repair forms
                     a complex with Mlh1p to promote meiotic crossing-over
                     mammalian homolog is implicated mammalian microsatellite
                     instability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452646.1"
                     /db_xref="GeneID:2892630"
                     /db_xref="GOA:Q6CTU3"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR028830"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU3"
                     /translation="MSIKRLDDTVSSRLKSHESVVSTTAVVRELVQNSVDADATKIKV
                     DINTERFIIEVQDNGFGITPSDLNLLGGHNITSKLESLQQLPAISSYGFRGEALHLML
                     QCSKVLIISKSKDYSGIWARELPAPAFISDEGKFPLMKGALSGTVIKISDVFYNYPVR
                     RKMMEKQSISDLVSAIRTEILTVLIKFPTLDVSVFINQQLRISSIAVSTLEPYPKQLD
                     TCFHNIFGEILPRKQLKFVSASFKSHTVKGIVSINPIQSKDYQYIFINGRKYSDSRFF
                     SAVNKLFQSTKYVEKNWDSYSVKSVGSPYSAYPLFIIGCEVPLEISDLIQDPGKTIFQ
                     SGTLKTLCPLILNVMSSFLKHLGYEPGVDVSTFDNSSYFETAHYFTNTKRVELAVKPT
                     NKHANGNRVHKPQNNKVLEILKSPPRTRGIFSRLLENTTGGRQCRDHHYDSEFDIQKL
                     NLAGTESSYLKNHAVSDFKLSKSQIRNFEVIQQVDLKFILVKSGGTLLMLDQHACHER
                     ILVENMLKETIIKCMNKCFNYVKLNMKMNISAEEAGWFRESIPEFDTWGIVLEIKDID
                     TRSSVIELIKAPEFFHEKIKHDSAFLKHVLLQHIYDLRSSKRRRITQLMKEQHSSNKW
                     WIMVPHMPRVYTEIINSKSCRSAIMFGTSLSRTECDVMISDLSKCQQPFHCAHGRPSV
                     VPIVEINDSIFGFSDKDYEILL"
     gene            complement(<867386..>868093)
                     /locus_tag="KLLA0_C10054g"
                     /db_xref="GeneID:2891866"
     mRNA            complement(<867386..>868093)
                     /locus_tag="KLLA0_C10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452647.1"
                     /db_xref="GeneID:2891866"
     CDS             complement(867386..868093)
                     /locus_tag="KLLA0_C10054g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452647.1"
                     /db_xref="GeneID:2891866"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU2"
                     /translation="MKFNKITPLILAPLAAAQYFNGSTTTLEPSNTENDQDISTYLTT
                     VTKEIVNTVYWTLENNEVSTQLSTLTTSDISSVVTTLQPTITTEDEDDSTLTVRDEST
                     STTTITIYSTVSLDDSTTLDVVNAGIDQIYADDVTSTLTSVLLQTVTLSDSAGNPTAT
                     TVSSLEKQVLLGDFSCVPETVTVTQYEATKYITVDSSTPTQADTSSGSDYEAAAVTVS
                     TQATSAIYSNTTSTDLL"
     gene            complement(<869088..>869918)
                     /locus_tag="KLLA0_C10076g"
                     /db_xref="GeneID:2892219"
     mRNA            complement(<869088..>869918)
                     /locus_tag="KLLA0_C10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452648.1"
                     /db_xref="GeneID:2892219"
     CDS             complement(869088..869918)
                     /locus_tag="KLLA0_C10076g"
                     /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
                     YPL162C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452648.1"
                     /db_xref="GeneID:2892219"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU1"
                     /translation="MQNDNECKLLGPVSIAIQLLMAFLIICSLLLKRQSEHPKRTWVV
                     WCYDVGKQILGALSIHFLNVLISVLKGSNSLEDAIIFIFRAGLKLMTKDGGSDSGDEC
                     DWFFLNLLLDTTVGIPILWCCLTFYEYILTAIGIENIESGNYFSESESHSSTAKREPL
                     FSAFLKQLTVFIVSLASMKGCLFLILLYFENVAEWLANWVLGWSDPWPNLQVFLVMFV
                     FPLLLNCFQCFCVDTIIKLPATNITAQNVDNFDQESLIESDGIYVTRTVSNKRYGTIV
                     "
     gene            complement(<870147..>871973)
                     /locus_tag="KLLA0_C10098g"
                     /db_xref="GeneID:2892224"
     mRNA            complement(<870147..>871973)
                     /locus_tag="KLLA0_C10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452649.1"
                     /db_xref="GeneID:2892224"
     CDS             complement(870147..871973)
                     /locus_tag="KLLA0_C10098g"
                     /note="similar to uniprot|P39011 Saccharomyces cerevisiae
                     YPL161C BEM4 Protein involved in establishment of cell
                     polarity and bud emergence interacts with the Rho1p small
                     GTP-binding protein and with the Rho-type GTPase Cdc42p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452649.1"
                     /db_xref="GeneID:2892224"
                     /db_xref="UniProtKB/TrEMBL:Q6CTU0"
                     /translation="MEYEQILFGLQPLLNAANPKDVPVQDVFLQSYITVLEQLAVHLR
                     AESNRDLIRETGLLSQLLRVLNSFLDYAFQESSKRIQFLQISSELVRSIANCLVDNDA
                     NREVFWNGDCTKHNEFIDYYAGRILGLFDEEDYVVKLQLRTVVLISNLAMDNDTYYER
                     AARRVAVPLFKLIISMKNVFLDEQYNLLVGTSFDLLCSFVDHKKFLSLVQLVSLSEVL
                     IQVCKCIESTSNIAVCNSGEIDTSKNDAQIEEVEDEEEDTFLPSLVNNISHCILKTSE
                     PEDYNFSDEVNTSILQHNLLTSLENLGSKEFDNQLIINREILSSIANVSSNKSYSNGK
                     DVDISIKLLQCHKSSYAAASALIVISNYVSDAQKANEINKKLSYDIIVKSSTTIRDPI
                     QFQGLLSLLRKLLKPDIIMFTPNETLAQLSQLLVICHDQSNYYQGLSPILEMLLQKLL
                     AVSTAKTLTTMIAAVPRFTEVLSNRGIILSCQAIDKLAKKRDLESPLSVDLLAKKVFE
                     YCKNITLDNLLQDPFTTFHILRSTGIYINETPTDEQDEVFDKYSDVIFKLLEASLSTK
                     SSTETAAKAIWNNGRYLAGMVIASKCSTIPKEVKDIAHQCFQ"
     gene            <872435..>873715
                     /locus_tag="KLLA0_C10120g"
                     /db_xref="GeneID:2891868"
     mRNA            <872435..>873715
                     /locus_tag="KLLA0_C10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452650.1"
                     /db_xref="GeneID:2891868"
     CDS             872435..873715
                     /locus_tag="KLLA0_C10120g"
                     /note="similar to uniprot|Q06640 Saccharomyces cerevisiae
                     YDR306C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452650.1"
                     /db_xref="GeneID:2891868"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT9"
                     /translation="MANKRRPKKVKPPYRKYVGGVGFTHTQGFSQIAEENDTTNIQKF
                     NELQINEIRNPSDSEESRLQGDSVRSDVTDYGGMKLPLEIFDLTISMMSPQDIRMNLV
                     LVCRAWYLICIPKLYRTPKLTSRNFLKFVETVLADRKRKTCEHVVHLDLSPIIQSGKN
                     SYVSKVLRRCSKNLVSFTAPQTSFGIAPLISLKSCQNLKYLDLGLVSETVNLKELFLA
                     IKNFHELTHLSFPRSSIQCDGYRDFQWPPNLQYLKLSGGITNEFVQETIFPNTIKILE
                     FSFCPQINEHSIYTVLAKIGDNLTQLYFHYPMPALKDNSLDHVFRYCSNLKVLQLMID
                     YCTRWVFSEYFFTQLPYPRPLRTLILECSGHLGQTFKVHPDDLTIAICEGRLPCLKII
                     RISSRLGWDSQGDDVGDLVSSLEEENGGSMYITY"
     gene            <873948..>874630
                     /locus_tag="KLLA0_C10142g"
                     /db_xref="GeneID:2892626"
     mRNA            join(<873948..874004,874115..>874630)
                     /locus_tag="KLLA0_C10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452651.1"
                     /db_xref="GeneID:2892626"
     CDS             join(873948..874004,874115..874630)
                     /locus_tag="KLLA0_C10142g"
                     /note="similar to uniprot|P49775 Saccharomyces cerevisiae
                     YDR305C HNT2 Dinucleoside triphosphate hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452651.1"
                     /db_xref="GeneID:2892626"
                     /db_xref="GOA:Q6CTT8"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT8"
                     /translation="MTAGSIFFSKFVVTKQVFYKTKYSYALVNLKPLFPGHVLVVPLR
                     TECLSLSDLTPEENKDYFATLQVVHQFISDEFHADSVNVAIQDGPEAGQTVPHLHTHI
                     IPRHKVNNIGDKVYDKLDAWTFEEQLAKWNERRSDYASADTSIIKRELIVPDVQREPR
                     SMDEMSAEAHALSQKLNLFLEQNPKLKEYY"
     gene            complement(<874796..>875173)
                     /locus_tag="KLLA0_C10164g"
                     /db_xref="GeneID:2892010"
     mRNA            complement(<874796..>875173)
                     /locus_tag="KLLA0_C10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452652.1"
                     /db_xref="GeneID:2892010"
     CDS             complement(874796..875173)
                     /locus_tag="KLLA0_C10164g"
                     /note="similar to uniprot|Q75EY2 Ashbya gossypii AAL054W
                     AAL054Wp and some similarites with YHR059W uniprot|P38783
                     Saccharomyces cerevisiae YHR059W FYV4 Protein of unknown
                     function required for survival upon exposure to K1 killer
                     toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452652.1"
                     /db_xref="GeneID:2892010"
                     /db_xref="GOA:Q6CTT7"
                     /db_xref="InterPro:IPR019083"
                     /translation="MLFRRLFSSSVIVQAASKTSLRKTVKPSEEIPDVNAFLGRIGRK
                     CDEFTDTYENKWDNLFTWGGPVLKEKGIPIQQRRYILNQVEKLRKGEEIKEIKKGKKS
                     FFGGERKRKETIAKWRAEQRNAE"
     gene            <875492..>876298
                     /locus_tag="KLLA0_C10186g"
                     /db_xref="GeneID:2892222"
     mRNA            <875492..>876298
                     /locus_tag="KLLA0_C10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452653.1"
                     /db_xref="GeneID:2892222"
     CDS             875492..876298
                     /locus_tag="KLLA0_C10186g"
                     /note="similar to uniprot|P38782 Saccharomyces cerevisiae
                     YHR058C MED6 RNA polymerase II transcriptional regulation
                     mediator RNA polymerase II mediator subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452653.1"
                     /db_xref="GeneID:2892222"
                     /db_xref="GOA:Q6CTT6"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="InterPro:IPR016612"
                     /translation="MSLPPLDELQWKSPEWIQTFGLHTDNVLDYFSESPFFDKTSNNQ
                     VVKMQQQFSQQSQVPGSMPLGSSSGIGAAAGAGTVSPSDRSLIWERYPVHAMLEKELM
                     KMKGIEYILVLVREPDLWIIRKQQRDGPTKTTTLRDYYVIGSAVYQSPTVYKIIQNRL
                     LSTNYHLSHSLSQLNKLVEFHPAQGASFLRPEDPLCSSVAAATTSGSTASHTVASSVS
                     VPETGPINAETSGATAAATSIDPDRRQDSFNTEIMDKLMATSIKANPVYI"
     gene            <876495..>877100
                     /locus_tag="KLLA0_C10208g"
                     /db_xref="GeneID:2892230"
     mRNA            <876495..>877100
                     /locus_tag="KLLA0_C10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452654.1"
                     /db_xref="GeneID:2892230"
     CDS             876495..877100
                     /locus_tag="KLLA0_C10208g"
                     /note="similar to uniprot|P35176 Saccharomyces cerevisiae
                     YDR304C CPR5 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) of the endoplasmic reticulum catalyzes the
                     cis-trans isomerization of peptide bonds N-terminal to
                     proline residues transcriptionally induced in response to
                     unfolded proteins in the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452654.1"
                     /db_xref="GeneID:2892230"
                     /db_xref="GOA:Q6CTT5"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT5"
                     /translation="MKLLIQFIAVLSALAAFVLADPTITHKVYFDIEHGDESVGRIVI
                     GLFGEVAPRTVQNFFELSISEDPKMGYVKSIFHRVIPQFMIQGGDFTNGNGTGGKSIY
                     GDTFDDESFEVKHDKPGRLSMANRGRNTNGSQFFITTVPTPWLDGKHVVFGEVLEGMD
                     VVSYIENVPRNRSDRPKQDVRIAGSGEVETVPPSDLDNDEL"
     gene            <877485..>878324
                     /locus_tag="KLLA0_C10230g"
                     /db_xref="GeneID:2891852"
     mRNA            <877485..>878324
                     /locus_tag="KLLA0_C10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452655.1"
                     /db_xref="GeneID:2891852"
     CDS             877485..878324
                     /locus_tag="KLLA0_C10230g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452655.1"
                     /db_xref="GeneID:2891852"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT4"
                     /translation="MSLLIPVRRFSGNAVLRTAITNLSARKQGTGTGPFVELPDLQPL
                     HDSLLLRIPSSSSVVGKLNNITVIDSSNELKDIELTKLFAIQKQKDTGFVTLSTADEP
                     VNLICTASTRLNNVTVINLDDYEQGWTVNDPLNNILCYSGDVSINGNKIVGRGIFALN
                     GQGSSWHIMLKESEQIVAPATSVLGFSSTVSVSPDKITSPLHFTIPTFFALPTGVSTW
                     IHSNITPKYEALRFQYNKLFRKNKITASLQGPGIVILQHQNTNYSRNILYTDEALLEA
                     LKK"
     gene            complement(<878425..>879078)
                     /locus_tag="KLLA0_C10252g"
                     /db_xref="GeneID:2892225"
     mRNA            complement(<878425..>879078)
                     /locus_tag="KLLA0_C10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452656.1"
                     /db_xref="GeneID:2892225"
     CDS             complement(878425..879078)
                     /locus_tag="KLLA0_C10252g"
                     /note="similar to uniprot|Q06636 Saccharomyces cerevisiae
                     YDR302W GPI11 ER membrane protein involved in a late step
                     of glycosylphosphatidylinositol (GPI) anchor assembly
                     involved in the addition of phosphoethanolamine to the
                     multiply mannosylated GPI intermediate human PIG-Fp is a
                     functional homolog; GPI11 ER membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452656.1"
                     /db_xref="GeneID:2892225"
                     /db_xref="GOA:Q6CTT3"
                     /db_xref="InterPro:IPR009580"
                     /translation="MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVR
                     KSWTLIPFHLLALLYWFLKYTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLN
                     WLLVFITLGACLLLSIPCLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCN
                     FKVGYFKKYFISVVIGCWISCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIGGYI"
     gene            complement(<879403..>883305)
                     /locus_tag="KLLA0_C10274g"
                     /db_xref="GeneID:2892237"
     mRNA            complement(<879403..>883305)
                     /locus_tag="KLLA0_C10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452657.1"
                     /db_xref="GeneID:2892237"
     CDS             complement(879403..883305)
                     /locus_tag="KLLA0_C10274g"
                     /note="similar to uniprot|Q06632 Saccharomyces cerevisiae
                     YDR301W CFT1 Functions in cleavage of 3'-ends of pre-mRNAs
                     prior to polyadenylation 23.5% identical to the 160-kDa
                     subunit of mammalian cleavage and polyadenylation
                     specificity factor (CPSF-160) Component of pre-mRNA
                     cleavage factor II (CFII) 150-kDa protein associated with
                     polyadenylation factor 1 (PF I)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452657.1"
                     /db_xref="GeneID:2892237"
                     /db_xref="GOA:Q6CTT2"
                     /db_xref="InterPro:IPR004871"
                     /translation="MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSR
                     AQKLVLAYEWKLAGKIIDMQLLPQIGSPLKMLAILSSKSKVSLVRFDPVAESLETLSL
                     HYYHDKFVNLSTSSLKTESIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENG
                     IKEPMAKRLKRNQGITSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAW
                     CGNEKVLGNTMRYMVLSLDVEDEKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLY
                     ISASGALQSCIRLNTFATSSINTRITDNSDMNIFLSKSSIYFYKALKRHDLLILIDEN
                     CRMYNIITESEGNLLTKFDCVQVPIVNEIFKNSRLPLSVCGDLNLETGRVLIGFLSGD
                     AMFLQLKNLKVAFAAKRQLVETVDDDDDEYSALYGESQNNTHTRIVETQEPFDISLLD
                     SIFNIGPLTSLTIGKVASVEPTIQRLPNPNKDEFSIVATSGVGRGSHLTALHSTVQPH
                     IEQALKFTSATRIWNLKIKGKDKYLVTTDADKEKSDVYQIDRNFEPFRAQDFRKDSRT
                     IGMETMDDDKRILQVTSGGLYLFDVDFKRLARLTIDIEIVHACIIDPYILFTDARGNI
                     KIYQLDSKNKKKFIKFKLPEALNEIIITSGSIFKSNICNKFLHGLENSSQEQLLFTFV
                     TGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIPEEMNPDPSIKQIMLNRLGHH
                     KKEEFLTILTFGGEIYQYKKSTKHSGKLLKCKSHPLITGAPNNAYPQGVNKIERVAHY
                     FPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMARWGKNSVMCVDNIKNA
                     RVMKLDPECYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMYIISYTKFIEYQALS
                     EDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVNDIKTMLIQLNSK
                     TRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFKQLFEEEIRGS
                     VNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSNLMIIGDSM
                     QGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHVLRYAPD
                     EANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKTSNYIALGCQTDGSIFRMIPL
                     NEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYIHL
                     PITKRTTIENRVGRHASTELWHDLIDIEFSLRSLTNSN"
     gene            <883644..>884900
                     /locus_tag="KLLA0_C10296g"
                     /db_xref="GeneID:2891953"
     mRNA            <883644..>884900
                     /locus_tag="KLLA0_C10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452658.1"
                     /db_xref="GeneID:2891953"
     CDS             883644..884900
                     /locus_tag="KLLA0_C10296g"
                     /note="highly similar to uniprot|P32264 Saccharomyces
                     cerevisiae YDR300C PRO1 Gamma-glutamyl kinase catalyzes
                     the first step in proline biosynthesis and to YHR033W
                     uniprot|P38690 Saccharomyces cerevisiae YHR033W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452658.1"
                     /db_xref="GeneID:2891953"
                     /db_xref="GOA:Q6CTT1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT1"
                     /translation="MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGH
                     KVIIVSSGGIAVGLKTMNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQI
                     LITRNDIVDWTQYKNAQNTISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAAL
                     TGADYLFLLTDVDCLYTDNPRANPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMK
                     TKLIAAELATNAGVHTIIMKSDTPENISKIVLYMQERDDGVNELTQDLADLQLTEMQS
                     LVNNHVPLHTRFIANSNHHHLKNRQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLP
                     AGVIEVQGSFHEHECIDIKLGVRDSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQS
                     DQIEDILGYADSEYVAHRENLAFPPH"
     gene            complement(<885031..>886032)
                     /locus_tag="KLLA0_C10318g"
                     /db_xref="GeneID:2891957"
     mRNA            complement(<885031..>886032)
                     /locus_tag="KLLA0_C10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452659.1"
                     /db_xref="GeneID:2891957"
     CDS             complement(885031..886032)
                     /locus_tag="KLLA0_C10318g"
                     /note="similar to uniprot|P38768 Saccharomyces cerevisiae
                     YHR034C PIH1 Protein of unresolved function may function
                     in protein folding and/or rRNA processing interacts with a
                     chaperone (Hsp82p) two chromatin remodeling factors (Rvb1p
                     Rvb2p) and two rRNA processing factors (Rrp43p Nop58p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452659.1"
                     /db_xref="GeneID:2891957"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:Q6CTT0"
                     /translation="MSFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVINPGTTSLSS
                     NAKIFINICHNDQIPLPEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVS
                     DCCINTKCVSWIQHDLQLREIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPEL
                     EILREDLTENYEETINDLVNREQKEPVSIIEKRRDFLAEDEPSTGELPPLIPIDQSSR
                     RKPLIEEIEDLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFLLKIEVTSELNSSL
                     DYNIKYDAKSNKLIIKNTNLGIYPEKKLKVPLPDIFNNPPKLECFFVKPERRLIIFL"
     gene            <886390..>888015
                     /locus_tag="KLLA0_C10340g"
                     /db_xref="GeneID:2891830"
     mRNA            <886390..>888015
                     /locus_tag="KLLA0_C10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452660.1"
                     /db_xref="GeneID:2891830"
     CDS             886390..888015
                     /locus_tag="KLLA0_C10340g"
                     /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
                     YDR338C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452660.1"
                     /db_xref="GeneID:2891830"
                     /db_xref="GOA:Q6CTS9"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS9"
                     /translation="MNQESEYLCDSMDRPRYDTINDNTRYESDGESASSGDAIDNRYR
                     LMSPDADRDDFIDEDFIEDLTAPTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVI
                     GHVCKSSDALASASLAVMTYNITGLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRC
                     AAMIMTGIFPVIISWWFSASWLGYVIAEQDILPEIQLFLRIISFGLPGLIFFETGKRF
                     LQSQGHFQAGTYSLLITVPVNIILVYSFTRYIGYAGAPLGIAISHWFMALMLLVYCKF
                     WRKETLICWYPMFSSMFHFKRLFCSWKPMWNLAFPGLLMIEAEYLSFEVLTIMSTYLG
                     VKAIAAQSVVSNIGSLIYQIPFAMGCVVSTRVANYVGTESVNNAKICINTSYVIAAFV
                     GIANCCLILTGDKNLAYLFTKDKEVVELYRHVAPILAVNQLYDAFTTFSAAILRAQGR
                     QQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGLWYGCGTGILLLAFALSYCVFNSN
                     WENIVEECHRREKEENEVDLESMASNMSNIIDV"
     gene            complement(<888123..>889703)
                     /locus_tag="KLLA0_C10362g"
                     /db_xref="GeneID:2892016"
     mRNA            complement(<888123..>889703)
                     /locus_tag="KLLA0_C10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452661.1"
                     /db_xref="GeneID:2892016"
     CDS             complement(888123..889703)
                     /locus_tag="KLLA0_C10362g"
                     /note="similar to uniprot|Q66RD8 Saccharomyces cerevisiae
                     YDR299W BFR2 Essential protein possibly involved in
                     secretion multicopy suppressor of sensitivity to Brefeldin
                     A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452661.1"
                     /db_xref="GeneID:2892016"
                     /db_xref="GOA:Q6CTS8"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /translation="MGKKSLAEQIADIANKPQVEDFDIENDEGVFQHGGSDSDVSSGD
                     ESEEELKKQHYVAVGKSKLRNVVDQGLAVKDKKYVGSKGSRAELFNDEEMDAPEQGES
                     ESEAESGSEESDAVSFRSDSEDVSESEATSESEIEKDREEDEETAMKKEKLAKIVQTQ
                     TKQVINNLAHSAQRDASKGYAILQQNKFFDKILDSRIKLQKALSASNQLPLSQQSWDE
                     LLDENNSKLLTSTFKVLEKVLTQCVTVRHKFQIGDHINQSENPSDFDNSKKRSFKELV
                     HETVTLDSDLKSYRSAVLNKWSAKVSASSGKSLLQASKFKAINQSADVQVDNQLADMP
                     RLLKRTKLNRSNTKPLLFDEDLQKGLLKELQLEENVEGDIEEENNLDIPKNYDPRRKD
                     NNALDFTQNPYIYDDEDFYRVLLNDLVEKKISNSQQSNGVTLAITSRSENKLKKNIDT
                     KASKGRKLNYSIQEPIANYEASVNTGYKWSDEQIDEFFAGLLGQKINFNEDDELEADT
                     MHNEEDEEIKNDDIQIFG"
     gene            <890604..>891224
                     /locus_tag="KLLA0_C10384g"
                     /db_xref="GeneID:2891844"
     mRNA            <890604..>891224
                     /locus_tag="KLLA0_C10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452662.1"
                     /db_xref="GeneID:2891844"
     CDS             890604..891224
                     /locus_tag="KLLA0_C10384g"
                     /note="uniprot|O74190 Kluyveromyces lactis KLLA0C10384g
                     ATP5 ATP synthase subunit 5, mitochondrial precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452662.1"
                     /db_xref="GeneID:2891844"
                     /db_xref="GOA:O74190"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR020781"
                     /db_xref="InterPro:IPR026015"
                     /translation="MFSRVFVRSMAASAKAGVKPPVQLFGLDGTYATALFTAASKTTS
                     VEAAASSLNALKETVAKDTKLTSILENPALSAEDRNIVVDTLSKKINLDQSVQNLLKV
                     LAENNRLSLLEHVTSQFSKLTDAYHGLVQATVTTAQPLDSKLFKRVEKALAASSLVGK
                     GKSLKLENVVKPEIQGGLIVEVSDRTVDLSIASRINKLNQVLREAI"
     gene            complement(<892040..>893059)
                     /locus_tag="KLLA0_C10406g"
                     /db_xref="GeneID:2891958"
     mRNA            complement(<892040..>893059)
                     /locus_tag="KLLA0_C10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452663.1"
                     /db_xref="GeneID:2891958"
     CDS             complement(892040..893059)
                     /locus_tag="KLLA0_C10406g"
                     /note="similar to uniprot|P38992 Saccharomyces cerevisiae
                     YDR297W SUR2 Sphingosine hydroxylase has a role in
                     sphingolipid metabolism catalyses the conversion of
                     sphinganine to phytosphingosine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452663.1"
                     /db_xref="GeneID:2891958"
                     /db_xref="GOA:Q6CTS6"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS6"
                     /translation="MANIVESAVQHLYLQVKDAMDVSFMNSKAPPASVITKKQDILPW
                     ISDGKLALALPVVAYWLYSMFFHYIDTNEVFEQYRIHPSEEVQQRNKASRLEVLKEVI
                     LQHFIQTFTGLGMLYLDPVPTSGFEKYEMWKWRQSLPFFVPSVFIKFMYCYGWSMIRI
                     FIGFCIVDSWQYWLHRVMHMNKTLYKKFHSRHHRLYVPYAYGALYNSPVEGFLLDTLG
                     TGIAAIVTQLNHTEQVVLYTFATLKTVDDHCGYALPLDPFQWLFSNNAVYHDIHHQSF
                     GIKSNFSQPFFTIWDKFCDTKYHGFEEYEKKQRRVTIDKYKEFLNKRKLEHQAKLKAM
                     KEKMS"
     gene            complement(<893936..>894595)
                     /locus_tag="KLLA0_C10439g"
                     /db_xref="GeneID:2891994"
     mRNA            complement(<893936..>894595)
                     /locus_tag="KLLA0_C10439g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452665.1"
                     /db_xref="GeneID:2891994"
     CDS             complement(893936..894595)
                     /locus_tag="KLLA0_C10439g"
                     /note="similar to uniprot|Q06630 Saccharomyces cerevisiae
                     YDR296W MHR1 Protein involved in homologous recombination
                     in mitochondria and in transcription regulation in nucleus
                     binds to activation domains of acidic activators required
                     for recombination-dependent mtDNA partitioning"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452665.1"
                     /db_xref="GeneID:2891994"
                     /db_xref="GOA:Q6CTS4"
                     /db_xref="InterPro:IPR024629"
                     /translation="MSKHLAITKFRPANWLQKAGYAPQVFLFRNLESGQVLYSQFPTF
                     SWKQIDTNFQRPNWENKKPSTRRDIWKCMAVVDLPDYDKSVKVYQNLCRLRYLRDVTF
                     SKQAKDMRKKNESGHTWYSSQYRPTYSQEAVADLRECLLKLKDVQSSIKVHWEDEWRM
                     GDKEKYWNPVLPELNHTTLERLGNVSREESAILKELGERAKEEFARVRQQESAAQNIS
                     L"
     gene            <895022..>897010
                     /locus_tag="KLLA0_C10461g"
                     /db_xref="GeneID:2891807"
     mRNA            <895022..>897010
                     /locus_tag="KLLA0_C10461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452666.1"
                     /db_xref="GeneID:2891807"
     CDS             895022..897010
                     /locus_tag="KLLA0_C10461g"
                     /note="weakly similar to uniprot|P38769 Saccharomyces
                     cerevisiae YHR035W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452666.1"
                     /db_xref="GeneID:2891807"
                     /db_xref="GOA:Q6CTS3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS3"
                     /translation="MFELNYGAVPTSRTDCLARVLDCGDDNRGSISAICEPDLTIDGN
                     SSLASSENYTNCKICGGFANFLCSRDSRAGWFCSFCNAYNELGNIPLSSSYLKHLGTA
                     AVPTHSKFAIIIDLNCEFEENLDALKMLQFGSVQSLALITIEDGSVTIHTDGSHITVD
                     AESSSCISHLKKLDTEWFIAKYGLLVRKIWTDQISFGAKLAELLCQRTRSKKRCRRNT
                     ALAIFLAQCLNPSQSIAFVFGPCTVAPGKVISMDRKNHIRQHRNIEEDKDVKYWKPSR
                     EFYNKMSKSLKFAPCTVFVASMDQVGIWEMRSCLNNFIQYESFNDRNFIYDWQAYIQG
                     KGCYEITRIVIKTSNKLLLNGIFGPVSSLKDKDTHVSDTPKGFGGSGTFRYKGPSSNL
                     PSILISLSVDTSRSAAEALQEMPDKFSFQMECYYKHLNQEYVSVETKFIPSTTLPGEH
                     LLTQNFHWDIMAGSIMKKISFAVLFQGKFYDYDLRWWTLEIVKLLKSLNAIDVPGIKS
                     LQEVTYFMQRSTLLRKRNTSPDEWIVYHWTILNSPLSHIFKMVRPQVYSTTGLIQNTT
                     DILNYAEPLLVDGGNVLVVRDTSVGDSRVDSLKAAADTIYHDGSRFPKPWYRETKPGA
                     SQDRFVIARLGLTAEHSLHSDDLTLDKYMALFKSKSTA"
     gene            <897356..>899260
                     /locus_tag="KLLA0_C10483g"
                     /db_xref="GeneID:2891955"
     mRNA            <897356..>899260
                     /locus_tag="KLLA0_C10483g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452667.1"
                     /db_xref="GeneID:2891955"
     CDS             897356..899260
                     /locus_tag="KLLA0_C10483g"
                     /note="similar to uniprot|Q06629 YDR295C Saccharomyces
                     cerevisiae YDR295C HDA2 Subunit of a possibly tetrameric
                     trichostatin A-sensitive class II histone deacetylase
                     complex that contains an Hda1p homodimer and an
                     Hda2p-Hda3p heterodimer; required for the activity of the
                     complex; has similarity to Hda3p; Ploidy-related"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452667.1"
                     /db_xref="GeneID:2891955"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS2"
                     /translation="MNSTSNRTQVFYIPVGLTQVQKDLLEILISIHAESFVSCVDKRL
                     LPELQSKLEKKGTNLKRDLSMTALTDVQLTEWFFENIRAVSNHPCLLVEHYMPRQFLL
                     MEPTERLIYTSDKFGKLNLMVDLLLNRKDKSRPLQVAIISHSVKELDLIEGVMLGKVA
                     KLKRLSGTSLFDEKHEYDDQTSGSRTTNGENSSSSGSVAPEQIGKSKDEYNYSKSRRK
                     NNISQLDWLFLATTTHLTHSEDLLSRYNLDLIISFDPMLDESLPSIFKVRKNGRKTPL
                     FKLLVQDSPDHYLLSKKKPTTTSEKLILDSIVHFLKYRADIKDLISLQQYENIIDSLI
                     KETDPGEFLPSVNPGSSRNNDDLIPFLTNPMELMPLTYGKYELRLQSGPMDIKNYQYI
                     LKTLTAERLKQCHVEYEEREKLVLKTRLKETKRLNDFDDLKVNIGQHFKKLKENETKI
                     NDSEKRVERTRSELEVLEERLKSLVERKSELVRLLTLEDIAKEIENQKQQHTKLSDEV
                     SSFKKSNDEESFKNDDLRSSYQQKSSEAASEVLKTSALKAEKEELERQLNGPFTKWEL
                     IILQEKEAQLKSSLRKMVQQSQFLIQYMNRIQGQYNIENEPAKKSSPATNNSSRYTTR
                     TTRATSPTYT"
     gene            <899784..>901532
                     /locus_tag="KLLA0_C10505g"
                     /db_xref="GeneID:2891993"
     mRNA            <899784..>901532
                     /locus_tag="KLLA0_C10505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452668.1"
                     /db_xref="GeneID:2891993"
     CDS             899784..901532
                     /locus_tag="KLLA0_C10505g"
                     /note="similar to uniprot|Q05567 Saccharomyces cerevisiae
                     YDR294C DPL1 Dihydrosphingosine phosphate lyase regulates
                     intracellular levels of sphingolipid long-chain base
                     phosphates (LCBPs) degrades phosphorylated long chain
                     bases prefers C16 dihydrosphingosine-l-phosphate as a
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452668.1"
                     /db_xref="GeneID:2891993"
                     /db_xref="GOA:Q6CTS1"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS1"
                     /translation="MGKMSFIEGLQKRFFLGYSYKYNTFELDPIILATSIKVAVLDYF
                     RNTPWYWIIRDAVFYHLLFNVLSRIILYIRGYGLLTSISKLFHYASRRLFEVLLSLPM
                     VRGSVDKEVSKVLATIEKDMIKNDANLKDFPELPRTGLSEADVLKELDKLNSVLKHSD
                     WENGKVSGAVYHGGDDLIDLQSKAFKKFCVANQLHPDVFPGVRKMEAEVVSMVLNLFN
                     APPTGCGTTTSGGTESLLLACVSAKMLGLRYKGITEPEIIIPKTAHAGFDKAGYYFGI
                     KIHHVDLDPVTFQADVKQMRKLINRNTVMLAGSAPNFPHGIIDDIVSIGKLGETYKIP
                     VHVDCCLGSFIVAFMSKAGFNDVPLFDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNP
                     ELRKQQYYVSTEWTGGLYGSPTLAGSRPGALVVGCWATMVHVGADGYINSCKDIVGKA
                     RELKEFIQKEIPELQILGDPLCSVISFTSNKIDIYELSDTLSKSGWHLSALQNPSSIH
                     LALTKLSLKSVDELKHLLKSTVDKMKQSPDAKPSSDGTSALYGVAGSVKTVGVADRLI
                     EGFLDSLYKLEPEHAT"
     gene            <901896..>903242
                     /locus_tag="KLLA0_C10527g"
                     /db_xref="GeneID:2892258"
     mRNA            <901896..>903242
                     /locus_tag="KLLA0_C10527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452669.1"
                     /db_xref="GeneID:2892258"
     CDS             901896..903242
                     /locus_tag="KLLA0_C10527g"
                     /note="similar to uniprot|P38770 Saccharomyces cerevisiae
                     YHR036W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452669.1"
                     /db_xref="GeneID:2892258"
                     /db_xref="GOA:Q6CTS0"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:Q6CTS0"
                     /translation="MEEFNALSLTSSCQDDTLEESDLLAMSNLSISERKPMPEELINK
                     FLPYTPPCPSPLRATVSIPKSDHDDLMEIDEIYDIAGNEDKKIQGTQNGKMKDGVGED
                     LLVEDTEDTYLDSKGEQTGLIKTLLSPTSLGIALATRDLENKPEPSNDESANAATEIP
                     VEPINSKLDSTVGSSSTSTSIHDLPSVSEEKLHSRYPDSQKPWQIQVQNHHYYYMVPD
                     RTPQSNEFYHETSMPQTSEHLDRKELPLPWSSESNPASKASYAFTTYLQMALNIITVM
                     IICSTITAFAKAVRTDIKSTWEHRKLELDFESANCKVEYLANHCNQDEVVPALLEQCN
                     QWGKCMNRNNDIYFRARTSLGARLFGEIINSLIEPLGWKALIVILLTLAIWCFSSNFL
                     LGFMRAKSYYGTPTPHTQLTHSSQPLQPLRPTESMNNITKGPHPNSMKQLEPPAAS"
     gene            <903888..>905618
                     /locus_tag="KLLA0_C10549g"
                     /db_xref="GeneID:2892659"
     mRNA            <903888..>905618
                     /locus_tag="KLLA0_C10549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452670.1"
                     /db_xref="GeneID:2892659"
     CDS             903888..905618
                     /locus_tag="KLLA0_C10549g"
                     /note="highly similar to uniprot|P07275 Saccharomyces
                     cerevisiae YHR037W PUT2 delta-1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452670.1"
                     /db_xref="GeneID:2892659"
                     /db_xref="GOA:F2Z666"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:F2Z666"
                     /translation="MLSSRIQLLRSSKRCVAQLSHIQPPKQIGNEPVKAFGSKDLVDW
                     DLLRASLSKFKNSSLDVPLVINGERIYYNDDGGKRGIFQQLNPANHSEVLANVTQATN
                     EDVKAAIQASKQAKDKWYKLPYYERASVFMKAADLICTKYRYDMLAATMLGQGKNVYQ
                     AEIDCITELADFFRFNVKYANELYAQQPIESSPGVWNRAEYRPLEGFVYAVTPFNFTA
                     IAGNLIGAPALMGNTVVWKPSQNANLSNYLLLTVLEEAGLPNGVVNFVPGNAVEVTKE
                     VLSDSEFAALHFTGSTAVFKQLYGDIQKGVVNGLYRDYPRIVGETGGKNFHLIHPSAN
                     IPHSVLSTLRGAFEFQGQKCSATSRVYLPESKSEEFFRDLGGVLSEVQPVNTSASKIN
                     GGDLHGFIGPVIHEGSFDKLAKVIDDAKNDPELEIVFGGFHDKSKGYYIQPTIIKTTN
                     PRHPYLSQEFFGPILTVYEYPDAKFEDVCELVDSTSQYGLTGSIFARDREAIKIADEK
                     LKYSAGNFYINDKSTGAVVAQQWFGGARMSGTNDKAGSGNILNRFVSVRNIKENYYEL
                     TDYRYPSNYE"
     gene            <906848..>910381
                     /locus_tag="KLLA0_C10571g"
                     /db_xref="GeneID:2892622"
     mRNA            <906848..>910381
                     /locus_tag="KLLA0_C10571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452671.1"
                     /db_xref="GeneID:2892622"
     CDS             906848..910381
                     /locus_tag="KLLA0_C10571g"
                     /note="similar to uniprot|P24276 Saccharomyces cerevisiae
                     YDR293C SSD1 Protein with a role in maintenance of
                     cellular integrity interacts with components of the TOR
                     pathway ssd1 mutant of a clinical S. cerevisiae strain
                     displays elevated virulence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452671.1"
                     /db_xref="GeneID:2892622"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR8"
                     /translation="MPEQERFVQTTGGKGTPKQIHIAHRKSPSELTNLMIEQFTLQKQ
                     IENNSSGGNLGVQGQSAANFLPQPPNVQYQLSPNSGNRKGRSHSRSGSAFYNNNDHKQ
                     NPAAGGHRRTGSQTSVYGHSRRQSIGLNEAKRAAAEEQAKRESGPQIKIDNVQDIPKL
                     VDENEQTSFKFPGSPTTESKNLGHRRTQSNMSPNRSFQFPPAKLNQKENNDDFIPVGT
                     PHRRTNSKNEGIDGNWRLQQQQQQVSPFHHSRTHSREYSGHPGLEPPPVFQPGHKSRG
                     SNASSHSFTSANGQQNSNGRKSLFAPYLPQANIPQLIEEGKLVAGILRVNKKNRSDAW
                     VSTNGVLDADIFICGSKDRNRALEGDLVAVELLMVDDVWESKKEKEEKKRRKDASTQQ
                     DIIPLDSKDDYHNDASTSIVTSASCSSENKGSDATLGSSSGSIKRRGSLKQRPTQKKN
                     DDVEVEGQSLLLVEEEEINDDYRPLYAGHVVAVLDRIPGQLFSGTLGLLRPSQQANND
                     VNKPNKPKIVWFKPTDKKVPLIAISIEQAPKDFVENADKYLNKVFVASIKRWPITSLH
                     PFGTLVSQLGDVNDPKTEIDSILRDNNFLSDEYLDPQDRTKERDSFAPVLLSEEQSKT
                     RRTYENVIAISETGEVSDYAVHLRDTDNGNLELGFHVVDVTVHIEEGSSLDRRARKRS
                     SAVFMPQKTVGLLPAALNEFLSLQPEKLSNTVSIIYELKPENFDIVTTWIGETRVKPN
                     TSLTHDRLNQELERSSASGSKFVEKLEAVAKEFYRCRLNSKNADLYRTLPLLESLDDE
                     KVKVDLNILQRSKALTLLSEIERKVNNTVATRLFTSLGDVAFLRRQPEPISTKLKTFQ
                     KKVEKLGVEMDITSSESVLNSILAIDNNTTRMAVELFLSKTLTPAKYFISGKVEPDQF
                     AHYSLNLPLFTHFTAPLRRYSDHVVHRQLKSIINGTEYKETIESLKITSEYCNFKKDC
                     AHHAQEQAIHLLLCKTTNDMGNQNGQVLTLATVLQVYESSFDVFIPELGIEKRVHGDQ
                     LPLVKAEFDVAERVLELYWKKGVDSATFVPSDEQNPKSYRNSIKNKFNSSSKEIAFNQ
                     NSLQNNLISEQFSKELKELKLTPPSLNLRKFNNADALEGYFETTVTREEGDNYIQEIR
                     ELQQVPLLLRAEIGMALPCLTVRALNPFMRS"
     gene            <911134..>911859
                     /locus_tag="KLLA0_C10593g"
                     /db_xref="GeneID:2892251"
     mRNA            <911134..>911859
                     /locus_tag="KLLA0_C10593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452672.1"
                     /db_xref="GeneID:2892251"
     CDS             911134..911859
                     /locus_tag="KLLA0_C10593g"
                     /note="similar to uniprot|P38771 Saccharomyces cerevisiae
                     YHR038W RRF1 Ribosomal Recycling Factor 1 originally
                     characterized as FIL1 a Factor for Isocitrate Lyase
                     expression mitochondrial ribosome recycling factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452672.1"
                     /db_xref="GeneID:2892251"
                     /db_xref="GOA:Q6CTR7"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /translation="MSLQAFRIGLLSTTAAPLAYARPFSSYAALLAKKKGKTSGKPGK
                     ADNEEPIEIIDVKKYVIDATKQFEKTLELHKRKLAEQKVGTASPTIFNDLRVGKEGQK
                     FTELAATSLKGRNALIVTVFDPKDTKNIVSAIMAAGLNLNPERIPNNDQQLKVSLPPI
                     TTETRQAVCKDLKKVFEDYKHSALKESLGHVRGEIMKELKHLQKKNDDVKKVIQDVEK
                     IHKEYTIKLQEQLKQAEKSVMNQ"
     gene            complement(<912077..>913999)
                     /locus_tag="KLLA0_C10615g"
                     /db_xref="GeneID:2892255"
     mRNA            complement(<912077..>913999)
                     /locus_tag="KLLA0_C10615g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452673.1"
                     /db_xref="GeneID:2892255"
     CDS             complement(912077..913999)
                     /locus_tag="KLLA0_C10615g"
                     /note="similar to uniprot|P38694 Saccharomyces cerevisiae
                     YHR039C MSC7 Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the endoplasmic
                     reticulum msc7 mutants are defective in directing meiotic
                     recombination events to homologous chromatids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452673.1"
                     /db_xref="GeneID:2892255"
                     /db_xref="GOA:Q6CTR6"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR6"
                     /translation="MNSTSTQVYLNSSVLQQLNATIQAYLTDLVSTGQTFNSSQIVSE
                     NVRFTSGTLVVGLISIYFIYQWVFSKSKLPSAVQFKLYIPDAAHKHWKGKRMFPCSVY
                     NPEQPHMIQSYCPATGQFLGSFKSMSDTDIDEIVLLAERAQLQWAKTSLKERLQVLLS
                     LKNFILENQEAIARVACRDSGKTMLDASMGEILVTLEKIQWIIEHGEDVLKPSARPGP
                     TNFFMKWYKGAEVRYEPLGVVGAIVSWNYPFHNLLGPIVASIFTGNAVVVKCSEQVVW
                     SSKFFTLLVQEALKACGHDPNLVQLCYCLPPTGNDDAANYFTSHPVFKHLTFIGSKPV
                     AHHVLKAAADSLTPVVVELGGKDAFIVLDSVKDLQALSSIIMRGTFQSAGQNCIGIER
                     VIVSAKNYDALVSILNDRVGQLRLGSDIDNLEDVDMGAMISDNRFGQLENLISDALSK
                     GAKLLHGGSRYNHPNYPQGHFFQPTLLVDVTEDMQISHNEVFGPILTVMRAKDTDDCI
                     RLANAAPFGLGGSIFGADFGECNRVANSLTTGNVAINDFATFYVCQLPFGGLNGSGYG
                     KFGGEEGLLGLCNAKSVCFDTLPFISTQIPKPLDYPIKSNSKAWEFVKAFITGAYAVS
                     TWQRIKSLVSLAKNAN"
     gene            complement(<914466..>914893)
                     /locus_tag="KLLA0_C10670g"
                     /db_xref="GeneID:2892232"
     mRNA            complement(join(<914466..914804,914891..>914893))
                     /locus_tag="KLLA0_C10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452674.2"
                     /db_xref="GeneID:2892232"
     CDS             complement(join(914466..914804,914891..914893))
                     /locus_tag="KLLA0_C10670g"
                     /note="similar to uniprot|P48836 Saccharomyces cerevisiae
                     YHR039C-A VMA10 Vacuolar H+ ATPase subunit G of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452674.2"
                     /db_xref="GeneID:2892232"
                     /db_xref="GOA:Q6CTR5"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR5"
                     /translation="MSQNGIATLLKAEKEAHEIVAKARQHRQELLKQAKSDAAAEITE
                     YKSKKEQELKKFEASNEGGVEGLEKEAENSVQTELKEIKELASKKEDDVVKLLIKAVT
                     TPTGEMHVNAA"
     gene            <915315..>916583
                     /locus_tag="KLLA0_C10681g"
                     /db_xref="GeneID:2891809"
     mRNA            <915315..>916583
                     /locus_tag="KLLA0_C10681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452675.1"
                     /db_xref="GeneID:2891809"
     CDS             915315..916583
                     /locus_tag="KLLA0_C10681g"
                     /note="similar to uniprot|P38772 Saccharomyces cerevisiae
                     YHR040W BCD1 Essential protein required for the
                     accumulation of box C/D snoRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452675.1"
                     /db_xref="GeneID:2891809"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR4"
                     /translation="MRHQKLVRVITLDCNTIPSTSHLDLSKKKTDMDDKCMVCLNETW
                     KYKCPRCLKKSCSLACSKKHKETDNCSGISNATEYVSSQNLKEADTSEEMNHLVQRDY
                     NFLIGMNRRLAVLKEDGKSKNKRVLQKVPGVTGPSRYNVSKPPRVMRRGVKCLLLPKG
                     MQRSISNKSKWDKPLDTFVWSLEWVLFDQKDEHWSHLSHRNKEESELVHCIGKQVYDK
                     CKEFYRGAEEEEDKENSATTKEDRSSQMIEFGFRFFTKWFPNNVESIMDTKEVVEIDP
                     KKCVGEIFRDMTVIEFPTIFIVPDMETLTKHGFHLHVEGSIDTPVPLRRLTDPVQQAT
                     STTTTTAPIPVISESHYPVEYSVIDPKPQASLDVAKSSDSTSSDSVSDSDADLDSDSD
                     SSAPEEGSAKRHSDSEDDYEVGVSLDFLTA"
     gene            complement(<916718..>918280)
                     /locus_tag="KLLA0_C10692g"
                     /db_xref="GeneID:2892253"
     mRNA            complement(<916718..>918280)
                     /locus_tag="KLLA0_C10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452676.1"
                     /db_xref="GeneID:2892253"
     CDS             complement(916718..918280)
                     /locus_tag="KLLA0_C10692g"
                     /note="weakly similar to uniprot|P21147 Saccharomyces
                     cerevisiae YGL055W OLE1 Fatty acid desaturase required for
                     monounsaturated fatty acid synthesis and for normal
                     distribution of mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452676.1"
                     /db_xref="GeneID:2892253"
                     /db_xref="GOA:Q6CTR3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR3"
                     /translation="MSEGRNEGSIPEFDFTQLLQSQGLDEPGVATRREIPLENNIIPA
                     SVKHRDHPVVHLLKKVDVGSTILCIVIPLFSLFKLILDKPEYNADLLKLLVCYWFLSE
                     ISLIAGYHRFFTHSSYQCHIAIQFTMAILGASCGLGSILDFTSQHMVHHRHIDTERDP
                     HSQHVYGWLFSLWGHRFFRGNRKSVKAVAKCRETIVSTARATYDNHTTQLIRSVSYPL
                     LLWQDANYLQLWILANLLFPFLVSKYFLELPPWNCIFYLGFVRMSVVQQQWLLIGSLC
                     HWKNFPLADQPFDDSKSAINLKLGWIGDILTFGEANHNFHHEFPGDFRNGPGRFTIDP
                     AKWVIYLLQWFNLAKNLHTVSTEQIEKCLVQQQQKMIDEESARLKWGIPIERLPRMTS
                     LQFVKLAKDEYIKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFNGAV
                     YRHSNAARNLLATMRVAVITDQSSNIQRTTWEENSIANATHRNNMDRQDVVRNRKHAT
                     LTRRNHYAAGAA"
     gene            <919128..>920930
                     /locus_tag="KLLA0_C10714g"
                     /db_xref="GeneID:2892040"
     mRNA            <919128..>920930
                     /locus_tag="KLLA0_C10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452677.1"
                     /db_xref="GeneID:2892040"
     CDS             919128..920930
                     /locus_tag="KLLA0_C10714g"
                     /note="similar to uniprot|P32916 Saccharomyces cerevisiae
                     YDR292C SRP101 Signal recognition particle (SRP) receptor
                     - alpha subunit contain GTPase domains involved in
                     SRP-dependent protein targeting interacts with SRP102p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452677.1"
                     /db_xref="GeneID:2892040"
                     /db_xref="GOA:Q6CTR2"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR015284"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR2"
                     /translation="MIDQFAVFTPAGNLLYGYNSLNKKFSETQINRFVSEFISQPVKD
                     VTSKFPIISTSDTSYMYHETKQPHLFLVVSFASSESIQLTAEAESVVVLATKLWESLG
                     LNEVILDNISGKGKKNVHNFRFITEGASDQISKFGSYFEVKYDEMKKTSQQKGKKHTA
                     NYNKQVPVSAANKGKQSSKGKKENSQIKARKWGRDGLLEETAAMDESLDFSEGNRTAS
                     PPIAIGSDLESDMRNGSQFGKQNDKGEFLINEIDELLASNKEKSKAKPTTSSPFSFLQ
                     KHILGNKTISEEDLKTVLDSLKQKLISKNVAPEVADHLCNQVSKDLIGSKTENWTSVD
                     QTARESLQKCLSSILTPSVSVDLLHEIQKRINKKDSSGLNDPYVFSVVGVNGVGKSTN
                     LSKLAFWLLKNNLKVLIVACDTFRSGAVEQLRVHVENLAQLTDHNHVRGTKNRRGKTG
                     NEYVELFEGGYGGSNLVTKIAKQAIKYAKTEHFDVVLMDTAGRRHNDATLMSPLKSFA
                     EQANPDKIIMVGEALVGTDSVQQAHNFNQAFGKERNLDFFIISKCDTVGELLGTMVNM
                     VYATSIPILFIGVGQTYTDLRTLSVEWAVNSLLS"
     gene            complement(<921019..>924258)
                     /locus_tag="KLLA0_C10736g"
                     /db_xref="GeneID:2891848"
     mRNA            complement(<921019..>924258)
                     /locus_tag="KLLA0_C10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452678.1"
                     /db_xref="GeneID:2891848"
     CDS             complement(921019..924258)
                     /locus_tag="KLLA0_C10736g"
                     /note="similar to uniprot|Q05549 Saccharomyces cerevisiae
                     YDR291W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452678.1"
                     /db_xref="GeneID:2891848"
                     /db_xref="GOA:Q6CTR1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014939"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR1"
                     /translation="MVDETEEDVAFLKKRKIGKDEFWELKNIFFRLNTFYTFLLTRNH
                     VITTFDVLKPAVQKAVKRPLLEQDFAKICVIMPSDTIFKYIDRNQFQVEEKVFNFKNG
                     GYQQKDNDIFDLKAEDHQVNDEVEDSQVLVFQFKDGNMMNTWKKKTNKSDMNAPEFTT
                     DAMKKMISRRKLSFESALNRFIFNCKLEGKTPMEELERLSAARVPKKKDFMDPIESML
                     QAKKNIETEVVNEAGDSRPTIPILLEKIKHSSIYNDQITNSYIIPERIAKYGELEFAL
                     SPEVYQALEYKDFYSHQAAAINCIHKGENVIITTSTSSGKSLIYQLSAIDALLKDPHS
                     TFMYIFPTKALAQDQKRSFQKLLSKIPELSHVIVDTYDGDTEQQARAGIRISARVIFT
                     NPDMIHTSILPNHPNWKMFLDNLRYVVVDELHIYKGFFGSHVALVMRRLVRIVKGFYK
                     NEKLQFISCSATLKHPIQHMQDIFGIEQVTLINEDGSPRGTKHLVVWNPPKLSQHDRK
                     RENFIGESAKILVQLIIQNVRTIAFCYVRRVCELLMKEVRIILQDMGKLQLINEVMSY
                     RGGYSASDRRKIEQEMFHGNLRAVVSTNALELGIDIGGLDSVLMCGFPLSLANFHQQS
                     GRAGRRNRDSLTLVVASDSPVDQHYVAHSESLLEVDNPESYQDLVLDFDNMLMFESHI
                     QCAAFELPIDIDRDSQYFDRKNLTTICETRLQHDANGYHANDRFLPWPSALISLRGSE
                     EDIFAVVDITNGRNIIIEEVEASRTSFTLYDGGIFIHQGYPYLVKEFNPDDKYAKVQR
                     VDVDWTTSQRDFTDVDPEEIEQIRSMQNSDVPAYYGKIRTTIIVFGFFKIDKQGRILD
                     AVETHNPPVIINSKGLWIDIPKRALELIESKHLNSAGGIHAAQHAILGLLPRFIVAGV
                     DEISTECKAPEKEFAERQTSRKRPARLVFYDSKGGKQGSGLCMKTFEHIEEILNGALQ
                     RVEECPCEDGCPECVAAAFCKENSLVLSKPAALVILHCILGHKESSFMTRIKDGPEPN
                     MPEILVETIEPVSGHVKFSKDLQVIDTREIKNGEENLVTIKKEDNPNEN"
     gene            <924736..>925824
                     /locus_tag="KLLA0_C10758g"
                     /db_xref="GeneID:2892199"
     mRNA            <924736..>925824
                     /locus_tag="KLLA0_C10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452679.1"
                     /db_xref="GeneID:2892199"
     CDS             924736..925824
                     /locus_tag="KLLA0_C10758g"
                     /note="similar to uniprot|Q05543 Saccharomyces cerevisiae
                     YDR289C RTT103 Regulator of Ty1 Transposition regulator of
                     Ty1 Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452679.1"
                     /db_xref="GeneID:2892199"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:Q6CTR0"
                     /translation="MTFSREQFVSKVQSLDETQDSIVNTSKWMLTLYKDADKVATAWT
                     EYLHKSSISTKRKLLVVYLANDIVQQAKHRQVPNFDKSFGNVLPSALEKVYADFPTEL
                     RAKVKRVVGIWRQRKVLSESVLDEIDRRLDVAGKITPSSSTTAQRSKDKVDKRWGQLS
                     SLYDNIEQNQKSGNTLRLRFDKSLEALDPNSVVYAENYNVISKIGSSVKESLTKSIDF
                     RSTLIKELEKLITEQNALVNKEQDSINEIDSILVDKDPTTIAQSTNSNDADLLPTYEN
                     SDDDDDDKHSSENEDEVANKKRSVSPEKQSDLGSTSDKSSSEEPTMKKMKTDELKQEE
                     PTPSTSPSKSNTGAIASSIQDLLSRLAD"
     gene            complement(<925855..>926574)
                     /locus_tag="KLLA0_C10780g"
                     /db_xref="GeneID:2891888"
     mRNA            complement(join(<925855..926476,926561..>926574))
                     /locus_tag="KLLA0_C10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452680.1"
                     /db_xref="GeneID:2891888"
     CDS             complement(join(925855..926476,926561..926574))
                     /locus_tag="KLLA0_C10780g"
                     /note="similar to uniprot|P34162 Saccharomyces cerevisiae
                     YHR041C SRB2 RNA polymerase II holoenzyme/mediator
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452680.1"
                     /db_xref="GeneID:2891888"
                     /db_xref="GOA:Q6CTQ9"
                     /db_xref="InterPro:IPR013921"
                     /db_xref="InterPro:IPR016532"
                     /translation="MTYYGVLFVEKCTPSTITQLQDVLSTDLISMGDKWSFELKTFRT
                     SAKNTDPNDTKVMHTVQLSHKNNETVTIKNQSAIITPTYVTKALYDNGCVFGTPEPFD
                     YMLSNKLSNIWTQRQSIKGEFGVSYQTADLSIRVNNAFSYSGFQGLILELESKSSDNL
                     EAFEKNVERVRTMLSGMGLSDVRVSSDKSQGSKQEDSSLFDLAAHYLKVLG"
     gene            complement(<926916..>931934)
                     /locus_tag="KLLA0_C10802g"
                     /db_xref="GeneID:2891894"
     mRNA            complement(<926916..>931934)
                     /locus_tag="KLLA0_C10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452681.1"
                     /db_xref="GeneID:2891894"
     CDS             complement(926916..931934)
                     /locus_tag="KLLA0_C10802g"
                     /note="similar to uniprot|P15442 Saccharomyces cerevisiae
                     YDR283C GCN2 Protein kinase phosphorylates the
                     alpha-subunit of translation initiation factor eIF2
                     (Sui2p) in response to starvation activated by uncharged
                     tRNAs and the Gcn1p-Gcn20p complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452681.1"
                     /db_xref="GeneID:2891894"
                     /db_xref="GOA:Q6CTQ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ8"
                     /translation="MSLSNLTLSQYYEIQKLETEALQSIYMDDFTDLTKRHSSWDKHP
                     QIIFEIGLRSQESDPAECSLNLHVVLPSTYPHAAPQITFKNVINVPDGQLNKLRQEIK
                     EIHQRSKGQEIIYEIIIATQDVLEDSQKHVVTDSLEDQRLQRIRDEEARMKLEEEQRQ
                     KMIEKQKMQEQKLIDEVFQKELAKRMDDEVLEFSNDKEIDLLPPAELTSSGQAFVFPQ
                     LITAKLPNNSQYKFRAVIQPQSINLCDDPLSFASQMLVKPFIPAESPLYNVLKSSDQL
                     DSIQYLLTEVILDNPYFNTSNGKKEISLLEKDLEAVIQVNHDNVNRLYAFSVERLGRN
                     SSTFQWKIRLLTEFAQFTTLNDIVTSVGFVNLATARGWLLRLLEGLENLHKHGISHRL
                     IDMHTVQLSKDTDFGTTIPKLIHPSYGYTILSMVTRYPSKNGVKLELPNIKWIAPELV
                     KFKGSKPQRKTDIWQLAVLFIIIISGVDTTINFSSPDEFLETVEMDDSLYEFLKKMLQ
                     PEPKQRLTPLELLPMKFLRTNIDAGINKLNLYPDSLIDNKTLSTLPSSSGSQTLRSRT
                     ASRASTDGGRRRSFNIGSRFSSLNSGSRSRYATDFEEIAVLGKGAYGQVVKARNALDS
                     RYYAIKKIRHSEEKLSTILSEVMLLASLNHRYVVRYYAAWLEEEQANHDSTAIESEDE
                     FSDDSYSFSSSDGQGSINKSLTGLNSNNWDFISNSFQGSYPEIVFGNSSDEDEDEAED
                     EDATGVSKASASEVTGLDSSKNDTLQEDGIGDMKFGRDKRSKMKSLSVKSPRKSTLFI
                     QMEYCENRTLYDLIHTESLNNQKEEYWRLFRQILEALSYIHSQGIIHRDLKPMNIFID
                     ESRNIKIGDFGLAKNVQISQDTLRRDSFTSAGSSGDLTSAIGTALYVASEIITSHGNY
                     NEKVDMYSLGIIFFEMIYPFDTGMERVNVIKKLRNIDVEFPSDFDDKKLHTEKKIIKL
                     LLDHDPVRRPTASALLRSGWVPVKNQDELIKEALKNISDPSSPWQQQVRENLFTQPYH
                     LSSDILFDLSRSDTTPFLQLLRAQMVDEVIKIFRRHGAIENNEPPIIFPKAPIYSTQN
                     VYEVLDRGGSVLQLQYDLTYPMARYLSKNPNTTSKQYRMQYVFRPSESTHSSTEPRKF
                     GEVDFDIISNSSTDSAVHDAECLKVVDEIVSTFPVFTNTNTILVINHADILDGVFNFC
                     NIDKAQRSLVSHMLSQLGFGRAFKDLKIDLRSQLNISSTSLNDLELFDFRSDLETSKK
                     RLSKLLVDSPYLKRIEEAFGYVSKVVDYFKPLGVTRNVVISPLSNYNNGFYKGGIMFQ
                     SVFDNGRTRSLISAGGRYDNLISLIARPSGGKLNHIQKAVGFNLAWETMFLIVKNYFK
                     LAGGRTNKKFTKSIKVGNNEWKPKRCEVLVSSFSNSILNTVGIEVVSKLWKAGISADI
                     VRGCFSVEDVITSAQKDGVDWIVLIKQQSYSIANTKRKYKPLKIKNLSTNFDADMDID
                     EFLSLYEDSFNREANNDLPMKDDFFSEHDDRNKWDDNSSQERSQDGESDTISAAGPQK
                     VIFIPNPATRAKGKPSKKDKWVFEESARNASRQLIHSLSSVPIFAVDAIHDETLEIIS
                     ITSLSQKDEWLRKVFGSAANSAPRSFATNIYNNLSKEAAKGGRWAIVHCNKTGKSCVV
                     DLQR"
     gene            complement(<932418..>933311)
                     /locus_tag="KLLA0_C10835g"
                     /db_xref="GeneID:2892645"
     mRNA            complement(<932418..>933311)
                     /locus_tag="KLLA0_C10835g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452683.1"
                     /db_xref="GeneID:2892645"
     CDS             complement(932418..933311)
                     /locus_tag="KLLA0_C10835g"
                     /note="similar to uniprot|Q05521 Saccharomyces cerevisiae
                     YDR284C DPP1 Diacylglycerol pyrophosphate (DGPP)
                     phosphatase zinc- regulated vacuolar membrane-associated
                     lipid phosphatase dephosphorylates DGPP to phosphatidate
                     (PA) and Pi then PA to diacylglycerol involved in lipid
                     signaling and cell metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452683.1"
                     /db_xref="GeneID:2892645"
                     /db_xref="GOA:Q6CTQ6"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ6"
                     /translation="MGIDRVSFGTDRLKFYKSLKKWKLTDLILCVVLFLVNIPVYYQK
                     PFQRQFFINDLTISHPFAEVEMVNNHALIVYSYFVPFFTIILFSLLLADSKHRWYLMY
                     ISLLGLSFTWISTSLLTNYLKNWFGRHRPDFLARCAPKHGTPKNTLVYAIDVCTSTDY
                     AVLYDGFRTTPSGHSSESFAGLGFLFLWLCGQLLTELPETGSWRTIVACLPLVGASVI
                     ALSRTQDYRHHFVDVMLGSLLGILVAHWSYRRYFPSIHSKLPFKPLLDDSDVVLEEYS
                     QVRSSGTDEELLPISRSTNNN"
     gene            <934234..>935595
                     /locus_tag="KLLA0_C10857g"
                     /db_xref="GeneID:2892465"
     mRNA            <934234..>935595
                     /locus_tag="KLLA0_C10857g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452684.1"
                     /db_xref="GeneID:2892465"
     CDS             934234..935595
                     /locus_tag="KLLA0_C10857g"
                     /note="similar to uniprot|P28625 Saccharomyces cerevisiae
                     YMR152W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452684.1"
                     /db_xref="GeneID:2892465"
                     /db_xref="GOA:Q6CTQ5"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /translation="MYTLFYVEVLLCNGHQQIKRKKHRGKKRKTKKMYEMILRYKGMS
                     CVSSWLLYRCYCVRSVSLHLIYANNSSRYLLFNSELFHIRNKTLQKGDRMVTNRALTY
                     VNSSTPLKIIENEIDLDNCYGDKEIVVKVHAAAFNPIDFILHDFANKWLVGSKPKTIG
                     RDYSGEIVKVGEKVDKEWAVGDKVCGLFDAVYNEQGAMRDYLVFDPESSRTKLLTKLP
                     EFHDAQHSDYVLGAAWPLVFTTTIQGFTDYGQKFGPDSNILVLGASTSVGFHVIKIAK
                     ELYNVNAVVGTCNSKSFERNKEVGCDYCIAYDTEDIPVRLKEVITDELKGQKFDLIFD
                     CAGYNDLIPHINDYLKPKNQNSQYINITGTVKYQFDPKKQTKGFIWKSLLGMCRFHRS
                     FNYHFLLMRTERSIGPKFKEFLSNGHYHPPIDSVTPLDQYKTAETKMRSYGAKGKMVI
                     SFE"
     gene            <936212..>938479
                     /locus_tag="KLLA0_C10879g"
                     /db_xref="GeneID:2892692"
     mRNA            <936212..>938479
                     /locus_tag="KLLA0_C10879g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452685.1"
                     /db_xref="GeneID:2892692"
     CDS             936212..938479
                     /locus_tag="KLLA0_C10879g"
                     /note="weakly similar to uniprot|P31111 Saccharomyces
                     cerevisiae YDR285W ZIP1 Synaptonemal complex (SC) protein
                     that connects homologous chromosomes partially during
                     zygotene and entirely during pachytene potential Cdc28p
                     substrate synaptonemal complex protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452685.1"
                     /db_xref="GeneID:2892692"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ4"
                     /translation="MSNFFRDNSIGFKPRHNIFSKLRTGKDTESDESNNSSIMENPFF
                     QRTEESVKLLTPKDKPLLAKELIQSTPKSSPTKKQAEEEELEITEVREVALQQPDDVV
                     SEKDEKESHSINDSSTINDNTSSNDVLLEAFTNTQRICSNLKIELQKQQQKNLQQKEL
                     IDQYKAEILAVTEKIHVHKNLLSLLEDQIKGLKHSKSENDSLIAELGDSYKLLNEKVK
                     SSIAESEALKITLQQQKSLQKSLESALQQKNKELDYKKKELDECSGQLSEEKIKYTEL
                     LQQLSTSKKEITAEIQECFNKVEATSNTRVDTLQNYVNSRLQAICENIKEANVDIAKG
                     LGMDLNQKTEKLISELGVVKDSVSTAATSTTEIIMHEVNKLYVTLPHIENIVSELKEM
                     TANNGTLTMEFITSAFLSSVDTLLKTLQVSMESLQKLPDAICTLDNKITSAEGFENEI
                     NALKEEVHTTMLQKTETVSMLRSKDHEIEELNNNLLSKIKELEELSDKNAILQTEFSS
                     ITVSNEAYVREITRIKKENEEAITSLDSKLTAQTEISSILQKDMNDTKKEIDSLKKKH
                     TQALDENNSIKHKYENLQQQFHKINVELVQSKAKELEFGEINRNLREQFEELESASNH
                     TSNSFKRVNDKVHALEKEKSALNLEKLDLMDKIEELEDKLKEANNQNRSNSNLDPPKR
                     KISSTQQKIIEDDAFALSSDDLELTNPEYSMLMKPVEARRMPSKSNKAVRRKKLLLSD
                     DLEDSPRLKKTKRFR"
     gene            complement(<938502..>938837)
                     /locus_tag="KLLA0_C10901g"
                     /db_xref="GeneID:2892655"
     mRNA            complement(<938502..>938837)
                     /locus_tag="KLLA0_C10901g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452686.1"
                     /db_xref="GeneID:2892655"
     CDS             complement(938502..938837)
                     /locus_tag="KLLA0_C10901g"
                     /note="similar to uniprot|Q05530 Saccharomyces cerevisiae
                     YDR286C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452686.1"
                     /db_xref="GeneID:2892655"
                     /db_xref="GOA:Q6CTQ3"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ3"
                     /translation="MFRNIRKFHSSKILYNISDVQLTLFSKQQCGLCDTAKSVMDQVL
                     QKPDFKDCKYKVVDIMDPENKQWFDKYCFDVPVLHAHNIDNASEGKVEKLFHRFDEKK
                     VQDLVVKIK"
     gene            complement(<939148..>941475)
                     /locus_tag="KLLA0_C10923g"
                     /db_xref="GeneID:2892636"
     mRNA            complement(<939148..>941475)
                     /locus_tag="KLLA0_C10923g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452687.1"
                     /db_xref="GeneID:2892636"
     CDS             complement(939148..941475)
                     /locus_tag="KLLA0_C10923g"
                     /note="weakly similar to uniprot|P07272 Saccharomyces
                     cerevisiae YLR014C PPR1 Zinc finger transcription factor
                     containing a Zn(2)-Cys(6) binuclear cluster domain
                     positively regulates transcription of genes involved in
                     uracil biosynthesis activity may be modulated by
                     interaction with Tup1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452687.1"
                     /db_xref="GeneID:2892636"
                     /db_xref="GOA:Q6CTQ2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ2"
                     /translation="MANKVTKESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQ
                     EPCITIDPSTRREIPRSYVVYLEDKVLALEELLEKNGIDPEHANGNIPATSDDKACDI
                     GLFEERERLRGKHKLPNGNEMAGFIINKGTSMLNGIVDNARDLKDASNQFSKVGIVKQ
                     KIEHEADMEEPSASYLGDSSGISFAKMMFTAVKFRPDVLPKDEKNSAGGTAHKIPRFT
                     KKQSLKIPSKSQAEAMISDYFTASNSQLPILHRELFLQKYFKPIYGSLSPHVSWASDH
                     TKINDIFQIPEAFNPVEFKQTLVSYLEENPDADKIPVEYHQPFFFLNIVFAIGLSTKI
                     LINTGFDHRLFKFCADQYQDSLYTSKTNRLEALQGLLLIAVYSLMRPTVPGLWYTLGS
                     AIRLCVDLGLHAEKLNKNYEPFIRDVRRRLFWCCYSMDRQVCAYFGRPVSIPDVNVTT
                     MFPSSLDDALITTAEDNVRDYSSPSLVNSDPTYKSVCLSMFQIRKIQSEIVQRMYAPN
                     ATIPDEFLDLEDWRIAILNQLDVWFQRVIPKTSIQMNCSFPIDFFALNYHYTKHILYG
                     LSPKCPTLNNAGFIVVYESSMDIANINYKLTLEKKLNYTWVAIHNVFMCGMTYLYVIY
                     HTKQFDDAIPTKFEEICNKILLVLVSLFDKCSAANNCHKIFKVMSSVILKLKMEAMGQ
                     NFSPHNESIKAHPETPLNFLGNDSLQQFFDEMNRNPPSTESMQSHTSPISPSVSDQQT
                     RFQRDGTRFFEMVQQLGGESIWGEFFSNSNSFENL"
     gene            <941764..>942981
                     /locus_tag="KLLA0_C10945g"
                     /db_xref="GeneID:2892484"
     mRNA            <941764..>942981
                     /locus_tag="KLLA0_C10945g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452688.1"
                     /db_xref="GeneID:2892484"
     CDS             941764..942981
                     /locus_tag="KLLA0_C10945g"
                     /note="similar to YLR015W, uniprot|P43132 Saccharomyces
                     cerevisiae YLR015W (BRE2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452688.1"
                     /db_xref="GeneID:2892484"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6CTQ1"
                     /translation="MSVPVIPYLDYDIVDLGSDIKKPDFPQLSESHRINEQQYYITED
                     TPLNKRNFMYQPCAANLMLDKLKYCGTDYFDKSSINLMDRSDKLAFSLDDHSVSVSEN
                     CGWRSVRSDVCMKEGKIYWEVEVKNVSDTSHIRCGISRREASTETPVGCDFYGYSIRD
                     KGLQVIHEGRLHTVLKPHEMQAGDRIGFLLTLPSLQSQSEQAMDYSLKRIQELNNDDS
                     RTNKRNKKFNKEFYKFLLRSCEPTNVVRDQIAIRYKNQLFYESTDYVKTTKPEYYDNR
                     DDMQKFYELENSSFEVFVNGVSHGIAFEGLTPFLPPFSELQYNEKFYLHHWNKRNVTK
                     GIEIRNKYVNNNRLGYYATLSSFQGGTASIITEAMELKFLPKDVDIKTLNDIYNEQIA
                     SDIVWDLIDEIDT"
     gene            <943312..>944514
                     /locus_tag="KLLA0_C10967g"
                     /db_xref="GeneID:2892039"
     mRNA            <943312..>944514
                     /locus_tag="KLLA0_C10967g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452689.1"
                     /db_xref="GeneID:2892039"
     CDS             943312..944514
                     /locus_tag="KLLA0_C10967g"
                     /note="similar to uniprot|P47057 Saccharomyces cerevisiae
                     YJL036W SNX4 Sorting NeXin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452689.1"
                     /db_xref="GeneID:2892039"
                     /db_xref="GOA:Q6CTQ0"
                     /db_xref="InterPro:IPR001683"
                     /translation="MSESGTLTNKESDTKILSVLVSDPQKQKTHSQTYITYQVSTKID
                     GKDEPNCVVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCR
                     SLQTFMRRLLSHSELSKSRILETFLTSTDWDVYRRSLTGQISTSEVSDVLINAFKHVN
                     RQRDEFVEIKEKSEKLDHNLSHLDKLFHKSVKRVDLIGQNLKKLQSSLSGLQELCCDE
                     KELSNSIKAFNDGTMQLIDSLNDLNKYVDYEYNVDIKDMINYIEALKQLIRLKDQKQI
                     DYEELSEYLTRSINEKNNLLSGYGSGNYFKSKLEELAGINQEMARRDKIAKLETRVQS
                     LTDEVEKSKQVADEFEKEVLKEVEQFEQIKTLELKDSLAALAQKHIDFYDDMVEKWSK
                     IEERLESA"
     gene            complement(<944739..>945455)
                     /locus_tag="KLLA0_C10989g"
                     /db_xref="GeneID:2892025"
     mRNA            complement(<944739..>945455)
                     /locus_tag="KLLA0_C10989g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452690.1"
                     /db_xref="GeneID:2892025"
     CDS             complement(944739..945455)
                     /locus_tag="KLLA0_C10989g"
                     /note="similar to uniprot|P47058 Saccharomyces cerevisiae
                     YJL035C TAD2 tRNA-specific adenosine-34 deaminase subunit
                     Tad2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452690.1"
                     /db_xref="GeneID:2892025"
                     /db_xref="GOA:Q6CTP9"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP9"
                     /translation="MSQDLLHMRTAITLAKYALDHEETPVACIFVHSKLNKVIAYGMN
                     GTNESISGISHAEFMGIKQIQEKYGTDPKILSEVVLYVTVEPCIMCASALKQLGIKKV
                     VFGCGNERFGGNGSILCIHNDTSTNKSNKYVSIPGVLRREAIMLLRYFYVRENDRAPK
                     PRTKKDRKLDKETFPPLQWDKYLTLEEFEDEFGQEFRDAFYSHRDVYDEIDWDLIDTG
                     CDESFLHDLIEQVQSVNCTY"
     gene            complement(<945689..>946417)
                     /locus_tag="KLLA0_C11011g"
                     /db_xref="GeneID:2892037"
     mRNA            complement(<945689..>946417)
                     /locus_tag="KLLA0_C11011g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452691.1"
                     /db_xref="GeneID:2892037"
     CDS             complement(945689..946417)
                     /locus_tag="KLLA0_C11011g"
                     /note="highly similar to uniprot|P38777 Saccharomyces
                     cerevisiae YHR049W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452691.1"
                     /db_xref="GeneID:2892037"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP8"
                     /translation="MTTATAAPKLLFLQGFLQNGKVFSEKSSGIRKLLKKSNVQCDYM
                     DAPVILEKKDLPFEMDDAKWQETLNAGVNRAWFYHSDISSELDLSPAIEAVTKYIKDN
                     GPYDGIVGFSQGAALASIITNKITELVPSHPQFKVSLLIAAYSFTEPDPENEGQLRIS
                     QKFQDSFKPMDDRTTKMLFVYGTADMAVPCERAKYLYNIYTKGQELDDCKAYEHPGGH
                     MVPNKKDIIRPIVEEINTSLGVSV"
     gene            <947926..>950505
                     /locus_tag="KLLA0_C11033g"
                     /db_xref="GeneID:2891889"
     mRNA            <947926..>950505
                     /locus_tag="KLLA0_C11033g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452692.2"
                     /db_xref="GeneID:2891889"
     CDS             947926..950505
                     /locus_tag="KLLA0_C11033g"
                     /note="highly similar to uniprot|P32454 Saccharomyces
                     cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
                     yscII and to uniprot|P37898 Saccharomyces cerevisiae
                     YHR047C AAP1' Arginine/alanine aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452692.2"
                     /db_xref="GeneID:2891889"
                     /db_xref="GOA:Q6CTP7"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP7"
                     /translation="MSSQPDRIILPQNVSPLHYKLQLEPYFDTFKFDGTVSIDLKVND
                     KESDFVELNTFELDIHEAKINDVKSLETVTDEENQTSRFKFPAGTLKDSDNVTIDIKF
                     TGILNDTMAGFYRAKYIDNATGETKYMATTQMEPTDARRAFPCFDEPNLKASFEITLV
                     SDPKLTHLSNMDVKKEEIFDGKKFTYFNPTPKMSTYLVAFIVAELEYVECKDFRIPVR
                     VYATPGSEHLGQYAANLTAKTLSFFEKAFGIEYPLPKMDSVAVHEFSAGAMENWGLVT
                     YRVVDLLLDEKNASLERIKRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSW
                     YACNQFQPEWKVWEQYVADDLQSALGLDSLRSSHPIEVPVKRADEINQIFDHISYAKG
                     SSLLRMISQWLGEDVFVKGVSQYLNKFKFGNAKTEDLWDALSEASGKDVRNVMDIWTK
                     KVGFPIVSVTEDGHKITFKQNRYLNTADVKPEEDKTLYPVFLSLKTNSGVDHSLTLDE
                     RELTVTVEDVDFIKTNANQAGIYVTSYSDDRWTTLSKQSDLLTVEDRTGLVADCKTLS
                     LSGYTSTKNFLQLISQWKNEDSFVVWEQMINSLGSLKAAWAFEPKETLEALDEFTRQL
                     VSEKTHSLGWEFSENESYASQRLKVEMFSSSAAAKDPVVVKAALKMFEKYTSGDSNAI
                     PPLIKSSVFGTVARDGNAKNYEKLFAIYKNPSSSDEKLSALRCLGRFEDPALMKRTLG
                     YLFDGTVLNQDIYIPMGGMRGHKEGIKTLWAWTKENWDALHKKFPPSLTMLGSILTVA
                     TSGFTSRQAIDEIEDFFKDKSTKGFDQSLAQTLDTITSKANWVDRDREVVVKFLKEHN
                     YYK"
     gene            complement(<950647..>952293)
                     /locus_tag="KLLA0_C11055g"
                     /db_xref="GeneID:2892019"
     mRNA            complement(<950647..>952293)
                     /locus_tag="KLLA0_C11055g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452693.1"
                     /db_xref="GeneID:2892019"
     CDS             complement(950647..952293)
                     /locus_tag="KLLA0_C11055g"
                     /note="similar to uniprot|P38775 Saccharomyces cerevisiae
                     YHR045W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452693.1"
                     /db_xref="GeneID:2892019"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP6"
                     /translation="MVDWITFSKYLVAILVIVASTVWFINSVIIDSKRDLHTISLNAQ
                     SNVESVRKEHETAIYRNLLVPASFPLTTGLNLSLGYRLRNGNFGDLWSAIMTNGKSTV
                     LQFHTEETTLTRINGIAKRIVVKVESIGAKKIGIATSIDSSMGFSVGVAGLMLSLKDC
                     IPWFLHSIPRNDLEVDIIFINDWESVKYLNGSEKWYQWIIVCDRSIKHRNDYQNNVIS
                     LKDFIGEVTDDPEFKYDPKDSGDDAKILAYISNLFGGTTSFTQMCLVSSVSSFIKSFP
                     LGHSLGEADHLTISMSTQWRHSLSIQSWVKTLSVLLHGGSVSFSDEPRSLNDLPKDTT
                     LLAITGNSAFLNHVLTQSKGIRTSLSKALFSEGVFNKIGQISQQVDKLRCIYILNELK
                     NVNQVTDFSSSVLRLEKSTIDRYSTSQLTLLRSLFGSRVVMEVYSPYSVLGPLSYTNY
                     YDYRVLPSTVDKVVTCYGSFTTSLEGKLVETEENPDLTAPNRQGMLVIRGFTIGKPVE
                     KDRLAQALKLVDKFNGGEGWMPLLGVFGLFGNDGCFYEYK"
     gene            <952702..>953715
                     /locus_tag="KLLA0_C11077g"
                     /db_xref="GeneID:2891857"
     mRNA            <952702..>953715
                     /locus_tag="KLLA0_C11077g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452694.1"
                     /db_xref="GeneID:2891857"
     CDS             952702..953715
                     /locus_tag="KLLA0_C11077g"
                     /note="weakly similar to uniprot|Q6Q5R1 Saccharomyces
                     cerevisiae YDR279W RNH202 Ribonuclease H2 subunit required
                     for RNase H2 activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452694.1"
                     /db_xref="GeneID:2891857"
                     /db_xref="GOA:Q6CTP5"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP5"
                     /translation="MTVEKVIRKGCLLVALPNSVDSPVEIFELPHPSNNESKKPIKLF
                     VHDDKVYQLKIKKFSKGCDYNCSRDLVNDKYHYTSDSQTFKSTFLINEENRKDGHILE
                     DGSILYAEKYDLTFNICGYYYRNNKVTSEDLAFITPCVPPALDMDTNFYTSSDYQEKL
                     TNNHSENWEKIPPKLWESCLGKISHTVEEAGDKYYRIEPQMIVEWLLKKVIKINNNFP
                     TSLKIPKSLPEDIASSLKCIMSCNLLVSLIPQLAYQDLIRHESSNLNIKQCFDSYDKY
                     KNETLQTERERELLIKAAMSTAIPNGTKTVKKQPIQKAKVVKPKVAKGKGRIDGFFKT
                     NKT"
     gene            <954057..>954974
                     /locus_tag="KLLA0_C11099g"
                     /db_xref="GeneID:2892669"
     mRNA            <954057..>954974
                     /locus_tag="KLLA0_C11099g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452695.1"
                     /db_xref="GeneID:2892669"
     CDS             954057..954974
                     /locus_tag="KLLA0_C11099g"
                     /note="highly similar to uniprot|Q05636 Saccharomyces
                     cerevisiae YDR280W RRP45 Ribosomal RNA Processing Putative
                     3'->5' exoribonuclease component of exosome complex of
                     3'->5' exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452695.1"
                     /db_xref="GeneID:2892669"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP4"
                     /translation="MAKDIEISNAESKFILEALKLKQRLDGRSYDQFRDVKIEIGEAY
                     GDVTVTMGNTKVHCRISCEIAQPYEDRPFEGLFHISTETTPMAGAQFENGNNTGEEEV
                     LISRMIEKAVRRSGALDVEGLCIIAGSKCWSLRADVHFLDCDGGLIDASCIAVMAGLL
                     HFKKPDVTVLGERVTVHPIDEREPVSLGVLHVPICVTFSFFNPDDTEENIKGEDNAEI
                     SIIDASLKEELLRDGVLTVTLNKNREVVQISKAGGLPMEALSLIDCCHKAYGIVEKIT
                     DQIHRVVKQDTIARNQYAHILSSENARET"
     gene            complement(<955199..>955576)
                     /locus_tag="KLLA0_C11121g"
                     /db_xref="GeneID:2892285"
     mRNA            complement(<955199..>955576)
                     /locus_tag="KLLA0_C11121g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452696.1"
                     /db_xref="GeneID:2892285"
     CDS             complement(955199..955576)
                     /locus_tag="KLLA0_C11121g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452696.1"
                     /db_xref="GeneID:2892285"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP3"
                     /translation="MSHLWDQRNNPILYICGYYILFVVVSIVLLFIIYCTVTYWANSK
                     NILAAEERYLNSAPETQISIDKHMMMLDERDLYPELNSRNGFEFEKNDLNRYPNLIHI
                     VKFNAREESVTSSTERDMTRLYI"
     gene            <956474..>957280
                     /locus_tag="KLLA0_C11143g"
                     /db_xref="GeneID:2892506"
     mRNA            <956474..>957280
                     /locus_tag="KLLA0_C11143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452697.1"
                     /db_xref="GeneID:2892506"
     CDS             956474..957280
                     /locus_tag="KLLA0_C11143g"
                     /note="similar to uniprot|P38773 Saccharomyces cerevisiae
                     and to YHR044C uniprot|P38774 Saccharomyces cerevisiae
                     DOG1 2- deoxyglucose-6-phosphate phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452697.1"
                     /db_xref="GeneID:2892506"
                     /db_xref="GOA:Q6CTP2"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP2"
                     /translation="MPSIAVDYVLFDLDGTLVSSTDAAEEAWNKLCDKYGVDYSTLSK
                     VSHGSRTAEILAKFFPNVDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPT
                     GAHPGEVFHHRKWAVVTSGSPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFA
                     LATKRLKEIWQDDRKEVRTVVFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADY
                     VVEDLSQVCLQSNNKDETVLTITDPIPRGEEAEYGDDDDDDDDDDDNDNE"
     gene            complement(<957421..>958491)
                     /locus_tag="KLLA0_C11165g"
                     /db_xref="GeneID:2892266"
     mRNA            complement(<957421..>958491)
                     /locus_tag="KLLA0_C11165g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452698.1"
                     /db_xref="GeneID:2892266"
     CDS             complement(957421..958491)
                     /locus_tag="KLLA0_C11165g"
                     /note="similar to uniprot|Q05648 Saccharomyces cerevisiae
                     YDR282C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452698.1"
                     /db_xref="GeneID:2892266"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP1"
                     /translation="MLKRLFVNRFFSTGRTLFYAGPNPTAARSLRRSRQLKRPQTIES
                     SLVTRIRPVTAITTAESYDLQKTIDLLSRKGYQPTTLIPNEIISFKYLHDGCRGDIMV
                     LAQNGSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLK
                     RDYSINDESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTR
                     EFTESLSRGKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWSEPQLEKLYRQ
                     ISRNLDIQPRISILNTKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEVCFELYH
                     FYEKYQELVADAENKTKAENHY"
     gene            <959457..>962360
                     /locus_tag="KLLA0_C11187g"
                     /db_xref="GeneID:2891942"
     mRNA            <959457..>962360
                     /locus_tag="KLLA0_C11187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452699.1"
                     /db_xref="GeneID:2891942"
     CDS             959457..962360
                     /locus_tag="KLLA0_C11187g"
                     /note="similar to uniprot|Q12252 Saccharomyces cerevisiae
                     YOL084W PHM7 Protein of unknown function expression is
                     regulated by phosphate levels green fluorescent protein
                     (GFP)-fusion protein localizes to the cell periphery and
                     vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452699.1"
                     /db_xref="GeneID:2891942"
                     /db_xref="GOA:Q6CTP0"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6CTP0"
                     /translation="MSDAEGASSSTSAFVTTLIVNGVIATVFVWLFLTLRPKQQRVYQ
                     PRSLTDIKTIPESERTEEVPSGYFDWVPYLLTKPHSYLIQHASIDGYLFLRYISIFGG
                     ISLIGCFILFPILLPVNATNGYNLEGFELLAFSNVSNKNRFFAHVFLSWIFFGLIIFI
                     IYRELYYYVTLRHSIQTSPLYDGLLSSRSIILTDLQGDFCSEPELNERFLNVSQVFLA
                     RDLSTLHELVKERAQLANKYESTLNGVITKSVKKKLKADKKGEKVAEGTTNLDQPQND
                     LETYIPLKKRPKHRLSKIPILNICLSEKVDTLDYSVKHISELNEKIGTEQESWEDNNT
                     VGSAFIEFKTQYDAQRAYQSIPYLFDKDIYDSALIGYGPDDVIWESTSMNRKTRKVKR
                     LGGNTILTLMIIFWAIPVAVVGCISNINFLTDKVPFLRFIDNMPDVLMGVITGLLPTI
                     LLALLMSLVPVFIKKVAMMTGALTRQEIELYCHAWYYAFQVVQVFIVVTLASSASSTV
                     TDIIDEPDSAMTLLAQNLPKASNFYIAYFLLQGLTVPSGALLQVVALILSKVLGRVLD
                     KTPRQKWARYNTLSQPSWGVVYPVLELLVCIFITYSIIAPIILVFSTVALGFFFLAYL
                     YNLTYVMSFSYDLRGRNYPRALFQVFVGLYLAEICLIGLFIMAKTWGPLVLEAVFLAA
                     TALAHIYFKRRFIPLFDAVPLSAIRYARGEEGSYYPAKDQGLNEIQVEGKKLAENILS
                     EDRNGVFQETTKQDLQRVNMLPDEYEDSLENDSKSNNGNGTISGSSKQNPSTFVNDSE
                     QFHKTKVPPQIPPPEVHQEERDPNIIVNRADAGQVISDVKGYPINAPEEQLGLPSDLI
                     RPKSIVARCKLFFQPQKYYDFAIVRQTLPYVFNDVIRYDLEYLETAFTEPCVREKEPI
                     IWCARDPMGLSHQQISIASASGVDVRDDFAGYDETGKTTYSNSPPDYEMIAKK"
     gene            <962988..>964871
                     /locus_tag="KLLA0_C11209g"
                     /db_xref="GeneID:2892287"
     mRNA            <962988..>964871
                     /locus_tag="KLLA0_C11209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452700.1"
                     /db_xref="GeneID:2892287"
     CDS             962988..964871
                     /locus_tag="KLLA0_C11209g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452700.1"
                     /db_xref="GeneID:2892287"
                     /db_xref="GOA:Q6CTN9"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR024543"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN9"
                     /translation="MSYDSYYGHQVDIHFTGPKGISSRQVIQARSSPDMVALRKIGLS
                     LFQSTNIFDSYAVTAKVNETASERTPIRNYKDLESIWDDVLTVGTLYIDVAEKNHYEP
                     HDAGSITDAITDGNDTKMSIPSSQWDKLIRSLEKLELSIRGNNVNSSTSEDTVHEGIV
                     CDGCQGPADGIRVVNTKTADQNGFIKGPRFCCLYCHDYDLCSECEKKGFTSGTHKSYH
                     NFVKVVTPDAKLKSFTSDYLKSTHQQVTRPSRYNQVPAPSRYNQVPAPSRYNQAPAPS
                     RYYQVPATSRYSQFPAPPRYNPEPLPSEIKVEGFYGKDKASPRNSSPRVPAANVQHDF
                     NDVIIEVGQQNKAMFDFFAEIKTESELEKLMQDAISWRIAKQWYGEDIYEKLERYQNM
                     MQENAQKERENESSDEATMNTQGSSNPSLRVEMFQKGHLLTFKLFNDGDETIPNGLKL
                     VFQCEQKGRVATPIKCNLQVGPDELQPGNYKILNFNYRGTLEEFSFEQPCKIDLIDVR
                     EQVVYTTEQSTVPGSSVFHLKPPVCKMLPMGDRRNIPCNEDEDPDVQYTLTSPSQSDT
                     DVISSSVTDQEEEEEEEEEEEEEEEEEENTAQADNENNDLVYVESLSEEYDLLSDSDF
                     DHN"
     gene            <965524..>966840
                     /locus_tag="KLLA0_C11231g"
                     /db_xref="GeneID:2891963"
     mRNA            <965524..>966840
                     /locus_tag="KLLA0_C11231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452701.1"
                     /db_xref="GeneID:2891963"
     CDS             965524..966840
                     /locus_tag="KLLA0_C11231g"
                     /note="highly similar to uniprot|P12385 Saccharomyces
                     cerevisiae YBR143C SUP45 Translation release factor
                     involved in translation termination mutant form acts as a
                     recessive omnipotent suppressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452701.1"
                     /db_xref="GeneID:2891963"
                     /db_xref="GOA:Q6CTN8"
                     /db_xref="InterPro:IPR004403"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR024049"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN8"
                     /translation="METDAEKNIEIWKVKKLIKSLEKARGNGTSMISLVIPPKGQISM
                     IQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYTKIPPNGLVLYCGDMITEEG
                     KEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGALFGLLTG
                     NTRTVLHKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVNV
                     KGLILAGSADFKTDLAKSELFDQRLQAKIVKIVDISYGGENGFNQAIELSAEALANVK
                     FIQEKKLITEYFDQISQDTGKYCYGIEDTLKALDLGAVEILIVFENLETIRYVYRDSE
                     DKEVLKFVEPEEQDKSYSLDKTTGAEMDLVSEQPLIEWLAENYKNYGANLEFITDKSS
                     EGAQFVTGFGGIGALLRYKVNFEQLMEDSDDEYYDENEDDDDYDFI"
     gene            complement(<967067..>969457)
                     /locus_tag="KLLA0_C11253g"
                     /db_xref="GeneID:2891940"
     mRNA            complement(<967067..>969457)
                     /locus_tag="KLLA0_C11253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452702.1"
                     /db_xref="GeneID:2891940"
     CDS             complement(967067..969457)
                     /locus_tag="KLLA0_C11253g"
                     /note="similar to uniprot|P38112 Saccharomyces cerevisiae
                     YBR142W MAK5 Essential nucleolar protein putative DEAD-box
                     RNA helicase required for maintenance of M1 dsRNA virus
                     involved in biogenesis of large (60S) ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452702.1"
                     /db_xref="GeneID:2891940"
                     /db_xref="GOA:Q6CTN7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVYGVSKMANKNRKNLKPVKSDRKDRISKNHSKKKVNKNSLKKV
                     ATTDITVNANELNWKSVDIPDTLDDFGGFYGLEEIDGVDVKVVDGKVQFITKDNKNVK
                     KEPEQVEEKDNIVFQEDDEDVNMDELIEFKNFDDIKEGELSAASDDEESEFHVSTEEE
                     GEEGEEAEDQEEERSEKENVKGEAGTVVTEDQTNDDLLQSNVFSSNVDIDDQEPPVLP
                     EWSENMDLSFTVLKGLSGLGFTRPTEIQLKSIPLALKGHNIMGKASTGSGKTLAYGIP
                     IIEQLIKDTSNDRSIGLIFTPTRELAHQVTDHLQKVWTKMNKLNKYTILSLTGGLSIQ
                     KQERILKYDGSGRIIVATPGRFLELLERNPDLIPRFAKIDTLVLDEADRLLQDGHFDE
                     FEKILKLLGKARKIKTSIDGKPTGSGWQTMIFSATFSLDLFTKLDKTSWKILKTAGGE
                     NNEMEQVLNHLMKKIQFKSKPVIIDTNPEHKVTSQVKESLIECLPMERDLYVYYFIMM
                     YPGTTLVFCNAIDSVKKLNAFLNNLKISSFQIHSSMAQKNRLRNLEKFKEQSEKNSKV
                     GKPTILIASDVAARGLDISGIKHVLHYHLPRSADVYIHRSGRTARGDNEGVSVMICSP
                     QESMGPLRKLRKVLSTKKSSNPRKTKWQNDVPMLPLEPDIVSQLRERSKIASELADDE
                     IATKSLHKDDNWLKKAAEELDIELDSEEEEKDQFLARNKTKKLNKQLEKNENKALKYQ
                     LNELLKMPLRKDLRKSYLTGGLTNLADTLVKHKGHNSIIGHDKVDALQTLKGKKHK"
     gene            <969789..>970853
                     /locus_tag="KLLA0_C11275g"
                     /db_xref="GeneID:2892137"
     mRNA            <969789..>970853
                     /locus_tag="KLLA0_C11275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452703.1"
                     /db_xref="GeneID:2892137"
     CDS             969789..970853
                     /locus_tag="KLLA0_C11275g"
                     /note="similar to uniprot|P38278 Saccharomyces cerevisiae
                     YBR141C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452703.1"
                     /db_xref="GeneID:2892137"
                     /db_xref="GOA:Q6CTN6"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN6"
                     /translation="MLSRRKRTITGKPVAKHVPKIKPSKARKIIRRFHLLIQKRRVIC
                     NKLRCDIVENDEEANAINIENFFRKNKTLQEDFNKGKKSRRPNPRLEELLVHVQSIEH
                     SQQLCQILGYICGEIEEDGGLQNYQFASTVGQDSNRGGDSSKQLVKWCKELGVDKALG
                     MNALELGSLSAKNHISVCGLFNPVVRIDLNSNDTVNIERQDFMKRPLPKDESQRFDLI
                     SCSLVLNFVPTPLQRGQMILRFKQFLKCNKKTYLFLVIPLPCLTNSRYMTKDRFNEIM
                     HALGYRKIRFKEAKKVAYWLYELEQSENTMCSSQNMNQFAKKAKLLDKPGMNNFSITF
                     PNRQPSHQGIYTTTKPLFSR"
     gene            <971068..>971481
                     /locus_tag="KLLA0_C11297g"
                     /db_xref="GeneID:2891875"
     mRNA            <971068..>971481
                     /locus_tag="KLLA0_C11297g"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_452704.1"
                     /db_xref="GeneID:2891875"
     CDS             971068..971481
                     /locus_tag="KLLA0_C11297g"
                     /note="similar to uniprot|P53937 Saccharomyces cerevisiae
                     YNL081C SWS2"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_452704.1"
                     /db_xref="GeneID:2891875"
                     /db_xref="GOA:Q6CTN5"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN5"
                     /translation="MVVHILGKGFKGKEIIKIGLASKFYGIGLKTAEKICSKLGFYPW
                     MRMHQLTEPQVMAITSELANMTIEGDARAIVKENIALKRSIGSYEGMRHALGLPVRGQ
                     RTRNNAKVARRLNKVDRRGYHTQTRSPILEQISNL"
     gene            complement(<971620..>974391)
                     /locus_tag="KLLA0_C11319g"
                     /db_xref="GeneID:2891896"
     mRNA            complement(<971620..>974391)
                     /locus_tag="KLLA0_C11319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452705.1"
                     /db_xref="GeneID:2891896"
     CDS             complement(971620..974391)
                     /locus_tag="KLLA0_C11319g"
                     /note="similar to uniprot|P14242 Saccharomyces cerevisiae,
                     YNL082W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452705.1"
                     /db_xref="GeneID:2891896"
                     /db_xref="GOA:Q6CTN4"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN4"
                     /translation="MGIQAIENADIHKITSGQVIVDLRSAIKELLENSLDAKADKIEI
                     IFKNYGIESIECADNGVGISEDDLDNVGQKHRTSKISSFEDVSKVTSFGFRGEAIASL
                     CQMGKVIITTTTKGPKAYKIVFNHSGTCNKIICSRNTGTTVLVSNLFDTLPVRKKDFI
                     KNYKRQFNRSIDLIQSYAIIQTNVKISVSNVLPSGKKTLILSSIGKSDITRNLVSVFG
                     SNAGKGLASIDVDLDLSNIRHTSILPENQKEENASEFQVKITGQISMVSFGCGRASKD
                     RQYVYINKRPVDYPKVAKTINETYQSFNNVQYPSFVLDFRVGTKFLDLNVTPDKRTVS
                     LHYEEYVLDALRESLQLFFQKQGFVVPKSETTSDNPFGPKRIKVEPLDASTLHNSENS
                     KIISNGNHLRHPTIIKDEVHELPRLISPLRSPTLAKMKGESEQSELKSSTVETEDLDD
                     GFDDKLHNHRESVHKDEISANNHLDYVAEDVNTGPHLLNPHEKEGDTKRLFVDSDLEN
                     TIESESNVISKELDESEDVDIDKNNLKVTPKGNHIQLGDFLHRRMSNVDIEKSPVEVD
                     ELVVQIDNNISTIPASQDRDNKLVFHPHTSHSGNDSCRHSHNHSPNESDYSDDDFENG
                     TDIVFKNTVENESDLEQIKKQIEGSSSESLSLHQINNLVTSVRASLKIEAEKSQKVVC
                     AIEIDKAIKHERLVNEIASIDDKEKAEHLLTLTVSKNDFQNMTIVGQFNLGFIIVTRC
                     KEGAFDLFIVDQHASDEKYNFEMLQKNTVFKSQSLLSLKTLELSVIDELLVMEYKDVF
                     SKNGFKLSIDQEEEPGQRIKLVSFPVSKNTMFTEYDFHELIQLIREHEGHDMSNIRCS
                     KIRSMFAMRACRSSIMIGKPLSMRTMKKVVNNLSDLEKPWNCPHGRPTLRHLMELKDW
                     DSFCDDYMI"
     gene            <974626..>975321
                     /locus_tag="KLLA0_C11341g"
                     /db_xref="GeneID:2891895"
     mRNA            <974626..>975321
                     /locus_tag="KLLA0_C11341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452706.1"
                     /db_xref="GeneID:2891895"
     CDS             974626..975321
                     /locus_tag="KLLA0_C11341g"
                     /note="similar to uniprot|P38927 Saccharomyces cerevisiae
                     YIL139C REV7 Subunit of DNA polymerase zeta which is
                     involved in DNA repair required for mutagenesis induced by
                     DNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452706.1"
                     /db_xref="GeneID:2891895"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN3"
                     /translation="MKFIEKWLPVYLKAWIQLIWYHRDIYPRETFSWTDYHAFNLPSH
                     IPVNVNPELQKYLDELCDDILSKLKQLHYLNLYICECDDEDYVIERYCLDFGDINHLD
                     KTEANTDQENLVFDEFRSSIYSLIAHLEKLPQLEPGKYTFDIVIETVEMSLGHMSNEN
                     LPRSKENVTNLERDWNWVKYKDPSNDFPSAGQSQERVKMYSLVGCDLNSLVFHQFAER
                     LVPQDNNISTSIE"
     gene            complement(<975442..>976995)
                     /locus_tag="KLLA0_C11363g"
                     /db_xref="GeneID:2892519"
     mRNA            complement(<975442..>976995)
                     /locus_tag="KLLA0_C11363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452707.1"
                     /db_xref="GeneID:2892519"
     CDS             complement(975442..976995)
                     /locus_tag="KLLA0_C11363g"
                     /note="similar to uniprot|P48233 Saccharomyces cerevisiae
                     YNL083W SAL1 Probable transporter member of the Ca2 -
                     binding subfamily of the mitochondrial carrier family with
                     two EF-hand motifs Pet9p and Sal1p have an overlapping
                     function critical for viability polymorphic in different
                     S. cerevisiae strains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452707.1"
                     /db_xref="GeneID:2892519"
                     /db_xref="GOA:Q6CTN2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN2"
                     /translation="MSNSIGDESPEEQKKRHLKLFETIDINHTGKIDIRTLQQAFEKS
                     DHPLKGSPEAIEHIFKSLDQNKDSVIDFNDFEKYVTTAETQIKVGFQKIDKDNDGRIK
                     MEELSKYLSQFREDHDIKDVADSKQRKKPSKISNFVDWAFNRKSYITYEQWRDFLLFV
                     PRKEGSRLNTAYAYFYLFNEDVDLSSEGDVTLINDFIKGFGFFIAGGCSGVVSRTCTA
                     PFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKAATTLYRQGGLRAF
                     YVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGVAAQ
                     FSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIFPY
                     AALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLL
                     RTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSISYLCYE
                     NLKRLMKLE"
     gene            <978786..>980387
                     /locus_tag="KLLA0_C11385g"
                     /db_xref="GeneID:2891976"
     mRNA            <978786..>980387
                     /locus_tag="KLLA0_C11385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452708.1"
                     /db_xref="GeneID:2891976"
     CDS             978786..980387
                     /locus_tag="KLLA0_C11385g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452708.1"
                     /db_xref="GeneID:2891976"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN1"
                     /translation="MLTRFGKRKLVNSGPSSLILKSLQKPILHQHTRLMHSRDDGKST
                     DAANQPDATATTLTDKHEYQRVFMNNSAVTEGFKATWVNALAERKKQLAQGKIIDSYS
                     YNSVKSTEVGEKTRADSFTYLTLPFKDDPIIADFYVNAGGRIRMGQIFQDLDALAGRI
                     AYRHTSPAEPVIVTASVDRIYMLKPLDHISDYNVVLSGTVVWTGRSSMEIAIKASAIQ
                     GAIPSEINESTLSDEDTFLTASFTFVARNPETHKSLPINKLLPLNEKEWMDFRRAESH
                     NAAKKLRAKNENLDTNPPTDDESSIIHKMWQASKELSTMESKPFNVMLMEDTNVKSTM
                     FMQPQYRNRHSYMIFGGYLMRQTFELAYCAASSFSHSLPRFISLDSTTFRAPVPVGSI
                     LHMDATVVYTEHLHETASQPKVAASVVDKEVDGNTIFHFEPTAVNNISVNKDDFLSKP
                     GTIIQVKVNTVVQALDSEKQTKSGSFIYSFFAPRDYDSEKPGSPGYATVIPQTYSEMI
                     EYIEGRRRAIETAAYAKTMKRVSKL"
     gene            complement(<980649..>983006)
                     /locus_tag="KLLA0_C11407g"
                     /db_xref="GeneID:2891968"
     mRNA            complement(<980649..>983006)
                     /locus_tag="KLLA0_C11407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452709.1"
                     /db_xref="GeneID:2891968"
     CDS             complement(980649..983006)
                     /locus_tag="KLLA0_C11407g"
                     /note="some similarities with uniprot|P38928 Saccharomyces
                     cerevisiae YIL140W AXL2 Integral plasma membrane protein
                     required for axial budding in haploid cells localizes to
                     the incipient bud site and bud neck glycosylated by Pmt4p
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452709.1"
                     /db_xref="GeneID:2891968"
                     /db_xref="GOA:Q6CTN0"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="InterPro:IPR028064"
                     /db_xref="UniProtKB/TrEMBL:Q6CTN0"
                     /translation="MKTELLLSSALSLLFAVASASVYEAYPINKQLPPIARVDEDFQF
                     KISNDTFKSTNEGSVQISYESSELPNWLSFDSSSLTFSGKVSSDFLDDNEDTKYFDII
                     LKGTDSTDSASFNTTFQLVATKKSGISLADDFNLLNLLKNYGYTNGKDALKLSPGDIF
                     NVTFERDNFDVSSNDSVVTYYGRSSQYNAPLPNWVFFDANNLKFSGSAPVVNSDIAPE
                     MDYSFNLIATDIDGFSAASINFQIVVGAHRLTTSIENTLIINVTDSGSFSYPVPLDYV
                     FLNDEVISKDDLGDIKLVDTPDWISISDNYTLEGTLPSNESDYDFQLSIYDKYMDVVY
                     LNFVIESTQNLFAISSFPSVNVTRGEWFQYALLPSQFTSFDETTVSANYSSQANWLRF
                     QSSNLTFYGEVPDDFDDLSIDIVASLGSKMDSLVLKMVGIDAKNSTKTQTSSSASHTA
                     TSKSTASSTSTSSTSQSSSSALLPNNKKSKSTNIVAIVCGVVIPIVVLLILLIIFLLW
                     RRRRNEKKENDKEKMAISGPDPKNPANDPNACGDVNPFSDENTLDSGEVSTEAKRLAT
                     LNAMKLDDVSNSSTMTSLDEKVSADSVYQDAEMANSRDMLLQRDDESSVFDDKYRSSS
                     VYFQNAPSQRKSWRFSKNKIQPDDRTMRQSYASLNTVSTQELLNSELKNDSTLPHDPR
                     KSSLGLRDSVFWNKDTNSSSPLKPVSENDITESAARTDSQSPHSSMSSDGLIPMKQQD
                     GQYKWVTNDQPVRKKSTKRVGSVREQAGVNVSNVNNFTGESPERM"
     gene            <984117..>985259
                     /locus_tag="KLLA0_C11429g"
                     /db_xref="GeneID:2892454"
     mRNA            <984117..>985259
                     /locus_tag="KLLA0_C11429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452710.1"
                     /db_xref="GeneID:2892454"
     CDS             984117..985259
                     /locus_tag="KLLA0_C11429g"
                     /note="similar to uniprot|P39013 Saccharomyces cerevisiae
                     YNL084C END3 EH domain-containing protein involved in
                     endocytosis actin cytoskeletal organization and cell wall
                     morphogenesis forms a complex with Sla1p and Pan1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452710.1"
                     /db_xref="GeneID:2892454"
                     /db_xref="GOA:Q6CTM9"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /translation="MPKLEQFEIKKYWQIFSGLKPVENKLTHDQVLPILFNSKLDTSI
                     LNKIWFLADIDDDDQLDFEEFVICMRMIFDMVNKNIDSVPDELPDWLIPGSKAELVKQ
                     RKTERSSGTAETSSVVNVPTSSPAVDDYQKEVDWYISRDDKSQYESIYESAITSRDNS
                     VSYVSLSSAVRSKYINLSSQDLEKTWRLVNPKLDTSIDKDPALYFIHILRQVNDYACP
                     IPSHLPSALKETFTKTRVSTDLSSKQSEVRRPTLSTSNSSSYQIPKRGGTDFSVTQGT
                     DWEVVRLQRELANIDSELSSAQQQSTSHNDSNDRMKLVKQQLEQFLEYQKNLVNNSNT
                     SSESVDVGGLRDDIESIEQQVQMLEEYLKTKKSELHNLKIEVQSLY"
     gene            complement(<985410..>986999)
                     /locus_tag="KLLA0_C11451g"
                     /db_xref="GeneID:2891861"
     mRNA            complement(<985410..>986999)
                     /locus_tag="KLLA0_C11451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452711.1"
                     /db_xref="GeneID:2891861"
     CDS             complement(985410..986999)
                     /locus_tag="KLLA0_C11451g"
                     /note="highly similar to uniprot|P39076 Saccharomyces
                     cerevisiae YIL142W CCT2 Subunit beta of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452711.1"
                     /db_xref="GeneID:2891861"
                     /db_xref="GOA:Q6CTM8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM8"
                     /translation="MSVPIFGDQVTEERAENARMSAFVGAIAVGDLVKTTLGPKGMDK
                     LLQSASNNTSMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKLVEQGKIHPQTIIEGFRIASAAALSALEKAAVDNSNNKEEFYNDLISIANTT
                     LSSKILSQDKDHFSKLATDAILRLKGSTNLEHIQIIKIIGGKLSDSFLDEGFILPKRF
                     GSNQPKRVENAKILIANTSLDTDKVKIFGTKFKVDSTSKLAELEKAEREKMKKKIEKI
                     ANFNINTFINRQLIYDYPEQMFTDLGINSIEHADFEGVERLALVTGGEVVSTFDNPEK
                     CKLGECKLIEEIIIGEETFTKFSGCKSGEACTIVLRGATEQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKAVDTVGQNVEGKKALAVESFAKALRQLPTILADNAGF
                     DSSELITKLRSSIYNGMSTSGLDLDNGTIADMRELGIVESYKLKRAVVTSASEAAEVL
                     LRVDNIIRAKPRTADRQHGHM"
     gene            complement(<987546..>989264)
                     /locus_tag="KLLA0_C11473g"
                     /db_xref="GeneID:2891841"
     mRNA            complement(<987546..>989264)
                     /locus_tag="KLLA0_C11473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452712.1"
                     /db_xref="GeneID:2891841"
     CDS             complement(987546..989264)
                     /locus_tag="KLLA0_C11473g"
                     /note="similar to uniprot|P53180 Saccharomyces cerevisiae
                     YGL045W RIM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452712.1"
                     /db_xref="GeneID:2891841"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /translation="MGLFDKLLRSNERAERGSPSAFVVSSFDSVSNAGKSSIFKHSGM
                     KSYILEFEIVLDDVHRVWKPNETISGTVKLRLRKDVPNVWIKLAHIGEFQLHSNNPMT
                     AGSLKSKYSDTVFCRSTSIYGSEENPLHLTGGEHKFPFSCKINGKNLVSSIDFKKGSI
                     RYWVQAELHAQKTPPIFCKQHYQLIVPIDVGQLPKPNIKTVVLQSPNSSNNGIHVRRL
                     MAAGSADPQDGASSLTRKTGGSSTITNGSSSSNNSGNSNASMLADNKTVKISVEIPCL
                     GYTIGEEIPVKVHVTHYKQYFHPAGLIATLVRISRVSNPRNTEQIETFRKDICQGVAP
                     LYTDPETHEAVIMLKLKVPLDTFPSLDLKNKFFTFQYYVEILANLSRKNLVYTESNRL
                     VGGQRTSSIPMPSNKFSMFQDLSNQGEVTAGEDDSVTFFQDLINVDRLKRLRNVTGMS
                     IEVVIGTHREEHEPESPTVDRLDSHSINQLPDDVDAVYNQCSSAESPIDEAYDYLLHR
                     HNGPSPSSRIFTDTDMTLCYPADPVPLYSRGLDDFTGCSMSGVTDDKQELEQMRLKEL
                     ESEPPI"
     gene            complement(<990832..>992169)
                     /locus_tag="KLLA0_C11495g"
                     /db_xref="GeneID:2891960"
     mRNA            complement(<990832..>992169)
                     /locus_tag="KLLA0_C11495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452713.1"
                     /db_xref="GeneID:2891960"
     CDS             complement(990832..992169)
                     /locus_tag="KLLA0_C11495g"
                     /note="some similarities with uniprot|P27476 Saccharomyces
                     cerevisiae YGR159C NSR1 Nucleolar protein that binds
                     nuclear localization sequences required for pre-rRNA
                     processing and ribosome biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452713.1"
                     /db_xref="GeneID:2891960"
                     /db_xref="GOA:Q6CTM6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM6"
                     /translation="MGKSTDKKVSKKVSKKDLKLKKKQDEKKVKAVEPESSSDSSSDS
                     SSDSSSDSSSDSSSDSDSSSSSDSSDSSDEEEEPKKETKKEESSSDSESSSDSDSESE
                     KEEAKKEESSDSDSSSDSSSDSDSDSDEEEEKKEEKKKEESSASSSDSDSSSDSDSSS
                     DDDEEEEKSSNKRKADDDEEKSESKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEP
                     IGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKP
                     AGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPET
                     EQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYSIPKQNFGNNQRGGFNRGGS
                     DRGGRGGRGGSRGGRGGFGGNRGGREFSSGSNASPLGATRQTASFQGTKKTFD"
     gene            complement(<993074..>994636)
                     /locus_tag="KLLA0_C11517g"
                     /db_xref="GeneID:2891947"
     mRNA            complement(<993074..>994636)
                     /locus_tag="KLLA0_C11517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452714.1"
                     /db_xref="GeneID:2891947"
     CDS             complement(993074..994636)
                     /locus_tag="KLLA0_C11517g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452714.1"
                     /db_xref="GeneID:2891947"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM5"
                     /translation="MLFPVTFAWFLFAGVFAQALSTKTFTSTLTSTSQICPDCTTITS
                     YSTMPEPTTEDEPSTITSTICPSCTRPSTEVTTKSSTEPEETTTEPNTTESLTEPETT
                     DCWSTESVPEDTTSEETTTSEEPSTSKLITSSEETITSEPPSTSTELTTSEEPITSEE
                     TTTSKESATSEESSSETEISSFTTLEPKSSTTPEEPVTSSTSTISTSTISTLTSTVCP
                     SCDTHSTSTTLSSSSSSSSSSMISSTTDTDSESSTSSVTTIAPPPSFTTTLPDTTPST
                     LSSSTGRTESETIPSTASISTEITESETTTLPTPIPTTLSTIITSDISTTETEISTET
                     TIVCSNREECADTVTSDTPVLESTTSELIQTITTSEIKTDSFKTTEPTIESSIETNVE
                     ASTESGTTETTEIYSTPLSETTITSENCYGTRCTTVTSTVTVPVTDLTTSTSPSNSSP
                     SSAPNETTEPMEPSLESFTSQAPKTDTEQSSSTVSFGAVSSISIFQGVASSINARSST
                     IFGVFLGLISLL"
     gene            complement(<995618..>996529)
                     /locus_tag="KLLA0_C11539g"
                     /db_xref="GeneID:2892004"
     mRNA            complement(<995618..>996529)
                     /locus_tag="KLLA0_C11539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452715.1"
                     /db_xref="GeneID:2892004"
     CDS             complement(995618..996529)
                     /locus_tag="KLLA0_C11539g"
                     /note="some similarities with YGR161c, uniprot|Q7ZA12
                     Saccharomyces cerevisiae Hypothetical ORF, RTS3
                     SGDID:S0003393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452715.1"
                     /db_xref="GeneID:2892004"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM4"
                     /translation="MNMNRPQLSTELSENKFLGLKKPDQKGMRPQDTIAVVTDSESED
                     DFRKKPFFRVPSPGKTAKRTKRGSQSSAYSTPPSPGSFHPPHHSGRRLSSEEIINQME
                     KEQDAMVMRLLKEIDLLREENVRLRRSLNQLSSNLHNSDVSMSLDPVSASRPNSSSSS
                     SLSQLQLSSQQQSTSGLLGVGMGNITGTSSAANSRRPSSSSQLLDNLTPELQRKRNSV
                     TKNEIDFMEGYSPTLRTGSTMLTPNLSTGIESLPRRASSIMCGSRRRRSSGRPMEESD
                     TMSLSPSSVSKIPKRAGSPTTSVTVAR"
     gene            complement(<997866..>998933)
                     /locus_tag="KLLA0_C11561g"
                     /db_xref="GeneID:2891915"
     mRNA            complement(<997866..>998933)
                     /locus_tag="KLLA0_C11561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452716.1"
                     /db_xref="GeneID:2891915"
     CDS             complement(997866..998933)
                     /locus_tag="KLLA0_C11561g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452716.1"
                     /db_xref="GeneID:2891915"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM3"
                     /translation="MDASAFEIDSGLTGIPSEDTAVGVSGGRVTNEESGKRLSGHDQQ
                     NGSMHHHNQTNGSIASKNDRRFIARDWFNINSDRDCELMQIFIDQLNSSNHVNYSKAY
                     LLFKERTGFPFSDPKHMRKRMDQIVYTFKTQGEMLPENVKQIISEYNTALEAAKQRDS
                     SNRKRLSLMEPLEIDDGNITGNSSDEDSHAMVSNSNKIGIRNNSLSSSSHFYHHNHHN
                     PQQQRIHNDLHRLSSSNLIRKRKFSGTSSPTDDITNKTLNKINENVEKLTKMLESHDA
                     LLKKVVRYLDIQHSRTDDTESTQSDQNDGSNNAAAAAAAAAAAVSAASNVLNLNPSLS
                     VPDIDPNHDPNVYSNGHVNQR"
     gene            complement(<999466..>1001553)
                     /locus_tag="KLLA0_C11583g"
                     /db_xref="GeneID:2891863"
     mRNA            complement(<999466..>1001553)
                     /locus_tag="KLLA0_C11583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452717.1"
                     /db_xref="GeneID:2891863"
     CDS             complement(999466..1001553)
                     /locus_tag="KLLA0_C11583g"
                     /note="similar to uniprot|Q752T1 Ashbya gossypii AFR492W
                     AFR492Wp and weakly similar to YGL021W uniprot|P43633
                     Saccharomyces cerevisiae YGL021W ALK1 leucine zipper
                     (putative) membrane protein (putative) and YBL009W
                     uniprot|P32789 Saccharomyces cerevisiae YBL009W haspin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452717.1"
                     /db_xref="GeneID:2891863"
                     /db_xref="GOA:Q6CTM2"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM2"
                     /translation="MVVEVARMDFETSFDEYSIGESAKRFIALEVSDHEDDYNSSVDS
                     FHESNIGFVADVDTERVSQSAAVAPTLEHASITTGQEETGKGDSVSVASTSGIEPPLA
                     TSNGNSAGNIRPHKDEKKRWSFISTNSSSKKRWSTLSFVSDTKSNKRLSVVSTESSSK
                     RSSVQSLSKQSSTNKLKRSSTGASLRSMFNKIALKDEDKENSGVMLAHKRGQSTTLAS
                     SFTVSAKAQPTPSARIPLKPINQNNKREQRFSTIPMSPSMDNMSMFSQQSNSSMGTRW
                     KFWKRKQDCPQDSRFMQDSNISMRNKSSLSDLRKSIFQNSMMGQSEPTQDLKSRRSHS
                     SLQHKSSHSSLKQKSSHPSLKKLHSRRNSSIASNDSSAPQISLPIPDQVSRDKIRTKL
                     RHSSSLISINSNILGGSVIIAETDEYDESVLQQMLDLCTVKEILPFTNSPHLRQLDHY
                     IYIDSNDYTIYKIVPLDNDDRECKMTRQMRLQELQLTMLMNGTPGFVNVLDVKIIRRE
                     DDQTLFLVYHMKNHGKSLNQLISNEHRKFSVTEIKDIITQCIRILYVAETKFQFEHRL
                     LTLDHVLIDSSKNITLVDYKLSRVKYGSQVLFTRLDHPLFFEFRKDYNTVLQWLRQSM
                     TVDSWPLFHPKTNLVWVNYVVTKLQHNCKDPQTPSPLLNKIQSSLESTKSRKLWKRHD
                     GQIESCADIVSFL"
     gene            <1002022..>1002807
                     /locus_tag="KLLA0_C11605g"
                     /db_xref="GeneID:2892600"
     mRNA            <1002022..>1002807
                     /locus_tag="KLLA0_C11605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452718.1"
                     /db_xref="GeneID:2892600"
     CDS             1002022..1002807
                     /locus_tag="KLLA0_C11605g"
                     /note="weakly similar to uniprot|P32788 Saccharomyces
                     cerevisiae YBL010C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452718.1"
                     /db_xref="GeneID:2892600"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM1"
                     /translation="MASDSDSDSDFGDFGEGTVTIEETAPSTNKDEHTKEGTADANAE
                     SEPQQAFTAVEVLFDCMRKILAAKERGIEIRDKNVLFQDLLKNEKTRKVYDALFPNGK
                     PLPPVQWRREPLQKLLRQTLNIDEPQEEEVEEKEEYVIQDLLYLKLEEDQDQKSLEQL
                     GYKKLNAEGVPDADLSQLLSYQDFQTIPGNELPVIHDQLIDAIETVLLDLESLQNEEQ
                     ELLKDKATYEELITNLVGHTQRIRREEIAEYQRKHKSKSKKKF"
     gene            complement(<1002978..>1005254)
                     /locus_tag="KLLA0_C11627g"
                     /db_xref="GeneID:2892030"
     mRNA            complement(<1002978..>1005254)
                     /locus_tag="KLLA0_C11627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452719.1"
                     /db_xref="GeneID:2892030"
     CDS             complement(1002978..1005254)
                     /locus_tag="KLLA0_C11627g"
                     /note="similar to uniprot|P39007 Saccharomyces cerevisiae
                     YGL022W STT3 Subunit of the oligosaccharyltransferase
                     complex of the ER lumen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452719.1"
                     /db_xref="GeneID:2892030"
                     /db_xref="GOA:Q6CTM0"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:Q6CTM0"
                     /translation="MKQSTLLALEGFQTVLKALIFIAIFGVAISSRLFSVIRFESIIH
                     EFDPWFNFRATKYLVSHSFYEFLNWFDDRTWYPLGRVTGGTLYPGLMTTSGAIWHILR
                     KIGLPIDIRNICVLFAPAFSGFTAWATYEFTKELKDSSAGLLAAAFMAIAPGYISRSV
                     AGSYDNEAIAITLLMVTFMFWIKAQKTGSILYSMLAALFYFYMVSAWGGYVFITNLIP
                     LHVFILILMGRYQSKLYSAYTTWYAIGTLASMQIPFVGFLPIRSNDHMAALGVFGLIQ
                     IVALGDYIKSQVSGERFKVVMFISLGLIISIGISGLFFLTYMGYIAPWTGRFYSLWDT
                     NYAKIHIPIIASVSEHQPPAWPSFFFDNQFLIWLFPAGVFLLFLELKDEHVFVLAYSV
                     LCSYFAGVMIRLMLTLTPIICVTGAIAISKLFDIYLDFSVALSTKSPKDVKSVKLDKE
                     KKETSDLEQEDDDYEAELVVDYEPSSKARWFDITAKAVVSSTFLMYLFLFVYHCTYVT
                     SNFYSSPSVVMPSQNPDGSVALIDDFREAYYWLRMNTAEDAKVAAWWDYGYQIGGMAD
                     RTTLVDNNTWNNTHIAIVGKAMSSPEEKAYEILKAHDVDYVLVVFGGALGYSGDDLNK
                     FLWMVRISEGIWPDEVKERNFFTGRGEYRVDADATKTMKDSLMYKLSYHDFPSIYPNG
                     VGHDRTRNQKITNNEVGPLDYFEEVFTSEILLVRIYKLKSPDSLGRDHGEAAKFDRNL
                     QSGVKKRLVKKPELELRV"
     gene            complement(<1005591..>1006307)
                     /locus_tag="KLLA0_C11649g"
                     /db_xref="GeneID:2891979"
     mRNA            complement(<1005591..>1006307)
                     /locus_tag="KLLA0_C11649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452720.1"
                     /db_xref="GeneID:2891979"
     CDS             complement(1005591..1006307)
                     /locus_tag="KLLA0_C11649g"
                     /note="similar to uniprot|P32656 Saccharomyces cerevisiae
                     YER163C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452720.1"
                     /db_xref="GeneID:2891979"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:Q6CTL9"
                     /translation="MTKGSEGIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSI
                     DHRGTPDSPGRVATLIPFDGITNNAEFEKDLRTWNSKVVAKQDDLKLLAVAYYIPPEH
                     AQFVTEHLDVREKNGYTAHRIFIHLQPPKSEPLELQALLHKLPVHETTGKHILDSLVY
                     IGTSDNEAFIGPEDINVTAKVISHNLGPSGPNYEYLKLLHDSLTEMADELGQSLEEIE
                     DSYLDSLLKQTEQLRSIVQS"
     gene            complement(<1006574..>1007575)
                     /locus_tag="KLLA0_C11671g"
                     /db_xref="GeneID:2892507"
     mRNA            complement(<1006574..>1007575)
                     /locus_tag="KLLA0_C11671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452721.1"
                     /db_xref="GeneID:2892507"
     CDS             complement(1006574..1007575)
                     /locus_tag="KLLA0_C11671g"
                     /note="highly similar to uniprot|P40093 Saccharomyces
                     cerevisiae YER156C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452721.1"
                     /db_xref="GeneID:2892507"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:Q6CTL8"
                     /translation="MSVSQPLKKAKMSLKQICTHSGSFHADEALAVYMLRLLPQWKDS
                     KIVRSRNPEDWEASDIVVDVGGKYDNGVKFFDHHQRGFSETFNDKYKTKLSSAGLVYK
                     HFGKEIIKELGPGLNEDQVELLYDRVYSQFIESLDANDNGIDQFDTDVEPRFSAKAIT
                     LPSIISRFNPEWNKESSDETYYNQFLKASGYIGTVFFDLVSGYINSWLPAKTLVIDAV
                     KNRFNIDASGKIIELAEFCPWKEHLFQVEREMNIENTIEFVIFPDTSGSYRVSTVPIT
                     STSFDFRKGLPEPLRGLRDEELSEKSGLSGCVFIHAAGFIGGAKPRDSAIGLAKMSL"
     gene            <1008096..>1008494
                     /locus_tag="KLLA0_C11693g"
                     /db_xref="GeneID:2891883"
     mRNA            <1008096..>1008494
                     /locus_tag="KLLA0_C11693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452722.1"
                     /db_xref="GeneID:2891883"
     CDS             1008096..1008494
                     /locus_tag="KLLA0_C11693g"
                     /note="similar to uniprot|P38958 Saccharomyces cerevisiae
                     YDR079W PET100 Chaperone that specifically facilitates the
                     assembly of cytochrome c oxidase located in the
                     mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452722.1"
                     /db_xref="GeneID:2891883"
                     /db_xref="UniProtKB/TrEMBL:Q6CTL7"
                     /translation="MRWRLPFKYTRAQLEVFRFGFCLLAPVAVMYYIGTDTDKKLNVP
                     GFWPDPETLNKIPKEPYEIKAELARMKKERLEKRLRLEKKIAEEFGIDIEAEKEKIRQ
                     EELALKAAQEPVKEEEQEQGLALDKPASSE"
     gene            <1008738..>1010867
                     /locus_tag="KLLA0_C11715g"
                     /db_xref="GeneID:2892552"
     mRNA            <1008738..>1010867
                     /locus_tag="KLLA0_C11715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452723.1"
                     /db_xref="GeneID:2892552"
     CDS             1008738..1010867
                     /locus_tag="KLLA0_C11715g"
                     /note="similar to uniprot|P40094 Saccharomyces cerevisiae
                     YER157W COG3 Essential component of the conserved
                     oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
                     tethering complex that functions in protein trafficking to
                     mediate fusion of transport vesicles to Golgi
                     compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_452723.1"
                     /db_xref="GeneID:2892552"
                     /db_xref="GOA:Q6CTL6"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:Q6CTL6"
                     /translation="MTRSRRSSIVQDIASKNLGSHELPVYTDDLLQILKNIEPHWNPE
                     PLQTANHGIDDKYKEYFDYLEQLDSKNGYYTKLREKSSNIAGKLSLILEKFEVISADT
                     EAFQLSTDPLAKKLLDSEDTYTQIQNELQYFQNLDPISRKLNHYSSPNIVLRDSFKQN
                     FVKIDESLKFLEEHSDYLEADSYRIRFKQCLIRACSLVSDYLNNQIKAINTDITLRLN
                     AGGTQLAANSQDALLYNKFATVAPTYIQLIGTISEHARYDEIESVLKDCVSTYFNSRA
                     RLLKNSIWLQLNQTIVRSNQTVKFIQDNLLYFENLAHREFNLFSQFYPINEDIETSFN
                     EWCMELFEPLYDCVRTRILRETSISTICDSITLLNKYYQMEETSPEYKLQFQHIKIDM
                     LFKPILKECQSRLIFRSQIYVEENINSYKPKVDSFIIRHRKTPKEAKNKANDLDEIST
                     SFFQLDEFNSAYPPLVYGIALLSKIYQMVNSTVFDDIAHTIVHDCIMSLKKAFQLVST
                     NATINLLDTQLSLLKNLLLLRDQIQNFDIQYISKETYLDFSGLLKGINDIRRRTISVF
                     QMGFDTVPKIINNMVDARSELIAELRNTINGITKTAADQITKDYLSISETGDKLLEQN
                     MEVRKSIEINLVSIFDQISNFITNDEVKSHLVDAIQQEVVSRYASYYETLADSAKIDS
                     QKLSEIMYIDVFQNFINNETAKLLAKP"
     gene            complement(<1010903..>1011121)
                     /locus_tag="KLLA0_C11737g"
                     /db_xref="GeneID:2892593"
     mRNA            complement(<1010903..>1011121)
                     /locus_tag="KLLA0_C11737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_452724.2"
                     /db_xref="GeneID:2892593"
     CDS             complement(1010903..1011121)
                     /locus_tag="KLLA0_C11737g"
                     /note="highly similar to uniprot|Q3E7C1 Saccharomyces
                     cerevisiae YDR079C-A TFB5 Component of the RNA polymerase
                     II general transcription and DNA repair factor TFIIH
                     involved in transcription initiation homolog of the
                     Chlamydomonas reinhardtii REX1-S protein which is involved
                     in DNA repair"
                     /codon_start=1