GenomeNet

Database: RefSeq
Entry: NC_006040
LinkDB: NC_006040
Original site: NC_006040 
LOCUS       NC_006040            1715506 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Kluyveromyces lactis strain NRRL Y-1140 chromosome D complete
            sequence.
ACCESSION   NC_006040
VERSION     NC_006040.1
DBLINK      BioProject: PRJNA12377
            BioSample: SAMEA3138170
            Assembly: GCF_000002515.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Kluyveromyces lactis
  ORGANISM  Kluyveromyces lactis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1  (bases 1 to 1715506)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1715506)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1715506)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382124.
            This is an updated version of the complete genome sequence. The
            Kluyveromyces lactis sequence is made of 6 chromosomes (A to F).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1715506
                     /organism="Kluyveromyces lactis"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-1140"
                     /db_xref="taxon:28985"
                     /chromosome="D"
     gene            <4326..>5849
                     /locus_tag="KLLA0_D00143g"
                     /db_xref="GeneID:2893391"
     mRNA            <4326..>5849
                     /locus_tag="KLLA0_D00143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453077.1"
                     /db_xref="GeneID:2893391"
     CDS             4326..5849
                     /locus_tag="KLLA0_D00143g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453077.1"
                     /db_xref="GeneID:2893391"
                     /db_xref="GOA:Q6CQ35"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ35"
                     /translation="MSATLQSIMSENNTTFREKGEAATSLETSNISSAGELKDPGRLE
                     KEQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYY
                     MDSGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALL
                     AAFSTKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIV
                     FNLSTQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDM
                     FKYPVIWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPL
                     VGLAADKFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTS
                     IITRLVGLPKLEAVYSVVWMFLGVCAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTA
                     YLLAALALWCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
     gene            complement(<6536..>6754)
                     /locus_tag="KLLA0_D00157g"
                     /db_xref="GeneID:9487371"
     mRNA            complement(<6536..>6754)
                     /locus_tag="KLLA0_D00157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999319.1"
                     /db_xref="GeneID:9487371"
     CDS             complement(6536..6754)
                     /locus_tag="KLLA0_D00157g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999365.1"
                     /db_xref="GeneID:9487371"
                     /db_xref="UniProtKB/TrEMBL:B5FV68"
                     /translation="MVSLECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNV
                     SAYFENGSFYRWESFATVAATSDFFASH"
     gene            <7837..>8277
                     /locus_tag="KLLA0_D00187g"
                     /db_xref="GeneID:2893130"
     mRNA            <7837..>8277
                     /locus_tag="KLLA0_D00187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453079.2"
                     /db_xref="GeneID:2893130"
     CDS             7837..8277
                     /locus_tag="KLLA0_D00187g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453079.2"
                     /db_xref="GeneID:2893130"
                     /db_xref="UniProtKB/TrEMBL:Q6CSL0"
                     /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLELDMVSNS
                     TSVCFNSTSYTIDVSELPLPEWLDDWDSLLLAMPCDDEIFVSVPKDLDSNTTAKILAY
                     SLASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVHN"
     repeat_region   8289..8700
                     /rpt_type=long_terminal_repeat
     gene            complement(<8764..>9141)
                     /locus_tag="KLLA0_D00209g"
                     /db_xref="GeneID:2892849"
     mRNA            complement(<8764..>9141)
                     /locus_tag="KLLA0_D00209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453080.2"
                     /db_xref="GeneID:2892849"
     CDS             complement(8764..9141)
                     /locus_tag="KLLA0_D00209g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453080.2"
                     /db_xref="GeneID:2892849"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK9"
                     /translation="MSLEVGGPTLFCTEQYVLPIDSSTTLGDAIRCGRSWGSRHPSDD
                     WLPESMDISPPIYNASAPNTDLNSTHRTCGPYFILAGSSNITLLQAWQCGVLAGNRAT
                     SSSSNVVKTPHLLYLMILIAYFV"
     repeat_region   9376..9466
                     /rpt_type=long_terminal_repeat
     gene            complement(<9854..>11626)
                     /locus_tag="KLLA0_D00231g"
                     /db_xref="GeneID:2893072"
     mRNA            complement(<9854..>11626)
                     /locus_tag="KLLA0_D00231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453081.2"
                     /db_xref="GeneID:2893072"
     CDS             complement(9854..11626)
                     /locus_tag="KLLA0_D00231g"
                     /note="uniprot|Q9Y844 Kluyveromyces lactis mal22 Maltase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453081.2"
                     /db_xref="GeneID:2893072"
                     /db_xref="GOA:Q6CSK8"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK8"
                     /translation="MTITKFVSEHPQTDPKWWKEAIVYQVYPASFKDSNHDGWGDIKG
                     IDSKLEYIKELGANAIWICPFYDSPQEDMGYDISDYEKVWPRYGTNEDIFNLIDRAHG
                     LGIKIIVDLVINHCSSEHAWFKEARSSLDNPKRDWFIWKAPKGFDSNGKPIPPNNWRS
                     FFGGSAWEYDEHTGQFYLRLFAKGQPDFNWENEVTRNAIYESAVGFWLDHGVDGFRID
                     TAGLYSKQPGFPDVPIINPGLDFQHPDPAILNGPRIHEFHKEMNKFMRERVKDGRELL
                     TVGEIPCGTHDVCKAYTSAKEQEITQLFEFEHVSVGRKPGNVGVVNFKLSEFKDGIAA
                     AFQFIDKTDSWSTVYIENHDQPRSVTRFGDDSPEYREISAKLLALLETSLTGTLYVYQ
                     GQELGMINFRDWPIEKYEDVEVKGMYKMMVDQFGADSDQVKDYVNGLQLISRDHARTP
                     FPWTSEAPYAGFTDGKEPWFPLTETFQEGINAEDELKDPKSVFNFWKTAIEVRKTHKD
                     VLNYGYDFTFVDHANEKLFAFTKKYGEKVLYVVLNFSKEEIEFSFLEGYNSYDYIFGN
                     YPEAEIDTGSNKLQPWEGRFYYAN"
     gene            <12804..>14534
                     /locus_tag="KLLA0_D00253g"
                     /db_xref="GeneID:2892879"
     mRNA            <12804..>14534
                     /locus_tag="KLLA0_D00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453082.2"
                     /db_xref="GeneID:2892879"
     CDS             12804..14534
                     /locus_tag="KLLA0_D00253g"
                     /note="highly similar to uniprot|Q9Y845 Kluyveromyces
                     lactis mal21 Maltose permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453082.2"
                     /db_xref="GeneID:2892879"
                     /db_xref="GOA:Q6CWZ8"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CWZ8"
                     /translation="MDSSSSVLQKDTKQVDIEHREEASSNDQLVDQNALLDSFLGDVD
                     GAASADATEKSMSLLEGLRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTF
                     GEYNQANDIWEIPSKWQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAF
                     NFILYFANSLTMIAIGQILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIG
                     QVIAAGVLKACQEHLANDELGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQ
                     AKRSVTRILTLPTSEKDKLTDIMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRI
                     TCLTWVMQNLTGSALMGYSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRA
                     GRFTILFWGVFFQTIVMFITGGLGFSSSEGASWGAGSMLLIYNFFYNSTLGPVVYCVV
                     SEIPSDRLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISL
                     VWAYFDLPETKGRTFAELDELFHQRVPARKFNSTHVEPFSRETIMKDLDVNPEVWLET
                     IEEGDTDIKK"
     gene            complement(<15217..>16671)
                     /locus_tag="KLLA0_D00258g"
                     /db_xref="GeneID:9487511"
     mRNA            complement(<15217..>16671)
                     /locus_tag="KLLA0_D00258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999320.1"
                     /db_xref="GeneID:9487511"
     CDS             complement(15217..16671)
                     /locus_tag="KLLA0_D00258g"
                     /note="similar to uniprot|P24031 Saccharomyces cerevisiae
                     YBR092C PHO3 Constitutively expressed acid phosphatase
                     similar to Pho5p; brought to the cell surface by transport
                     vesicles; hydrolyzes thiamin phosphates in the periplasmic
                     space, increasing cellular thiamin uptake; expression is
                     repressed by thiamin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999366.1"
                     /db_xref="GeneID:9487511"
                     /db_xref="GOA:B5FV69"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B5FV69"
                     /translation="MKQIKNAGSNKLRLIMLSILLGLLSLSGTHAAPISKDNGTVCYA
                     LNNSTTDESIFSLLNGQGPHYDYPQSFGIPVEVPDQCTVEHVQMLARHGERYPTASKG
                     KLMIALWDKLKEFQGQYNDPLEVFNDYEFFVSNTKYFDQLTNSTDVDPSNPYAGAKTA
                     QHLGKYIAYNYGDLFSDSNPVFTSSSGRVHQTAKYVVSSLEEELDIQLDLQIIQENET
                     SGANSLTPADSCMTYNGDLGDEYFENATLPYLTDIKNRWMKKNSNLNLTLEHDDIELL
                     VDWCAFETNVKGSSAVCDLFERNDLVAYSYYANVNNFYRRGAGNPMSNPIGSVLVNAS
                     YNLLTQADELDNKVWLSFSHDTDIQQFISALGLIDNGVTEYSLDQVDFQNIQQLSWVT
                     PMGGRIFTEKLKCGNASYVRYIINDVIIPVPGCTSGPGFSCPIEDFDDYITNRLNGID
                     YVSSCEVQQVSNTTELTFYWDYNEVEYNGPVSNK"
     gene            complement(<18273..>21287)
                     /locus_tag="KLLA0_D00264g"
                     /db_xref="GeneID:9487307"
     mRNA            complement(<18273..>21287)
                     /locus_tag="KLLA0_D00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999321.1"
                     /db_xref="GeneID:9487307"
     CDS             complement(18273..21287)
                     /locus_tag="KLLA0_D00264g"
                     /note="some similarities with uniprot|P39712 Saccharomyces
                     cerevisiae YAL063C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999367.1"
                     /db_xref="GeneID:9487307"
                     /db_xref="GOA:B5FV70"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:B5FV70"
                     /translation="MRNSRYSLLVLLAALSNNIQAQSTTDEVIIGCAPAENSLKKGFE
                     VSYYHYPKTEYDVVLKRSTDDFDLDDYLQGGYETYDGGLIGTSSGVTDLTFQTDLGDG
                     WGFPVTVGTMPPNYNYDTPLTVTNFSMLFTGYFYATQTGNYQFNFDYVDEYAFLNIGA
                     GNAFDCCSNSASTPGPFDLAVSNVYPEVIYRKRSIIWSEQNYVNAYLTGGYYYPIRLF
                     FINSADNAELSFSYVDPDGNLHTTFEDSVFSVDDSEDCPVPDLTTTLPWSGTVTTTVT
                     THTEYTDSNSKTTNGNIVIVKTPEVNTATTTYTPWSGTETQTIGTEIVTETGSDDIPT
                     IKTIYTVKTPEVQTATTEYSGWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQ
                     TDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT
                     TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETG
                     SDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTV
                     ETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYT
                     PWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTE
                     TVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTV
                     KTIYTVETPQGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKTIYSVETPAETK
                     PTFSGWASNTTTSDVTSTEPTFSLTTVTTTSNGMTTIYTTTCPIDTTVTESESDATIS
                     DVKSTQPTFSLTTVTTTSNGVTTVYTTTCPIDTTTTESASNEYHTSKSEIDEISTRET
                     SFATGTNKDQSSSVEVTTASQNAEVSSADIAITSDVSSESETRQAQTSSTAETRVVTT
                     TTASTSNLISTYEGSAVKLLATPFIAVILALL"
     gene            complement(<22009..>22491)
                     /locus_tag="KLLA0_D00269g"
                     /db_xref="GeneID:9487434"
     mRNA            complement(<22009..>22491)
                     /locus_tag="KLLA0_D00269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999322.1"
                     /db_xref="GeneID:9487434"
     CDS             complement(22009..22491)
                     /locus_tag="KLLA0_D00269g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999368.1"
                     /db_xref="GeneID:9487434"
                     /db_xref="UniProtKB/TrEMBL:B5FV71"
                     /translation="MRQITMSQNREDTCCVTVCNFECSVKPFNLARRTFSQPWQLRLY
                     GRPQKKTEVKISRNKNRNKKHSSKDLQTFFIAAGVILALVLLQYQTCFAFFFFGFSFP
                     VFLSNLHSLCVVHRKKLHVQSVDLGISKRSTQKNAALPIQMPVLRSSDNKIKKNSGFG
                     "
     gene            complement(<24448..>25623)
                     /locus_tag="KLLA0_D00275g"
                     /db_xref="GeneID:2893125"
     mRNA            complement(<24448..>25623)
                     /locus_tag="KLLA0_D00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453083.1"
                     /db_xref="GeneID:2893125"
     CDS             complement(24448..25623)
                     /locus_tag="KLLA0_D00275g"
                     /note="some similarities with uniprot|P39712 Saccharomyces
                     cerevisiae YAL063C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453083.1"
                     /db_xref="GeneID:2893125"
                     /db_xref="GOA:Q6CSK6"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK6"
                     /translation="MLAKTLALLFLAVPTCVRAQSLEVPQVEPITTETTVFSRGPGQI
                     TTTYSTEVVTDDGTIPTVMTIYYVQIPYFDDDDYVTEETIVTTEYTAWTGTYTTTYST
                     EVLTLSGSPIPTVKTIYKVQTPDTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTD
                     VLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTRWTGTYTTTYSTDIS
                     TETGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTET
                     GEDGYPTIKTIYLVQTPLSFSNTTDGDDDKTSDDNGDDNTTDDDGRTTIEPPTTSTDT
                     TTDQDDNGNGGETSTPSDAPPDSTSSESSTDGSGTTFEGGATRVLATSFFVVLLALL"
     repeat_region   26171..26564
                     /rpt_type=long_terminal_repeat
     gene            complement(<26976..>29273)
                     /locus_tag="KLLA0_D00330g"
                     /db_xref="GeneID:2892773"
     mRNA            complement(<26976..>29273)
                     /locus_tag="KLLA0_D00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453086.1"
                     /db_xref="GeneID:2892773"
     CDS             complement(26976..29273)
                     /locus_tag="KLLA0_D00330g"
                     /note="similar to uniprot|P07337 Kluyveromyces marxianus
                     Beta- glucosidase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453086.1"
                     /db_xref="GeneID:2892773"
                     /db_xref="GOA:Q6CSK3"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR019800"
                     /db_xref="InterPro:IPR026892"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK3"
                     /translation="MIMSKFDVEQKLSELTRDEKISLLSATDFWHTKEIERLGIPSVR
                     VSDGPNGIRGTRFFDSVPSGCFPNGTGLASTFDEELLKEAGKLMAKEAVAKNAAVILG
                     PTTNMQRGPLGGRGFESFSEDPYLAGVATASVVQGIQSEGIAATVKHFVCNDLEDQRF
                     SSNSILSERALREIYLEPFRLAIKNSDPVCLMTALNKVNGEHCPQNKKLLIELLRKEW
                     SWDGMIMSDWFATYTTAASIKNGLDIEFPGPTRWRTNELVSHSLNSREQISIHDVDDR
                     VRQVLKMIKFVVDNQEKTGIVQNGPETTSNNSKETAELLRKIAADSIVLLKNENSVLP
                     LKKEESIVIIGPNAKAKVSSGGGSASLHSYYVISPYEGIVNKVGKEVPYTLGAESHKT
                     LSNLIEQLVVDPSKPAEGDNVGAAAYFYNEPAGARPQGKSPFHVTTFKHSHNMLFDFK
                     HEKIDSSNPLFYITLEGYFTPKEDANYLFGLQVYGTGILYLDDELVVDQKKDQTRGSF
                     CFGAGTDEKTKTVSLQKGKAYKVRIEYGSGPTSELVSEFGSGGFQVGVAKAIDADEEI
                     RKAAKLAAGHDKAILCIGLNAEWESEGHDREDMILPGRTNDLVRAVLEANPNTVIINQ
                     SGTPVEFPWVEQANALLQAWYGGNELGNAIADVLYGDVVPGGKLSLSWPLKLEDNPTY
                     LNFKTEFGRVLYGEDIFIGYRFYEKLQRRVAFPFGYGLSYTEFALSHLQVQTDEEVIS
                     VSVNVKNTGEEYAGIRSRTNLHCCD"
     gene            complement(<29820..>30341)
                     /locus_tag="KLLA0_D00352g"
                     /db_xref="GeneID:2892854"
     mRNA            complement(<29820..>30341)
                     /locus_tag="KLLA0_D00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453087.1"
                     /db_xref="GeneID:2892854"
     CDS             complement(29820..30341)
                     /locus_tag="KLLA0_D00352g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453087.1"
                     /db_xref="GeneID:2892854"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK2"
                     /translation="MHSLNVGYLPYLQVIGSKLAIDFLPNSCSDLKVSEHPPQNTFVD
                     TQVGFASRGQCSKSHRNHFHRTPCSVELKALPERLLFQFSAAKFLRGNRNECTTCSSV
                     PYFNKKKTACILQPLFLPLPSKEPRKGCGRKEGLITSYIYSYDSCFYGNNRARTHKNV
                     EHDGLMSWLCTCS"
     gene            <30962..>32632
                     /locus_tag="KLLA0_D00374g"
                     /db_xref="GeneID:2892800"
     mRNA            <30962..>32632
                     /locus_tag="KLLA0_D00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453088.1"
                     /db_xref="GeneID:2892800"
     CDS             30962..32632
                     /locus_tag="KLLA0_D00374g"
                     /note="similar to gnl|GLV|DEHA0G07139g Debaryomyces
                     hansenii DEHA0G07139g and weakly similar to uniprot|P32466
                     Saccharomyces cerevisiae YDR345C HXT3 Low affinity glucose
                     transporter of the major facilitator superfamily,
                     expression is induced in low or high glucose conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453088.1"
                     /db_xref="GeneID:2892800"
                     /db_xref="GOA:Q6CSK1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK1"
                     /translation="MSSDSVSENAKYEVADSCSADKINADDRHHMIMSDVLPDLGKPF
                     YKVPYLRTLSLFVVGLSLSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAELGVISNGM
                     VFGMLILFQLAPYIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDKKDVF
                     GMFVASRIILGSGVLLISIATPALISEISYPPHRELCTSIYNTCWYLGAIVSAWVTYG
                     CRNLAHHWNWRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGN
                     NEEYAGLIDFELAEIKLAIEQEKASQSTKFSDFIKTSGNRHRLWILIWTAIFTQLSGN
                     GLVSYYLSKVFNSIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISL
                     VSMTSCYVVWTALSAENQKRNFEDKSLANGVLAMIFLYYLSYNFGFNGFPNLYTTEIL
                     PYTLRGKGLTIFQLAISISVIFNGFVNPVAMDAIEWKYYIFYCCFLAVEIVVCYFTFV
                     ETSGRSLEEVDEVFGDGITQLPEVTSQIMLEAGKRLSVEHVERTDTSS"
     gene            complement(<36277..>37362)
                     /locus_tag="KLLA0_D00396g"
                     /db_xref="GeneID:2892888"
     mRNA            complement(<36277..>37362)
                     /locus_tag="KLLA0_D00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453089.1"
                     /db_xref="GeneID:2892888"
     CDS             complement(36277..37362)
                     /locus_tag="KLLA0_D00396g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453089.1"
                     /db_xref="GeneID:2892888"
                     /db_xref="GOA:Q6CSK0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CSK0"
                     /translation="MLKPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDYVV
                     PPRRSDELKKLHHSVSCVKGSVERLLKSSVVSSTSIDDQNEENAYRFGSSSIIELGND
                     DAGCHRASTTTNRNNQSQHQHQNEQVTWVSIQKSLAGVVPSRIIKVSDDFFIRLMLKH
                     SSLLINNFEIDLFDLEEVLFEFMFIVKSLLPSERLPPFNNASQLLSSKEGSLYLISII
                     NFYFDIPNFDYLEFYDHVCSNQSNYQVNQLWLFTNVILYGPAYFSSKVTQFSLPSSCL
                     PLQMQCTGSSLSNDLRPAFAKLYYSSDFKFHCPKLYTLQEKFAIFKGDPLLQLIEFKC
                     KPQRIVHGNSTSMSLSQLSICQFNDQR"
     gene            <38504..>39238
                     /locus_tag="KLLA0_D00418g"
                     /db_xref="GeneID:2893288"
     mRNA            <38504..>39238
                     /locus_tag="KLLA0_D00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453090.1"
                     /db_xref="GeneID:2893288"
     CDS             38504..39238
                     /locus_tag="KLLA0_D00418g"
                     /note="some similarities with uniprot|P32800 Saccharomyces
                     cerevisiae YJL210W PEX2 RING-finger peroxin, peroxisomal
                     membrane protein with a C-terminal zinc-binding RING
                     domain, forms putative translocation subcomplex with
                     Pex10p and Pex12p which functions in peroxisomal matrix
                     protein import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453090.1"
                     /db_xref="GeneID:2893288"
                     /db_xref="GOA:Q6CSJ9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ9"
                     /translation="MSRVAQLDGVSLDLQLTRALQSDLGFPCPQIVVEILVFLLGSRR
                     WHQGSVATYGSVLTGVGYQCSRWRLFAVTVVLRHLLHRFERTNLVYELLDLIHLLQFL
                     TSGTGGPSLLHRLFRVPAVFQPGFSYSDTTSGSSASEVQMLWNASIEMIAGLSLFKNG
                     FVSVTSTNAAAVAAAKAIAGGSSSVGAPGEKFSQKNTLCPVCGEVATNAFTITCCNTR
                     YCYTCALEVEQSHCLVCNTKNPKFFC"
     gene            complement(<39291..>40289)
                     /locus_tag="KLLA0_D00440g"
                     /db_xref="GeneID:2893438"
     mRNA            complement(<39291..>40289)
                     /locus_tag="KLLA0_D00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453091.1"
                     /db_xref="GeneID:2893438"
     CDS             complement(39291..40289)
                     /locus_tag="KLLA0_D00440g"
                     /note="similar to uniprot|P08466 Saccharomyces cerevisiae
                     YJL208C NUC1 Major mitochondrial nuclease has RNAse and
                     DNA endo- and exonucleolytic activities has a role in
                     mitochondrial recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453091.1"
                     /db_xref="GeneID:2893438"
                     /db_xref="GOA:Q6CSJ8"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ8"
                     /translation="MSFSRNAFSALVGVGTVSYFWGKSSALSGGNSGTSFPGSTGSSN
                     NIPSDPSSSNQAGRVSLVGSNVDPGAFFKYGFPGPIHDLETRQEFISCYDRRTRNPYW
                     VLEHITPESLKTKGADRKNSIFKEDEQIPEMFRGRLKDYFRSGYDRGHQAPAANAKFS
                     QQAMDDTFYLTNMCPQVGEGFNRDYWAHLEYFCRQLVDKYNSVRIMTGPLYLPKRDPK
                     DGKFKVTYEMIGNPPNIAVPTHFFKLVVAERPKQLGNGRDDELHVAAFVLPNAPISNS
                     TTLIEFEVPVNALERSSGLQLLQNVPKEKKKELCKQVRCEITVREFNNTVLALPGK"
     gene            <41415..>43202
                     /locus_tag="KLLA0_D00462g"
                     /db_xref="GeneID:2893203"
     mRNA            <41415..>43202
                     /locus_tag="KLLA0_D00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453092.1"
                     /db_xref="GeneID:2893203"
     CDS             41415..43202
                     /locus_tag="KLLA0_D00462g"
                     /note="similar to uniprot|P05066 Saccharomyces cerevisiae
                     YOR386W PHR1 DNA photolyase involved in photoreactivation
                     repairs pyrimidine dimers in the presence of visible light
                     induced by DNA damage regulated by transcriptional
                     repressor Rph1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453092.1"
                     /db_xref="GeneID:2893203"
                     /db_xref="GOA:Q6CSJ7"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018394"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ7"
                     /translation="MRVGNSNSIKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERP
                     LALLGDSIHADSKNSRQQLDDTVDNRLVIHWFRGDLRVRDNTGLAYALNQSKSGSVEA
                     LYVINEHDWIAHMESGWKLKFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREY
                     AQWFSHIIEEIAASKNYDGNSKDDTKDDTDADEPALKKRKKDNDENQKGGSPNILVTA
                     NLQYEVDELYRDLKICRLQTQSSNSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPW
                     YKKWVSFLEANQKDKHTICIEASIPQSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIP
                     KADEETALKKLTEFISKRASKYNNDKDLLDLTGTSLLSCYVTSGVISARTILNQSYQA
                     NNSRLMNKDIKKNNSLETFIKEVAWRDFYKHAISYWPFLSMDLPFKFETLNIKWENDV
                     FLFEKWCYGETGIPIVDAIMLKMLKTGYINNRSRMITASFLAKNLLIDWRWGERWFRK
                     HLIDYDTASNVGGWGFCASTGIDCQPYFRVFNMKLQSEKYDPEGKFIRHWLENDENDS
                     DNVHEPKPNAIVDLRDSRERVLERFREVM"
     gene            <44879..>47893
                     /locus_tag="KLLA0_D00484g"
                     /db_xref="GeneID:2893578"
     mRNA            <44879..>47893
                     /locus_tag="KLLA0_D00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453093.1"
                     /db_xref="GeneID:2893578"
     CDS             44879..47893
                     /locus_tag="KLLA0_D00484g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453093.1"
                     /db_xref="GeneID:2893578"
                     /db_xref="GOA:Q6CSJ6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ6"
                     /translation="MSGALGLQQQAGGVGANGPRTQIRDEELTAHDHVFNVNSNSSEI
                     RTTTGDSSSEEKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDCTYRN
                     QFVFQKNEFPNVGSMNYNSAIMSSSNTNNVSNNNNNGVSNTHSNHGVSMGSMSNNGHL
                     PFTTALNNANQGSTVGLGVGSGGLSIPVAFSYPNGPIPLQLVGNTAVAGIGGGTSSSP
                     TPGSAITSPIGGTSLGFNRTAAPHGSIAYASLKGSIPAAAPYHHQQPNNSGSAGAVST
                     TSGIRSLPPLTVDSTQNLINYTNQQDDSTNQLDVDSNTKAKQESNAASSLLLQQQQQQ
                     QEQHARQAQQSSQQQFQSQNLNFASTPLTHVYPMTQSFGSTGSLAGTESSNTLSQIKR
                     FAPDVQNNFITDTGFDQKKLYQSVKESLANTVRKRTTENMNSSDNLSHNNVISRNNSN
                     NNNNNNNTNNDAYTQFNSGHTQTGSGTLAGGEQTEMVPDTDDTNFDADLVNIRDYIYI
                     SPTDWNFLNLLRFDQNQTRNTTPELAQSSQTNLFKLCWRGASNSEIFSVFSTYDPIQL
                     LYATENPSAATTIPLDDPKLLNFIWTVSRVTLLGGNLILFPFENHFDPLLNDFITMGR
                     KDPVMKDVLIYVTALFMKDAYYNSNLKYFSHIWDRYVRMPTLKRCLDQLTSLIRKSND
                     YCGNISLTFTVTVLFAANSSIKSSDWRTHLRGVHDLFMRVEKLKPAEINQDNIEELAH
                     DCYLFVKDWFCHAEVLAWITSDKGGCFDKQEDLEDLLNNATYSKFNLLNSRMDLLRGY
                     TTDYYPIFTKLSSFLLNLKKRGKDCSGTNMLRSYFTESDPAVIKSFKDMGDSTLKMLE
                     NIRIDDEYIDQATTGLCDIRLRLSMKNCTRMYHYALNLYLELFFLGKPLDKIGLKTKL
                     EKMLECLFSIPFQNTCSIACHWPIYLGAIGSLMIEDKNLYSHFTSVLDSFVSNGMNVA
                     SNSLERLAHISKALSYGDYSALVDPAHDYIVY"
     gene            complement(<48092..>49318)
                     /locus_tag="KLLA0_D00506g"
                     /db_xref="GeneID:2892779"
     mRNA            complement(<48092..>49318)
                     /locus_tag="KLLA0_D00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453094.1"
                     /db_xref="GeneID:2892779"
     CDS             complement(48092..49318)
                     /locus_tag="KLLA0_D00506g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453094.1"
                     /db_xref="GeneID:2892779"
                     /db_xref="GOA:Q6CSJ5"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ5"
                     /translation="MDTIYHARLEALLQDTPIVDTHNDFAWLIRMNLHNQIYKFGFNF
                     NSNRIVSHTSIPKLRKGRVGIQFSSGFVECKNPDQYSTDFNLKSSIVRDTLEIFDITK
                     RLCADYPEHLKFVRSCDEAISTYHNGKIAVPLAIEGLHQIEGSLSVLRQYYELGIRYA
                     TLNHNCDNPFSTAASSIMAGLPDRGLSPLGVECIKEMNRLGIMVDLSHTSYKTMHDVL
                     NVTQAPVIFSHSCAWALTHHERNIRDDVLLRVKESGSVVQVCFYGRFLSQDPKNPETA
                     SIDDLVDHIFYIASLIGWEHVGFGGDYDGMEKAPVGLEDVSKYPDVIYKCMERGASDE
                     DVRGLMGNNLLRVWKSVEIISEIIKSKMLRGRCIEAEWEGREWEYFECFKDVNEVFQG
                     SKELYFSAHKWLPSNH"
     gene            <51518..>54526
                     /locus_tag="KLLA0_D00528g"
                     /db_xref="GeneID:2893313"
     mRNA            <51518..>54526
                     /locus_tag="KLLA0_D00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453095.1"
                     /db_xref="GeneID:2893313"
     CDS             51518..54526
                     /locus_tag="KLLA0_D00528g"
                     /note="similar to uniprot|Q75C89 Ashbya gossypii ACR027C
                     ACR027Cp and some similarities with uniprot|P28273 YKL215C
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453095.1"
                     /db_xref="GeneID:2893313"
                     /db_xref="GOA:Q6CSJ4"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="InterPro:IPR010318"
                     /db_xref="InterPro:IPR024071"
                     /db_xref="InterPro:IPR027479"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ4"
                     /translation="MTNRKLLIGVDVGGTNSDLVVLDPTRLGHPDRGVLAWHKSVTTP
                     DVSVGIQAAIKTILENPNNHIEKSEIVSVTIGTTHFINAVIERDSSRLEKVAVIRLSG
                     PYGRHMPPFGDFPEDLAEIINGYYCTLDGGCRVDGKDIKPLDEDGLRKECANIKTLGI
                     TAVAVVATFANINNDHELRATKIIKEALPNVDVVMSHTISGLGFIERENASILNASIK
                     KFGRKIIKSFIHATKEIGLNCTVLLSQNDGTVLSTKDALETPIRTFSSGATNSMRGAA
                     ILCSDDPDVKNKSVIVCDIGGTTSDVGQLLPSGFPRQSSTFSYVGGVKMNFSMPHVES
                     VGLGGGSIVRDQDGKLTAGPDSTGADIIKEAILFGGDIVTTSDVNIGKRVDEFGVESL
                     DPALKMGTVTNVKGRFTDEFKIRYDKVIATKFERIIDRMKTSPDPIPVIFVGGGSFIA
                     PDTLEGTSKVIKPPFYQVANAIGAALGKVSCTITEMKSLADFENEKTAYIEKLIHRAT
                     EDAINKGAMASSINVVSIISDAVPYVDKVYKFEVKVVGDVDYESALSATQKSVEQVVD
                     DVSSSEGEEVELVPKEDEYVLEEIFKSAKVSRVEKEITNYAHYKPTIINGEWLLSEID
                     IDFISTGAYILGCGGGGDPGPESIELKRIIKQGGKLRIVTLDEFERKTEGKGTAINVG
                     YCGSPVISSERLHGSEMIEAVSLIERWEGKKTDGIFMFEIGGGNGLSGIWTAFKMGLP
                     CVDLDLMGRAYPTQWQSLPSVVHDLHGYPYVSLSDGNGMSMLITSSEDDVQMEDVIRD
                     AMYNHGVQCAVVEPSMTCDEMRNETIFNPISNSWRIGRAVHLTRAASDIDSLPTRIIE
                     AVGGSSAAKCLLKGKIIGVEKMIKRGYGYGVVVLQSTEGDETKIRIPFKNENIVCYKV
                     NEDGSEVPLCCVPDLITLVDNNGNAIGTQDYQYGLLVYLMVFAPSDKWTTAKGIEIGG
                     PRAFGELFYDLEYKSIGKYIEPVPIAEEYS"
     gene            complement(<55088..>56827)
                     /locus_tag="KLLA0_D00550g"
                     /db_xref="GeneID:2893316"
     mRNA            complement(<55088..>56827)
                     /locus_tag="KLLA0_D00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453096.1"
                     /db_xref="GeneID:2893316"
     CDS             complement(55088..56827)
                     /locus_tag="KLLA0_D00550g"
                     /note="weakly similar to uniprot|Q08579 YOR192C
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453096.1"
                     /db_xref="GeneID:2893316"
                     /db_xref="GOA:Q6CSJ3"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ3"
                     /translation="MAGVLGKLHNLLVLDESDRTSNKDLVPMPVSRRKWGIYGFTSYW
                     TLLCLCISTWSGGSALLLYDVGTDGELTLSGMNGRQTIGCIVLANFFISIAAIINSVY
                     GSEYHIGYSVFQRIIFGMRGSSFGVLIRAILSVVWFASQAWLGGLCVNVIISSWSETY
                     LNLPNTFPESVPMTRQELIGFVIFLVINTPVLMIRPEYFDHILALGSFCMFFVGLGIT
                     IWAVTINGGSNGPLLTAKVTASSSDLAWSWITNLNAWYSFIIAGISNQSDFSRFNKRP
                     RSAYIGILIGVNVMGIVLPLMGIVTASALLEKYGESFWMPNDICMYWMQLNYTPKSRA
                     AAFFAGLGLLISQLGVNCISNAISGGMDLASIFPRYINIRRGSILIMLLAWPTQPWLF
                     YNATSTFLTVMSSFTVFITPLTAMFVCDYFVIRKGVIKLSDCYDDSPSSIYWFQYGIN
                     WKNILCFLCGAAPGLPGLINAANPNIPINTGIEHFFQGSFIFQFAVTFALYYIINTIF
                     KPTVGETDQIDYYHTFTERELQEKNMIADDQEDIGVHSIDSSNYLADPTEVSLRNLKI
                     NSPEKSDSTDVVL"
     gene            complement(<57285..>57704)
                     /locus_tag="KLLA0_D00572g"
                     /db_xref="GeneID:2892883"
     mRNA            complement(<57285..>57704)
                     /locus_tag="KLLA0_D00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453097.1"
                     /db_xref="GeneID:2892883"
     CDS             complement(57285..57704)
                     /locus_tag="KLLA0_D00572g"
                     /note="some similarities with uniprot|Q12090 Saccharomyces
                     cerevisiae YLR107W REX3 RNA exonuclease; required for
                     maturation of the RNA component of RNase MRP; functions
                     redundantly with Rnh70p and Rex2p in processing of U5
                     snRNA and RNase P RNA; member of RNase D family of
                     exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453097.1"
                     /db_xref="GeneID:2892883"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ2"
                     /translation="MHLNVRTLSPYSIGSQFLGNASRKMHLATNHHFHISAFCGDMMV
                     QRLLILKTKPRKNLKASSKINLKTIINSHWSDVGKNKVHDTGQIWLLHSTLLKKNDSI
                     IVDWVNKTKKPNPANTASMARFTQNFKEPTETGACFC"
     gene            complement(<57894..>58856)
                     /locus_tag="KLLA0_D00594g"
                     /db_xref="GeneID:2893296"
     mRNA            complement(<57894..>58856)
                     /locus_tag="KLLA0_D00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453098.1"
                     /db_xref="GeneID:2893296"
     CDS             complement(57894..58856)
                     /locus_tag="KLLA0_D00594g"
                     /note="highly similar to uniprot|P41819 Saccharomyces
                     cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
                     responsible for conserved m6(2)Am6(2)A dimethylation in
                     3'-terminal loop of 18 S rRNA part of 90S and 40S
                     pre-particles in nucleolus involved in pre-ribosomal RNA
                     processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453098.1"
                     /db_xref="GeneID:2893296"
                     /db_xref="GOA:P78697"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /translation="MGKAVKKKYSGASSGGKEVDAEKHLTTVFKFNTDLGQHILKNPL
                     VAQGIVDKAQIKPSDIVLEIGPGTGNLTVRILEQARKVVAVEFDPRMAAELTKRVHGT
                     PVEKKLEILLGDFMKTELPYFDVCISNTPYQISSPLVFKLINQPKPPRVSILMFQREF
                     AMRLLARPGDSLYCRLSANVQMWANVTHIMKVGKNNFRPPPKVESSVVRIEIKNPRPQ
                     VDFNEWDGLLRIVFVRKNRTIAAGFKSTTVLEILEKNYKAFLATQSAVPTTSSGDSLI
                     NEVKEKIEQVLSETGLAEKRAGKCDQTDFLKLLYGFHQVGIHFA"
     gene            complement(<59155..>59844)
                     /locus_tag="KLLA0_D00616g"
                     /db_xref="GeneID:2892987"
     mRNA            complement(<59155..>59844)
                     /locus_tag="KLLA0_D00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453099.1"
                     /db_xref="GeneID:2892987"
     CDS             complement(59155..59844)
                     /locus_tag="KLLA0_D00616g"
                     /note="similar to uniprot|Q08981 Saccharomyces cerevisiae
                     YPL267W ACM1 Protein of unknown function potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453099.1"
                     /db_xref="GeneID:2892987"
                     /db_xref="UniProtKB/TrEMBL:Q6CSJ0"
                     /translation="MIQHRSPLKKRAVLTSKNVNIISTGNSITKPTGSTSSHGSPRRI
                     KTKLDVERALQKSPVKQVFSIKRGSPKKKGDDDPSSFAFYEESEEDRAVALMRHVSLR
                     RKAVHDENEQELENIDENKLAKVRAQATQNRGSNGTAISPLQDLDIELFPGTIQYRGF
                     SQEHHLNLHLNHTRKLPEYITPPRNAKLKDFFVHETHVNDKDQVFSKTTDDINANKVV
                     RKLQFCIDENR"
     gene            complement(<60190..>63120)
                     /locus_tag="KLLA0_D00638g"
                     /db_xref="GeneID:2892722"
     mRNA            complement(<60190..>63120)
                     /locus_tag="KLLA0_D00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453100.1"
                     /db_xref="GeneID:2892722"
     CDS             complement(60190..63120)
                     /locus_tag="KLLA0_D00638g"
                     /note="similar to uniprot|Q75C92 Ashbya gossypii ACR024W
                     ACR024Wp and weakly similar to YPL268W uniprot|P32383
                     Saccharomyces cerevisiae YPL268W PLC1
                     Phosphoinositide-specific phospholipase C hydrolyzes
                     phosphatidylinositol 4 5-biphosphate (PIP2) to generate
                     inositol 1 4 5-triphosphate (IP3) and 1 2-diacylglycerol
                     (DAG) involved in kinetochore function and pseudohyphal
                     differentiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453100.1"
                     /db_xref="GeneID:2892722"
                     /db_xref="GOA:Q6CSI9"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI9"
                     /translation="MDPFMVSCYMMTSQKRLVEPSMRLEFNDVDDEHQAIMPQSILRS
                     LSLEDGSNSDMSSKSTAPSSGSEESFVYDHIYKGIKGFLSRRPSFNGHGNSNNNPNKN
                     KTSQLGGPLTYALSSNLRLESTDSGFGSFSADPLDLPLLKVTRRKRVRYTFHIDQNTI
                     SWNNGKKLIYVDTIKDIRSGDMATNYMDMYNVPCPSRDLWCTIIYSVNKNRLKALHVI
                     AEDAAVFKSFYETTVNLVNSRRKLMEDIAVPNNEQFANIHWQTSVSTKKEDQDKDTLS
                     FADVKRLCNRYHIYCSDNYLYALFIKADTNNNSLLNFPEFQDFVKYLKARPEIEIIWN
                     QMKNKDTKVVDFQSFYQFICDVQGEVISQTNAYKIFKKYCTADELLDVEGLLKFLTKQ
                     PFLQLFEEDYSRPLNEYFISSSHNTYLMGKQVVDEVSVEAYTRALQQGCRCIEIDIWQ
                     GDHGPVVCHGLFTQSIPLEDVVKTIRKYAFITSPYPLIVSLEIHCKKDYQLMITKIMK
                     EILGDLIFVIPPNTSLLSPEQLKNRIILKSKKTHAVESEIISGSTSSYTSSSSHESLS
                     ETNDMRLIKKRGLQKSTTSSTSPNTTTVPVTTKRNNKSLLLSTKIMISDKVHEISGIH
                     GVRFRNFSLPESKTTTHCFSLSEKKFINLDKDETQKLAINKHNRRHLMRIYPHMLRYK
                     SSNFNPIRFWKEGVQMVATNWQTYDLGQQLNHAMFQVSLDRNSIWHSGYVLKPAHLRK
                     EIHKMKDIPVIMERLKREKIHIHLDVISGQMLSLQNCKILAPFVEIELITDNTMESLH
                     LTNCLQPMGYTSNNSTHATGITSMSNASNGTFANITSTSTKRVDSNGSSGKTEPLCES
                     NGTTVISGLSAEDGILSTPSAPPAVSVPVLSSPQLFSTKCFRDNGFSPVWNASFECTL
                     TNTTFNFVRFTVKNSTQTIATTCVRLNYLKQGYRHLPLYNIKGEKFIFSTLFIRYKEE
                     LLKW"
     gene            <63920..>64846
                     /locus_tag="KLLA0_D00660g"
                     /db_xref="GeneID:2893524"
     mRNA            <63920..>64846
                     /locus_tag="KLLA0_D00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453101.1"
                     /db_xref="GeneID:2893524"
     CDS             63920..64846
                     /locus_tag="KLLA0_D00660g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453101.1"
                     /db_xref="GeneID:2893524"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI8"
                     /translation="MSLTLAYYYALLILATLATATAVPQYTFYEDHNDFRVSYNLPTD
                     VRDKYNILRDNSSLNYSMIGNYGVATYVNLVNMLPKSIEPMKIGETMNYHIRNNISDV
                     SSVIAALGLDCVVLDDKLNEFFNSTPIRKSYDDSYISKRNEQCSDGWWFNHYDSLIKM
                     YERRGNLKAWLREHFWINTTSFIKLGRNMATVCNYIAGALKRGSTKTSCNGFSYWLNL
                     DALGEDRLTYMVGIAPFTSGKNCDTQVSIDSIKALISNWLIDTADHNMAPYCTRFHDA
                     GSWWADVRLIVWDETANVEARLFGLVLAKAIS"
     gene            <65058..>65771
                     /locus_tag="KLLA0_D00682g"
                     /db_xref="GeneID:2893413"
     mRNA            <65058..>65771
                     /locus_tag="KLLA0_D00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453102.1"
                     /db_xref="GeneID:2893413"
     CDS             65058..65771
                     /locus_tag="KLLA0_D00682g"
                     /note="highly similar to uniprot|Q04432 Saccharomyces
                     cerevisiae YDR533C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453102.1"
                     /db_xref="GeneID:2893413"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI7"
                     /translation="MTRVLIALTSYNEAFFTDGAKTGVFAVEALHPFNYYKEQGYDVD
                     FVSETGKYGFDEHSLSADFLSGKDKEQFEDKNSAFNQALAKTKVAADVNPSTYKIFFA
                     SAGHGTLFDYPTAKNLQKIASDIYANNGVVAAVCHGPAIFDGLTDKDTGKPLIQGKVI
                     TGFTDIGEEILGVADILKQKKLDTVEDIAKKYHAKYMAPIGPWDDFSIADGRLVTGVN
                     PASASSTAKRTDQVLNSLN"
     gene            <66841..>67554
                     /locus_tag="KLLA0_D00704g"
                     /db_xref="GeneID:2893218"
     mRNA            <66841..>67554
                     /locus_tag="KLLA0_D00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453103.1"
                     /db_xref="GeneID:2893218"
     CDS             66841..67554
                     /locus_tag="KLLA0_D00704g"
                     /note="highly similar to uniprot|Q04432 Saccharomyces
                     cerevisiae YDR533C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453103.1"
                     /db_xref="GeneID:2893218"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI6"
                     /translation="MTKVLIALTCYNDTFYADGTKTGVFVVEALHPFNYYKEQGYDVD
                     FVSETGKYGFDEHSLSADFLSGKDKEQFEDKNSAFNQALAKTKVAADVNPSTYKIFFA
                     SAGHGTLFDYPTAKNLQKIASDIYANNGVVAAVCHGPAIFDGLTDKDTGKPLIQGKVI
                     TGFTDIGEEILGVADILKQKKLDTVEDIAKKYHAKYMAPIGPWDDFSIADGRLVTGVN
                     PASASSTAKRTVQVLNSLN"
     gene            complement(<67744..>69450)
                     /locus_tag="KLLA0_D00726g"
                     /db_xref="GeneID:2893321"
     mRNA            complement(<67744..>69450)
                     /locus_tag="KLLA0_D00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453104.1"
                     /db_xref="GeneID:2893321"
     CDS             complement(67744..69450)
                     /locus_tag="KLLA0_D00726g"
                     /note="weakly similar to uniprot|P32526 Saccharomyces
                     cerevisiae YPL269W KAR9 Karyogamy protein required for
                     correct positioning of the mitotic spindle and for
                     orienting cytoplasmic microtubules localizes at the shmoo
                     tip in mating cells and at the tip of the growing bud in
                     small-budded cells through anaphase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453104.1"
                     /db_xref="GeneID:2893321"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI5"
                     /translation="MAEELKGFPHERLSISLRSNSQQYQDILLFFDDYQFDLDSTNQH
                     LCSLAELLLKSHTLLAELFSDDVSVSQLLPYFDWIQEGRSEFYQLFNGIKTIEKVLLH
                     LMEIIEEEFGCNEDELFQKELTALFDLLEEISDTLVSIKPIISSLKNLFDTAIEFNEI
                     FKDHMNSLDEEIENNLSKCIELQEQNFESPVRHNKPTFTLDQLIKTLSSTNSPTKGLQ
                     IPAFSPSEQKIHEKLTQLEDSSAPIDLSLKHVLSERLDNFETRDVVNLEYLMRLLRKK
                     YQYILDKYELLQVELRDLKQAIVDEKWVLIFTTLNDELRIMLKDVEKLLLKVGNPDLS
                     EQLKTKLHDQLRSKSYTIDKTFGIIYNALESSILNESIATVTNEHAEKWLQLNTKFEH
                     LLPEHQNENDPNKTITQLSNDISELRLNDAPSEKPGSNRSSIGAILFKKMNIKPVLVR
                     EGDENDSNSDNVKCDRHRYSNPFFDPCQATKLSPKKVLNFNKVPALSFEQQLSILGTL
                     ESRAYDINRLKQYGKLPTRIPRLPFQRQKIIPHRTILFNFDANWVKKDNHQLKFPVSY
                     VS"
     gene            complement(<69839..>72208)
                     /locus_tag="KLLA0_D00748g"
                     /db_xref="GeneID:2893314"
     mRNA            complement(<69839..>72208)
                     /locus_tag="KLLA0_D00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453105.1"
                     /db_xref="GeneID:2893314"
     CDS             complement(69839..72208)
                     /locus_tag="KLLA0_D00748g"
                     /note="similar to uniprot|P33311 Saccharomyces cerevisiae
                     YPL270W MDL2 Half-type ATP-binding cassette (ABC)
                     transporter of the inner mitochondrial membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453105.1"
                     /db_xref="GeneID:2893314"
                     /db_xref="GOA:Q6CSI4"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI4"
                     /translation="MLKPVLGLRGSIGRGRGLLALSNPLLSITRRFDDRLSLPISSIR
                     TLNYAVNRFGEMKGNQRFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTN
                     KPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNA
                     LSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLL
                     KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGF
                     KALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTK
                     VAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSF
                     LLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFEL
                     LDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP
                     SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRE
                     NITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIAR
                     ALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVI
                     VLGIDGSVVEMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAITQESEPQTEE
                     NGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP"
     gene            <73422..>76484
                     /locus_tag="KLLA0_D00792g"
                     /db_xref="GeneID:2893063"
     mRNA            <73422..>76484
                     /locus_tag="KLLA0_D00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453107.1"
                     /db_xref="GeneID:2893063"
     CDS             73422..76484
                     /locus_tag="KLLA0_D00792g"
                     /note="similar to uniprot|P39985 Saccharomyces cerevisiae
                     YEL055C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453107.1"
                     /db_xref="GeneID:2893063"
                     /db_xref="GOA:Q6CSI2"
                     /db_xref="InterPro:IPR007015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI2"
                     /translation="MKEDQVVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRE
                     SEDGVREWEYVIGRLVKGLASNRGGARLGFSMCLTEVIALALERRDILPSIYAFLNQL
                     EQTLPAGTAFKNGKEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLN
                     KLIQLALSKTWLREPCLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLS
                     IYLMFNAQRDTYSSSLVIHNSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTW
                     APRLHYVWDILLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVV
                     DESFFNEKSSNERKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNK
                     ISTQALKSIVAECERSPAKVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKE
                     HLVDLVNLLISQLPQDQSTKDSFNLTRFIFDTFLHITRAHKTRLESHWVKPLLSAIIK
                     AAFFNESDNSKLSELAKERLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGST
                     LSIDLDEDLESVRKSAIKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVS
                     ILQDLISFYEECDKESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELN
                     VLLQTLTARENKQGFADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSE
                     DDVSEEDKDAALEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDD
                     DFSGEDESMDDEAMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHR
                     VVDMLEIYVKSFDRAVARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKL
                     MKLRLCKVKATIAKEEKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLS
                     KLYLSSGGSHENLIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKRAA"
     gene            complement(<76687..>77913)
                     /locus_tag="KLLA0_D00814g"
                     /db_xref="GeneID:2892824"
     mRNA            complement(<76687..>77913)
                     /locus_tag="KLLA0_D00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453108.1"
                     /db_xref="GeneID:2892824"
     CDS             complement(76687..77913)
                     /locus_tag="KLLA0_D00814g"
                     /note="similar to uniprot|P39984 Saccharomyces cerevisiae
                     YEL056W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453108.1"
                     /db_xref="GeneID:2892824"
                     /db_xref="GOA:Q6CSI1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /translation="MTEVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQ
                     WLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAK
                     ENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHG
                     AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV
                     NDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA
                     GTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNI
                     GAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI
                     VRPPQPPADFDITTLE"
     gene            complement(<78202..>80124)
                     /locus_tag="KLLA0_D00836g"
                     /db_xref="GeneID:2893255"
     mRNA            complement(<78202..>80124)
                     /locus_tag="KLLA0_D00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453109.1"
                     /db_xref="GeneID:2893255"
     CDS             complement(78202..80124)
                     /locus_tag="KLLA0_D00836g"
                     /note="similar to uniprot|Q08979 Saccharomyces cerevisiae
                     YPL263C KEL3 Cytoplasmic protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453109.1"
                     /db_xref="GeneID:2893255"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:Q6CSI0"
                     /translation="MAKKKDKESKKARTEAKNKKALEKAAVKDKKKAKKLSQDEEEDD
                     MDIEEMLANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQE
                     TGTTHFYNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQN
                     TFYHYSDSWLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYL
                     NDLWVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKG
                     KILSDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETE
                     ESLRSIFYNELYTYQIENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDK
                     ANLRDAEDDDESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAV
                     VDDTLFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDD
                     EFGDEDDDDEDDGEEEIVDSKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETL
                     RAFYVRTGPTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGG
                     VEDVIEKDTSKTQRRR"
     gene            complement(<80327..>81952)
                     /locus_tag="KLLA0_D00858g"
                     /db_xref="GeneID:2893051"
     mRNA            complement(<80327..>81952)
                     /locus_tag="KLLA0_D00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453110.1"
                     /db_xref="GeneID:2893051"
     CDS             complement(80327..81952)
                     /locus_tag="KLLA0_D00858g"
                     /note="similar to uniprot|P38628 Saccharomyces cerevisiae
                     YEL058W PCM1 Essential N-acetylglucosamine-phosphate
                     mutase a hexosephosphate mutase involved in the
                     biosynthesis of chitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453110.1"
                     /db_xref="GeneID:2893051"
                     /db_xref="GOA:Q6CSH9"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH9"
                     /translation="MSFRDLYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVL
                     RSIYLKSKFVGVMITASHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQL
                     ESTLQSIIAELNIDTTQLANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTT
                     PQLHFLVYSLNTSSQPSQVRDSTYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGA
                     DKVKQLISQAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLY
                     CSFDGDADRVVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQT
                     AYANGSSTKYITDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFL
                     ETVDSRLQETSGNEQQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDW
                     DGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRAS
                     GTEDAVRVYAEAETTESAIELATKVGELVKLFG"
     gene            <82211..>82426
                     /locus_tag="KLLA0_D00880g"
                     /db_xref="GeneID:2892775"
     mRNA            <82211..>82426
                     /locus_tag="KLLA0_D00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453111.1"
                     /db_xref="GeneID:2892775"
     CDS             82211..82426
                     /locus_tag="KLLA0_D00880g"
                     /note="uniprot|P78699 Kluyveromyces lactis KLLA0D00880g
                     SOM1 Protein SOM1 mitochondrial precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453111.1"
                     /db_xref="GeneID:2892775"
                     /db_xref="GOA:P78699"
                     /db_xref="InterPro:IPR024645"
                     /translation="MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTP
                     FKRLFEQCMVKDGRVLNIEVTNLNTNR"
     gene            <83648..>85126
                     /locus_tag="KLLA0_D00902g"
                     /db_xref="GeneID:2893546"
     mRNA            <83648..>85126
                     /locus_tag="KLLA0_D00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453112.1"
                     /db_xref="GeneID:2893546"
     CDS             83648..85126
                     /locus_tag="KLLA0_D00902g"
                     /note="highly similar to uniprot|P08417 Saccharomyces
                     cerevisiae YPL262W FUM1 Fumarase converts fumaric acid to
                     L-malic acid in the TCA cycle cytosolic and mitochondrial
                     localization determined by the N-terminal mitochondrial
                     targeting sequence and protein conformation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453112.1"
                     /db_xref="GeneID:2893546"
                     /db_xref="GOA:Q6CSH7"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH7"
                     /translation="MLRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVP
                     SDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPI
                     KQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNN
                     HCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQ
                     DATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAE
                     QVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGY
                     GELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKPV
                     MISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS
                     KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE"
     gene            complement(85441..85556)
                     /locus_tag="KLLA0_D00935r"
                     /db_xref="GeneID:2892790"
     tRNA            complement(join(85441..85485,85518..85556))
                     /locus_tag="KLLA0_D00935r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2892790"
     gene            <86703..>88388
                     /locus_tag="KLLA0_D00979g"
                     /db_xref="GeneID:2892752"
     mRNA            <86703..>88388
                     /locus_tag="KLLA0_D00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453114.1"
                     /db_xref="GeneID:2892752"
     CDS             86703..88388
                     /locus_tag="KLLA0_D00979g"
                     /note="similar to uniprot|P09232 Saccharomyces cerevisiae
                     YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
                     protease of the subtilisin family involved in protein
                     degradation in the vacuole and required for full protein
                     degradation during sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453114.1"
                     /db_xref="GeneID:2892752"
                     /db_xref="GOA:Q6CSH5"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH5"
                     /translation="MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASS
                     DLDKPQHHANGKARSKSRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYI
                     IVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGI
                     QDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARI
                     SHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD
                     GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVE
                     EQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAEN
                     AITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVG
                     LLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGG
                     QDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII"
     gene            <88911..>89600
                     /locus_tag="KLLA0_D01001g"
                     /db_xref="GeneID:2893100"
     mRNA            <88911..>89600
                     /locus_tag="KLLA0_D01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453115.1"
                     /db_xref="GeneID:2893100"
     CDS             88911..89600
                     /locus_tag="KLLA0_D01001g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453115.1"
                     /db_xref="GeneID:2893100"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH4"
                     /translation="MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKVNLQHNSA
                     GQIKSDKTLPKLSNLKDKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQT
                     VQQDIYQEYIPSRIHTTGRESSKHRKIKLTNRRSANPQRQSESIGTIVTQSTPIPVSS
                     NIDQPSILNTFSSSLKSVFDYVDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWYIEL
                     LIILIARSVYQ"
     gene            <89887..>90693
                     /locus_tag="KLLA0_D01023g"
                     /db_xref="GeneID:2892910"
     mRNA            <89887..>90693
                     /locus_tag="KLLA0_D01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453116.1"
                     /db_xref="GeneID:2892910"
     CDS             89887..90693
                     /locus_tag="KLLA0_D01023g"
                     /note="similar to uniprot|Q12339 Saccharomyces cerevisiae
                     YOR004W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453116.1"
                     /db_xref="GeneID:2892910"
                     /db_xref="GOA:Q6CSH3"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH3"
                     /translation="MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFD
                     FVKGLQRTLQAEVKPMITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLEC
                     LTSVVDVNGKNKHRYVVATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSR
                     EVEEQKLYKGLNDPKFAGIARDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKTTES
                     TGSISSLSASSNNISTPTEAGDVSGTSKNKRRRKHKKSNDKPNDSADSIQ"
     gene            <91110..>94007
                     /locus_tag="KLLA0_D01045g"
                     /db_xref="GeneID:2893511"
     mRNA            <91110..>94007
                     /locus_tag="KLLA0_D01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453117.1"
                     /db_xref="GeneID:2893511"
     CDS             91110..94007
                     /locus_tag="KLLA0_D01045g"
                     /note="similar to uniprot|Q8J1G7 Ashbya gossypii ACR010C
                     CIN8 Kinesin-like protein CIN8 and some similarites with
                     YEL061C uniprot|P27895 Saccharomyces cerevisiae YEL061C
                     CIN8 Kinesin motor protein involved in mitotic spindle
                     assembly and chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453117.1"
                     /db_xref="GeneID:2893511"
                     /db_xref="GOA:Q6CSH2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH2"
                     /translation="MSATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIG
                     ANEVSINTSGDIGITARMNSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTM
                     LVYGMTSTGKTYTMTGDEKLYDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIE
                     LYNEELKDLLDDGQDSGGNNSRKLRIYDSLNSSNNVTNVNSRSSSRSNSPTVNLEAKR
                     RIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQE
                     FHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINL
                     VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ
                     DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNIS
                     HELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLH
                     KDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA
                     LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDS
                     LETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ
                     ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQN
                     RTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSL
                     KSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEK
                     NVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTP
                     LRPLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGNSKKQR"
     gene            complement(<94114..>96096)
                     /locus_tag="KLLA0_D01067g"
                     /db_xref="GeneID:2892697"
     mRNA            complement(<94114..>96096)
                     /locus_tag="KLLA0_D01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453118.1"
                     /db_xref="GeneID:2892697"
     CDS             complement(94114..96096)
                     /locus_tag="KLLA0_D01067g"
                     /note="similar to uniprot|P39923 Saccharomyces cerevisiae
                     YEL062W NPR2 Regulator of nitrogen permeases transcription
                     is induced in response to proline and urea contains two
                     PEST sequences"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453118.1"
                     /db_xref="GeneID:2892697"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="UniProtKB/TrEMBL:Q6CSH1"
                     /translation="MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFD
                     TIKNYIIPKPQLCNKLLTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATS
                     PYEPAIARLGKMFKVLEEQSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT
                     DIKSTGDDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIK
                     LFPVRTPPSSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARS
                     DVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL
                     KQSLLPFEGRPNNIYPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSS
                     TSSYFRAHASENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRD
                     NRIDVRKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFS
                     AADIKVVDTKEEGNQSDKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNA
                     FTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLES
                     LSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS"
     gene            complement(<97438..>100161)
                     /locus_tag="KLLA0_D01089g"
                     /db_xref="GeneID:2892937"
     mRNA            complement(<97438..>100161)
                     /locus_tag="KLLA0_D01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453119.1"
                     /db_xref="GeneID:2892937"
     CDS             complement(97438..100161)
                     /locus_tag="KLLA0_D01089g"
                     /note="similar to uniprot|Q08387 Saccharomyces cerevisiae
                     YOR005C DNL4 DNA ligase required for nonhomologous
                     end-joining (NHEJ) forms stable heterodimer with required
                     cofactor Lif1p catalyzes DNA ligation as part of a complex
                     with Lif1p and Nej1p involved in meiosis not essential for
                     vegetative growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453119.1"
                     /db_xref="GeneID:2892937"
                     /db_xref="GOA:Q6CSH0"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR029710"
                     /translation="MNDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLE
                     IITNFIKLWRSTVGNYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETEN
                     RLLRWKQRAARGVKLSDFCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMG
                     YMALTDSRAFNYCLNHMTFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVS
                     DLDVLSQRLYNPNERLRQTDLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKM
                     DGERLQIHYINYGEQIKYLSRRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEM
                     ITYDTEKDIVLPFGLVKSSAMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLA
                     LERRKDYLTKILTPVERSVEIIQYMKAINAEAIKDSLEQAISMGSEGIVLKHLHSKYF
                     VGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGKKDSFFCGLSISDPNEVAEKPRFIS
                     FCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEV
                     KARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRK
                     SHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQ
                     EDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSC
                     IEEGYKTPFTESDIFRGELESSMDCSQFYTDFNTASLNHLLETANRGIKNPDSDLLLP
                     EVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELVHIENASIIIVFNDFISRE
                     DLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL"
     gene            complement(<100315..>101259)
                     /locus_tag="KLLA0_D01111g"
                     /db_xref="GeneID:2892859"
     mRNA            complement(<100315..>101259)
                     /locus_tag="KLLA0_D01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453120.1"
                     /db_xref="GeneID:2892859"
     CDS             complement(100315..101259)
                     /locus_tag="KLLA0_D01111g"
                     /note="similar to uniprot|Q12094 Saccharomyces cerevisiae
                     YOR006C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453120.1"
                     /db_xref="GeneID:2892859"
                     /db_xref="GOA:Q6CSG9"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG9"
                     /translation="MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFP
                     VKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVE
                     ENGASVVECSWARLDEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFA
                     IVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIE
                     RKQQAKTEDIWMIGNVNRASRDLPGSSGEEEEEDYLNGDSLIDVRDIKYDSLGNVISY
                     NDEEEDEEGEGEVSEHELANEDIGISCELSSLSLQDTV"
     gene            <101580..>104783
                     /locus_tag="KLLA0_D01133g"
                     /db_xref="GeneID:2893170"
     mRNA            <101580..>104783
                     /locus_tag="KLLA0_D01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453121.1"
                     /db_xref="GeneID:2893170"
     CDS             101580..104783
                     /locus_tag="KLLA0_D01133g"
                     /note="some similarities with uniprot|Q04257 Saccharomyces
                     cerevisiae YML002W and some similarities with
                     uniprot|Q04257 Saccharomyces cerevisiae YML003W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453121.1"
                     /db_xref="GeneID:2893170"
                     /db_xref="GOA:Q6CSG8"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="InterPro:IPR020683"
                     /translation="MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVP
                     STETLLQFQDLESGLELAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGR
                     KLSIRYRNSTIVTGDGFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLV
                     PLDELQVFSKVAGNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTK
                     ARIKKAISVIGIRTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQ
                     LSEIVEDQELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYL
                     KSIDLKTTHSGKLEVLSTTMRLLSREINGISTDADTLLSLFVLLICRSQVTGLVRTLT
                     YLTNFEISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSK
                     VEAELLSSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALS
                     TLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLES
                     VGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHE
                     DPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERL
                     LCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVVIHSLRFEERKWKIGIFSEGIF
                     KKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDM
                     LFSYVNTRGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAE
                     FQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYD
                     LSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWKHFGELMELKKEWKKNFPNDKAP
                     PSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIE
                     FKEQFYHDHIVKSIVDQRIRENKQIMQQLIDTMKGHV"
     gene            complement(<104847..>105854)
                     /locus_tag="KLLA0_D01155g"
                     /db_xref="GeneID:2893412"
     mRNA            complement(<104847..>105854)
                     /locus_tag="KLLA0_D01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453122.1"
                     /db_xref="GeneID:2893412"
     CDS             complement(104847..105854)
                     /locus_tag="KLLA0_D01155g"
                     /note="similar to uniprot|Q12118 Saccharomyces cerevisiae
                     YOR007C SGT2 Glutamine-rich cytoplasmic protein of unknown
                     function contains tetratricopeptide (TPR) repeats which
                     often mediate protein-protein interactions conserved in
                     human and C. elegans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453122.1"
                     /db_xref="GeneID:2893412"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG7"
                     /translation="MSLSNKEIAALIVDFLSSSSSSVNEDYVDSLNVAIDCITEAFQF
                     ERDETDSLISGPFNGKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQG
                     NKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP
                     TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNL
                     EKSSTSASSEDVSDKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAE
                     KMMQNPGLMQDMMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQ
                     Q"
     gene            complement(106277..106366)
                     /locus_tag="KLLA0_D01177r"
                     /db_xref="GeneID:2893530"
     tRNA            complement(join(106277..106313,106329..106366))
                     /locus_tag="KLLA0_D01177r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2893530"
     gene            complement(<106736..>108436)
                     /locus_tag="KLLA0_D01221g"
                     /db_xref="GeneID:2893345"
     mRNA            complement(<106736..>108436)
                     /locus_tag="KLLA0_D01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453123.1"
                     /db_xref="GeneID:2893345"
     CDS             complement(106736..108436)
                     /locus_tag="KLLA0_D01221g"
                     /note="similar to uniprot|Q12001 Saccharomyces cerevisiae
                     YOR002W ALG6 Glucosyltransferase involved in transfer of
                     oligosaccharides from dolichyl pyrophosphate to asparagine
                     residues of proteins during N-linked protein glycosylation
                     mutations in human ortholog are associated with disease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453123.1"
                     /db_xref="GeneID:2893345"
                     /db_xref="GOA:Q6CSG6"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG6"
                     /translation="MGLKKKQTPKNAVKKTVSSLPANAETTTSTAIMKKVESVEAFFA
                     SPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQRHWM
                     EITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESLN
                     LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHG
                     HFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTY
                     SPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANF
                     WCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSF
                     FLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQY
                     GVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGS
                     YIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL
                     "
     gene            complement(<108848..>109783)
                     /locus_tag="KLLA0_D01243g"
                     /db_xref="GeneID:2893016"
     mRNA            complement(<108848..>109783)
                     /locus_tag="KLLA0_D01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453124.1"
                     /db_xref="GeneID:2893016"
     CDS             complement(108848..109783)
                     /locus_tag="KLLA0_D01243g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453124.1"
                     /db_xref="GeneID:2893016"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG5"
                     /translation="MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPF
                     LMLDNFDVSPPAGFPEHPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKA
                     IVHSEIPVKMDNGESTQGLQLWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVI
                     SGESYGVKSLTELAYTPVEFYHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEY
                     PESSAIFFKNDGDGIRGFTTSDNAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQN
                     YQNGVNGFENARTWSPVIKNGVTEAEVQQYLPKGN"
     gene            <110784..>111407
                     /locus_tag="KLLA0_D01265g"
                     /db_xref="GeneID:2893025"
     mRNA            <110784..>111407
                     /locus_tag="KLLA0_D01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453125.1"
                     /db_xref="GeneID:2893025"
     CDS             110784..111407
                     /locus_tag="KLLA0_D01265g"
                     /note="highly similar to uniprot|P32939 Saccharomyces
                     cerevisiae YML001W YPT7 Gtp-binding protein of the rab
                     family required for homotypic fusion event in vacuole
                     inheritance for endosome-endosome fusion and for fusion of
                     endosomes to vacuoles when expressed from high copy
                     plasmid GTP-binding protein rab family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453125.1"
                     /db_xref="GeneID:2893025"
                     /db_xref="GOA:Q6CSG4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG4"
                     /translation="MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADF
                     LTKEVIVNDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSW
                     RDEFLVHANVSSPETFPFVILANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKD
                     SINVQDAFEEIARSALQQSQSDADAYEDDLSEAINIQLDGEPSSCNC"
     gene            <112866..>113903
                     /locus_tag="KLLA0_D01287g"
                     /db_xref="GeneID:2893353"
     mRNA            <112866..>113903
                     /locus_tag="KLLA0_D01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453126.1"
                     /db_xref="GeneID:2893353"
     CDS             112866..113903
                     /locus_tag="KLLA0_D01287g"
                     /note="similar to uniprot|P20052 Saccharomyces cerevisiae
                     YOL001W PHO80 Cyclin negatively regulates phosphate
                     metabolism Pho80p-Pho85p (cyclin-CDK complex)
                     phosphorylates Pho4p and Swi5p deletion of PHO80 leads to
                     aminoglycoside supersensitivity truncated form of PHO80
                     affects vacuole inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453126.1"
                     /db_xref="GeneID:2893353"
                     /db_xref="GOA:Q6CSG3"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG3"
                     /translation="MESMNTIDPQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFL
                     IQINDANNAGNQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS
                     AVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLE
                     RVRYRIIPRDDNIENCKIEQKLGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGN
                     PLNSPDKTSTYFFKMVDPMNPGIGGTLVPPSTTIKNNLKDKGNGRLNTNIISTTGRIV
                     SPSITEGDSFNLSEHRKTRSRETSVNENSDSPPITIPQKRNMKEDDPTNMDRKSTLLR
                     NGKKLSSHFNS"
     gene            <114713..>116947
                     /locus_tag="KLLA0_D01309g"
                     /db_xref="GeneID:2893367"
     mRNA            <114713..>116947
                     /locus_tag="KLLA0_D01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453127.1"
                     /db_xref="GeneID:2893367"
     CDS             114713..116947
                     /locus_tag="KLLA0_D01309g"
                     /note="similar to uniprot|Q12149 Saccharomyces cerevisiae
                     YOR001W RRP6 Exonuclease component of the nuclear exosome
                     contributes to the quality-control system that retains and
                     degrades aberrant mRNAs in the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453127.1"
                     /db_xref="GeneID:2893367"
                     /db_xref="GOA:Q6CSG2"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG2"
                     /translation="MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLED
                     TSTNILSLINDLLLSIDPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAG
                     NGGNAGGPSLKYLNDDDRSNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQ
                     PFEISLKMVPEEESIPSHYPHPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDT
                     VEGLNKMKDELSKATELAIDLEHHDYRSYYGIVCLMQISDREHDWIVDTIALREELYI
                     LNDIFTDPNVTKVLHGAFMDIIWLQRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLER
                     FANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIFDKLRNSLLEQNKMSDVLHE
                     SRKVAKRRFEYSSFRPKVPSSAVFSPIEKDEPWKNIMFQYNIPASKELLLRRLYEWRD
                     TIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSVSSYVSEHLRTNSKVIANLIKRT
                     LEDLKGNSNSSAIPLLESAESNGTDLANIITTSQIKSIQNIFHSLASEINSQKLNNEQ
                     NSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHELLKRQHEITRTLEQEYTDRQAQSI
                     VLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENKDEVITLRKRQSQSNNKRKTISP
                     PASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSVEHVGPQPIKKKSKPAKGKNV
                     SFKR"
     gene            <117469..>118395
                     /locus_tag="KLLA0_D01331g"
                     /db_xref="GeneID:2893007"
     mRNA            <117469..>118395
                     /locus_tag="KLLA0_D01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453128.1"
                     /db_xref="GeneID:2893007"
     CDS             117469..118395
                     /locus_tag="KLLA0_D01331g"
                     /note="similar to uniprot|Q12442 Saccharomyces cerevisiae
                     YOL002C IZH2 Membrane protein involved in zinc metabolism
                     member of the four-protein IZH family direct target of the
                     Zap1p transcription factor expression induced by zinc
                     deficiency and fatty acids deletion increases sensitivity
                     to elevated zinc"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453128.1"
                     /db_xref="GeneID:2893007"
                     /db_xref="GOA:Q6CSG1"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q6CSG1"
                     /translation="MSTRKRSVVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQK
                     DNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEY
                     PTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSM
                     ISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSA
                     VFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHS
                     HQLFHVLVVVAALCHLKALVVSYGLVHQALSQ"
     gene            complement(118602..118674)
                     /locus_tag="KLLA0_D01364r"
                     /db_xref="GeneID:2893013"
     tRNA            complement(118602..118674)
                     /locus_tag="KLLA0_D01364r"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:2893013"
     gene            <118965..>120434
                     /locus_tag="KLLA0_D01386g"
                     /db_xref="GeneID:2893355"
     mRNA            <118965..>120434
                     /locus_tag="KLLA0_D01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453130.1"
                     /db_xref="GeneID:2893355"
     CDS             118965..120434
                     /locus_tag="KLLA0_D01386g"
                     /note="similar to uniprot|P23796 Saccharomyces cerevisiae
                     YMR283C RIT1 Modifies initiator methionine tRNA to
                     distinguish it from elongator methionine tRNA Initiator
                     methionine tRNA 2'-O-ribosyl phosphate transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453130.1"
                     /db_xref="GeneID:2893355"
                     /db_xref="GOA:Q6CSF9"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="InterPro:IPR016519"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF9"
                     /translation="MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPT
                     FQYPVVPNERCGLWYCDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGL
                     VILDSTRRGKKIPDALSKTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEF
                     DRMFAKLPELVQKLKKLDIIDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLF
                     SGEVIENTHWEPPSNIIPVILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQ
                     LFWENIDELGDISKSDAELKDSYNAVILRAKVQNSLDISGDISKMLEIDTITARLHLG
                     KITSQFRITPKTVKYLNQKYSAVVLCHEAISVTEITELPRSIHIFPLPSGSKKSSREL
                     RSHLIKINALIEEQLSRPDTAANLPILIACDSGKDISVSILLVALCKYYNLDWELQPQ
                     DSVNKTIIKKHLAKIIESLQGRNVNPSRASLNSVNSFLM"
     gene            <120712..>122268
                     /locus_tag="KLLA0_D01408g"
                     /db_xref="GeneID:2893015"
     mRNA            <120712..>122268
                     /locus_tag="KLLA0_D01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453131.1"
                     /db_xref="GeneID:2893015"
     CDS             120712..122268
                     /locus_tag="KLLA0_D01408g"
                     /note="weakly similar to uniprot|P22136 Saccharomyces
                     cerevisiae YMR282C AEP2 Mitochondrial protein likely
                     involved in translation of the mitochondrial OLI1 mRNA
                     exhibits genetic interaction with the OLI1 mRNA
                     5'-untranslated leader"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453131.1"
                     /db_xref="GeneID:2893015"
                     /db_xref="GOA:Q6CSF8"
                     /db_xref="InterPro:IPR024319"
                     /translation="MLKKSRVLGKIPIPYLIKGSSCFYSTVVTSAPITLEDSLQSILS
                     DIQDGSNIVTPNKPNTNLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTPEDY
                     SVFVNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLNQFVRMFI
                     NLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWTTQTSRNFYQDL
                     IGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQALG
                     HYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYGHNNNITSGM
                     TVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLMLNWYATIGK
                     AVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYAYQRF
                     IIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQKKLNDEDDDY
                     NFPLFGTNIL"
     gene            complement(<122369..>123160)
                     /locus_tag="KLLA0_D01430g"
                     /db_xref="GeneID:2893020"
     mRNA            complement(<122369..>123160)
                     /locus_tag="KLLA0_D01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453132.1"
                     /db_xref="GeneID:2893020"
     CDS             complement(122369..123160)
                     /locus_tag="KLLA0_D01430g"
                     /note="similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
                     ABL120Wp and weakly similar to YMR281W uniprot|P23797
                     Saccharomyces cerevisiae YMR281W GPI12 ER membrane protein
                     involved in the second step of
                     glycosylphosphatidylinositol (GPI) anchor assembly the de-
                     N-acetylation of the
                     N-acetylglucosaminylphosphatidylinositol intermediate
                     functional homolog of human PIG-Lp"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453132.1"
                     /db_xref="GeneID:2893020"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF7"
                     /translation="MILLRGLNKFVLWYLVFLVIYGCLTKTIKEHNRWYFHELVSESM
                     VSKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQE
                     LVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPDSNPLVLTFDQFGVS
                     GHINHISCGRLVEKLPYSHKLHLRSDQPIYVKYSAFIAGIFQLGISTVYPDYGKPRCF
                     ISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINELITSI"
     gene            <124018..>128355
                     /locus_tag="KLLA0_D01452g"
                     /db_xref="GeneID:2893022"
     mRNA            <124018..>128355
                     /locus_tag="KLLA0_D01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453133.1"
                     /db_xref="GeneID:2893022"
     CDS             124018..128355
                     /locus_tag="KLLA0_D01452g"
                     /note="similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
                     ABL121Cp and similar to YMR280C uniprot|P39113
                     Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
                     transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453133.1"
                     /db_xref="GeneID:2893022"
                     /db_xref="GOA:F2Z5X6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:F2Z5X6"
                     /translation="MVEKKDSAGRFNGQPSHGGPRFIRTLGSQSLSGLNPLSNAQQGV
                     SQQQQHLSHHSHNVTDSDSPSIQDSGIPITSALIKKESPSHAVSGIPSNSNSINNNSK
                     SNSNNNPSSVFSSRNNTSIQQLQQGPSPTLSNSESPVNASLLSSITTPLLHQTGSASH
                     PPSNTGSSTNGTTTPSYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSR
                     RAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEE
                     EQILHELSKTNGGSLRVSSTNLYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRI
                     MSPRNSVADSDPSQTNTGNNDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALS
                     SLSKYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLK
                     ENNISSIPPELEVLKNHNLWEIDDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEEL
                     MQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFS
                     CLLIIIVQMGMLSKIKRDKITSGKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCL
                     SMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRIL
                     FWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSL
                     SVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTI
                     NMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTP
                     TDNQTENGSVDRSLSSYVLLQQATNTLLNVLTALNSIYLPLPINLARTKTRFGLFSAR
                     GSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPVN
                     SNPEKTEKMIQKKINYYNKLMGQPTVAVKRKRDPKATENTSKKVKVEDDHSQDNLHNI
                     TTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNS
                     GIFENAGSIHNNINDNNNNNNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDAS
                     LLNLSNALGNHGNSAEGMKDGTSVSNLLNLSTSDSLFKVPSNGDFLKDYYINNMSNTG
                     LSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPAMD
                     GFSFAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQL
                     QQHQQQTHHPPSHNSSSIPMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGL
                     HQHQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWNNAASSSDPNSAGDSSVS
                     DLLRWQNGN"
     gene            <129351..>132806
                     /locus_tag="KLLA0_D01485g"
                     /db_xref="GeneID:2893032"
     mRNA            <129351..>132806
                     /locus_tag="KLLA0_D01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453135.1"
                     /db_xref="GeneID:2893032"
     CDS             129351..132806
                     /locus_tag="KLLA0_D01485g"
                     /note="similar to uniprot|Q03735 Saccharomyces cerevisiae
                     YML117W NAB6 Putative RNA-binding protein based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453135.1"
                     /db_xref="GeneID:2893032"
                     /db_xref="GOA:Q6CSF4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="InterPro:IPR018885"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF4"
                     /translation="MNSGTSANHYQPSLIYGRPPVGYEQQVYDVAGRNGGSNHHPPQY
                     IYYTHRGGSMPGSIPGSIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPM
                     SAGTGANGVPVGSNNIMNLRNSSYKSFYPPAPKLRPAPSGRLRRARRKDNKPQQQREH
                     SRDNNKVEAEYDVERGYSSRSASRSQSFSASTSGSMSGSSGPKSIRKTIDSELKIQFQ
                     YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENL
                     NTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTK
                     ESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISLGATRSLYV
                     EFADDSVTSDTIWDTLPFLKNSGKYVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMAL
                     EVKELLETGDEAVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFSTDSRSRSRS
                     SNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDHHLNSWS
                     ISKPTTLYMHESGTTNFSSSNLSDDIDPLSISSHDPVPQQMLLNEYPYIMEPLMPPQI
                     TQTIQNQYSKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRI
                     CFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY
                     VSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWIN
                     FMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGS
                     NHNRNSQNNNTSRGHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNKNFLS
                     LGVDADFSEGLGISISPQAERRHVLSDNEDEREEHREEEQEECGNRHSGVNGSNVANN
                     EAINETLINGTYTADIPEDTLQVGSDSCSTYSGSSSSDVDIIVNAPSPKAGDAKSFTH
                     TRRNAHHRQRNTNQTRQYNNHHHAQQHQFQPLSHINAPYQTPQPQYHPYPQTPHRFSN
                     SFVPVAQHEGANNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQDPVFY
                     DEDNA"
     gene            <133636..>135183
                     /locus_tag="KLLA0_D01507g"
                     /db_xref="GeneID:2893011"
     mRNA            <133636..>135183
                     /locus_tag="KLLA0_D01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453136.1"
                     /db_xref="GeneID:2893011"
     CDS             133636..135183
                     /locus_tag="KLLA0_D01507g"
                     /note="weakly similar to uniprot|Q12303 Saccharomyces
                     cerevisiae YLR121C YPS3 Aspartic protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453136.1"
                     /db_xref="GeneID:2893011"
                     /db_xref="GOA:Q6CSF3"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF3"
                     /translation="MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSAGSA
                     FKVESKNSKYAAQFVNINDALSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQA
                     YFVNVTIGDEIYPLVVDSGSAYLWVYGSSCTSKSCTSNKLFSTDNVKRAADESTFSLI
                     YSSGTASGDVYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPSNNSDNIE
                     SIISVLSESNAISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLY
                     TGDIHYASLITNENHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTL
                     LILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEILSLEINGVKWPISSEEYLGEAYPQ
                     DSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDVQNQQFGLANKNENAILVPYVN
                     SATNSSDTISGDRSSTTISASNLPATSTAASSSTSKSGSTSFGLGSTIKPQSFMSWVA
                     TLILLAF"
     gene            complement(<135998..>137503)
                     /locus_tag="KLLA0_D01529g"
                     /db_xref="GeneID:2893024"
     mRNA            complement(<135998..>137503)
                     /locus_tag="KLLA0_D01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453137.1"
                     /db_xref="GeneID:2893024"
     CDS             complement(135998..137503)
                     /locus_tag="KLLA0_D01529g"
                     /note="similar to uniprot|P23642 Saccharomyces cerevisiae
                     YML115C VAN1 Mannosyltransferase with a role in protein
                     N-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453137.1"
                     /db_xref="GeneID:2893024"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF2"
                     /translation="MVVFVKDKRLELPMHHDSKQKGNHFRPKSGFGLFFAKINGLRYA
                     KSRIVFLFALVLVSTFLLLSKLVGGNVNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKY
                     DEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHV
                     LLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQN
                     GTLSKTLQDFEADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIF
                     EKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCP
                     GTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIV
                     EGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENH
                     AETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRNQR"
     gene            complement(<137965..>138960)
                     /locus_tag="KLLA0_D01551g"
                     /db_xref="GeneID:2893019"
     mRNA            complement(<137965..>138960)
                     /locus_tag="KLLA0_D01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453138.1"
                     /db_xref="GeneID:2893019"
     CDS             complement(137965..138960)
                     /locus_tag="KLLA0_D01551g"
                     /note="highly similar to uniprot|Q08985 Saccharomyces
                     cerevisiae YPL273W SAM4 S-adenosylmethionine-homocysteine
                     methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453138.1"
                     /db_xref="GeneID:2893019"
                     /db_xref="GOA:Q6CSF1"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF1"
                     /translation="MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPF
                     INESFWSSDASKDRIIVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNG
                     LLDRIVSFSRSCIGEDRYLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNF
                     VQSKDIDIIGFETIPNIHELRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIAD
                     LISSLGDKLNSNLMFIGINCCAFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKI
                     WLKNENQLCTWDDVVKSYIENGARIIGGCCRTTVDDIKEVRLAVNKYAKQTTSSL"
     gene            complement(<139183..>141006)
                     /locus_tag="KLLA0_D01573g"
                     /db_xref="GeneID:2893362"
     mRNA            complement(<139183..>141006)
                     /locus_tag="KLLA0_D01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453139.1"
                     /db_xref="GeneID:2893362"
     CDS             complement(139183..141006)
                     /locus_tag="KLLA0_D01573g"
                     /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
                     YMR278W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453139.1"
                     /db_xref="GeneID:2893362"
                     /db_xref="GOA:Q6CSF0"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q6CSF0"
                     /translation="MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDIT
                     ELHKRLDTMIAFGTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGH
                     DHRHNSRLFGKVTVDTFLQLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITA
                     SHNPKMDNGYKVYYTNGCQIIPPHDKLIAESIIHNLEPFSSPQTGTIIDCKEKMTKKY
                     IDAIGSTLIDGAVNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQK
                     YPDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTT
                     TAWRQLTGNEIGFLFAYYEWERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDT
                     LTGFKWLGNRALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRA
                     SGQTVLDILATASLKYGHFKEFNGYYIVPDLAITKQVFDAIRSIESPYPKKLGSSFEI
                     IKFRDLTNGYQSDTPDHIPELASDPSSQMITCEMLLVEQPTSRVRFTIRGSGTEPKLK
                     VYIEARTNTEPNSIALAKFTWDVLRQEWFKPELTGLLTPFQ"
     gene            complement(<141459..>143618)
                     /locus_tag="KLLA0_D01595g"
                     /db_xref="GeneID:2893018"
     mRNA            complement(<141459..>143618)
                     /locus_tag="KLLA0_D01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453140.1"
                     /db_xref="GeneID:2893018"
     CDS             complement(141459..143618)
                     /locus_tag="KLLA0_D01595g"
                     /note="similar to uniprot|Q03254 Saccharomyces cerevisiae
                     YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453140.1"
                     /db_xref="GeneID:2893018"
                     /db_xref="GOA:Q6CSE9"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE9"
                     /translation="MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDF
                     QDVLVKYEEKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHD
                     ITYGGLCVQCGNTVDEEDNSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVL
                     VVDLDQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPAR
                     KSWYYVKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRD
                     ENGSLTTKSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLP
                     RQQNSVLHLGRHHRRKQEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRK
                     EGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLR
                     VHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTD
                     MFGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKES
                     PYELLIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDS
                     WLDNDDDEMDELLNDEDDDAQNDEENEGDEETDEDERPSVKRRKTQLDDTKDFNHSEI
                     PETDGQAENHGVDQSSSEPDEDLEDDLEAELLLELEG"
     gene            complement(<143940..>145628)
                     /locus_tag="KLLA0_D01617g"
                     /db_xref="GeneID:2893034"
     mRNA            complement(<143940..>145628)
                     /locus_tag="KLLA0_D01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453141.1"
                     /db_xref="GeneID:2893034"
     CDS             complement(143940..145628)
                     /locus_tag="KLLA0_D01617g"
                     /note="weakly similar to uniprot|Q03750 Saccharomyces
                     cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved in
                     RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453141.1"
                     /db_xref="GeneID:2893034"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE8"
                     /translation="MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQ
                     AVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLLQSLKKITQVQRRTKISKLDLNLY
                     FKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVLKVKQQFMKELEEKELLSSKHS
                     EFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLE
                     EGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEHIKESQLETDLIFDPHKT
                     IPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNP
                     FIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPRVKEVRERARKEAEER
                     ERLLQEQRRIEKEKKMAEQEILDLNNLQTDPLLHGWDKDSEDDDENDDEKFLTQGPPE
                     VQAITDTNISTLGELASELLHGPDEEKPMESTETFEDVLPSITPANSTPLLSEVASGS
                     ASGLTPKDISEDAPEAGSEEAKSELALHTSPGVATDELLENQSQDHDSNVNDLF"
     gene            complement(<146344..>147489)
                     /locus_tag="KLLA0_D01639g"
                     /db_xref="GeneID:2893029"
     mRNA            complement(<146344..>147489)
                     /locus_tag="KLLA0_D01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453142.1"
                     /db_xref="GeneID:2893029"
     CDS             complement(146344..147489)
                     /locus_tag="KLLA0_D01639g"
                     /note="similar to uniprot|Q03529 Saccharomyces cerevisiae
                     YMR272C SCS7 Required for the hydroxylation of the very
                     long chain fatty acid (VLCFA) located in the endoplasmic
                     reticulum desaturase/hydroxylase enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453142.1"
                     /db_xref="GeneID:2893029"
                     /db_xref="GOA:Q6CSE7"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="InterPro:IPR014430"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE7"
                     /translation="MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHP
                     GGAEYILDYAGTDITDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDH
                     VVEVNLKGNNEFDSTVFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKF
                     TKDFYLDQVHRPRHYGKGSAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMN
                     QAFAIFLFAVGVFVWTLIEYGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRF
                     RLVMPPTLFVVLCTPFYKLVFALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPY
                     MRKLKKYHLEHHYKNYELGFGVTSWFWDKVFGTYLGENAPLSNMKYD"
     gene            complement(<148193..>148531)
                     /locus_tag="KLLA0_D01661g"
                     /db_xref="GeneID:2893351"
     mRNA            complement(<148193..>148531)
                     /locus_tag="KLLA0_D01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453143.1"
                     /db_xref="GeneID:2893351"
     CDS             complement(148193..148531)
                     /locus_tag="KLLA0_D01661g"
                     /note="similar to uniprot|Q03759 Saccharomyces cerevisiae
                     YML108W defines a new subfamily of the split
                     beta-alpha-beta sandwiches."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453143.1"
                     /db_xref="GeneID:2893351"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE6"
                     /translation="MSATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQ
                     VDEMDLLNSWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN
                     VPESEKEQDE"
     gene            complement(<148855..>151689)
                     /locus_tag="KLLA0_D01683g"
                     /db_xref="GeneID:2893037"
     mRNA            complement(<148855..>151689)
                     /locus_tag="KLLA0_D01683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453144.1"
                     /db_xref="GeneID:2893037"
     CDS             complement(148855..151689)
                     /locus_tag="KLLA0_D01683g"
                     /note="some similarities with uniprot|P54786 Saccharomyces
                     cerevisiae YML109W ZDS2 Protein that interacts with
                     silencing proteins at the telomere involved in
                     transcriptional silencing paralog of Zds1p and with
                     YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
                     ZDS1 Protein that interacts with silencing proteins at the
                     telomere, involved in transcriptional silencing; also has
                     a role in localization of Bcy1p, which is a regulatory
                     subunit of protein kinase A; paralog of Zds2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453144.1"
                     /db_xref="GeneID:2893037"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE5"
                     /translation="MPMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDP
                     ELEYRVSSRQGTGTATDQDTGTPYIATSSIKTETTKSEQGEQEYGNDDNQETQLSHSS
                     LSEDDTTTAGAAVEEEDDSYSFTDDSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRV
                     LSGSISRSISGTSSTSDGNDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLEN
                     MNLGGRSPTANETQAQSLSGLKTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGM
                     TDQPLAAAAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDS
                     TGQGLSNNLADEEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQSSSSKEERIIETR
                     SPSGSNNSPNSIIGLYNDEPFNEKKPIVQEFFSTLPASDDFESESSTEDAESSADFSN
                     EVSSELETTDKQRINETSKSWRWSQSPTTSNDYQQAQYVPKENIAPLKINHSRNRHNI
                     AATNSERNTSETSINTTGSAATVVTQTSIDTSSKETSNTQEIKPEKRRSASMNLDHDT
                     TSIEVNDKKLKKGNHGQNKFMKFFKKRSSSASSGGKIFKESTTENLPSMPIERELKKK
                     QSGSGLSNKFWISPKKQSKSESGKEEQLKHKDRIKFEYEKEKKQKEKRTKKKPSLQPA
                     VTVVKSNRQVSGELGTVNYYADDKTKGNTHNQQSSSSFSKSNSNRTSDYEEDDVEVTE
                     FSVHEDSFTSVHSNSSVNTFKDAILQTDHSQDSPYSGTSSTSSPSSPASPPAPMQIPS
                     ASTPPPPTQQQEQEQAQGTLENQYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLP
                     PLTISTVIMFDHRLPIHVERAIYRLSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSL
                     YLQQIEEEHMGNNGSMNMGNSNALIDIPDM"
     gene            complement(<152307..>153272)
                     /locus_tag="KLLA0_D01705g"
                     /db_xref="GeneID:2893008"
     mRNA            complement(<152307..>153272)
                     /locus_tag="KLLA0_D01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453145.1"
                     /db_xref="GeneID:2893008"
     CDS             complement(152307..153272)
                     /locus_tag="KLLA0_D01705g"
                     /note="similar to uniprot|Q03530 Saccharomyces cerevisiae
                     YMR274C RCE1 Type II CAAX prenyl protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453145.1"
                     /db_xref="GeneID:2893008"
                     /db_xref="GOA:Q6CSE4"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE4"
                     /translation="MFSRPADVVAVYISLSYVVAVHTVSRDVNEFKIRRDDPKVIKAR
                     MKAVIALSAFHLTTIPLLLKYMNGDSIQNTLLRFGLLPGFLNETETGLPSWVPFNYFK
                     DSSRHLSLAIVLYSTPLLDSLLHYCFLPDKSYKDIISDICCEFSTIWGLRDYIFGPIT
                     EELFYTSMMLVAYLRLGDSSQYDANYLTLIVPNLFGIAHVHHAFEQYSLGIMNLANII
                     FITLLQMSYTWLFGSFTNYLFLNSSGNLWSCILIHTFCNYMGLPQGNTFSKAYALVPI
                     EKRSNLGTLFSSVWRLLYLPLLVISIVLFKNNLTSLTAGTYEPIV"
     gene            154028..154149
                     /locus_tag="KLLA0_D01727r"
                     /db_xref="GeneID:2893360"
     tRNA            join(154028..154064,154113..154149)
                     /locus_tag="KLLA0_D01727r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2893360"
     gene            <154445..>155359
                     /locus_tag="KLLA0_D01771g"
                     /db_xref="GeneID:2893349"
     mRNA            <154445..>155359
                     /locus_tag="KLLA0_D01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453146.1"
                     /db_xref="GeneID:2893349"
     CDS             154445..155359
                     /locus_tag="KLLA0_D01771g"
                     /note="highly similar to uniprot|P49017 Saccharomyces
                     cerevisiae YML110C COQ5 2-hexaprenyl-6-methoxy-1
                     4-benzoquinone methyltransferase involved in ubiquinone
                     (Coenzyme Q) biosynthesis located in mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453146.1"
                     /db_xref="GeneID:2893349"
                     /db_xref="GOA:Q6CSE3"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR023576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE3"
                     /translation="MSMISARARLSLAQSLRINGGLRSFSNARVQLNQKQSNSDGFSG
                     DSTTHFGSRTVLKEEKEKLVGNVFSSVASKYDVMNDVMSLGIHRLWKDHFINKLDAGK
                     RPNSTEPLHFIDVAGGSGDIAFGLLDHAEQKFHDVESTMHIVDINADMLKEGEKRAMD
                     QGKYYNDPRVTFLVQNGETLDQIESNSKDIYTISFGIRNFTDIQAGLNTAYRVLKPGG
                     IFFCLEFSKIDNPLVNLIYQRWAQVLPVMGSVVANDYDSYQYLVESIERFPSQEHFKS
                     MIEKAGFQSAGYENLSFGICAIHWGIKT"
     gene            complement(<155616..>158402)
                     /locus_tag="KLLA0_D01793g"
                     /db_xref="GeneID:2893366"
     mRNA            complement(<155616..>158402)
                     /locus_tag="KLLA0_D01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453147.1"
                     /db_xref="GeneID:2893366"
     CDS             complement(155616..158402)
                     /locus_tag="KLLA0_D01793g"
                     /note="similar to uniprot|Q03758 Saccharomyces cerevisiae
                     YML111W BUL2 Component of the Rsp5p E3-ubiquitin ligase
                     complex involved in intracellular amino acid permease
                     sorting functions in heat shock element mediated gene
                     expression essential for growth in stress conditions
                     functional homolog of BUL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453147.1"
                     /db_xref="GeneID:2893366"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE2"
                     /translation="MGSDKRPQLKKQQTEDESILRGRGATKNPSGSSNLFFRSSSASN
                     LFRLRKSFANGGSSSSSNSAMVLKSGQSKLKNEDGSEVSDTHHMIDVLPSFEMYNALH
                     RNIPRGNVNPDQHDLPPSYLEVESQRQTPDSSDGTTVSQLDEMFLSPSPSLYDANTRV
                     GSSQSLQSLNTVSSGVLQNSLQALSTRYEAIIDDLDDSDNIKIEKLYSLPKVSTPIDV
                     NIRILKKATKPCEEKPEEESILKEYTSGDIINGFVVIENRSQHPLRFEMFYVTLEGCA
                     CVIDKKQGKRTVKRFLRMVDLSASWSYSNIDLATGFQYVPGDIDQDGCVLGLNNDRFL
                     QPGVRYKKFFTFKFPNQLLDISCKHEMFCHCLLPPSFGVDKYKHHARYSNIKLNSMLG
                     YGHLGTKGSPILTNDLCSDNLSVSYTIDARVVGKDAKRNELTIMKEKEYNLRLIPFGF
                     CQPLTGEGDPLIQMNALQKLVEERMDALERVFKRLEAGECITANDIHSTDLSGTIDND
                     TNIDSREILDRKLNQLHIANRIDPDAATFPLRNVKTSKRHQHTIVSEFPYTIKPKSKS
                     RNKLKKNIFSGLYGSSSSTTAAETETAASATSTTASLASESVPSSSLVSSDTMKYGII
                     MLECKVPEDGLPYIRPSLLKKTNQYQNKNKHDQANWDCAQSSFLDEEMKVLDHLNIHL
                     RCIQANSSVSHKPPEIQAVTTQLICITSKAVSSFPLKLNAELLLNTEKMKGITGTFHG
                     YLQKVKDYKQKFKSNIDQLTELYNKSKSTMSSHQEIRFSDFVTPQLMNDIESLASLVI
                     DVKSLNNIFKKQDQTLSHASDKISGGTNLLSSDSAPLSLQAALSHSNPLTQAELMKQE
                     LLHEWIESNEKEYNREVTVNLVLDTEIKETLVPTFESCLCSRMYCVRVNVKFENNIGT
                     TSIDVPVRIRYLEC"
     gene            complement(<158846..>159916)
                     /locus_tag="KLLA0_D01815g"
                     /db_xref="GeneID:2892996"
     mRNA            complement(<158846..>159916)
                     /locus_tag="KLLA0_D01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453148.1"
                     /db_xref="GeneID:2892996"
     CDS             complement(158846..159916)
                     /locus_tag="KLLA0_D01815g"
                     /note="similar to uniprot|P46963 Saccharomyces cerevisiae
                     YML112W CTK3 Gamma subunit of C-terminal domain kinase I
                     (CTDK-I) which phosphorylates the C-terminal repeated
                     domain of the RNA polymerase II large subunit (Rpo21p) to
                     affect both transcription and pre-mRNA 3' end processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453148.1"
                     /db_xref="GeneID:2892996"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE1"
                     /translation="MDAFEARLRFVDVIKHLHKTLHKKRETSPGADGDSTISAAAMAI
                     AGSTGTGAAGSNGNASASGSSSSLLQDPVQFYLKHYEHHFEDFHQCFFLTTANMDSLD
                     RLNVLIYWSRIISSLWSRCLKNMDEQWNIQGKVMFEYLLLDLNRMIDLVLPKEDWKAL
                     TNLPVAIEVIQFISSLVTGNSSDMDVSEQNQNSIEECWKLLSQDRQETVNQFNQLEWD
                     CIEKKQFAVGLEWVQYRKQSRCDSSLLQCLQLLVDRRRKAFILQECYRKHSVLALPIS
                     SQLQTLLHRMENDRERHKKSKEHEWVIDRATMTDTLEFDTVWNSYALGMNRNDYQNIK
                     TIQEIAQQSYMYLDNSTLGQSN"
     gene            complement(<160236..>161006)
                     /locus_tag="KLLA0_D01837g"
                     /db_xref="GeneID:2893324"
     mRNA            complement(<160236..>161006)
                     /locus_tag="KLLA0_D01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453149.1"
                     /db_xref="GeneID:2893324"
     CDS             complement(160236..161006)
                     /locus_tag="KLLA0_D01837g"
                     /note="similar to uniprot|P13483 Saccharomyces cerevisiae
                     YML113W DAT1 DNA binding protein that recognizes
                     oligo(dA). oligo(dT) tracts; Arg side chain in its N-
                     terminal pentad Gly-Arg-Lys-Pro-Gly repeat is required for
                     DNA-binding; not essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453149.1"
                     /db_xref="GeneID:2893324"
                     /db_xref="UniProtKB/TrEMBL:Q6CSE0"
                     /translation="MAKKLSDGRKPGSGRKPGRAKTLAEGRKPGSGRKKGSKNLGISN
                     GAVNATGSGTRRSRSSSQHYGMDHSSSSASSPTIAMATSLLLQQQQQFHNGQAHYAAP
                     HRIMKRGTADSANSSSNSSSNSDPVSKRDRELIDALNKLSRCKSPPQSPDPMQTAKLP
                     MLSSFWGSVDVPLRQEHEQQLQHQLQLQLQLQHQLQLQHQHQQIHSQQNSLNSNNSHQ
                     QIPGVMWPNTPPPQVASSSSSLHQNNPSAHPSDLNSSH"
     gene            <161628..>162743
                     /locus_tag="KLLA0_D01859g"
                     /db_xref="GeneID:2893342"
     mRNA            <161628..>162743
                     /locus_tag="KLLA0_D01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453150.1"
                     /db_xref="GeneID:2893342"
     CDS             161628..162743
                     /locus_tag="KLLA0_D01859g"
                     /note="similar to uniprot|P48510 Saccharomyces cerevisiae
                     YMR276W DSK2 Nuclear-enriched ubiquitin-like
                     polyubiquitin-binding protein required for spindle pole
                     body (SPB) duplication and for transit through the G2/M
                     phase of the cell cycle involved in proteolysis interacts
                     with the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453150.1"
                     /db_xref="GeneID:2893342"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD9"
                     /translation="MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQR
                     LIYSGKILKDTETVESYKIQDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPS
                     NISAGQTGGFNPLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPI
                     FQSQMNEMLSNPQMVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMA
                     NSMGMSPDGAASAFPAPGSASGAGGANETSTNDADSAATGAAASSTGQANPFAGLFGA
                     TPGNAAAANPFAGLFPGGQQPQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQL
                     RQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV"
     gene            complement(<162870..>163847)
                     /locus_tag="KLLA0_D01881g"
                     /db_xref="GeneID:2893028"
     mRNA            complement(<162870..>163847)
                     /locus_tag="KLLA0_D01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453151.1"
                     /db_xref="GeneID:2893028"
     CDS             complement(162870..163847)
                     /locus_tag="KLLA0_D01881g"
                     /note="weakly similar to uniprot|Q03760 Saccharomyces
                     cerevisiae YML107C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     nuclear periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453151.1"
                     /db_xref="GeneID:2893028"
                     /db_xref="GOA:Q6CSD8"
                     /db_xref="InterPro:IPR012935"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD8"
                     /translation="MDTKLKERVDQLSRYLDGEDRIKVDKYMTRWIEKMSRASSRVNK
                     YRYKTRTVRLDSAKFSVAPYERVLDTLGESYKGIDVFNRDEFHRALERMVQTTKTEAI
                     FWDSQYVNPITILAHGLRIEFCDGSVVTLKCDSCKETLSLDLCDSEFNQQYASHLLTM
                     HKSVCFWHTSSVPLDIVYYVNKSSVIYEIERIKIQWARYSGLSDRFKSWQLGFPLPEK
                     IKLLCGWFGYQSLQSSDIALLYVLLRGYAPVDGQSETDFGILQCVGSYLTVDVKQVLC
                     NSDFNGHPKWSSHYDQDTILDLLYDTLIEIPDESMQGRISRLKRIITKW"
     gene            <164524..>165204
                     /locus_tag="KLLA0_D01903g"
                     /db_xref="GeneID:2893005"
     mRNA            <164524..>165204
                     /locus_tag="KLLA0_D01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453152.1"
                     /db_xref="GeneID:2893005"
     CDS             164524..165204
                     /locus_tag="KLLA0_D01903g"
                     /note="highly similar to uniprot|P13298 Saccharomyces
                     cerevisiae YML106W URA5 Fifth step in pyrimidine
                     biosynthesis pathway Orotate phosphoribosyltransferase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453152.1"
                     /db_xref="GeneID:2893005"
                     /db_xref="GOA:O13474"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /translation="MPTALEDYQKNFLELAIESKALRFGEFTLKSGRVSPYFFNLGLF
                     NTGKLLSNLATAYAIAIIQSELKFDVIFGPAYKGIPLASIVCVKLAEIGGSKFQDVKY
                     AFNRKEAKDHGEGGNIVGAALKDQKILIIDDVMTAGTAINEAFEIIAKEEGKVVGSII
                     ALDRQEVVNTEDTEVLSATQSVSKRYDIPVLSIVNLSNIISYLDGRISVEEREKMEQY
                     RQTYGASA"
     gene            complement(<165317..>166129)
                     /locus_tag="KLLA0_D01925g"
                     /db_xref="GeneID:2892774"
     mRNA            complement(<165317..>166129)
                     /locus_tag="KLLA0_D01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453153.1"
                     /db_xref="GeneID:2892774"
     CDS             complement(165317..166129)
                     /locus_tag="KLLA0_D01925g"
                     /note="similar to uniprot|P29478 Saccharomyces cerevisiae
                     YML105C SEC65 signal recognition particle subunit
                     homologue of mammalian SRP19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453153.1"
                     /db_xref="GeneID:2892774"
                     /db_xref="GOA:O13475"
                     /db_xref="InterPro:IPR002778"
                     /translation="MPVIEEIDDIDDIDNLEMDLAELDSTMKTPVAPKIVPTVVRSQD
                     QEEEAYSAAISGNAGSGSGFNFVNSTTGQVEKSHSLTKEELDEIKEFQMLYPCYFDTR
                     RTHAQGRRAPKDLCVENPLAKTIADAARSLGIPSIFEGSKTHPQDFGNPGRVRVLIKE
                     NGKPFVSGIDNKRVLMKRIGEYLKSHPTTLESVKQLPYGPDFDNVEPKKIPLLKGTAM
                     NDIVPLHSPYLTQHPMTKSLYDAPPPPPPAQQVSAPEKQMKMPKNKFRVVRR"
     gene            <166415..>167653
                     /locus_tag="KLLA0_D01947g"
                     /db_xref="GeneID:2893333"
     mRNA            <166415..>167653
                     /locus_tag="KLLA0_D01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453154.1"
                     /db_xref="GeneID:2893333"
     CDS             166415..167653
                     /locus_tag="KLLA0_D01947g"
                     /note="similar to uniprot|Q756W7 Ashbya gossypii AER288C
                     AER288Cp and weakly similar to YMR270C uniprot|P53437
                     Saccharomyces cerevisiae YMR270C RRN9 Upstream activation
                     factor subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453154.1"
                     /db_xref="GeneID:2893333"
                     /db_xref="InterPro:IPR019622"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD5"
                     /translation="MDSQLARDAIDLLATLDQEQRNDLSVHLYSAHLLKHLLYRANKD
                     EKNILRTETFVKTVLKEDWTAWPSRNSIIDPNTSDIYEDQAGCLASENIGGIHRKGVQ
                     PGQLDQSSLNHATEMLYGELNAFWQQKLKESSVMGQQTENKTADEGQIEDPNTIVDEN
                     DSEILGVNDTALDVNEMDLPDDIFQNLLFKVDRFIGSLHLDAAETNTVTLSTIPSEPE
                     IKLKSTTIGNTEAVTTRSKEKYDYKDIIVHGCETGEDMSRQYLRAIDLFQDLPKTMDK
                     SQFVLPDAYLDRFSQVNLGNSDSEQSDDDPQDHTKLEENIKKKENSGKKDVKSFVDMK
                     RIIKDRNNDPVVRRETRLLLRKDEFARDKKMFFTVLNHQNSSEQSNKPRRRIKKRDKN
                     NNKNIVSLNIDSDYGPGDLD"
     gene            complement(<167629..>171015)
                     /locus_tag="KLLA0_D01958g"
                     /db_xref="GeneID:2893009"
     mRNA            complement(<167629..>171015)
                     /locus_tag="KLLA0_D01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453155.1"
                     /db_xref="GeneID:2893009"
     CDS             complement(167629..171015)
                     /locus_tag="KLLA0_D01958g"
                     /note="similar to uniprot|Q01846 Saccharomyces cerevisiae
                     YML104C MDM1 Intermediate filament protein required for
                     nuclear and mitochondrial transmission to daughter buds"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453155.1"
                     /db_xref="GeneID:2893009"
                     /db_xref="GOA:Q6CSD4"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD4"
                     /translation="MPSFKWHVLFVVPFFLGWGECLFVLSVASLLSIIWIYLALNEQP
                     RVLPTKPTLRFTGDKPITKTSDDDNFAGQEALFPNNEALSKEIDILLNNIISNFILSW
                     FGSISESDKFPNTVKSVLKEAIIRFSIALSDVDLCELMILRILPLLTKHYTTFYISQE
                     SITSSVAIDKPEQNVDLAVAVEFNKQYRIHKDLSLTLSQESLSEDVQNYSRKRAKELL
                     SILVDPKELESPFVRTILREVVACSVLQPLVSRIATPDFWNTKLIDICSQVLKERSQV
                     TELRAVLSKTIEADDENCLDNESLAKSGTIDVTNVHGTDDDYECFLKQLSCLTEVSQL
                     NILKVKLWIDALQIRCVPNEGEVSSKSFQKKHALFNKRIELALNLIYSKLAYLSPNDP
                     QSNQAHDNLEQQLQSFEKFVETVTVQDVLTNVSSLKFFSAFLEPQTDQSGIIALQLWS
                     FIERKRNPLEDISNDEIQIDTSKNGNKHLRELEQQFFSSPISRAHIEELDSNSVKTII
                     DFLKERDDTPSVTESQFDKSVEARRCMLLLQKSALKILAEKWYPIFKDSDNFYQMLAD
                     SDFIKAHNIATQASNTLNNDFPTDTVRVITHGNLGKALDDILNNNDVSTTDAISSLKT
                     PKKSYSNIFGAREKSLFDDELFGDTSVQEDEETSELNSVSFYPYSIANSSLESLNGSS
                     KQENGSYNDTSILNSLNLKEEIGNLVLSIDTLKKQLELLHHLILKAELTNNQTRLILL
                     KKSERTLRRELEYKELLKQQHMVHENANILYGRAKLCIKSYLTDVSLEDGKETVYYLI
                     NVQHIFNNQLVTWDIPRRFSEFYRLNSYLKKKYPGVVSYLQNSNGFPERVKMSLKYHV
                     SKTLLYEERRKRLEYYMQELLKIREVCQDEYFRKYLTDVSNTFKVKENLEEDVEDKRR
                     SMVLLKTDNTVGEVTNVSAGRFDDPKSFSDELDFFEDERNFHSGANGSNNTGTLVKPI
                     CELFISFFALNQSNTGWLRGRAIIVVLQRLLGSTIEKYIKDVIQRIRSPEKVTLLISK
                     LNSILWVDDIFFKSSSIPQPSARTEGEIIRTSTESQAMLERFMVETCGKVVGTMYASN
                     AGYRLHSMLQNEYLNVSLMLEIMDVMFDEIKRIQSKSPGP"
     gene            complement(<171236..>171784)
                     /locus_tag="KLLA0_D01980g"
                     /db_xref="GeneID:2893026"
     mRNA            complement(<171236..>171784)
                     /locus_tag="KLLA0_D01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453156.1"
                     /db_xref="GeneID:2893026"
     CDS             complement(171236..171784)
                     /locus_tag="KLLA0_D01980g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453156.1"
                     /db_xref="GeneID:2893026"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD3"
                     /translation="MDSKGYLKSYGWQEGEALRNGGLKKPILVKHKKDKKGLGCAPGH
                     DDSEAWWERLFDGQLRNLDIKSGSDGISFKQNEVVASSISKSDSPLYRSFVRGEVLKG
                     TIKTDLPSNNGSTIVKLAVSEVTSKKDKKSKDEKKKKKKKKSHKVDKPKSKHKKDKKD
                     KHRKDKKDKKDKKGTHKRKSSH"
     gene            <173117..>173563
                     /locus_tag="KLLA0_D02002g"
                     /db_xref="GeneID:2893328"
     mRNA            <173117..>173563
                     /locus_tag="KLLA0_D02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453157.1"
                     /db_xref="GeneID:2893328"
     CDS             173117..173563
                     /locus_tag="KLLA0_D02002g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453157.1"
                     /db_xref="GeneID:2893328"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD2"
                     /translation="MSAFNDYCTVCGQLIERGNCDAQLDNDRLYCSSQCQENDRMTIE
                     NLKLTNELVGTPASLIRSPLLQPLDRSTGSSTSSTIYDLLDRDQDDMDFDLELSLDRN
                     TLGHGASLPMMTIPRSVVGKDQEFVSYTDHTAEDNYKLWLNYNLTG"
     gene            complement(<173877..>175547)
                     /locus_tag="KLLA0_D02024g"
                     /db_xref="GeneID:2893033"
     mRNA            complement(<173877..>175547)
                     /locus_tag="KLLA0_D02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453158.1"
                     /db_xref="GeneID:2893033"
     CDS             complement(173877..175547)
                     /locus_tag="KLLA0_D02024g"
                     /note="similar to uniprot|P40357 Saccharomyces cerevisiae
                     YGR009C SEC9 t-SNARE protein important for fusion of
                     secretory vesicles with the plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453158.1"
                     /db_xref="GeneID:2893033"
                     /db_xref="GOA:Q6CSD1"
                     /db_xref="InterPro:IPR000727"
                     /translation="MGIKKFFKIKPPPEATPEENREYLNELGISTKTTPSNRREKFAA
                     YGKFANDKVKSKVYAPEGYEQYANPGAQPSERQQLDDLNNSPYDEVSMINNRNASASA
                     RHTGNYVDPYSNDNASPYGNSDSSPYGNASASPYDTGYNAPLQQNNNPYGSMNNSYSN
                     KSYGSNSYSGDTYASPSPQASSSNNNGATGQRPSNPYANMNSQDPYGTNSYSNSGSVN
                     AYKGFTPNVAASDVSSRSYASPRHSTSATRSNDREFNFERSGADDEIDLNETIRPEID
                     NPKGVQRNGNGDDDDLNNSIHENEGIGTPAKGYQTFEDIQKESQRAEQQEEDEEVDGI
                     KQQIKFTKQSSVASTRNTLKMAQDAELAGMNTIGMLGHQSEKLNNVERNLNLMQIQNR
                     VADDKVSELKKLNRNILAVHVSNPFHSKRRAREAEDKIKLQRMQDKQNQEDITSTLHQ
                     STKRIENAMSSGHGPSEVRDRYQNQQILEKAKRYQFENDEEDDEMEMEIDKNLDKIGQ
                     ISGRLKKLAITTGKEIDSQQDRIKRIEESTDDLDIKIHVNTTRLTNIR"
     gene            complement(<175907..>176644)
                     /locus_tag="KLLA0_D02046g"
                     /db_xref="GeneID:2893010"
     mRNA            complement(<175907..>176644)
                     /locus_tag="KLLA0_D02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453159.1"
                     /db_xref="GeneID:2893010"
     CDS             complement(175907..176644)
                     /locus_tag="KLLA0_D02046g"
                     /note="highly similar to uniprot|Q12522 Saccharomyces
                     cerevisiae YPR016c TIF6 translation initiation factor 6
                     (eIF6) singleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453159.1"
                     /db_xref="GeneID:2893010"
                     /db_xref="GOA:Q6CSD0"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:Q6CSD0"
                     /translation="MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGD
                     AIPIAHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGL
                     VHPQTTVQDQEELSSLLQVPLVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDAQPEAISGNLRDTLIETYS"
     gene            <177264..>178481
                     /locus_tag="KLLA0_D02068g"
                     /db_xref="GeneID:2893369"
     mRNA            <177264..>178481
                     /locus_tag="KLLA0_D02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453160.1"
                     /db_xref="GeneID:2893369"
     CDS             177264..178481
                     /locus_tag="KLLA0_D02068g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453160.1"
                     /db_xref="GeneID:2893369"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC9"
                     /translation="MTDCNSTTERSLTSGLEAMSLKAISPSKLNRRHKVSSKPDKLNE
                     NVCLDRRAEVLVNTENEMPTEIVSKIKNENFHLQLELEQKNHEISKLKSMLLPKLTPP
                     AIDLRLTTSLKDPLYYHPESNKIPGMSGATVTNSDYVSHFSSSSYDGNRNDVRETSTV
                     ASTTISRKEKNHMLFTRNILPFIRDSINMYKNSHVLNEEVVPIEKELDKFYDNSLKKD
                     EKCEVFSNVLLGLLRVQRLNIAALNRELELKTVERKMDYLATLFLDPQEYEIPRHSSM
                     KRIRDQMLDVIISLYGELPNPNQRAAREMKYQQPQQVPLKIKSDSKLNRQSHNPEILP
                     IGYSNSSSKPARSAKKRMRNIKLTPFKTASQEDMDADDDLDVDLSDPLQLLLAERITG
                     TDLENTTSLTNSL"
     gene            <178880..>180688
                     /locus_tag="KLLA0_D02090g"
                     /db_xref="GeneID:2893365"
     mRNA            <178880..>180688
                     /locus_tag="KLLA0_D02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453161.1"
                     /db_xref="GeneID:2893365"
     CDS             178880..180688
                     /locus_tag="KLLA0_D02090g"
                     /note="some similarities with uniprot|Q12495 Saccharomyces
                     cerevisiae YPR018W RLF2 Chromatin Assembly Complex subunit
                     1: largest (p90) subunit of three-subunit protein complex
                     (yeast CAF-I) involved in DNA-replication-linked
                     nucleosome assembly. Homol. to p150 subunit human
                     Chromatin Assembly Factor-I (CAF-I) p90 subunit of yeast
                     Chromatin Assembly Factor-I (CAF-I)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453161.1"
                     /db_xref="GeneID:2893365"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC8"
                     /translation="MSEMKPSVSNQKRRGILSFFQNTGKVDKATTVNAISQDSAIEID
                     IESDTLEPLNSSEPEEGEKDEEMDSQKSDTATLDAADSQQETEKTGGAEDNDSASTMA
                     NKKAERELRRQKEKQAKSKRKEEERLERERKKLEEKQKRDRQKQERELKKQQEKEERE
                     RKRLQEKEDREKKRQQEKEEREKKRLEEKEMKEQERLKKEEERLKKEEEKRKKEETKE
                     RSQSRIGNFFKKATVSSSEQSVTSDFKKHFLPFYIKSDVIMANTWKMDPQKLKENVPR
                     IDKLMKTEDRISSVEWMNSFKCHHGYEIKLTAVEVLQTMTSKKKTDEELSALLNEVPQ
                     KFIKFYENVRPPYVGTYSKKLTLPNNNPFSTEGTGFDYGYDSDLDWVNEEEEEGGVDD
                     LENDEDEEDEDQEDEEGGDNEMDGFLDKDENENMARKKFVGPLIPTIKLRKDTDKLDD
                     ESKQYFALVSVECMFQDQCFPVDPYKAPNKRPAVEDGSFETTSSKNPATKKSKSLITE
                     PKHLLQLLEQVHDCTFSLSTVVEIIQKHLPQYKKDTIKNSVKEYAAKSTKGDRRWEVK
                     DMNNWEHLKSSPTPRLSTPEVPTANDEALLTGIPLS"
     gene            <181482..>182015
                     /locus_tag="KLLA0_D02112g"
                     /db_xref="GeneID:2893027"
     mRNA            <181482..>182015
                     /locus_tag="KLLA0_D02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453162.2"
                     /db_xref="GeneID:2893027"
     CDS             181482..182015
                     /locus_tag="KLLA0_D02112g"
                     /note="some similarities with uniprot|P31379 Saccharomyces
                     cerevisiae YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453162.2"
                     /db_xref="GeneID:2893027"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC7"
                     /translation="MLLQCNAWTLRGVRNFVLPKFTNDIFELTLLRKGQIETLNSLKR
                     RQLPACPELHLNNIEFWIHDVPFNTFSFLRWLFVFIFITLISLLPIVGPLAATILQTP
                     DRAYGYYDVWMIRRRLSDKAKRDEYYSRLGQLWAFGLTAGLLELIPGFSALLMISNVI
                     AVGVWANDDIKLKRVQL"
     gene            complement(<182345..>184033)
                     /locus_tag="KLLA0_D02134g"
                     /db_xref="GeneID:2892894"
     mRNA            complement(<182345..>184033)
                     /locus_tag="KLLA0_D02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453163.1"
                     /db_xref="GeneID:2892894"
     CDS             complement(182345..184033)
                     /locus_tag="KLLA0_D02134g"
                     /note="highly similar to uniprot|P40970 Saccharomyces
                     cerevisiae YDR062W LCB2 Component of serine
                     palmitoyltransferase responsible along with Lcb1p for the
                     first committed step in sphingolipid synthesis which is
                     the condensation of serine with palmitoyl-CoA to form
                     3-ketosphinganine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453163.1"
                     /db_xref="GeneID:2892894"
                     /db_xref="GOA:P48241"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /translation="MISISSTRVPLIPPEDIPLEDKKENEFGQLTSEEYLYQSKSRDG
                     KALQDPILDAPAYHVSLITYLNYLILIILGHIHDFLGLTFQKEKHKDIMEQDGLAPWF
                     STFESFYVRRLKQRIDDCFSRPTTGVPGRFIRCLDRVSHNLNDYFTYPGTTSMCLNLS
                     SYNYLGFAQSEGQCTTAALEATDKYGVYSGGPRTRIGTTDLHVMTEKYVAQFVGKEDA
                     ILFSMGYGTNANFFNSFLDSKCLVISDSLNHTSIRTGVRLSGAAVKTFKHNDMRALEK
                     LIREQIVQGQSKTHRPWKKIIICVEGLYSMEGTMANLPKLVELKKKYKCYLFVDEAHS
                     IGAMGPSGRGVCDFFGIPCSDIDIMMGTLTKSFGAAGGYIAADKWIIDRFRLDLTTPH
                     YGEPTPAPVLAQIASSLKTITGDINPGEGQERLQRIAFNARYLRLALQRLGFIVYGIA
                     DSPVIPMLLYAPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSAALTKEDID
                     YLLQHINEVGDKLFLKVSSGKAGGSLDGKPPRWNIDEVIKRTPTDCKDDSFFRI"
     gene            complement(<184520..>186085)
                     /locus_tag="KLLA0_D02156g"
                     /db_xref="GeneID:2893334"
     mRNA            complement(<184520..>186085)
                     /locus_tag="KLLA0_D02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453164.1"
                     /db_xref="GeneID:2893334"
     CDS             complement(184520..186085)
                     /locus_tag="KLLA0_D02156g"
                     /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
                     YDR061W Mitochondrial protein member of the ATP-binding
                     cassette (ABC) transporter family transcriptionally
                     activated by Yrm1p along with genes involved in multidrug
                     resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453164.1"
                     /db_xref="GeneID:2893334"
                     /db_xref="GOA:Q6CSC5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC5"
                     /translation="MTLNKQVVKITDAFFKSSLRKGSPYVFPNKIRFEINEGEKWCIW
                     GPSKEKFIDILSNKYISDPFSAVTYAKVVKGRLPRIEQVKFKGVMPTAHLSARYEFFK
                     DEFDQTCEKFILDNSMGSRAVNYEVETTNRYVDPELLTYLLKELKLIDIKDRWAMGLS
                     NGQMRRTRLARSLLKEPDLTIIDDPFLGLDPSACSIISKFLSKYDKGTSVIIGLRYQD
                     QIPDWCTHVVCVDKDGIEFQGPMEQYRDQVESMRLQLLEVLQLNKPKSKYTIEDLISP
                     HKYYKSPHHDVMKIPSVVTLEGLSVTYSGEPVLKDIYWDVKQGSKWHIQGNNGAGKST
                     LLSLITADHPQSWNSKFVDHGVPRRTGSTNFFDINKRIGLSSPEMHALFLKNAGDLSV
                     LETVASGFHAVSSNNFLKAHNTLTDEQKRIVDMYIDYFHLDPKKTFASLSVSEQKIAL
                     FVRAAVKMPEIMILDEAFSGTETDQLIRAHEFLEQWPGTVFVVSHVQEETPKCNHYLR
                     LIEPGQYEIGDVN"
     gene            <186452..>187303
                     /locus_tag="KLLA0_D02178g"
                     /db_xref="GeneID:2893030"
     mRNA            <186452..>187303
                     /locus_tag="KLLA0_D02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453165.1"
                     /db_xref="GeneID:2893030"
     CDS             186452..187303
                     /locus_tag="KLLA0_D02178g"
                     /note="similar to uniprot|Q03193 Saccharomyces cerevisiae
                     YDR090C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453165.1"
                     /db_xref="GeneID:2893030"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC4"
                     /translation="MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMF
                     LWVVSGVPFGIYFLITRGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCI
                     LPMILFIVSFEIGFTLWLRPVYDHGTHWPALVIGIIATILLAAGLIPPYFELAKRQGR
                     VVGINFIFLFVDSLGAWCSIASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFK
                     WFGNGTGEFDDDDVGSTSSSVGIEINGIDGDSAEDGIFAGPYINNEQDKDDIGSNNTK
                     SMKEQRS"
     gene            complement(<187364..>187912)
                     /locus_tag="KLLA0_D02200g"
                     /db_xref="GeneID:2893014"
     mRNA            complement(<187364..>187912)
                     /locus_tag="KLLA0_D02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453166.1"
                     /db_xref="GeneID:2893014"
     CDS             complement(187364..187912)
                     /locus_tag="KLLA0_D02200g"
                     /note="similar to uniprot|P36116 Saccharomyces cerevisiae
                     YKR020W (VPS51)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453166.1"
                     /db_xref="GeneID:2893014"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC3"
                     /translation="MAEQITHKKSLKRVDNEKRRLLKEYYRLQKDNKPGETTAESDKA
                     DTKSPSPSVLPGVTTGSIPASGADIDSGVTSANLGNVVASTPIENCKSPQDTEQEIRL
                     ELEKGDIDVTKKSLKQLLQVQNLLLAEETEADNAIKNTIYDNYYDLIKVDEILKEMTQ
                     LDESLVEQLRETCNMARPMLKQ"
     gene            <188350..>190266
                     /locus_tag="KLLA0_D02222g"
                     /db_xref="GeneID:2893346"
     mRNA            <188350..>190266
                     /locus_tag="KLLA0_D02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453167.1"
                     /db_xref="GeneID:2893346"
     CDS             188350..190266
                     /locus_tag="KLLA0_D02222g"
                     /note="weakly similar to uniprot|P47030 Saccharomyces
                     cerevisiae YJL083W TAX4 and to uniprot|P36115
                     Saccharomyces cerevisiae YKR019C IRS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453167.1"
                     /db_xref="GeneID:2893346"
                     /db_xref="GOA:Q6CSC2"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /translation="MRFRSRHQVDKPNVIVTQSNRKNEDRLGEDASLKAAQAMFKKHT
                     VSQGFAVSDAPGTKLSLPNSGHGTPAHNVQAMARSSSSSSATSTPINIIRRSPRSSLK
                     GKPMGGLSVSPRTVEGNAALSQQAAAVALENEISGDESIVLVPAGNSNGSMTRSNSSI
                     NAIRIVPGGGLSSSRSSSKVSIVKNSPTHSLALADKLNSITLESVYGKPSTATGTATR
                     TLAGRKAPPAAFIDQDSVLSNDKHSENEDTPIKGTISYDTTARMNVPVTYEGTLPDLI
                     PGHQRHKKKKWRNIFGSSATHGSSAGGAIGINGTSASGNDQYENPSGTLSELQLNRAE
                     DNLIVKSVNPTQKTRLQTTLRSNDYDRNSELAAVAGGYSSDESAFSSDSDRELHYATD
                     NHHNNSINNHSSGVYYGNVGGNGVYNGGTAGVGRTKHRAMVRSHKRKSFNEDKPWKSH
                     VDIGYISERERKRYEGIWVTNRNSYLELLPWWNQPLQDEEQEQEQEREMDHESQHGLE
                     EELEEEREQESGQGQEQDADIPEDGLMLNLIVMEIWSRSNLSNQLLGQIYDKVDTRHD
                     GTLNRQSFLTGMWLVDQCLYGRKLPKQIDQRVWDSVDKFVISIPNNNPHHRHRRRKKM
                     LRKELKTIKKDLKT"
     gene            <190557..>192734
                     /locus_tag="KLLA0_D02244g"
                     /db_xref="GeneID:2893339"
     mRNA            <190557..>192734
                     /locus_tag="KLLA0_D02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453168.1"
                     /db_xref="GeneID:2893339"
     CDS             190557..192734
                     /locus_tag="KLLA0_D02244g"
                     /note="similar to uniprot|P36114 Saccharomyces cerevisiae
                     YKR018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453168.1"
                     /db_xref="GeneID:2893339"
                     /db_xref="GOA:Q6CSC1"
                     /db_xref="InterPro:IPR019412"
                     /translation="MFRVFNALTGAGSPKATELSGEERTKFILQQAHDFEIALQAMDY
                     VLDDNAEVGLKLLADNQATSPGDATVGALAKGVIEFLEATLGFEPEVMKKASTTLAEA
                     EQLSLKSRAKLQKLNIKTSSLYPPGTEYAVTYTESCLLHALLMLFSESMVEGAKALFK
                     LRKAYHMLQDILKEINASEKRKRSSIYLQEINESTASFISSGTCFTSYDIPYKLTPEE
                     EQDKELLDLANKVYSLRRKRLCGAHIGNSPAINRLRDDVGAASLKKGSDEETQEFQLL
                     SDNANINQATMDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSVVGFHGSREEGLRLVW
                     KSTKDRNIHGGIGLLGLLFYYDGPFQFTDIDFDIPAARDDNLPVTEMDRPTLLHPGKI
                     LTSALLQARALFPNSALWLLQEARMLSKQGRLKEAVDLLDSIDHNTIEMKQVKALIVF
                     EKATTLVYMHEFERGAETMLIMLSISEWSHALYTYFAGCCYLEMFRKYEMGILNGENA
                     AEKKAYYKERATNLVFESANMVGKKKFMSKILPLDRFLLRKVDQFKKFQNIIKSSDPL
                     DSIGVSPVHELIYFYNGYNRMTMKELNLSLKSLTEYRNPTIDLQNPDQELIKDLLTSL
                     VLRRTGKIEEGCKILDTQVLPQLFTIQNDKVKYIKKTEDPWVYPTAFYERALFSWKLK
                     GMNGLHEAHEWLIRAQNYQDDYELSTRIGMKIKAAKDRVEESI"
     gene            <193082..>194587
                     /locus_tag="KLLA0_D02266g"
                     /db_xref="GeneID:2893031"
     mRNA            <193082..>194587
                     /locus_tag="KLLA0_D02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453169.1"
                     /db_xref="GeneID:2893031"
     CDS             193082..194587
                     /locus_tag="KLLA0_D02266g"
                     /note="similar to uniprot|P36113 Saccharomyces cerevisiae
                     YKR017C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453169.1"
                     /db_xref="GeneID:2893031"
                     /db_xref="GOA:Q6CSC0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6CSC0"
                     /translation="MTSLDDYNFELSEDDEYYQFVEDSDYESDYSSGKVLKVDESFQG
                     SDDLRLRYKSLSTNELYDDVMERVEFVRTITQLSTDSMIILLRLYGWNEEKLLEDYTE
                     NPSEILEKGGLIVPEHCKKRDLTDKPHYTCLICCDSYSKVPVFRMECGHEACINCYRT
                     YLTSTLKKPKAPTCMSCHLSITSSDIDRIFGNKEFSKKHICLSFETFINKHSKNYKWC
                     PYTGCGNIIYSNNESTLNEMLKRHKIPEVECSNKHAFCFYCSTEVHTPSDCKIAQYWI
                     QKVRDESTNLNWILNNTKPCPFCGTSIEKNGGCNHMTCQSCHSEFCWICDGKWAIHTD
                     NYVCKFQNEKKDNTINKSITKRFTDGYKMFIVHENSSDLDLKLAGTIESKIFTLQKEL
                     GISWIEGQFLSESIKILLHGRSVLKWSYAIGVFCDPSHNLTHILEQNQTMLSNAVESL
                     SLKIQIKDPKVLIKSKAEFHDASSLVNGRVVALEKCCQELLIKGICKLEAI"
     gene            complement(<194724..>196286)
                     /locus_tag="KLLA0_D02288g"
                     /db_xref="GeneID:2892798"
     mRNA            complement(<194724..>196286)
                     /locus_tag="KLLA0_D02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453170.1"
                     /db_xref="GeneID:2892798"
     CDS             complement(194724..196286)
                     /locus_tag="KLLA0_D02288g"
                     /note="similar to uniprot|P80428 Saccharomyces cerevisiae
                     YJL081C ARP4 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453170.1"
                     /db_xref="GeneID:2892798"
                     /db_xref="GOA:Q6CSB9"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR027667"
                     /translation="MSNPALQVYGGDEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSY
                     GNVETDGDTKRIFNEQPLLFPRAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFES
                     NKGTPVLLTEPIWNSEASRKKSLEILLESMEFEACYLAANSSAVSFAMGRPTCLVVDI
                     GHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDFVK
                     RTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLEAPWGEE
                     LIFDADTRYSFAEQLFRPVKEDFPEGWPASTDGIVKTWHNDYVPLKRTKPGTSTNTKE
                     KENTAESTPVPASTEQEAVDSPSQEPNENGKRPVENKEDSSNNEQNSNEIKNEDANSN
                     ESSAKATVPSNGIQAKGEDEVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPG
                     LSDRIMHELNKSLPALKFRMLSSGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEE
                     VGPERLLKDRFR"
     gene            complement(<196687..>198294)
                     /locus_tag="KLLA0_D02310g"
                     /db_xref="GeneID:2893040"
     mRNA            complement(<196687..>198294)
                     /locus_tag="KLLA0_D02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453171.1"
                     /db_xref="GeneID:2893040"
     CDS             complement(196687..198294)
                     /locus_tag="KLLA0_D02310g"
                     /note="similar to uniprot|P36112 Saccharomyces cerevisiae
                     YKR016W FMP13 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453171.1"
                     /db_xref="GeneID:2893040"
                     /db_xref="GOA:Q6CSB8"
                     /db_xref="InterPro:IPR019133"
                     /translation="MFRASKALGQRFASTNVPVKTARPFRNFLWKLGAATTVFYVGGV
                     ALSTYNYQFAELFTDNVPLAEELVQLVESYNDGTLNAPQLSLDEIRKKFGSITRKVQS
                     VPHLGSTSSTVTESQSIASGSGSTAAAATTGTDSNSVVLSSVPPVGSVLLRLPHLKLD
                     DDSNSFNNKSFVESFNKQVDSLNEKEFILPENAVESFLESYHGLSSQLNELNRDLADQ
                     LNSQLGQLSAELKQSVESDKVKEIESNKLQLMQQFEKDLSNLKVEFEQKFDSQLQSSL
                     KANEQAMLAKHKNELAMLSIKQVQEFNKIISNKIENERNGRLKNLDELNGSVKTVSDS
                     LAALEETLLRSECVNQLTNLVSSIKFKLNLDNTPSLDISKDLQKLTTLVNILPGKPNK
                     CDAKEPQLIDVVVNELNSLTSAKENKQILSNEQLLNRWGLLQDKIREASLLPPNAGFL
                     GHVSAKFFSLFLFNKSGISNENDIDSVISRVTENIKLNRLDKAVEDVVQLQGWSRLEA
                     DDWLQAARSKLELETLVDVVDHEIKTL"
     gene            <198735..>199220
                     /locus_tag="KLLA0_D02332g"
                     /db_xref="GeneID:2893035"
     mRNA            <198735..>199220
                     /locus_tag="KLLA0_D02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453172.1"
                     /db_xref="GeneID:2893035"
     CDS             198735..199220
                     /locus_tag="KLLA0_D02332g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453172.1"
                     /db_xref="GeneID:2893035"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB7"
                     /translation="MTVIAHLKNIPHYPGNPRNITPVKFRPTGTQFLNQYKKPSAAEH
                     PANPIANVIFFLPTSPIIHSPLVYFFSACLFQVYGSDKRGAGYSQWKSQSLGIKTKRR
                     KRKRTDADFNTTKTSVSDCGNSQNGVVLRSAIHFISTKRKRRNFPSNFPSYFLWGPLK
                     L"
     gene            <199795..>201057
                     /locus_tag="KLLA0_D02354g"
                     /db_xref="GeneID:2893327"
     mRNA            <199795..>201057
                     /locus_tag="KLLA0_D02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453173.1"
                     /db_xref="GeneID:2893327"
     CDS             199795..201057
                     /locus_tag="KLLA0_D02354g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453173.1"
                     /db_xref="GeneID:2893327"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB6"
                     /translation="MNSYVNTCSGLELTADQCQRLLQLSRVDSSVYHSSFQKILHWFY
                     HVQPDSSQSETLAIIVANILLHSCSIRTDANLNATLIKCVETSLFENPFDLPRWRIMF
                     LLAHCKPTLAHDGQGSDLDDSDQKHHQIFNRMLAPQSFQTMVTSLTMDPKRISILTEL
                     GKYWYALCFNYGYLSANSRVYWSLFTELSGKPYNSVAGFQDCLIQFGSLYLLLHTHNL
                     SVERTTVNRFLCIFEDKFNDWLLQASEELYCPLQEHRLPQILNILELLIGYSSPQLRQ
                     DIRTCFVSPHNSFHCPFVNSSFIKLIESPINNISNTTTSILNLLHLRHNRETHRLEPL
                     PPVSRESSVCSSISHDYITYSGLPTPSANTTTAASTVNSNSSMTSIAEQDSEADNWPE
                     EEQLLEAEKIGAAIQRLNELGFVKMSTE"
     gene            <201512..>202135
                     /locus_tag="KLLA0_D02376g"
                     /db_xref="GeneID:2893350"
     mRNA            <201512..>202135
                     /locus_tag="KLLA0_D02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453174.1"
                     /db_xref="GeneID:2893350"
     CDS             201512..202135
                     /locus_tag="KLLA0_D02376g"
                     /note="similar to uniprot|P36018 Saccharomyces cerevisiae
                     YKR014C YPT52 rab5-like GTPase involved in vacuolar
                     protein sorting and endocytosis probable purine
                     nucleotide- binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453174.1"
                     /db_xref="GeneID:2893350"
                     /db_xref="GOA:Q6CSB5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB5"
                     /translation="MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQT
                     IKLSEEYDEQVLKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWV
                     DELKEKVNDDKLIICLVGNKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGE
                     NVIKVFQDIGERLYLQNKDKIQESKKPNNNNISLQRPSTNDSQSCCS"
     gene            complement(<202446..>206063)
                     /locus_tag="KLLA0_D02398g"
                     /db_xref="GeneID:2892828"
     mRNA            complement(<202446..>206063)
                     /locus_tag="KLLA0_D02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453175.1"
                     /db_xref="GeneID:2892828"
     CDS             complement(202446..206063)
                     /locus_tag="KLLA0_D02398g"
                     /note="similar to uniprot|P06105 Saccharomyces cerevisiae
                     YJL080C SCP160 May be required during cell division for
                     faithful partitioning of the ER-nuclear envelope membranes
                     involved in control of mitotic chromsome transmission"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453175.1"
                     /db_xref="GeneID:2892828"
                     /db_xref="GOA:Q6CSB4"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB4"
                     /translation="MSEITPDVAEDYSQIVVDTPPSSADDSSKLAGQTIEQTEKSNGE
                     EAATAPAVKVLFPRLGGNAAASASGNAVSWGSTLKSGSSVNSVSSLSHGKNGRASSPG
                     SAKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLIS
                     GSSDKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPK
                     EVDEGTYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVP
                     FIDLESVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKE
                     KVPFKFHPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHT
                     VESLEISKAHGKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSI
                     TLISNNDAADAIKTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVP
                     FIQLGDCFPGNDDILLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVV
                     SLAKKEQDELLGESKVTLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASA
                     AVKSIVENSSTESKITFQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQDSKDENTD
                     VTLTGLQYNLDQAKTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYS
                     VFIRFPKDSELVTIRGPSRGVKAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKS
                     GETINDIKAEYGVELNFLDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQAS
                     NFETVTLEDIDSKYYSDIIGRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIF
                     GPSDFVKKVVKQIKGVVSGLENSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIH
                     VPNKNSSDEKVTVSGSPANIESCKKKIEKEIIRDSFDLEIAVPAKYHSYVSNSGLIFQ
                     TLRNEFSIDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTETEAKVDTI
                     PWRLTYSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDA
                     KKFNSIVGPNGRNIREIRNATKTVIHVPRKSDKVNNVIYVLGSEEGVKKAAELICKRL
                     K"
     gene            complement(<206544..>207182)
                     /locus_tag="KLLA0_D02420g"
                     /db_xref="GeneID:2893536"
     mRNA            complement(<206544..>207182)
                     /locus_tag="KLLA0_D02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453176.1"
                     /db_xref="GeneID:2893536"
     CDS             complement(206544..207182)
                     /locus_tag="KLLA0_D02420g"
                     /note="some similarities with uniprot|P36110 Saccharomyces
                     cerevisiae YKR013W PRY2 Protein of unknown function, has
                     similarity to Pry1p and Pry3p and to the plant PR-1 class
                     of pathogen related proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453176.1"
                     /db_xref="GeneID:2893536"
                     /db_xref="GOA:Q6CSB3"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB3"
                     /translation="MNQVYWLILVVLIHAKILCHAQGITVTKYNTVRIIRTKTVSTTT
                     HFTTSRTIVYRTASGTFTEQVSTKPTATDPDFKTEILDVHNSLRKKHQVSSLVWAPEL
                     ASRAQNFANSYVCNGQLEHSKLPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAAN
                     TGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYDPPGNVIGKFSENVLPEK"
     gene            complement(<207613..>208719)
                     /locus_tag="KLLA0_D02442g"
                     /db_xref="GeneID:2893323"
     mRNA            complement(<207613..>208719)
                     /locus_tag="KLLA0_D02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453177.1"
                     /db_xref="GeneID:2893323"
     CDS             complement(207613..208719)
                     /locus_tag="KLLA0_D02442g"
                     /note="some similarities with uniprot|P47032 Saccharomyces
                     cerevisiae YJL079C PRY1 Protein of unknown function, has
                     similarity to Pry2p and Pry3p and to the plant PR-1 class
                     of pathogen related proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453177.1"
                     /db_xref="GeneID:2893323"
                     /db_xref="GOA:Q6CSB2"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:Q6CSB2"
                     /translation="MPWQCRHTLRRCLAFVYLAFLLYSRIYFLTYIYVLIFFAGFKIS
                     WFKASIYITRGLISFCLRLKHQARFIFFKEPVPSFVTMKLSNATLLSLAATAIAAPVA
                     TVTVHEHVRHTVIVEGYVYIDGTTTSTGYRTVNGQSVETAAPATETDTAAFVTQVVAA
                     GAAASPSSQAVAAEYVSDEDTTTTGAPSTTSTAEQTTLTPTPTIEQTATSTPATTTAA
                     TSSSSSDSNLSSFASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLT
                     HSGGPYGENLAIGYGTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCG
                     IKQCGGVWGDYIICSYDPAGNMLGTFASNVEPLA"
     gene            complement(<209705..>210388)
                     /locus_tag="KLLA0_D02464g"
                     /db_xref="GeneID:2893361"
     mRNA            complement(<209705..>210388)
                     /locus_tag="KLLA0_D02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453178.1"
                     /db_xref="GeneID:2893361"
     CDS             complement(209705..210388)
                     /locus_tag="KLLA0_D02464g"
                     /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
                     YOR289W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453178.1"
                     /db_xref="GeneID:2893361"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR023473"
                     /db_xref="InterPro:IPR027485"
                     /translation="MSLETSSPYAFYAFYQLYSQFYRVPKITLETVNDFLYQGKGLKP
                     EFARSPLFVTWKKLKKGEYQLRGCIGTFSEGKIEEGLKRYALISALQDSRFTPIEREE
                     LSQLRCGCNLLSQFKTIYSSEGTGNSGDIWNWEIGKHGIEIKFRHPKTNSRMSATFLP
                     EVIPEQGWDQRETFENLIEKAGCWNYLEEVMKHWEKYFDEVIRYEGTKSEIAWDEFET
                     GLSTVAEAE"
     gene            <210629..>211615
                     /locus_tag="KLLA0_D02486g"
                     /db_xref="GeneID:2892965"
     mRNA            <210629..>211615
                     /locus_tag="KLLA0_D02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453179.1"
                     /db_xref="GeneID:2892965"
     CDS             210629..211615
                     /locus_tag="KLLA0_D02486g"
                     /note="similar to uniprot|Q12404 Saccharomyces cerevisiae
                     YOR288C MPD1 Member of the protein disulfide isomerase
                     (PDI) family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453179.1"
                     /db_xref="GeneID:2892965"
                     /db_xref="GOA:F2Z6B5"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:F2Z6B5"
                     /translation="MMYTRLLYALFLLVELAFGANFYDRDENIMELTPSNFDKVIHRT
                     NYTTLVMFYAPWCGYCQELKGSMKSAGKILSGMVQVAGVNCDESVNKQLCAQNRVSGF
                     PTLMVFRPPKINLDNPKKNSNGAASQHATEVYKGERKLKPIVDFALSRVKNYVKRLNR
                     YSKFEELLKSSRTRYAVVLISKKEKIPTLYKSVALDWLGIYDFYSIWDEKLQGVSQLS
                     FENDTKNWPNTVKYLQSLEKSETELQSPRIVVIDRETDTYDELDILKTTDKNDIATFL
                     SKFESKPREGPLSKRQEYLKSILNKSKSKKSKTKKNKQKTKLTKDDIVQDEL"
     gene            <211891..>212358
                     /locus_tag="KLLA0_D02508g"
                     /db_xref="GeneID:2893457"
     mRNA            <211891..>212358
                     /locus_tag="KLLA0_D02508g"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_453180.1"
                     /db_xref="GeneID:2893457"
     CDS             211891..212358
                     /locus_tag="KLLA0_D02508g"
                     /note="highly similar to uniprot|Q12487 Saccharomyces
                     cerevisiae YOR150W MRPL23 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_453180.1"
                     /db_xref="GeneID:2893457"
                     /db_xref="GOA:F2Z644"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:F2Z644"
                     /translation="MSQKVGHTGLAFARMWHHVDISKDKRTLGRVASQVALALMGKHK
                     PVYHPSADCGDYVVVTNCQALRVTGNKMTQKTYWSHTSRPGSLKLTTMEDMISNKGYS
                     EVLKKAVSGMLPKNKLRKIRLARLKIFDGSEHPYKSNITAFADQQLELQHQKK"
     gene            complement(<212703..>214826)
                     /locus_tag="KLLA0_D02530g"
                     /db_xref="GeneID:2893039"
     mRNA            complement(<212703..>214826)
                     /locus_tag="KLLA0_D02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453181.1"
                     /db_xref="GeneID:2893039"
     CDS             complement(212703..214826)
                     /locus_tag="KLLA0_D02530g"
                     /note="similar to uniprot|Q06440 Saccharomyces cerevisiae
                     YLR429W CRN1 Coronin cortical actin cytoskeletal component
                     that associates with the Arp2p/Arp3p complex to regulate
                     its activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453181.1"
                     /db_xref="GeneID:2893039"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA8"
                     /translation="MAHGYHIWHSLIISGRFVRASKYRHVYGQPAKKELQYENLRITS
                     NAWDSNLIKCNGKYISVNWNSSGGGAFAVIPVKEVGKIPDQVPLFRGHTAQVLDTDFS
                     PFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLF
                     HPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKL
                     RVWDVRAEKIVSEGPAHSGAKNQRVVWLGDTDKVATTGFSRLSDRQIGVWDAFNLEKG
                     NLGGFYNVDQSSGILMPFYDDSNRILYVAGKGDGNIRYFEFQNDELYELSEYQSTEPQ
                     RGFAVAPKRSVNVKENEVLKAYKAVGEHAVEPISFYVPRKSEVFQDDIYPDAPSSKPA
                     LSAAEWVEGKSVDGPILFKLQTLYDGSEPEFTDSKKPVKELTSESKEQPKSPSQSPSQ
                     SPSTEVKHEVIIQLTPSNKSKKTSPSPASSSSSGSPARKEMPPAKDTGKNQVDELLSK
                     DASVNKLLQKASDLDADNEAENPSEESSVWDSEDEKIVKASQQPEVVVKVEANTDSEP
                     DKAAEEVPQQKEENSSTEITSKASASSKVESTPEAKVEASSQASVETNIRVNPSQEDS
                     EEKPSSNPNTGGAAGAAAAAGAAAAAGASTNKSLNLRQSVETLSGLVLKLESYIDKLT
                     EENTRKDEILAALEAKVDRLLEQGK"
     gene            complement(<215290..>217149)
                     /locus_tag="KLLA0_D02552g"
                     /db_xref="GeneID:2893036"
     mRNA            complement(<215290..>217149)
                     /locus_tag="KLLA0_D02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453182.1"
                     /db_xref="GeneID:2893036"
     CDS             complement(215290..217149)
                     /locus_tag="KLLA0_D02552g"
                     /note="similar to uniprot|Q06436 Saccharomyces cerevisiae
                     YLR427W MAG2 DNA-3-methyladenine glycosidase II that
                     catalyzes of the hydrolysis of alkylated DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453182.1"
                     /db_xref="GeneID:2893036"
                     /db_xref="GOA:Q6CSA7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA7"
                     /translation="MSDKLNIEAPSFVPDYRQKKGGRNAGKALTTPNANTKPKPAKNG
                     RGSKGNGNSHRNHGKPSAHEDLEWNIQDELAHGDYKLNGKKTKISINHLLDFQLPEVE
                     RFKSGSTRAPDKRRRRRQSDNQDRVYLHGDSFVNANYKFLVDDEGSYEAQCNDPNVPL
                     ETESVKRVVIPKGQTCPICLSEDLISPRMVVCGHVFCQTCLLQLFTNDPMVGKNDEST
                     YARMKRKDLRECPLCSSIIKKTSVKPVLFTDADSKDNTPTIGSMVELQLMCRPHGSLL
                     PLPVNLNIDPFSIGNFPSVHMKELAVYSRIMKCSTQYAIHLLERDNLQIYEQLEIDKA
                     LYHDNGKLAQLALDENVSLINGLKSKNNNKEPDISALSIASGGLEKYNDDNAFFYYEA
                     GFNSTTKFYLSPLDVKVLKNVFAHYHEFPSTIKIKVEDIHYGSMVTETTISKFKYFSH
                     LPIGTELAFVDLDWRNEDIIPKEVYNKFFAELRQRHRKAMTKRNKEDKDKITYQERLE
                     QEHLEFYQRENNNQYPPMQKPATQFPSKKTSTVNHPSNIALSASPDDEASSKPKMKER
                     TVWGTQITVTDQNVIEEDLEFEKMLLEASQSKKGRSKKKGKTLLLSNNSTRTL"
     gene            <217940..>218449
                     /locus_tag="KLLA0_D02574g"
                     /db_xref="GeneID:2893347"
     mRNA            <217940..>218449
                     /locus_tag="KLLA0_D02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453183.1"
                     /db_xref="GeneID:2893347"
     CDS             217940..218449
                     /locus_tag="KLLA0_D02574g"
                     /note="similar to uniprot|Q04969 Saccharomyces cerevisiae
                     YML055W SPC2 Subunit of signal peptidase complex (Spc1p
                     Spc2p Spc3p Sec11p) which catalyzes cleavage of N-terminal
                     signal sequences of proteins targeted to the secretory
                     pathway homologous to mammalian SPC25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453183.1"
                     /db_xref="GeneID:2893347"
                     /db_xref="GOA:Q6CSA6"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA6"
                     /translation="MSKPINVYAVPEVRKALDEALPEIFSRLGYTQTFKLIDTKLILG
                     YSLVVFAAASFLLDKKLPWEQSKPYQQVLVALYMILSAVQLWFNKFVEKGTVYQGVKK
                     NDTVSVGAKYKKHSHEFHVSITNRKGRSLELDTTFTKFFNEQGYMQSDILFNWFKEQL
                     EALGSKKTE"
     gene            complement(<218659..>219782)
                     /locus_tag="KLLA0_D02596g"
                     /db_xref="GeneID:2893017"
     mRNA            complement(join(<218659..219586,219682..>219782))
                     /locus_tag="KLLA0_D02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453184.2"
                     /db_xref="GeneID:2893017"
     CDS             complement(join(218659..219586,219682..219782))
                     /locus_tag="KLLA0_D02596g"
                     /note="similar to uniprot|Q06417 Saccharomyces cerevisiae
                     YLR426W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453184.2"
                     /db_xref="GeneID:2893017"
                     /db_xref="GOA:Q6CSA5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA5"
                     /translation="MQGSTTWIQNVDTLWETLQPLIRYPVLPLILVEKLLGLNLRYLY
                     PVLLTYSVLLTIYFHIDTKYKTRGSWISIKDTADPVCVITGGSLGLGNELVKSLMSDI
                     PDIKIVILDVVDPKLDLSITKDRIEFLRCDLSSDEEVENAIKTIKNKFPKVDLLINNA
                     AIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAFHPKKSANNDFYYVVNIASALGIM
                     SPARASTYAASKAALISYHESWTYELLNDNAMNVRTLLVLPGQMDTQMFQGFEPPRQF
                     LAPVIKAPELAKEITQCCIEGRRGEICRPFYVNFLRMMKCFPEMIIEQLRAFSKMDAC
                     LPIGSKSS"
     gene            complement(<220267..>224253)
                     /locus_tag="KLLA0_D02618g"
                     /db_xref="GeneID:2893021"
     mRNA            complement(<220267..>224253)
                     /locus_tag="KLLA0_D02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453185.1"
                     /db_xref="GeneID:2893021"
     CDS             complement(220267..224253)
                     /locus_tag="KLLA0_D02618g"
                     /note="similar to uniprot|Q06412 Saccharomyces cerevisiae
                     YLR425W TUS1 Guanine nucleotide exchange factor (GEF) that
                     functions to modulate Rhop1 activity as part of the cell
                     integrity signaling pathway multicopy suppressor of tor2
                     mutation and ypk1 ypk2 double mutation potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453185.1"
                     /db_xref="GeneID:2893021"
                     /db_xref="GOA:Q6CSA4"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA4"
                     /translation="MDSTQRSPRLPALPPLQSQQSTPKKVGNNERRRRPPPPILTSPV
                     TPTSGSSFTVVPSRSSEKQQPQIDQQHLYSSPFVTEVSVSEKRAPAPKVYISPFVGDP
                     SVFRSPETLPNSSFSNNSDSPASQSDNNNYNNNRLSSSSTSSIFTNNVTMPNIEFEGF
                     ASSDSKDITMKALPALPPRTFSGPINAATKTTATSSSTLQFTGPVEHRYNDMAVPETL
                     PALDAISPISTGNFNWSTSDKSSLQNTTLYYPQPPKMKDVSNGAIGPNEPRLSDSISS
                     YYSNSSYAFNKNVEEYARHESFGSITGSKPLNNVASITVPTYPFTIDLLDERKLYQCY
                     NISQLSHIYQWLLKVYFEWFNEYVFGKLEFFQIVQLLLEFQLPNSCEQDIIDSNVDKI
                     IESLILQGAVRFEDDPETGNQITIIIAGLDTQGVFTDLLPCYSYSHIYDDPTTDLKCY
                     SYTCWSSKGSENYRSQLKISEFINKSVGLWTDYWKLTPEELSEINPKEVKRQSFIFDL
                     IVLEERSLNLANAAVEIYGASFDPALLPDDPNFKSMAYDIFIPLIELHKDILLSPILW
                     KLKIKGKFIDGVGKIYLKWANDAKQVYVKYAQNMATVHEIINWEKENNTRFASWLRQI
                     DESTPITRSKLYHDVIFFGGFFKSLQNMPVTLRSVLKCTDPSMDDHEYLRMAIQEIEQ
                     LSRLVDKAHGDAIDKRKIVRLARQLIFTSKTGNTVNYLNIQSGNDSVSNFTTNNEHLD
                     LKLGDGDRKLIMQGILQKKRELWLESAPVYVFLLDNYFLITEEIFKGSGKKYKLIERP
                     IPIDYLSVETKEDINYKRKSLSDADEESCNVQTPSTSKKPPLLPAGTTMSSIPKTIYQ
                     TATNATLNNDDNEESSYSFKIRNTASNESHTFSTSTMEEREHWVASLVKAFQNHMGHN
                     EKQAFQLQCLCDLFSYDEIQAPTNLPLEPEGSAVSSAMKEFYSVNSPKTFASMKGDIL
                     CSVSFQYENETFLLCSVNHGVYITLPRLLHQWKRILNFSKVTKMEISTKLGLLFLLAD
                     RKLCYFNIPSLISAFYDSEQYLPDNRIVGIIIQEKITFFKMAEDFSNSRHLFYERKGE
                     IIIMTPEFDPLTKVFKFFKHYKSYKIPVSSSGLTASTVSDITILRNSFIVCSSKGAIL
                     YSDSFNEEGAFLPTTLTDTSKLKLNHLSFRKQTESKSKNNSSTMKMAEYVKSDILSKK
                     TKPIACFRIDPNNFIICYDEAIIRINKFGEIPDWKKDILVLDFYCIGVSLNLGHLILA
                     GDNLVQVYNLRFVDTGEWALNTIKPVQIIKGKKIKITDTSQDCTSIVLTHPNIAGRQL
                     LLHFNLSV"
     gene            complement(<225482..>227251)
                     /locus_tag="KLLA0_D02640g"
                     /db_xref="GeneID:2893359"
     mRNA            complement(<225482..>227251)
                     /locus_tag="KLLA0_D02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453186.1"
                     /db_xref="GeneID:2893359"
     CDS             complement(225482..227251)
                     /locus_tag="KLLA0_D02640g"
                     /note="similar to uniprot|P00175 Saccharomyces cerevisiae
                     YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase) component of the mitochondrial
                     intermembrane space required for lactate utilization
                     expression is repressed by glucose and anaerobic
                     conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453186.1"
                     /db_xref="GeneID:2893359"
                     /db_xref="GOA:Q6CSA3"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA3"
                     /translation="MRSAVRVFGKNRVSGLRFASTSSKSPIHKSSATLRFGRSAKSGY
                     SAFSFGKKVITGGAFLVAGSVGIALISQFNDSVENGAKVDMTKPKVSPTEVAKHSSPK
                     DCWVVIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKIFAPIHAPDVIEKYIAPENRI
                     GPLDGTMPDDLVCAALTPGETPEDVARKEQLRQSLPDIDSLVNIYDFEFLASQILTKQ
                     AWSYYSSAADDEVTHRENHAAYHRIFFKPRILVNVKEVDTSTTMLGEKVGVPFYVSAT
                     ALCKLGNPKEGEKDIARGCGESDVKPVQMISTLASCSLQEIVEAAPSKEQIQWFQLYV
                     NSDRKITEDLIKNVEKLGLKAIFVTVDAPSLGNREKDAKVKFTNSNGAKAMEKSKVKE
                     SKGASRALSSFIDPALNWDDIIEFKKKTKLPIVIKGVQCVEDVLKAAEIGVAGVVLSN
                     HGGRQLDFSRAPIEVLAETMPVLREKKLDDKIEIFIDGGVRRGTDILKALCLGAKGVG
                     LGRPFLYSNSCYGKEGVKKAIELLKDELEMSMRLLGVTSIDQLSEKYLDLSTIHGRTV
                     NVPRDNLYREVYVPHEPTQFLEE"
     gene            228254..228327
                     /locus_tag="KLLA0_D02662r"
                     /db_xref="GeneID:2893332"
     tRNA            228254..228327
                     /locus_tag="KLLA0_D02662r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2893332"
     gene            complement(<228564..>229166)
                     /locus_tag="KLLA0_D02684g"
                     /db_xref="GeneID:2893012"
     mRNA            complement(<228564..>229166)
                     /locus_tag="KLLA0_D02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453187.1"
                     /db_xref="GeneID:2893012"
     CDS             complement(228564..229166)
                     /locus_tag="KLLA0_D02684g"
                     /note="highly similar to uniprot|P36015 Saccharomyces
                     cerevisiae YKL196C YKT6 v-SNARE (synaptobrevin) essential
                     for endoplasmic reticulum-Golgi transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453187.1"
                     /db_xref="GeneID:2893012"
                     /db_xref="GOA:Q6CSA2"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /translation="MKIYYIGVLRNSDDKTLELSSVKDLSQFGFFERNSVAQFMSFFS
                     ETVAGRTSAGQRQSVEEGNYVGHVYARPEGICGVLITDKEYPVRPAYTLLNKVLDEYL
                     VAHPPIQWKDVTESDDSLKLKELDIYIAKYQDPSQADAIMRVQQELDETKITLHKTIE
                     NVLQRGEKLDNLVDKSESLSAASRMFYKQAKKTNSCCIVM"
     gene            <229566..>230786
                     /locus_tag="KLLA0_D02706g"
                     /db_xref="GeneID:2893354"
     mRNA            <229566..>230786
                     /locus_tag="KLLA0_D02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453188.1"
                     /db_xref="GeneID:2893354"
     CDS             229566..230786
                     /locus_tag="KLLA0_D02706g"
                     /note="some similarities with uniprot|P36046 Saccharomyces
                     cerevisiae YKL195W MIA40 Essential protein of the
                     mitochondrial intermembrane space involved in import and
                     assembly of intermembrane space proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453188.1"
                     /db_xref="GeneID:2893354"
                     /db_xref="GOA:Q6CSA1"
                     /db_xref="InterPro:IPR010625"
                     /translation="MFRVSLQATRRVAFRSARQIRFYSAHPPSGGVSHMNKPALLLAG
                     FSTLGAIYVADGCPTLIERKPAPAEKPAEETPAAGQSQSISEPTKDADESPVSAQEEG
                     AEPVTTPENEITYSEETHQALAATLSGDEPAAIEPVAESVNEQATEPAASGEATNEPV
                     TGISEDTKAPSLSFDDSKTAKGVVLEDEADKKEIQQTSPDAVKTASKDGSEGESDVVL
                     HEKSPAEAETITEAEEQAEIRSISGGTAEQSATAAAAAAGVQGEKKNEQQTAYNPETG
                     EINWDCPCLGGMAYGPCGEEFKSAFSCFVYSEADPKGINCVEKFSTMQNCFRKYPDYY
                     AEQIKDEEEASAEASKIEDKSTTPVSTATSTVEVQTENAVFEPVLEKYVEENPQLKDT
                     PEAAAVTNTDDEKK"
     gene            complement(<231163..>233166)
                     /locus_tag="KLLA0_D02728g"
                     /db_xref="GeneID:2893335"
     mRNA            complement(<231163..>233166)
                     /locus_tag="KLLA0_D02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453189.1"
                     /db_xref="GeneID:2893335"
     CDS             complement(231163..233166)
                     /locus_tag="KLLA0_D02728g"
                     /note="weakly similar to uniprot|Q06411 Saccharomyces
                     cerevisiae YLR424W SPP382 Essential protein present in
                     native splicing complexes identified as a suppressor of
                     prp38-1 a spliceosomal maturation mutation cold sensitive
                     alleles accumulate pre-mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453189.1"
                     /db_xref="GeneID:2893335"
                     /db_xref="GOA:Q6CSA0"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:Q6CSA0"
                     /translation="MSEHISDDDQFKRRKISMTMNSMVFTDPYGYSDDNEEQKEEEDY
                     EPVRQANSNDGLKSDQMLKTYGMGAKLLSKMGYKQGEGLGRDGKGIVNPIETVTRPKG
                     VGLGMLSAVHDRDDSNYSNTSASSDESSNKKKTVEFKTRRATQLEKLIQNISLLAELK
                     IELPDTVTRTINGSELHEEEISSLNEIANKLLQLHSDIDRIQVGLEKAQLDDERKVHQ
                     EERLQSVLEKVKEKQLSQPSLEDQITECLEINDDDILDKLCTMFLLKELNRGINTADM
                     QVEKLNHLRAAIRFLSYRMESGYILNETQSSIYRLVYQPLCYWLDSNTGYSRMLRQIT
                     VQYLPIIDFISCREHFLSRYIMPALEIQLSPQFLSDEFMVTYGELHLILGERDLKSLK
                     ALILLEFEQFLKNWEPSMTVNPQNVILLKEAVGDSKFYELVNRYWLSSFADYFDSHFH
                     LIDEFTDAENEIYISAIIDVLKEYNDFFDLPTRNKVYKVINNSLLKTLFQWFVFKSST
                     FRYEASSWLKYMINRIYTASSLDNVEEVKKLLDFVDHPSTLSDHDERLSLKSLIESTG
                     QSESRFNAFNNTPMTKISTTFKTVVETFCHDHGLSFRKTDNDTASINIFGKEKVAPVF
                     TVSKYNNKRVNVVLMGDILWLQRRNRTESRFEPIFLYQLLDLI"
     gene            <233381..>234652
                     /locus_tag="KLLA0_D02750g"
                     /db_xref="GeneID:2893326"
     mRNA            <233381..>234652
                     /locus_tag="KLLA0_D02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453190.1"
                     /db_xref="GeneID:2893326"
     CDS             233381..234652
                     /locus_tag="KLLA0_D02750g"
                     /note="similar to uniprot|Q06410 Saccharomyces cerevisiae
                     YLR423C ATG17 Protein that interacts with and is required
                     for activation of Apg1p protein kinase involved in
                     autophagy but not in the Cvt (cytoplasm to vacuole
                     targeting) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453190.1"
                     /db_xref="GeneID:2893326"
                     /db_xref="GOA:Q6CS99"
                     /db_xref="InterPro:IPR007240"
                     /translation="MSDAATTIPSDEIDKLWNKARNQLVEAQVECEESLKILSKVRTE
                     MDSSQKSRFKLKFILNCLVNQVEFFKNIMLEKCISTELIDNEWSKLVLVEIVNDVSYW
                     QNEITTKMKILQGTKYDLTDDHSSLSDFICMDHVDILQQKIDEIPIIKQQVTNIRQHY
                     KSIKDRIENQLVAVKLKKLRTYFDSHFSRDSKNNLFKLLESDYVTELNEFENELADFL
                     RSITDHFDKCTILKEQQIPLPDLKELFQIVKKDDTQLENIRELVFETGLEVKAFSKKV
                     NETISEIMDKIGGFHLLASKIVTELEKCEEYLSIFQKIANLVFVYKESCIKKIEQVQQ
                     LCEFYDKFKLGYKNLLRERDRRKATALQMEKILKECQEKLQALSDADLDQRQQFLLEN
                     GDYLPENIWPGYIDDMESMYSFEYSIHNVPN"
     gene            complement(<234761..>236146)
                     /locus_tag="KLLA0_D02772g"
                     /db_xref="GeneID:2893341"
     mRNA            complement(<234761..>236146)
                     /locus_tag="KLLA0_D02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453191.1"
                     /db_xref="GeneID:2893341"
     CDS             complement(234761..236146)
                     /locus_tag="KLLA0_D02772g"
                     /note="similar to uniprot|P07236 Saccharomyces cerevisiae
                     YKL194C MST1 Mitochondrial threonyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453191.1"
                     /db_xref="GeneID:2893341"
                     /db_xref="GOA:Q6CS98"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6CS98"
                     /translation="MLLKRINYLPVRNAGVPCQFVKRLCSNHNEGPQAVDSAATTAHE
                     VSTKQELYITDPISPGSIFFLPNGTKIFNKLVSFMKLQQQNKYGFQEVVTPLIYRKTL
                     WEQSGHWENYKDDMFRVEGNDVSKEEYGLKPMNCPGHCVVFKRFDRSYNELPLRFSDF
                     SPLHRNEASGALSGLTRVRKFHQDDGHIFCTPDQVRQEIQKCLELVDMCYTKVFPISG
                     DSKQAAYSLTLSTRPEKYVGDIEVWDHAEDVLKDTLQSWGQPWTTNEGDGAFYGPKID
                     ILVNDHTGKSHQVATIQLDFQLPERFDLQFKDKDNSYKRPIMIHRAVFGSVERFMAIL
                     IDSSKGKWPFWLNPNQCMVIPVKTEDEKIMELAFKTVNSLRGENSDPKSPIPLNSFHF
                     SVDMDARDESVSKRIREAIKKHYSYIIMIGDKEVEAGKVAIRTRESKKVDLLTIDDVF
                     ERFVDLEKNYK"
     gene            complement(<236488..>237846)
                     /locus_tag="KLLA0_D02794g"
                     /db_xref="GeneID:2893329"
     mRNA            complement(<236488..>237846)
                     /locus_tag="KLLA0_D02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453192.1"
                     /db_xref="GeneID:2893329"
     CDS             complement(236488..237846)
                     /locus_tag="KLLA0_D02794g"
                     /note="similar to uniprot|P53960 Saccharomyces cerevisiae
                     YNL040W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453192.1"
                     /db_xref="GeneID:2893329"
                     /db_xref="GOA:Q6CS97"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="UniProtKB/TrEMBL:Q6CS97"
                     /translation="MVRGIKLVGTLAMVKTANHTFVGSLACQRDSFKAKEFETTVIAC
                     DVGKKKNTFEIELQDTILFPEGGGQPSDSGKFLLKTGASIPVSSVFRRGLHAVHITDR
                     DVPVGAKVSVEIDWDKRLDYMQQHTGQHLVSAILEQKWGLKTLSWSMGGIPSEKKPKI
                     EPYDLFNYLEINRRLTSEEVKELSDTVTEYITVNPKTITIFEGDPESQGEISTHKVPD
                     DYDLSKGVLRVVHIEDLDKNPCCGTHLQTTSQISSVLILPSQSSVRGTNSRLFFMCGD
                     RVRRYALFSNEVISNTKKLLSCSEDQIEHKCDMLLKNMQKTTKREQFWIKELAGFCSK
                     SLITDLKENSKAHFIRDEYGTLEFLTQLYNENNQLIAGSSLEDYCYVLAGREKASGGG
                     AIIIVSDSSNRIQEVSDKLKSVVSQLKGGGGKNGGKWQGKVALYKASEFEGLQHYLDS
                     EF"
     gene            complement(<238050..>239138)
                     /locus_tag="KLLA0_D02816g"
                     /db_xref="GeneID:2893330"
     mRNA            complement(<238050..>239138)
                     /locus_tag="KLLA0_D02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453193.1"
                     /db_xref="GeneID:2893330"
     CDS             complement(238050..239138)
                     /locus_tag="KLLA0_D02816g"
                     /note="similar to uniprot|P36047 Saccharomyces cerevisiae
                     YKL193C SDS22 Regulatory subunit of Glc7p type1 protein
                     phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453193.1"
                     /db_xref="GeneID:2893330"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q6CS96"
                     /translation="MSREERVLSDTDNENTNEEIETGIDSPDESSSGLFTAGRSLQSN
                     VIEDHNPDYISADAELAAEIPDDTEVIDLVHLKVLALEDLNLLRFKNLKKLYLRQNLI
                     ESIAELEVLPLENMEEIDFYDNRIKHISKSVNLFSNLKTLDLSFNKIRTIKNVDKLVN
                     LENLYFVQNKISKIENLGTLTKLKNLELGGNRIKEIGPDDLKGLANLEEIWLGKNSIP
                     KLINLQHLKNLRILSIQSNKLKKFEGLEELENLEELYVSHNFISKIEGLENNLKLTTL
                     DVTGNRLTKIENLKHLTHLTDLWASDNQIDQPFESLGEELGKLPEFETIYLEGNPIQT
                     KNPTQYRRKIMLNLGESLQKIDATYVRA"
     gene            complement(<239515..>239880)
                     /locus_tag="KLLA0_D02838g"
                     /db_xref="GeneID:2893357"
     mRNA            complement(<239515..>239880)
                     /locus_tag="KLLA0_D02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453194.1"
                     /db_xref="GeneID:2893357"
     CDS             complement(239515..239880)
                     /locus_tag="KLLA0_D02838g"
                     /note="similar to uniprot|P32463 Saccharomyces cerevisiae
                     YKL192C ACP1 Mitochondrial matrix acyl carrier protein
                     involved in biosynthesis of octanoate which is a precursor
                     to lipoic acid activated by phosphopantetheinylation
                     catalyzed by Ppt2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453194.1"
                     /db_xref="GeneID:2893357"
                     /db_xref="GOA:Q6CS95"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:Q6CS95"
                     /translation="MFRSVFRAAPSLTRVSGLRSGFVKPTFSSASRFYASSSLSKEEI
                     TTRIADVIKSFDKTASATSITANTQFSKDLGLDSLDTVELLVSIEEEFDIEFPDKVAD
                     ELKSVGETVEYIASSPEAN"
     gene            complement(<240197..>246019)
                     /locus_tag="KLLA0_D02860g"
                     /db_xref="GeneID:2893363"
     mRNA            complement(<240197..>246019)
                     /locus_tag="KLLA0_D02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453195.1"
                     /db_xref="GeneID:2893363"
     CDS             complement(240197..246019)
                     /locus_tag="KLLA0_D02860g"
                     /note="similar to uniprot|Q06409 Saccharomyces cerevisiae
                     YLR422W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453195.1"
                     /db_xref="GeneID:2893363"
                     /db_xref="GOA:Q6CS94"
                     /db_xref="InterPro:IPR010703"
                     /db_xref="InterPro:IPR026791"
                     /db_xref="InterPro:IPR027357"
                     /db_xref="UniProtKB/TrEMBL:Q6CS94"
                     /translation="MTKSNNDATANGSSDTPANHTELRQFEWIPTDRLIPGTVARAFL
                     PLKKCPELVLKSSDYVDLYPGDEVFVMEQTKDGKWCRGYVSNDLMPIDFMSNMGSVTD
                     NLPKQKIQRVIFPRRFVHLDFDEQIENYAFLRFPTGTELEQQDGRLKKLPSLYQLMRA
                     SKVSRETPPPYPFFVANGYALNREILLNLFTLTKHIYYLYSFGEFEIVDQMVDLYYKL
                     DAVRIQLQANFMATNERSLIMKKATALMSIFSKFIASHSVTKKIGSLQKRNRIDPFGF
                     ESILTRDQATGKLLTDSVSPQLMATSTSLYAMTTNYPVSNANDLKLKPDENTKFKSFP
                     PSQILVDCQEIIGTLVSDQHAEALTAYLYLRTAKEVLTEPFLIDLKKNNQKSMDNVSA
                     ALFRNLPYNIGENNRVYLVVEIVETIKVVIDEDVDQKFVKPFVPFAASADDITGSIRR
                     GVVAGATDISRVFSKEKGSLASGHAYNFKVELFASFYTDSKSEQPPIPAATLTDPAKL
                     AKLMKAKSNVSTKNNGWGDLIDRIINDSHTGIAVTGQMESLVVSVKEIKEDCKFLQTN
                     SDNAMAITAVNPIFYDTLEQKQTDRIYLTLDKVSICGLENKKSNVSNITIQISSNNDK
                     ITFRPSSVTHSYKKWAFITVRPGELVNETIRIDGIDSMTKEETLRVSAYLNGRLFAKS
                     RFYVKKGLQILEYKKKSVFQLISSLGKPLVEIEVGTRYVGNNYNMDRTVHSLLSLLRK
                     HQITENDFEQKSLEALKSLKMVSIKQITKYFNPILLSLLELLYYTCYRHAARSSEALK
                     KAVFSSLVQFLDMNIARHDNYKHLFNDFFEEVERENSNYLPELGPILVRLMSEQFSSS
                     ANSWSYVGRALCRSYILLLKLGRLFSKDIVGYHQAVDEFFNSLSIFFRVTNDSVLVDQ
                     VTILETYDLAINETSAIFDDPHLIQLVLLLFNACQEKENSIEFSQDDLSTKEKNFVNA
                     KYLLLRRILQNPELAPFFKDPAENPLRTKFLGQVIEWCFKPFIKEKGCVPNLTTASYA
                     NGVLITIIEQAQDTVFKRNLIRLLPIFCRIFLFLRSACEKEDCFKFKRVFAPLFPTVT
                     PLPEITVDSMVTDEVFVGVLLETATIIIALTKIVEQQYDSHGSFIKAIEACREDEDFQ
                     SPYYVTKIVREDLATIFVTIHRLIKGDFFPSKKWFTMTAAIMRACMTLSEMCLDVFKL
                     YYVPDEQCTLETFDAELWGRYFKLVLCIANHKTVNSTPLAPLPRKAVYLVTGDLIGRA
                     SYILEQIWDILGDNCIGTDLDNKYGILRSSVYQMTFLTAAMDIVTDFCAFSFLRHVDA
                     RRVGSKIIWVVLILVWTNENSLTTAIEELTPQFFNAYQKGALRPTVFEVEIFLDTLLH
                     VIHLDTEDSIKDTLFNYVRFLKEFLLSLAETEDIPSGEEFDDDRTASQLRIFGYLMSM
                     KRPEMLHTLVNDLFINHMRRKDYIQAALSLELLALTYEWNPNDSLPATKYPPLPEQSS
                     FERREYLYKEAARNFTKGLKLEKALTVYKDLADAYDKINYDLDGLSYVHGQISNIYTD
                     LQNVDRLVPNYFKVSFYGYGFPKNLRGKTFVFEGLPFEHITSVHNRLLKLYPGSKLVN
                     SFTEADKLLVSPPNGKFIHVISVEPRLQISDEYATSDKKNDNNKVRLYVENRDLKTFS
                     SSRRVAGTHGITDLWVIEYIFETKSTFPTLMNRSEVVKVTEKRLSPINNAIKSLQQKI
                     QELSGLEDMCYKLMKENGDCSEVFSELSRNITGTIDAPINGGIAEYRVFYTDEETKSK
                     LDPADVELLVAAFNELTIVLNRCLALHGQLCPISLSKSHTLLKDLFAKNFEKEIKVSG
                     IDINETNDEIIARIKSIQSSQQSFSKRSSMLMSRSIFSESHSIRSAGSNGSATKNSMH
                     DLTVTSSHRTTKSNAPSHAASHATRISRPTTHISMLRSTR"
     gene            <246326..>246946
                     /locus_tag="KLLA0_D02882g"
                     /db_xref="GeneID:2893368"
     mRNA            <246326..>246946
                     /locus_tag="KLLA0_D02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453196.1"
                     /db_xref="GeneID:2893368"
     CDS             246326..246946
                     /locus_tag="KLLA0_D02882g"
                     /note="similar to uniprot|O13563 Saccharomyces cerevisiae
                     YLR421C RPN13 Subunit of the 19S regulatory particle of
                     the 26S proteasome lid"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453196.1"
                     /db_xref="GeneID:2893368"
                     /db_xref="GOA:Q6CS93"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="UniProtKB/TrEMBL:Q6CS93"
                     /translation="MASAVANCLNRTYTHEDINHRTSERLSDQWYRFKRGEKNIDMTE
                     AISFRAGKCDYDEESKICTPKQMKGEIQIKPSEEAQGFFDFQWSTKDRVSGSAVEPIE
                     FILIPGETKWIDIKSAKNGRVLCLLFSTGEKWFFWLQEKHQGNESLNEWSEKDKELLA
                     KLQKLLEFEEEEEEEEEVKEQEQEQEPEKMEIDPQDNEQPKADSNP"
     gene            <247177..>247479
                     /locus_tag="KLLA0_D02904g"
                     /db_xref="GeneID:2893352"
     mRNA            <247177..>247479
                     /locus_tag="KLLA0_D02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453197.1"
                     /db_xref="GeneID:2893352"
     CDS             247177..247479
                     /locus_tag="KLLA0_D02904g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453197.1"
                     /db_xref="GeneID:2893352"
                     /db_xref="UniProtKB/TrEMBL:Q6CS92"
                     /translation="MLVKYIGSLSEESTEFKELCNCLPEDVEKGKENLLKCVRGPFFQ
                     QAVDILDLATKQSYSGQQLSQMFGYSYTGEGPRALLEGLRNKGLQEKLKKQDSQSE"
     gene            complement(<247616..>248710)
                     /locus_tag="KLLA0_D02926g"
                     /db_xref="GeneID:2893023"
     mRNA            complement(<247616..>248710)
                     /locus_tag="KLLA0_D02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453198.1"
                     /db_xref="GeneID:2893023"
     CDS             complement(247616..248710)
                     /locus_tag="KLLA0_D02926g"
                     /note="highly similar to uniprot|P20051 Saccharomyces
                     cerevisiae YLR420W URA4 Third step in pyrimidine
                     biosynthesis pathway dihydrooratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453198.1"
                     /db_xref="GeneID:2893023"
                     /db_xref="GOA:Q6CS91"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="UniProtKB/TrEMBL:Q6CS91"
                     /translation="MSESQTEYDLGITCDMHVHLRDGEMCKLITPTVKEGGISVAYVM
                     PNLSPPVITLERVQEYKCTLESLAPETTFLMSFYLCKDLTPELIHAAAKVGAIQGVKC
                     YPAGVTTNSAQGVDPNDFTVFYPLFKAMEEEGIVLNLHGEKPSVAGEKEDIHVLNAEE
                     SFLPALKKLHLDFPKLKIILEHCTTAAAIKTIEEINADVKDPLDVMVAATITAHHLFL
                     TIDDWAGNPINFCKPVAKLPSDKRALVQAATSGKPYFFFGSDSAPHPIENKAKHVGVC
                     AGVFSQSLAIPYLAEIFETQGKLDTLKNFVSDAPLSFYALKPEDIKSNQNVTVFKKTT
                     NIPEIITDGKGLRVAPFKAGDELHWAVRWD"
     gene            <249292..>251055
                     /locus_tag="KLLA0_D02948g"
                     /db_xref="GeneID:2893038"
     mRNA            <249292..>251055
                     /locus_tag="KLLA0_D02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453199.1"
                     /db_xref="GeneID:2893038"
     CDS             249292..251055
                     /locus_tag="KLLA0_D02948g"
                     /note="similar to uniprot|P32461 Saccharomyces cerevisiae
                     YKL191W DPH2 Protein required along with Dph1p Kti11p
                     Jjj3p and Dph5p for synthesis of diphthamide which is a
                     modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) may act in a complex with Dph1p
                     and Kti11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453199.1"
                     /db_xref="GeneID:2893038"
                     /db_xref="GOA:Q6CS90"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /translation="MNDSVLVAPSLSTAQTEDTFEFQSYGETEHSRSYLGSDVTKDNL
                     VELVSAYYSVPELIQYFEEHPQYKKITLQFPDELVLDSSIVVQLMQQELVKAEDETSQ
                     SFNTIDTDEVLHNEKSCGNCSGCDCSSKIDKTETKRKVWILADTSYSSCCVDEVASEH
                     VKGDIVVHFGDACMNAVQKLPVVYSLGRPVLDLDLVVSQFKLKYAAKDQKICLMADAP
                     HSMHMKSIYDILHDKEGYKNVVYSDINQDMLQSDTHIVGYNNAVEHDERLRKCVTCGN
                     RNIYAEVDVSELNEYDLFHVTIPKDPHLLYLTTKFQSVTLYDPSSGMLNEGPFPSMMK
                     RYKFMHMARTAGTIGILVNTLSLRNTKETMNKLTKLLKENGKKHYLFVVGKPNVAKLA
                     NFEPIDIWCILGCGQGGIVLDQYNEFYKPIITPYELLMALSDEVTWTGQWITDFKSII
                     NQIENEVNDSDDMEQDILSSGTECRSDEDEAPEFNAVTGKYVSTSRPLRQIARLEIET
                     PVEEVRASDSTELVKQFSQTVAIRNTVSTSAAFLQTRHWTGLGSDYKDDEDGEEDGAT
                     VEEGTAGVARSYQFDELNKKT"
     gene            <252052..>253704
                     /locus_tag="KLLA0_D02970g"
                     /db_xref="GeneID:2893337"
     mRNA            <252052..>253704
                     /locus_tag="KLLA0_D02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453200.1"
                     /db_xref="GeneID:2893337"
     CDS             252052..253704
                     /locus_tag="KLLA0_D02970g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease ureidosuccinate permease
                     expression is constitutive but sensitive to nitrogen
                     catabolite repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453200.1"
                     /db_xref="GeneID:2893337"
                     /db_xref="GOA:Q6CS89"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CS89"
                     /translation="MTNTEKQTGLLNDSSDHSSVHSRDEKIQAVVSITANEIADRDAL
                     ITTILSPDGKEVKITGDVDDAMKLALKSQNVVLTPEKDAKLLRKIDLMLFPIMCIIYS
                     VQFMDKITTSNAAIMGLQTDLKMHGEQYSYVGSAFYFGYLGGLFILPFLMQKTKKFMK
                     MLTSIIVIWGMVLALHAAPSVNYPSFIFLRCLLGFLESAITPAFTIITSQYWKKEEQF
                     SRITCWFGFNGLGSIWGGAIAYGLYIHKDSYPLAAWKLVFIITGCITIVVGFIMMIHL
                     PDSPDKAWFFSEEEKLLLVERIRENQQGFGNHHIKKYQIVEAFKDVRTWLYFLFSVSS
                     NIPNGGITNFSSILLKEDFQFSTDKSLLVNMGSGAVELVGCPLFGMLSFWCLKRKYKV
                     VGSRLAWAFFATAICFMGVCMLAFAKHDKSARLAGLMLFGISPVSFICVLSCISSNTL
                     GFTKKWTVSSINLLAYASANIAGPHTFIATQAPSYTGAKISLVVNYAAAMVIIVLIYI
                     VNARENKRRDKIEAERTHEQVVENIEFADLTDFENLKFRYAI"
     gene            complement(<253918..>254445)
                     /locus_tag="KLLA0_D02992g"
                     /db_xref="GeneID:2892802"
     mRNA            complement(<253918..>254445)
                     /locus_tag="KLLA0_D02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453201.1"
                     /db_xref="GeneID:2892802"
     CDS             complement(253918..254445)
                     /locus_tag="KLLA0_D02992g"
                     /note="highly similar to uniprot|P25296 Saccharomyces
                     cerevisiae YKL190W CNB1 Type 2B protein phosphatase
                     regulatory B subunit of calcineurin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453201.1"
                     /db_xref="GeneID:2892802"
                     /db_xref="GOA:Q874T7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /translation="MGAAPSRIVDNLLDDTNFDRAEIERLKKRFMKLDKDSSGSIDKT
                     EFMSIPGVSANPLAKRIIEVFDEDNSGDVDFQEFITSLSIFSGRGETDAKLRFAFRIY
                     DIDKDGYISNGELFIVLKIMVGTNLEDEQLQQIVDRTIMENDVDGDGKLSFEEFKKAA
                     ETTEVIQSLTLQHNI"
     gene            complement(<254897..>255658)
                     /locus_tag="KLLA0_D03014g"
                     /db_xref="GeneID:2893344"
     mRNA            complement(<254897..>255658)
                     /locus_tag="KLLA0_D03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453202.1"
                     /db_xref="GeneID:2893344"
     CDS             complement(254897..255658)
                     /locus_tag="KLLA0_D03014g"
                     /note="some similarities with uniprot|P32338 Saccharomyces
                     cerevisiae YGR044C RME1 mediates cell type control of
                     sporulation negatively regulates IME1 and sporulation zinc
                     finger protein negative regulator of meiosis directly
                     repressed by a1-a2 regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453202.1"
                     /db_xref="GeneID:2893344"
                     /db_xref="UniProtKB/TrEMBL:Q6CS87"
                     /translation="MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPS
                     STDIMKRKEGQRAGSTKKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTF
                     QSRYSSYEVQFNKRYTSTASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQ
                     FSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGC
                     DKHCNRVDILNRHIKNVRRNERLRLTNKYNIGKNK"
     gene            complement(<255868..>256974)
                     /locus_tag="KLLA0_D03036g"
                     /db_xref="GeneID:2893343"
     mRNA            complement(<255868..>256974)
                     /locus_tag="KLLA0_D03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453203.1"
                     /db_xref="GeneID:2893343"
     CDS             complement(255868..256974)
                     /locus_tag="KLLA0_D03036g"
                     /note="similar to uniprot|Q06697 Saccharomyces cerevisiae
                     YLR418C CDC73 Substituent of the Paf1 complex together
                     with RNA polymerase II Paf1p Hpr1p Ctr9 Leo1 Rtf1 and
                     Ccr4p distinct from Srb-containing Pol II complexes
                     required for the expression of certain genes and
                     modification of some histones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453203.1"
                     /db_xref="GeneID:2893343"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="UniProtKB/TrEMBL:Q6CS86"
                     /translation="MKLGELREYLGKDKSNHDLKLISGDGELIDDIVLAKSVVVNGEN
                     KDLDELTEFSLEGKPVPLRVVIHCWLHRNSSAADYLADCRAKNFTNVSFLHRNDLIQW
                     LSGESETSQYVSTSEEKSELPDKSALQSKESNAGKAASAQVKGEVFPYERAILDHNSS
                     LRGSKPTNFQYLIKEAELKLVHSFKSATKSKSGTSGISKPDHSKAKPSSQKDPIILIP
                     SAASSIFTIANIRQFLEESKYVNPKDLPISHKDLVTAVKKFDRISRPIRFLIVNNTKL
                     FTQPEYWDRVVAIFTTGHEWQFTNYQWSNPAELFQHCKGFYFHFSGDLVPRNAEQWNV
                     QKLELDKNKRFKDIEVSRFFWTIIERELLARGYH"
     gene            <257433..>261638
                     /locus_tag="KLLA0_D03058g"
                     /db_xref="GeneID:2892727"
     mRNA            <257433..>261638
                     /locus_tag="KLLA0_D03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453204.1"
                     /db_xref="GeneID:2892727"
     CDS             257433..261638
                     /locus_tag="KLLA0_D03058g"
                     /note="similar to uniprot|Q06698 Saccharomyces cerevisiae
                     YLR419W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453204.1"
                     /db_xref="GeneID:2892727"
                     /db_xref="GOA:Q6CS85"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CS85"
                     /translation="MAKKKKNVPVQELPTNDNNKGKKGSGGKNKREPLSEEEKAKRLQ
                     SRANVTSSVSWTGKLPHSVLHEYCQKQKWNKVEYDMKKIGDKGLVSTALISCTDPKTK
                     ETLVLRMSLEKKEIVPPQSTPAEARHYAATVALHRIAFNSKLYLMLPPNHKNLWYDLE
                     DFRKALLKENPGKCARLFDEDPFETMVRLRKEKEQQEKKKASQQEQDGKNKKTPVFIT
                     SINSKTKSSEGNKKIQQNVTYSKIKNVERPAVTFPKKVWDSAPFFDFDESSRRLIENS
                     LRKHIDWDSKLYTGGMTDERELLKSKLLNLGFRSVHVEEAMTFKDPLSFLICNLPEDD
                     LPHFFQRRKEESLNKIEIANLPLNKRNMIDSLCELGNSKEETQLALEECDYNEAEACL
                     KLLLDIYPINVPQITINEDEVNETWNQELEALKSIYESNFEQLNASSYKINLNDEFKI
                     KLKVYKTKSYPQTLPGIVVSTFDKSYKLPNYIKLTILEKLLHFLEESQLIGDMCVYHI
                     VDWLQQNLSEIIENPGPLLTKERIEITSNNLIKSTNKKRRFNARTSKLSNQEVSELED
                     EYRKRQKSNEFHTMREQRSKLPAWKIQNSIVELINSNDVVLITGETGSGKSTQVVQFV
                     LDNLMQHGDLNKTSIICTQPRRISAIGLAERVSQERCVKCGDEVGYIIRGVNLTKSAT
                     RIKFMTTGVLVRILQGDVTFLNDCVVVIDEVHERSIDTDLIIILLKNLLKKVKGMKLI
                     LMSATVNVDVFKAFFKNLKSIHIEGRTFPIQDYFLDDVLKETNFKIRREQMNYSAETN
                     EEDMYLTPTANSKFFTSGQINYDLIAETVFHVHNKLLRESNDGSLIVFLPGVGEVNRC
                     CKTLSKADSDSLFEILPLHSALTPDDQKRVFKKFKSRRKIIISTNIAETSITVDDCVA
                     TIDTGRVKTLNYDPSSNTSKLVESFVSKAEAKQRRGRAGRVRSGYSYKLYSKKVYESM
                     AELPVPEIKRVTLESLYLSVRSMGIKNVTKFLQQGLDPPPLSSLEKAEQILTTTGLID
                     ETDNTLTQLGKFVSLLPVMDSKHGKLLIFSILFGCTDIGVLIASLLSVGTSIFINEYE
                     NRVAIREILVENENLGDVLAVVLLLNKYINLEGASKRKFLKDHLLSYNKVTEIMSSRT
                     QFYSNLKDIGFLPFDYKPGNTSSEFLNRNAGNFEILKCVISGSFYPSIARVQLPEIKF
                     VATGVGAVEKDQDAKLTKYWIRNEEFIDQLYQKQGGQETNLLPASRAFVHPSSLLFSA
                     SNSVPAEAQSIESIDDISSKKKSKSKNSLKAPFVVYNGKRDTGKLYLTGITPTSAIAV
                     LLFGGSLSYNLNSSLNSPNVVVDNWSPIRIWCKNGVLIKELRSLVDEVIKEKLENPHY
                     VKADYSTKGDDVLKIVEQIVKSK"
     gene            complement(261828..261911)
                     /locus_tag="KLLA0_D03080r"
                     /db_xref="GeneID:2893144"
     tRNA            complement(261828..261911)
                     /locus_tag="KLLA0_D03080r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2893144"
     gene            263097..263180
                     /locus_tag="KLLA0_D03102r"
                     /db_xref="GeneID:2893270"
     tRNA            263097..263180
                     /locus_tag="KLLA0_D03102r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2893270"
     gene            complement(263506..263589)
                     /locus_tag="KLLA0_D03124r"
                     /db_xref="GeneID:2893226"
     tRNA            complement(263506..263589)
                     /locus_tag="KLLA0_D03124r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2893226"
     gene            complement(<263816..>264970)
                     /locus_tag="KLLA0_D03146g"
                     /db_xref="GeneID:2893197"
     mRNA            complement(<263816..>264970)
                     /locus_tag="KLLA0_D03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453205.1"
                     /db_xref="GeneID:2893197"
     CDS             complement(263816..264970)
                     /locus_tag="KLLA0_D03146g"
                     /note="similar to uniprot|P53164 Saccharomyces cerevisiae
                     YGL067W NPY1 NADH diphosphatase (pyrophosphatase)
                     hydrolyzes the pyrophosphate linkage in NADH and related
                     nucleotides localizes to peroxisomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453205.1"
                     /db_xref="GeneID:2893197"
                     /db_xref="GOA:Q6CS84"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6CS84"
                     /translation="MERSVTFFGLETINRVSFLRDDEVFIKQAFEHGSTQFVPFINGA
                     AFATETSDKSGTNLLMLGHQGCPNYSEWPGLLNKIRSVMDTERGWLVESGFTITFLGL
                     MDGDSSFSYKEYTGTPLFAMDLRPASDTLVQKSETKFILDQYEPLGRMQAFNLSNEVA
                     SLFSHANMYLDWLRKFLFCPGCASKVFPVHGGTKLQCGNNDESVKCSVRDAAVSNVCF
                     PRTDPVVIVAIVDRCFSKICLARSRRKHGNAVMYSTIAGFMEPAETVEHACQREIWEE
                     TGIKVELNDVDILFTQPWPYPCNLMIGCLGLIDFNGDNEIINLEHDKELLDAQWFEME
                     LVSQAFERYGKAPKGLVNFDDRITFPGDTAIAHQLIEHAVIKYKRFNGHL"
     gene            <265761..>267278
                     /locus_tag="KLLA0_D03168g"
                     /db_xref="GeneID:2892961"
     mRNA            <265761..>267278
                     /locus_tag="KLLA0_D03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453206.1"
                     /db_xref="GeneID:2892961"
     CDS             265761..267278
                     /locus_tag="KLLA0_D03168g"
                     /note="similar to uniprot|P29295 Saccharomyces cerevisiae
                     YPL204W HRR25 Protein kinase involved in regulating
                     diverse events including vesicular trafficking gene
                     expression DNA repair and chromosome segregation binds the
                     CTD of RNA pol II homolog of mammalian casein kinase
                     1delta (CK1delta)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453206.1"
                     /db_xref="GeneID:2892961"
                     /db_xref="GOA:Q6CS83"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CS83"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRT
                     KHPQLDYESRVYKYLSGGIGIPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSF
                     KTVIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFR
                     SHNHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRA
                     TTKRQKYDRIMEKKLCITVEQLCQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDL
                     FIKLEYHNDHLFDWTMLRYTKAMIDKQGGAQALEQKDENGNKQDSFDKVKQLAMKKFS
                     THFHYWKPDDTSHPTAEDIKQQTILNTQVISTIPDEVMNAIDRNMEQLKHEVNQQVAS
                     QPQQGQPQGQTQGQGQTQGQGQPQSGQQLDTQLPQPTTLLQQQRAQVQGQQEQMLQQQ
                     QQQQQQQQQQQQQQQLLQQQLQTQQQTHPNAMAITNPLPNPNNTTKTTTTNNIWL"
     gene            <267933..>269051
                     /locus_tag="KLLA0_D03190g"
                     /db_xref="GeneID:2893190"
     mRNA            <267933..>269051
                     /locus_tag="KLLA0_D03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453207.1"
                     /db_xref="GeneID:2893190"
     CDS             267933..269051
                     /locus_tag="KLLA0_D03190g"
                     /note="highly similar to uniprot|P06245 Saccharomyces
                     cerevisiae YPL203W TPK2 Involved in nutrient control of
                     cell growth and division cAMP-dependent protein kinase
                     catalytic subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453207.1"
                     /db_xref="GeneID:2893190"
                     /db_xref="GOA:Q6CS82"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CS82"
                     /translation="MEYQPVNLQQMNTAPAPATNPVNPADVTVGSQSTDYLLAQQKES
                     LLPQRSTVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMK
                     QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNP
                     VAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAKEVITVTWTLC
                     GTPDYIAPEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVY
                     PPFFHPDVVDLLGKLITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYE
                     PPIAVGVGDSSLFDQYPEEQLDYGVQGEDPYGQYFLDF"
     gene            complement(<269287..>269799)
                     /locus_tag="KLLA0_D03212g"
                     /db_xref="GeneID:2892822"
     mRNA            complement(<269287..>269799)
                     /locus_tag="KLLA0_D03212g"
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /transcript_id="XM_453209.1"
                     /db_xref="GeneID:2892822"
     CDS             complement(269287..269799)
                     /locus_tag="KLLA0_D03212g"
                     /note="similar to uniprot|P53163 Saccharomyces cerevisiae
                     YGL068W MNP1 Protein associated with the mitochondrial
                     nucleoid"
                     /codon_start=1
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /protein_id="XP_453209.1"
                     /db_xref="GeneID:2892822"
                     /db_xref="GOA:Q6CS80"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:Q6CS80"
                     /translation="MLRQVVRSSGVFARNSCRLGLVRYQSTAGTSTPAAAVDPKISQI
                     VQDISKLTLLETSALIQELKTQLNIPDISFPAAGAGSAAPAAPAEEAKEEEVVEEKTI
                     FSIKLESFDAKSKPKIIKEVKNLLGLSLVEAKKFVESAPKVLKENVAKEDADKVKAAL
                     EGLGAKIVLE"
     gene            <270311..>270679
                     /locus_tag="KLLA0_D03234g"
                     /db_xref="GeneID:2893336"
     mRNA            <270311..>270679
                     /locus_tag="KLLA0_D03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453210.1"
                     /db_xref="GeneID:2893336"
     CDS             270311..270679
                     /locus_tag="KLLA0_D03234g"
                     /note="highly similar to uniprot|P27999 Saccharomyces
                     cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
                     contacts DNA mutations affect transcription start site"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453210.1"
                     /db_xref="GeneID:2893336"
                     /db_xref="GOA:Q6CS79"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:Q6CS79"
                     /translation="MTTFRFCRDCNNMLYPREDKETHKLLFECRTCPYVEEAGTPLVY
                     RHELKTNIGETAGVVQDIGSDPTLPRSDKECPKCHSRENVFFQSQQRRKDTSMVLFYV
                     CLHCSHIFTSDKKNKRQTFS"
     gene            complement(<271036..>273507)
                     /locus_tag="KLLA0_D03256g"
                     /db_xref="GeneID:2892710"
     mRNA            complement(<271036..>273507)
                     /locus_tag="KLLA0_D03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453211.1"
                     /db_xref="GeneID:2892710"
     CDS             complement(271036..273507)
                     /locus_tag="KLLA0_D03256g"
                     /note="similar to uniprot|P22149 Saccharomyces cerevisiae
                     YGL071W RCS1 Transcription factor involved in iron
                     utilization and homeostasis binds the consensus site
                     PyPuCACCCPu and activates the expression of target genes
                     in response to changes in iron availability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453211.1"
                     /db_xref="GeneID:2892710"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:Q6CS78"
                     /translation="MKHELQTPIEGVDPLDPLHNPDLWQPSPSFDNMMASPKTSPIGS
                     GLSHTPAAHHVGSNLSSSNNSEVSYNNALSENAIEALRRQQDQNKLIHLDPIPDFKDK
                     SEVKPWLQKIFYPQGIEIVIERSDSMKIVFKCKAVKKNRNTSSISGCGHSHGVGSDSC
                     NTNGKNSTKGNGSNDNKCRKKGIGKGFAECDGLETETENGNNSNSTVGGGNGSNDTDK
                     KKRAIGPYNSCPFRVRATFSLKRKKWNIVVVNNVHTHPLKFNPDSEDYKKFKNALKES
                     GDLETVKKFDELEYRTRFNLPIDLSPIPCDCGLTQEIQSFNIVLPTTNIIVPGSRNTS
                     MDANTVTKPKKTGKKAVKSKTTKQLRRKSTKKKLQQDIESNSANTSRTATPLSTVQNS
                     LNLQFDSQSNVSVAPSVTSNLNSNLALTPQENIYSTDFLPNTASSQQMDSPNFSNFNS
                     NYFNVQNEIDFTEFFSKPLPHFKNNRHDVVTGQGMIPLTFSQKHQTSSQSAQHTPHQN
                     INSNLMYHNAGSASSTHSSPNMSIMTSVKTPITTATPSTNSHNMNAISSVPLYSSNLA
                     KEPIQDFIDMNQIFGTSTNNNDHSNANTSSVNTNNNHLHQQHNTSHANAMIPSHSLNF
                     QHSNLSPVNQNISAVCEINNFDVCANDPQCGGPLIGTATGIHGLNIDRSNMEIANGIS
                     QSNDATGYMDPLHTKPDYDAQSQEYISNVLNSDFNELRLSQSQHNQGEQHHQQHMQQQ
                     RRHQHQMQNQQQQQMQQQQQQQQLHDQHNPLHEILPLKEEEIEELVANSEYNYHLQFN
                     NDLDQPQQATHNPQMLWDEPHGFFQ"
     gene            complement(<274580..>275734)
                     /locus_tag="KLLA0_D03278g"
                     /db_xref="GeneID:2892991"
     mRNA            complement(<274580..>275734)
                     /locus_tag="KLLA0_D03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453212.1"
                     /db_xref="GeneID:2892991"
     CDS             complement(274580..275734)
                     /locus_tag="KLLA0_D03278g"
                     /note="weakly similar to uniprot|Q08956 Saccharomyces
                     cerevisiae YPL201C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453212.1"
                     /db_xref="GeneID:2892991"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="UniProtKB/TrEMBL:Q6CS77"
                     /translation="MGIPINLESLEVTRVYQAYDFDGRSGLGRRRSSYTAGNSLVSSR
                     GTMNGVLTVRKIETHQLRVGIEMNSASVEGFLVLWDKQGSQIVVISPFGDVSVYNVDG
                     GISPRNELVRVARISWNEFLFMGHSDAVYFGNAHDGGVRHDYWDVGAISTMWHIPKDD
                     TFCCVLPDGIAHVTENPRRTLRRRTSLDDENLESRQMTHYIQDYSIIEPCPAKDALAI
                     AKRTGEIAILVDGSLRFVTGMGLTDEEGNNNGNSNREQWNPNDRVMKMSWSHDGRFLC
                     IVTTQRIFVYDEEEDALTVVAGENPNQLISWGSSCRTLFLLSTHLYGTMLKAFEHNNE
                     EQQWICCGFEDIRSQFHINKVHAFNVSSTRDTLTIYHDQNIIDTFEYKIT"
     gene            complement(<276591..>278624)
                     /locus_tag="KLLA0_D03322g"
                     /db_xref="GeneID:2893291"
     mRNA            complement(<276591..>278624)
                     /locus_tag="KLLA0_D03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453214.1"
                     /db_xref="GeneID:2893291"
     CDS             complement(276591..278624)
                     /locus_tag="KLLA0_D03322g"
                     /note="similar to uniprot|P10961 Saccharomyces cerevisiae
                     YGL073W HSF1 Trimeric heat shock transcription factor
                     activates multiple genes in response to hyperthermia
                     recognizes variable heat shock elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453214.1"
                     /db_xref="GeneID:2893291"
                     /db_xref="GOA:P22121"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="PDB:1FBQ"
                     /db_xref="PDB:1FBS"
                     /db_xref="PDB:1FBU"
                     /db_xref="PDB:1FYK"
                     /db_xref="PDB:1FYL"
                     /db_xref="PDB:1FYM"
                     /db_xref="PDB:2HTS"
                     /db_xref="PDB:3HSF"
                     /db_xref="PDB:3HTS"
                     /translation="MGHNDSVETMDEISNPNNILLPHDGTGLDATGISGSQEPYGMVD
                     VLNPDSLKDDSNVDEPLIEDIVNPSLDPEGVVSAEPSNEVGTPLLQQPISLDHVITRP
                     ASAGGVYSIGNSSTSSAAKLSDGDLTNATDPLLNNAHGHGQPSSESQSHSNGYHKQGQ
                     SQQPLLSLNKRKLLAKAHVDKHHSKKKLSTTRARPAFVNKLWSMVNDKSNEKFIHWST
                     SGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRW
                     EFENENFKRGKEYLLENIVRQKSNTNILGGTTNAEVDIHILLNELETVKYNQLAIAED
                     LKRITKDNEMLWKENMMARERHQSQQQVLEKLLRFLSSVFGPNSAKTIGNGFQPDLIH
                     ELSDMQVNHMSNNNHNNTGNINPNAYHNETDDPMANVFGPLTPTDQGKVPLQDYKLRP
                     RLLLKNRSMSSSSSSNLNQRQSPQNRIVGQSPPPQQQQQQQQQQGQPQGQQFSYPIQG
                     GNQMMNQLGSPIGTQVGSPVGSQYGNQYGNQYSNQFGNQLQQQTSRPALHHGSNGEIR
                     ELTPSIVSSDSPDPAFFQDLQNNIDKQEESIQEIQDWITKLNPGPGEDGNTPIFPELN
                     MPSYFANTGGSGQSEQPSDYGDSQIEELRNSRLHEPDRSFEEKNNGQKRRRAA"
     gene            <279426..>279578
                     /locus_tag="KLLA0_D03333g"
                     /db_xref="GeneID:9487273"
     mRNA            <279426..>279578
                     /locus_tag="KLLA0_D03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999323.1"
                     /db_xref="GeneID:9487273"
     CDS             279426..279578
                     /locus_tag="KLLA0_D03333g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999369.1"
                     /db_xref="GeneID:9487273"
                     /db_xref="UniProtKB/TrEMBL:B5FV72"
                     /translation="MADWAVNLITLIDKEGLSLKKWKVEKAIRSRIYICGLQVIVQLT
                     KDLIGP"
     gene            <279652..>281364
                     /locus_tag="KLLA0_D03344g"
                     /db_xref="GeneID:2893340"
     mRNA            <279652..>281364
                     /locus_tag="KLLA0_D03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453215.1"
                     /db_xref="GeneID:2893340"
     CDS             279652..281364
                     /locus_tag="KLLA0_D03344g"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
                     pyruvate transcription is heme-dependent repressed by
                     glucose and derepressed in ethanol or lactate located in
                     the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453215.1"
                     /db_xref="GeneID:2893340"
                     /db_xref="GOA:Q6CS74"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:Q6CS74"
                     /translation="MFRSCNRINFRFVSNSSQNVKKYKVSTGIGVALVSAGFLAGYVG
                     SSITIAQNVPQFLFPSGSKTSLQDLRSPEYLDPRFALDKFKSRLLLIVQEQDLSFKKG
                     DLDDHSFNNYTLHKPKDNERPYVIVYPRDTEHISQIMKLCYEFGVPVIPFAGGTSIEG
                     QFISTRNINSDKECICEHQDTVTVMLDFNKYMNKVIQVNADDLDCIVQPGVIAKELND
                     EYLDKLGLMFGPDGAPGCEIGGQIGTSCSGTNAYRYGTMKENVVNVTAVMADGTIIKT
                     RQRPKKSSNGYNLTGLFIGSEGTLGVVTEATVKLHVKPIHETISIVSFQDLNQATQLV
                     QLLTKKGILGINAIELLDANMMKAINFSGQTSRSWKEQPTLLFKLGSHNKAILNEVIN
                     DIKKLSQETNCTSCEFAKTPEQQEELWSARKSIFWSSIDYGRHLFGPDVKIWSTDIAV
                     PVSKLSTVIDDSLKEVTDAGLYGTVVGHVGDGNFHCLVMYNIQDEQKALEVIDNMTIR
                     AIANEGTCSGEHGIGTSKRKFLTMELGQDTISVMRRIKMALDPARILNPDKLFKIDPA
                     DKKD"
     gene            <281588..>282556
                     /locus_tag="KLLA0_D03366g"
                     /db_xref="GeneID:2893076"
     mRNA            <281588..>282556
                     /locus_tag="KLLA0_D03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453216.1"
                     /db_xref="GeneID:2893076"
     CDS             281588..282556
                     /locus_tag="KLLA0_D03366g"
                     /note="weakly similar to uniprot|P53159 Saccharomyces
                     cerevisiae YGL075C MPS2 Essential membrane protein
                     localized at the nuclear envelope and spindle pole body
                     (SPB) required for insertion of the newly duplicated SPB
                     into the nuclear envelope potentially phosphorylated by
                     Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453216.1"
                     /db_xref="GeneID:2893076"
                     /db_xref="GOA:Q6CS73"
                     /translation="MTKQISKSTQYKPSKSTLVSAKLFSMNRTESTRLLDRAWSVLES
                     GSDGYVYAKDIPEIISFIDRELPSKLTTQSNDKVIESWVNNDPMKTLSKEQFLEAFSM
                     LVGTSFDTAVQIAMQSDILTPTRRGASLFGSYRRSSNDLEQVLPAEQIKALKRELQEW
                     KDKYTFLEHEFQFFLSQEKKNPEVIDNTKHEFIISELNRKLREQDEAIEDLKSQLDYG
                     LVPELKDKTNWIKALQRKAYNYLLPKILICLLLLLLYYCLAAKILFTKSSSTDDVPSF
                     IRQQSWWERNKILSRIQWYFKDRIENNVVRNSSEVIQNYNSVFGIH"
     gene            complement(<282705..>283448)
                     /locus_tag="KLLA0_D03388g"
                     /db_xref="GeneID:2892767"
     mRNA            complement(<282705..>283448)
                     /locus_tag="KLLA0_D03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453217.1"
                     /db_xref="GeneID:2892767"
     CDS             complement(282705..283448)
                     /locus_tag="KLLA0_D03388g"
                     /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
                     YPL199C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453217.1"
                     /db_xref="GeneID:2892767"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:Q6CS72"
                     /translation="MSYVAERGALLSTEKDYNHATDKEYQRLRGLADQAYKERQKLSQ
                     QSQSSFKTGDKSKAHELSEAAKKKLKEAEDYNLQAAEYVFVANNADSSSNEIDLHGLY
                     VKEAKWILQRRVAAAVKNGESELQVIVGKGLHSSNGVAKLKPAIQELCDEANLNDHVD
                     SKNTGVVIIDLTGARIPVSWDTTDFSTYSQSQANKPSKPQQAYQGQQQPQYQPYAQQQ
                     QHQQQQSSGSSSLVDQLLRMLCQCVKNNM"
     gene            284035..284136
                     /gene="SNR39b"
                     /locus_tag="KLLA0_D03399r"
                     /db_xref="GeneID:9487373"
     ncRNA           284035..284136
                     /ncRNA_class="snoRNA"
                     /gene="SNR39b"
                     /locus_tag="KLLA0_D03399r"
                     /product="snR39b"
                     /note="C/D snoRNA monocistronic SNR39b"
                     /transcript_id="XR_002633574.1"
                     /db_xref="GeneID:9487373"
     gene            <284516..>286345
                     /locus_tag="KLLA0_D03410g"
                     /db_xref="GeneID:2892731"
     mRNA            join(<284516..284526,285104..285197,285725..>286345)
                     /locus_tag="KLLA0_D03410g"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_453218.2"
                     /db_xref="GeneID:2892731"
     CDS             join(284516..284526,285104..285197,285725..286345)
                     /locus_tag="KLLA0_D03410g"
                     /note="highly similar to uniprot|P05737 Saccharomyces
                     cerevisiae YGL076C RPL7A and to uniprot|Q12213
                     Saccharomyces cerevisiae YPL198W RPL7B Proteins component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_453218.2"
                     /db_xref="GeneID:2892731"
                     /db_xref="GOA:Q6CS71"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:Q6CS71"
                     /translation="MSASKVLVPESQVKKAKAQQKTAEQVAAERVARKAEKRAAILER
                     NAAYQKEYETAERAVIDAKREAKANSSYYVSAEAKLVFVVRIKGINKIPPKPRKVLQL
                     LRLNQINSGTFVKVTKATSELLKLIEPYVAYGYPSYSTVRQLVYKRGYGKINKQRIPL
                     SDNSIVEANLGNYGILSVDDLIHEIVTVGPHFKQANNFLWPFKLSNPSGGWGVPRKFK
                     HFIQGGSFGNREEFINKLVKSMN"
     gene            285387..285477
                     /gene="SNR39"
                     /locus_tag="KLLA0_D03421r"
                     /db_xref="GeneID:9487497"
     ncRNA           285387..285477
                     /ncRNA_class="snoRNA"
                     /gene="SNR39"
                     /locus_tag="KLLA0_D03421r"
                     /product="snR39"
                     /note="C/D snoRNA intronic SNR39/SNR59"
                     /transcript_id="XR_002633575.1"
                     /db_xref="GeneID:9487497"
     gene            <287805..>292256
                     /locus_tag="KLLA0_D03432g"
                     /db_xref="GeneID:2892730"
     mRNA            <287805..>292256
                     /locus_tag="KLLA0_D03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453219.1"
                     /db_xref="GeneID:2892730"
     CDS             287805..292256
                     /locus_tag="KLLA0_D03432g"
                     /note="similar to uniprot|P32568 Saccharomyces cerevisiae
                     YDR011W SNQ2 ABC transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453219.1"
                     /db_xref="GeneID:2892730"
                     /db_xref="GOA:Q6CS70"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6CS70"
                     /translation="MEGSNNGLSSRPEKLDGDPRSTSDTSSSGSCTSLKEFSGNNHEL
                     HQDTDQQVVKDAAEDPAFLKKVETLSRSLSRRTTTLSEWDEVDENFDMYREIQGILKA
                     SNDGGIHLRKAGITARNVAVKGVDAQFLEGATYGDMLMLPATIFKGIKKARQTTLRDI
                     ISNVNLLVRPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKY
                     FKSDVIYNGEMDVHFPHLTVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFG
                     LKHTYNTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEA
                     IRCMTNLLKSTALITVYQASENIYETFDKVTILYEGKQIYFGRIEEAKKYFENLGFIC
                     PARQATAEFLTSLTDSKGLRRVRPGFENKVPRTRDDFVRVWEESKEYHDLIQSIEHYE
                     TKEVDGAKTIQFFKESMVEEKDKASRKKSKFTISYWAQIRLCTRRGFQRIYGDKSFTI
                     TNTVAAIIQALVTGSLFYNTPSSTQGAFSRGGVLYFAILYFSLMGLANISLANRPILQ
                     KHIAYSLYHPSAEALASTISNAFFRMISLTAFLIILYFLSGLTRNAGRFFMVYLFVAL
                     ASESINALFEFITAACDSISQANAIAGLVMMALSLYSTYMIQTPSMHPWFEWISYILP
                     LRYAFENMLNAEFHARRMDCGGTLVPTGPVYENVSSEYKVCAFIGSQPGESYVLGDNY
                     LKLQYDYSYSHQWRNFGILIAFLVGFLVFKSVITEFKTPIKSSGDALLFKKGTSLNTI
                     PKDEESNVNSTDSITKTTDSSSRSDDPALFADMRSEGIFLWKDICYTIPYKGGERLLL
                     DNVSGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGDMLVNGKPIDASFERRT
                     GYVQQQDVHIKEMTVRESLQFSARMRRPLTVPDEEKLDYVEKVIEILDMSAYGEALVG
                     NIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQLLKKLAGAGQS
                     ILCTIHQPSATLFEEFDRLLLLRKGGQTVYFGDIGEHSSTLLSYFERNGARRCEEKEN
                     PAEYILEAIGAGATASVKEDWHEKWIKSSEFVSVNQEINDLIEKLAHQPNDDSSTELI
                     TKYATPYWYQFVYVLRRTMVMFWRDVDYLMAKTMLYISSGLFIGFTFYNVGTSFVGLQ
                     NAMFAAFMACIVSAPAMNQIQARALQSRELYEVRESRSNMFHWSCMLFSQYITELPYQ
                     LWCSTLFFVSFYFPLKAEYTSLKAGLFYLNYCVIFQLYCVGLGLAVLYMSPDLPSSNV
                     IMGLLLSFMITFCGVVQPVNLMPGFWTFMWKVSPYTYLIQNFVSLMLHDKTVICTDKE
                     LSYFNPPPGSTCGSYMTDYFTEGFGYIKNPEATSNCAYCRYKIGDQYLSYISAKYADL
                     WRNFGFLWVYICFNLIAMVSLYYIFHVKRFSPKSLVMGVVGKFKKEK"
     gene            <293313..>295226
                     /locus_tag="KLLA0_D03454g"
                     /db_xref="GeneID:2892897"
     mRNA            <293313..>295226
                     /locus_tag="KLLA0_D03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453220.1"
                     /db_xref="GeneID:2892897"
     CDS             293313..295226
                     /locus_tag="KLLA0_D03454g"
                     /note="similar to uniprot|P05316 YBR021W Saccharomyces
                     cerevisiae FUR4 Uracil permease localized to the plasma
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453220.1"
                     /db_xref="GeneID:2892897"
                     /db_xref="GOA:Q6CS69"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:Q6CS69"
                     /translation="MVGNFRFNVRNDSTNKEPSKTEVKSAMSVELAEYFSNTSSTVSR
                     SHKKQGKSRSIDMEKDKIVQIDETLTENDSDENTEVIEYSSIWSKIYYDYILVDKTLS
                     KLSIKESFLYNHDLKPVEEQRRRWAWYNFLWFWVADCFNINTFQIAATGLQLGLNWWQ
                     TWITVWIGYALIGILVALASRIGSMYHVSFPVAARSSFGIYFSIWSVLNRVVMATVWY
                     AVQSWIALTPVSLMLQSIFGTNLPTRIHDGMGTPNATTYEFMCFFIFWVVSFPALLVP
                     PHAIRHLFTVKAILVPFAAFGFLIWTLKKSNGEIAFGALSDVEVSDTERRWAYIRSIM
                     ACLGNFATLVVNAPDFTRFSTTKRSAFIVQVVSIPILFTITSLIGILVTAAGFTMYNV
                     NYWSPVDVLGRFLQDSYSPGTRAGVFLISFVFALSQLGTNISANSLSAGTDMTALLPK
                     FINIRRGSVICACLALCICPWNMMASSSKFTMALSAYAIFLSSIAGVASADYYVVRRG
                     YIRITHLYSIKPGSFYMYNRFGFNWRALVAYLGSVSFSITGFVGEVGDNIKVSDAAMH
                     LYYMNYIIGYAAAFIIYVTLCWFFPVAGSPVKNILREKGWYERWVEVEDFPEQWKAMM
                     QKKDLYDEKEIEY"
     gene            <296287..>300969
                     /locus_tag="KLLA0_D03476g"
                     /db_xref="GeneID:2893356"
     mRNA            <296287..>300969
                     /locus_tag="KLLA0_D03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453221.1"
                     /db_xref="GeneID:2893356"
     CDS             296287..300969
                     /locus_tag="KLLA0_D03476g"
                     /note="similar to uniprot|P33302 Saccharomyces cerevisiae
                     YOR153W PDR5 Short-lived membrane ABC (ATP-binding
                     cassette) transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453221.1"
                     /db_xref="GeneID:2893356"
                     /db_xref="GOA:Q6CS68"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6CS68"
                     /translation="MSDDSGSSIDDRDGRNSTSPAAELNQYTGLNAAGAHRPYLGFEN
                     DPQEQQRIQTLARTLTNSSIASKQNSSVGAQGINNGNHGQDTADADSSTNESLQRTLT
                     RASLHINPDDVKIPFDEDARSADPRLDPYSANFDSKFWVQTMHQMFNSDPDYYKPVSL
                     GVCLKGLRVSGVSVDADYQATVANAPLKVLNAARHFVSKRDESRYFDILRPMDALFEP
                     GRLCTVLGRPGAGCSTLLKTVSARTYGFTVRPESVISYDGISQHDIEKHYRGDVIYSA
                     EMDYHFANLNVGYTLEFAARCRCPSARPQGVSREEYYKHYAAVVMATYGLSHTYSTKV
                     GDDYVRGVSGGERKRVSIAEVTLAGAKVQCWDNATRGLDSATALEFVRALKTNATISR
                     TTPLLAIYQCSQDAYDLFDDVLVLYEGRQIYFGPADSAKQYFLDMGWECPDRQTTADF
                     LTSVTAANERKCRPGYEKKVPKTPDEFYEHWKSSSEYAQLMNRIDAYLNKHNNEDSAK
                     EFFDHHTARQSKHSKSSSPFLLSFMMQVKAVMDRNVQRLKGDPSVYAFNIFGNCSMAF
                     IISSMFYNQKDNTGSFYYRTAALFTALLFNSFGSLLEILSLFEARKIVEKHKTYAFYR
                     PSADALASIITELPSKFIIAICFNLIYYFLVNFRRSPGHFFFYFLIAITSTFTMSHLF
                     RSIGAACTTLEQAMLPASILLLILSIYAGFVIPKGNILGWSKWLYYLNPIARSMEAMV
                     ANEFAGRTFECSQFIPAGGEYDELPLALKICSVVGSEPGSAYVSGTAYMEESFSYKDS
                     YRWRNWGIVLCYAVFFLAVYLLLIEYNKGEMQKGEMTVFPRSVLMKLKKKNQNLKNDI
                     ESNDSLLKDMTNGNDSQDEKSDSSNEKMAEKIGSDQVVFWKNICYDVQIKTETRRILD
                     NVDGWVKPGTLTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDASFQRSTG
                     YCQQQDLHGRTQTVREALTFSAYLRQPYNVSKKEKDEYVETIIRLLEMETYADALVGV
                     TGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQAI
                     LCTIHQPSAILMQEFDRLLLLQKGGQTVYFGELGHGCCKMIEYFESKGSQKFPADCNP
                     AEFMLHVIGAAPGSHVTTDYHKVWLESQEYQAVQKEIDRMSREMVNIPQEDSEDLKKE
                     FATPLWYQFLIMTRRVLEQHWRSPIYIYAKIFTTSFSALFIGFSFFNANNSMQGLQNQ
                     MFSLFMLLVMFSPLVHQMLPQYTDQRDLYEVRERPSKTCSWITFVLSQIAAELPWSFL
                     IGTITYFCFYYPVGLYRNAPNTEQVHERGALFWLICIAFINFTMTFGQACIAGVERRE
                     NAALLANNCFMICLAFCGVLVTRDKLPGFWKFMYYLSPFTYLISTMLATAVGNSDVRC
                     SAKEYLHFSPAPNMTCQQYMSPYMSVAGGYLLDGNATDSCGFCVMAETNVYLATVNIK
                     YSQIWRNWGIFLCYIGANVFLFVLLYWAFRVPRDHYLLIKIHAIKSKITNSLKSRKLI
                     RSSKNNEA"
     gene            complement(<301249..>304776)
                     /locus_tag="KLLA0_D03498g"
                     /db_xref="GeneID:2893230"
     mRNA            complement(<301249..>304776)
                     /locus_tag="KLLA0_D03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453222.1"
                     /db_xref="GeneID:2893230"
     CDS             complement(301249..304776)
                     /locus_tag="KLLA0_D03498g"
                     /note="similar to uniprot|P29465 Saccharomyces cerevisiae
                     YBR023C CHS3 Chitin synthase III catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for
                     synthesis of the majority of cell wall chitin the chitin
                     ring during bud emergence and spore wall chitosan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453222.1"
                     /db_xref="GeneID:2893230"
                     /db_xref="GOA:Q6CS67"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CS67"
                     /translation="MSDDYYAFDNESLLKSRSQRQISRQGSLVRPERNSFKDPDHPYH
                     YYALKAKETHLQINPSTTGALPEESSLDIPMQDLNVQSNDKLPSSSLNTVGEYGEPNE
                     RLVMEGSDGFEKKNSIYSEKNVSPPIEIGQRLESKAKDQNKPKVGFSLWQSYCFLITI
                     FIPPSVLKLFGMKTKAVQRAWRDKIGLISIIFYIGAFVAYLTFGFTRTVCVPGKVRMR
                     NNEATTGQLIIHGQAYSLESSSHPAAAGIPGGSNILYPPVNAGGMDASFLFQNVNGNC
                     KGLIEPRENSTIPFDDDGNMAWYFPCKLVNQDGSSKPNFTESEYYAGWGCHTSSTARE
                     QYYALNAPAEVYFSWEDIKNSTRKLIVYNGDVIDLGILDWLETDDLTYPETFDVLKSA
                     NLEGYDISLVLSTSRERNVARCLVELAKVGVIDSESIGCIASQVVLYLSLVFILSVVG
                     CKFFIACYFHYFVAKKQGAYTVDNKQLAKHNNDLEDWSEDINSRGPLKPVDPSLRPMK
                     KNHKKNSSSISLFNRKSRFSQQSLGKSVHLNDPVIQSLESTGMSTMTTQSVLKSAYMN
                     EMKRKSAHAGFASQSRPVSTINPFSDNLDPFGTSMTMESLDPTIIHPDAVLQPPPDFM
                     PYGFPLVHSLCCVTCYSEDEVGLRTTLDSIATTDYPNSHKLIVVICDGIIKGSGNDRT
                     TPDIVLDMMEDFVIPKEQVTAYPYVAIAVGAKRHNMAKIYAGFYKYDESTIPAENQQR
                     VPIITIVKCGTAEEQGSAKPGNRGKRDSQIILMSFLQKVTFDERMSALEFQLMKNIWQ
                     ITGLMANFYETVLMVDADTKVFPDSLTHMLSEMVHDPLIMGLCGETKIANKGESWVSA
                     IQVFEYFISHHQSKAFESVFGSVTCLPGCFSVYRIKTPKGKDGFWVPILANPDIVERY
                     SDNVTDTLHKKNLLLLGEDRYLSSLLLKTFPKRKTVFVPKAACKTVVPATFKVLLSQR
                     RRWINSTVHNLFELVLVKDLCGTFCFSMQFIIAMELVGTLVLPLAICFTVYVIIFAIV
                     SHPTPVITLVLLGLILGLPGLLIIVTATRWSYLLWMLCYIIALPIWNFVFPTYSYWKF
                     DDFSWGETRVIDGETKTADENEGEFDHSKIKMRTWREYERLEKMNRKQLSDDEYVNIA
                     SSPSQYMDILKDEESDAYNSNEHSKESVL"
     gene            <305905..>307278
                     /locus_tag="KLLA0_D03520g"
                     /db_xref="GeneID:2892976"
     mRNA            <305905..>307278
                     /locus_tag="KLLA0_D03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453223.1"
                     /db_xref="GeneID:2892976"
     CDS             305905..307278
                     /locus_tag="KLLA0_D03520g"
                     /note="highly similar to uniprot|Q96W94 Saccharomyces
                     kluyveri PYD3 Beta-alanine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453223.1"
                     /db_xref="GeneID:2892976"
                     /db_xref="GOA:Q6CS66"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q6CS66"
                     /translation="MTSTIAPTTTTTTTDSATGTINLVGHVPLQIAPGRLNDTILSTG
                     SEFGGVARWGEERHEFGMRRLAGTELDGKMRDWFVRECKDLGCSIKIDQIGNIFAIYP
                     GKNSGTKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFN
                     EEGARFARSCTGSSVWSHDLSLEDAYSLVSIGEEHPETVKESLTKINYIGDVPASYQE
                     NQIDAHFELHIEQGPILEDEDRRIGIVTGVQAYNWSKITVSGVGAHAGTTPWRLRKDA
                     LLMTSKMICAAAEIAESHDGLFTTGVIDVKPYSVNIIPGEVTFTMDLRHYSDEMLKQI
                     IEEIQSAFDKLIKNNKGGALTYEREVLQVSPSVKFNETCIDCVSRSAYSQFEKDKVKP
                     MWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPQEIADGFKVLLQAIINYDN
                     YRATRGH"
     gene            complement(<307437..>310193)
                     /locus_tag="KLLA0_D03542g"
                     /db_xref="GeneID:2892921"
     mRNA            complement(<307437..>310193)
                     /locus_tag="KLLA0_D03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453224.1"
                     /db_xref="GeneID:2892921"
     CDS             complement(307437..310193)
                     /locus_tag="KLLA0_D03542g"
                     /note="similar to uniprot|P14180 Saccharomyces cerevisiae
                     YBR038W CHS2 Chitin synthase II requires activation from
                     zymogenic form in order to catalyze the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for the
                     synthesis of chitin in the primary septum during
                     cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453224.1"
                     /db_xref="GeneID:2892921"
                     /db_xref="GOA:Q6CS65"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CS65"
                     /translation="MTRNPFMAEDEEPPVIRSPQRAAMRASQYSYSAVSYDDDASRFQ
                     GFPAVDSNPSSPSKAAARYSPQKMNNTLIDSVHNSPLPRNRYQANLQESPRRMNHALI
                     DVESNDGESLYDIYTNSPTKPGPLFQRLTSNETEYTYDSRKISGESTVYSGDTFGETK
                     FELNHPKTQTYKKRGLSEVRRHPPAFKQRRILKLDNPIPSGLRDIIPKRDSPEFTEMR
                     YTACTSDPDTFVEDGYNLRMAEMNRECQITICVTMYNEDKFALARTLHSIQKNVAHLC
                     KRHKSNVWGPTGWKTVQIIIISDGRSRINQGSLDYLAAIGVYQEDMAKSTVNGEPVKA
                     HIFELTTQVSIDEELNYRSEGTVPCQMVFCLKEENQKKINSHRWLFNAFCPILDPTVV
                     TLVDVGTKLNSTAVYHLWKVFDMDSNVAGAAGQIKTMKGKFDMKLLNPLVAAQNFEYK
                     MSNILDKPLESVFGYITVLPGALSAYRYRALKNNDDGTGPLHSYFLGETQEGRDHDVF
                     TANMYLAEDRILCWELVAKRDEAWVLKYVKEATGETDVPEEPPEFISQRRRWLNGAMF
                     SALYAQIHFHQIWKTRHSTTRKFFFHIEFLYQLVQMIFSWFSISNFFLTFYYLAGSMN
                     SIIPHGDVLFTFFKYLLICNLCALFIISMGNRPQGANHLFISSMVMLTICSTYALVCG
                     LVFAIKTLDDGTEEHSVFVNIVVSLLSTYGLYAFTSLLYLDPWHIFTSSVQYLLMLPS
                     FICTLQIFAFCNTHDVSWGTKGSTEAAKPIPSAEVIQGPDGITIVTDQWPQDIDNKYQ
                     ELKSRLKEKEMVEEKVDLTQKQNDYYRDIRTRIVMVWMLSNLILMMIITQIYEPEETV
                     NNIYLKFILWSVAALAAFRATGSIIFLLMKYLRLLISWKHKAEDSGSLNLPSVGNILS
                     VGEK"
     gene            310699..310809
                     /locus_tag="KLLA0_D03564r"
                     /db_xref="GeneID:2893439"
     tRNA            join(310699..310737,310774..310809)
                     /locus_tag="KLLA0_D03564r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2893439"
     gene            <311190..>312371
                     /locus_tag="KLLA0_D03608g"
                     /db_xref="GeneID:2893246"
     mRNA            <311190..>312371
                     /locus_tag="KLLA0_D03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453225.1"
                     /db_xref="GeneID:2893246"
     CDS             311190..312371
                     /locus_tag="KLLA0_D03608g"
                     /note="highly similar to uniprot|P38219 Saccharomyces
                     cerevisiae YBR025C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453225.1"
                     /db_xref="GeneID:2893246"
                     /db_xref="GOA:Q6CS64"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CS64"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCP
                     LGNPANYPFATIDPEEARVIVPSPRFDTLSEIYKPASKVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHIEGDVDPVRDLDIINTELRLKDIEFSE
                     KHLESIEKITRRGGQSLEVKQKKEEAELVTKIIELLKSGQRVANQSWSTKEVEIINSM
                     FLLTAKPSIYLINLSERDYIRKKNKHLLKIKEWVDKYSPGDLIIPFSVCLEEKLSHMT
                     EEEAEEELKNLGVQSALPKIVTTMREKLDLISFFTCGPDEVREWTIRRGTKAPQAAGV
                     IHNDLMNTFILAQVMKYEDVVEYKDDNAIKAAGKLQQKGKEYVVEDGDIIYFRAGAGK
                     N"
     gene            complement(<312661..>313599)
                     /locus_tag="KLLA0_D03630g"
                     /db_xref="GeneID:2893043"
     mRNA            complement(<312661..>313599)
                     /locus_tag="KLLA0_D03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453226.1"
                     /db_xref="GeneID:2893043"
     CDS             complement(312661..313599)
                     /locus_tag="KLLA0_D03630g"
                     /note="similar to uniprot|P23833 Saccharomyces cerevisiae
                     YBR037C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453226.1"
                     /db_xref="GeneID:2893043"
                     /db_xref="GOA:Q6CS63"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:Q6CS63"
                     /translation="MLRSIVRVPSITFASKEAMRPVLRKTTLAHFMNHYRSLSVSATK
                     LQEIKKYDPAPAVGSPKPKKKPLSRIPIGGAETHTQKVDTGSTIEFTTWKAAALFILI
                     GGGVYYFFKNEKQRLETEKEAEANRGYGRPLVGGPFSLIDFNGNPFTEKDLLGKFSII
                     YFGFSHCPDICPDELDKLGAWLTELKKRDINLQPVFITCDPARDPPEVLKEYLSEFHP
                     DIIGLTGDYDAVKNACKKYRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGQFIDALGR
                     NYDEQTGVEKIVEHVSAYVPKEEREKRKDKWYSFLF"
     gene            complement(<314243..>315172)
                     /locus_tag="KLLA0_D03652g"
                     /db_xref="GeneID:2893059"
     mRNA            complement(<314243..>315172)
                     /locus_tag="KLLA0_D03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453227.1"
                     /db_xref="GeneID:2893059"
     CDS             complement(314243..315172)
                     /locus_tag="KLLA0_D03652g"
                     /note="highly similar to uniprot|P20604 Saccharomyces
                     cerevisiae YDL047W SIT4 Type 2A-related serine-threonine
                     phosphatase that functions in the G1/S transition of the
                     mitotic cycle cytoplasmic and nuclear protein that
                     modulates functions mediated by Pkc1p including cell wall
                     and actin cytoskeleton organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453227.1"
                     /db_xref="GeneID:2893059"
                     /db_xref="GOA:F2Z682"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:F2Z682"
                     /translation="MSDNGPDLWLEKIKKCQALTESEMKQLCEMMKELLMEESNIQPV
                     QSPVTVCGDIHGQFHDLLELFRTAGGFPDQVNYIFLGDYVDRGYYSLETFTLLMCLKV
                     KYPSRITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFG
                     SKVSREFNHVNGLSLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     EDDLDPTFKIFSAVPDDYIQETNNNNQRGGYFL"
     gene            complement(<315846..>317207)
                     /locus_tag="KLLA0_D03674g"
                     /db_xref="GeneID:2893003"
     mRNA            complement(<315846..>317207)
                     /locus_tag="KLLA0_D03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453228.1"
                     /db_xref="GeneID:2893003"
     CDS             complement(315846..317207)
                     /locus_tag="KLLA0_D03674g"
                     /note="similar to uniprot|Q08231 Saccharomyces cerevisiae
                     YOL072W THP1 Nuclear pore-associated protein forms a
                     complex with Sac3p that is involved in transcription and
                     in mRNA export from the nucleus contains a PAM domain
                     implicated in protein- protein binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453228.1"
                     /db_xref="GeneID:2893003"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:Q6CS61"
                     /translation="MDHFFGALKAGDFSVLDINIERNGQLILELQQFLRSNDSIDLET
                     LINSHSLYENRWTRFNNLVSSFLGYCKELNPYSLWESSFSVFQYYQDLNTCLTNETTM
                     YPIDSLVPLFTATTELVIPMAIRLDANHKIIGTRQHQFLTHIASIISKLFNSIKARVD
                     DDKVEFDHLSGKQKVLLYISNKLNMIYFKINSPSSCANIFKNLKPKSNIYSFNQYPLT
                     ERIQYRYYLGRYYLLNHRMVNAFHQLNQCYELLATLPDSIAKQNNRRRLLKFLVPCGI
                     IISKLPDFNKLSQWDPILAQKYTALVIAVKNGNLNRVNFWLYENESWLKSSKLLIVLL
                     EKLPIITFRSLLRSIFLYYCIPRNSNKLPYSVIRPILAKSIGLYPPEMPSIYKDNYTA
                     ESLENILVTLSIQQLWKGNVFPSLQVCVTMKTNDISVIFPNINEKIVSRFSLNQEDSW
                     LDK"
     gene            <317854..>318312
                     /locus_tag="KLLA0_D03696g"
                     /db_xref="GeneID:2892803"
     mRNA            <317854..>318312
                     /locus_tag="KLLA0_D03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453229.1"
                     /db_xref="GeneID:2892803"
     CDS             317854..318312
                     /locus_tag="KLLA0_D03696g"
                     /note="highly similar to uniprot|P36010 Saccharomyces
                     cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
                     catalyzes the phosphorylation of nucleoside diphosphates
                     into the corresponding triphosphates for nucleic acid
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453229.1"
                     /db_xref="GeneID:2892803"
                     /db_xref="GOA:Q6CS60"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:Q6CS60"
                     /translation="MSNTERTFIAIKPDGVQRGLISKILARFEDRGYKLVGIKLVTPT
                     EALLKEHYADLVSKPFFPSLLSYMTSGPVLATVWEGKDVVKQGRAILGATNPLQSAPG
                     TIRGDFAIEVGRNVCHGSDSVESAEKEIGLWFKKEELIDYKLNQLSWIYE"
     gene            <318725..>319957
                     /locus_tag="KLLA0_D03718g"
                     /db_xref="GeneID:2892856"
     mRNA            <318725..>319957
                     /locus_tag="KLLA0_D03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453230.1"
                     /db_xref="GeneID:2892856"
     CDS             318725..319957
                     /locus_tag="KLLA0_D03718g"
                     /note="weakly similar to uniprot|P48412 Saccharomyces
                     cerevisiae YGR072W UPF3 Component of the nonsense-mediated
                     mRNA decay (NMD) pathway along with Nam7p and Nmd2p
                     involved in decay of mRNA containing nonsense codons"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453230.1"
                     /db_xref="GeneID:2892856"
                     /db_xref="GOA:Q6CS59"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CS59"
                     /translation="MLSKKRNRRRYRKRSADSSREFKLCIRSLPPNLTEEQFISTLQE
                     NNIDVHSFQKSFYYVQGHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDL
                     DNSMIPDLQISPFVKKWVSPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKN
                     LSVIAPLRKELEREEKMEEELNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKK
                     RKLKRAKAKNKDNPDEKDVSKDKSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTA
                     TTEKSAVTSEEKPKKKILLKPKKDDVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKK
                     DLTSKETKETPSKVTPKVKIKSKSANVEEMKSEKRKQENTKPEKNPSSESDKKAKSKR
                     KSRKGRQSDGPKHKDKPT"
     gene            <320199..>320531
                     /locus_tag="KLLA0_D03740g"
                     /db_xref="GeneID:2892869"
     mRNA            <320199..>320531
                     /locus_tag="KLLA0_D03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453231.1"
                     /db_xref="GeneID:2892869"
     CDS             320199..320531
                     /locus_tag="KLLA0_D03740g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453231.1"
                     /db_xref="GeneID:2892869"
                     /db_xref="UniProtKB/TrEMBL:Q6CS58"
                     /translation="MVNIRTTELEGDLAQLTYELGLKDKEVMTLKQSLERLNAEVEKL
                     RNENRGLKSELEHWNKLPMSPISLSSENDQTEDDKNRMIQENLRREILSLKNESNILS
                     EWIKTLIS"
     gene            complement(<320521..>321084)
                     /locus_tag="KLLA0_D03751g"
                     /db_xref="GeneID:2892821"
     mRNA            complement(<320521..>321084)
                     /locus_tag="KLLA0_D03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453232.1"
                     /db_xref="GeneID:2892821"
     CDS             complement(320521..321084)
                     /locus_tag="KLLA0_D03751g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453232.1"
                     /db_xref="GeneID:2892821"
                     /db_xref="GOA:Q6CS57"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:Q6CS57"
                     /translation="MSSSVILKRYNILLKRNPLLTKCITGAVLTGLSELFSQWVSLSP
                     EERKEKLNWIKVALMSLYGGLFNAPVNHFSYKWINEYTIRKVVSKYRSLVQLGCSLGM
                     VSPIQVLGLLFTLTSVNNGKVDKTKIIHAIKTRYAAMLSSSLATSTVLMSIAQRYISP
                     DKWSVFFSLAYAILGTAQNIYLKKFKK"
     gene            <321716..>322141
                     /locus_tag="KLLA0_D03773g"
                     /db_xref="GeneID:2892978"
     mRNA            <321716..>322141
                     /locus_tag="KLLA0_D03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453233.1"
                     /db_xref="GeneID:2892978"
     CDS             321716..322141
                     /locus_tag="KLLA0_D03773g"
                     /note="similar to uniprot|Q02260 Saccharomyces cerevisiae
                     YGR074W SMD1 Homolog of human core snRNP protein D1
                     involved in snRNA maturation U6 snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453233.1"
                     /db_xref="GeneID:2892978"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q6CS56"
                     /translation="MQLTGFLKKLKNERVSIELKNGTTVWGIVRSVSPQMNVSLTDVR
                     LTLPTKTSEATLAAVLLSGGSTQGQESKRTTSLEFINIRGNTIRQIILPDSINLDALL
                     VDQQEVNRLRKQGKVGSDPNKKRSLESNGNAPKRPKRAF"
     gene            complement(<322289..>322993)
                     /locus_tag="KLLA0_D03795g"
                     /db_xref="GeneID:2892843"
     mRNA            complement(<322289..>322993)
                     /locus_tag="KLLA0_D03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453234.1"
                     /db_xref="GeneID:2892843"
     CDS             complement(322289..322993)
                     /locus_tag="KLLA0_D03795g"
                     /note="similar to uniprot|Q00723 Saccharomyces cerevisiae
                     YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
                     particle dispensable for spliceosome assembly but required
                     for conformational changes which lead to catalytic
                     activation of the spliceosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453234.1"
                     /db_xref="GeneID:2892843"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:Q6CS55"
                     /translation="MPNEFYVEENLSGKQLNHQSASLVVPQIFRNKVSSCMYYKFNLT
                     PASLRGDTIVELIPVIVRDFGTMDERKTPHVTVLGGIEFKCLLMKLINLRPPWEQLKV
                     LLEPHEPLNNKYIAALVLCYMRISYYFLTESNPSEQDISFNLLHDLMKKYILDHRKLK
                     SYSLDMDCWSSSIKKEIKLIHFDELIDWLCDRNEIWGIPLGKCNWCKIWDDEEDDESS
                     SDSDSSSDPRDDSDQI"
     gene            complement(<323294..>323767)
                     /locus_tag="KLLA0_D03817g"
                     /db_xref="GeneID:2893263"
     mRNA            complement(<323294..>323767)
                     /locus_tag="KLLA0_D03817g"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_453235.1"
                     /db_xref="GeneID:2893263"
     CDS             complement(323294..323767)
                     /locus_tag="KLLA0_D03817g"
                     /note="similar to uniprot|P23369 Saccharomyces cerevisiae
                     YGR076C MRPL25 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_453235.1"
                     /db_xref="GeneID:2893263"
                     /db_xref="UniProtKB/TrEMBL:Q6CS54"
                     /translation="MSGASMKHYFELLPVQLKNFFKKYPPNVKYSDKPTLITAMDANP
                     FLPNKNPATGKYHEPKYSLRRMSDLYKLAYSYGIQDLLPPSKKLFFEEKYENKKFMKG
                     VLMPKGHKHERLLEGKVAKMEEAIKNADKYILEAKGSKYKRRLEKKQNQNTRSWF"
     gene            <324274..>325941
                     /locus_tag="KLLA0_D03839g"
                     /db_xref="GeneID:2892781"
     mRNA            <324274..>325941
                     /locus_tag="KLLA0_D03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453236.1"
                     /db_xref="GeneID:2892781"
     CDS             324274..325941
                     /locus_tag="KLLA0_D03839g"
                     /note="highly similar to uniprot|P04802 Saccharomyces
                     cerevisiae YLL018C DPS1 Cytoplasmic aspartyl-tRNA
                     synthetase homodimeric enzyme that catalyzes the specific
                     aspartylation of tRNA(Asp) class II aminoacyl tRNA
                     synthetase binding to its own mRNA may confer
                     autoregulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453236.1"
                     /db_xref="GeneID:2892781"
                     /db_xref="GOA:Q6CS53"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6CS53"
                     /translation="MSDEVKKDPVEQISEGVEQVILGEDGQPLSKKALKKLQKEQEKQ
                     RKKEERERQLAAEKEAREKEAAANDTAKENYGKAPLIQSTTKSGVERILFEDLDESKD
                     DGREVVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKWVGSINL
                     ESIVVVHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEA
                     AGLPVVNLDTRLDSRVIDLRTVTNQAIFRIQSGVCALFREFLTNKKFTEVHTPKLLGA
                     PSEGGSNVFEVTYFKGKSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMT
                     EFTGLDLEMAFEEHYDEVVDTLAELFVFIFSQLKTRYAKEIALVRKQYPVEEFKLPKD
                     GKMVRIPFKEGIALLREAGKDVDDFEDLSTENEKLLGKLVRDKYETDFYILDKFPLAI
                     RPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDADLLKERMNAHEVHPEDPGLKD
                     YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP"
     gene            <326381..>327973
                     /locus_tag="KLLA0_D03861g"
                     /db_xref="GeneID:2892864"
     mRNA            <326381..>327973
                     /locus_tag="KLLA0_D03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453237.1"
                     /db_xref="GeneID:2892864"
     CDS             326381..327973
                     /locus_tag="KLLA0_D03861g"
                     /note="similar to uniprot|P38738 Saccharomyces cerevisiae
                     YHL029C Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive-strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453237.1"
                     /db_xref="GeneID:2892864"
                     /db_xref="GOA:Q6CS52"
                     /db_xref="InterPro:IPR000195"
                     /translation="MPLKPSSSHSERKNRLHLHASSRNAKQQEWNRELVTLFIKLLNE
                     NDHASLALVARNAGVPPQLRPAVWPTLLKYHPMVISPNIMSNTLVFKDDENEAELRYF
                     PEDRSEEDISELMENDLNKYFQVRNSVPVSAEIQEIKSLLKECVWQFLRKWNKICKYE
                     SGLIWIALGLAEWCPLKNNDDLVLAGRKHHHHNSCLRHLYEEYPIPDELLNQLPDTEF
                     DFAAIYERLVLVLFHAPALDEKPDKSNYHLLKSGNLNQQSQLFFKVFAKTLPELYQPI
                     TDEGALQGSKKATWLYWWIKCCGCRVLHRQDRGRVWDVLLGWRPRPESINYYLEYNHK
                     SFESIYPPELKLSSEIFHKICKCEHDEFWFPDLMSLRLGQNGLNQDEDVIRELIRRNK
                     YGDDGHTTETQENEIPYSLLNPHAELLFIYVAIMQHNEFKLLEFEETEITEFLNNVPL
                     ISKFDDYNFKKMYEDDDISGSSTDTDESNASGIRPSSSNHMMIEVGTDDKTAHSFDDI
                     YQQAGDIWRNWAWQEMEEFIEE"
     gene            <328358..>329833
                     /locus_tag="KLLA0_D03883g"
                     /db_xref="GeneID:2892743"
     mRNA            <328358..>329833
                     /locus_tag="KLLA0_D03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453238.1"
                     /db_xref="GeneID:2892743"
     CDS             328358..329833
                     /locus_tag="KLLA0_D03883g"
                     /note="weakly similar to uniprot|P32523 Saccharomyces
                     cerevisiae YLL036C PRP19 Splicing factor associated with
                     the spliceosome contains a U-box a motif found in a class
                     of ubiquitin ligases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453238.1"
                     /db_xref="GeneID:2892743"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CS51"
                     /translation="MFCAISGKPPIKAVLSPNSKCIFEQHLIEQYIEQKGTDPITDDP
                     LQKTDLVEINATPQQISLSESLSSSTIANNYSIPSLLSTLQKEWDAVMLENFELRKQL
                     DVCKKNLSDTLYRFDAVASAAAKAFVERDQLKQELAELTSAITSSNVENDGTIDKLQN
                     SDQILSDFTSELSTKSQEYVTNSKKSKKKLQHFSNVSVVQSTDFSEIDLISRNQHVNL
                     NERSVVVKDNDKAFVFGPQDSILDVSQATEYLVEFKDVLYTFTQGLLAAYDLHTKSLL
                     YEEVLEGTDGPVIFMAYPHQISDSYFLFVTERGTIYGYEVTKKALFTISQVKLNDSVQ
                     FVNYHKDGALLAIGNQNEGVYVINLLAATKDPIKFSTGFPAKRVDFGLNGYWMFVFGD
                     SDLNVYDLRKDPGTLAMEPLSFAENIISVELDDTAKGFFVSMGNSQVQWYEYVKGQSF
                     VEKSTLPIETNTAESMTLVKIDQGYFLNVISENKCITYELK"
     gene            complement(<330128..>330634)
                     /locus_tag="KLLA0_D03905g"
                     /db_xref="GeneID:2892713"
     mRNA            complement(<330128..>330634)
                     /locus_tag="KLLA0_D03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453239.1"
                     /db_xref="GeneID:2892713"
     CDS             complement(330128..330634)
                     /locus_tag="KLLA0_D03905g"
                     /note="similar to uniprot|P38143 Saccharomyces cerevisiae
                     YBR244W GPX2 Phospholipid hydroperoxide glutathione
                     peroxidase induced by glucose starvation that protects
                     cells from phospholipid hydroperoxides and nonphospholipid
                     peroxides during oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453239.1"
                     /db_xref="GeneID:2892713"
                     /db_xref="GOA:Q6CS50"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6CS50"
                     /translation="MSDDFYSYSCETKDGSEYHMSELRGKVVLIVNVASKCGFRGQYG
                     ELQELYKEFHAKGFEILAFPCNQFMNQEPGSDEEIGKFCQEHYGVSFKIMKKCKVNGV
                     NALPLYKYLKDQQPRMFGFTFVRWNFEKFLIDRSGRVHGRYSTLTKPKSMKEDIEQLL
                     KQKSQLQS"
     gene            <331864..>332472
                     /locus_tag="KLLA0_D03927g"
                     /db_xref="GeneID:2892763"
     mRNA            <331864..>332472
                     /locus_tag="KLLA0_D03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453240.1"
                     /db_xref="GeneID:2892763"
     CDS             331864..332472
                     /locus_tag="KLLA0_D03927g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453240.1"
                     /db_xref="GeneID:2892763"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="UniProtKB/TrEMBL:Q6CS49"
                     /translation="MHIDSFSHKSSVPQFEQHFGVKYGTKEAVSISRNKPWLKGRSPK
                     PCSLKLKSGMEFLTVNTSHPLNDEDVKKFEKFVGTVLSSGVRAFYMKGNGGKLPDERC
                     MYVSSDGREFDIKNFLPISYPRFDGDMTVEQAYEILVENKYLVPRDYIPIVIDGGGFP
                     FCLRKGSEDVFFANIESGELIFIEKDLETFVTGVITEDEAWA"
     gene            <333566..>334243
                     /locus_tag="KLLA0_D03949g"
                     /db_xref="GeneID:2893555"
     mRNA            <333566..>334243
                     /locus_tag="KLLA0_D03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453241.1"
                     /db_xref="GeneID:2893555"
     CDS             333566..334243
                     /locus_tag="KLLA0_D03949g"
                     /note="similar to uniprot|Q07872 Saccharomyces cerevisiae
                     YLL038C ENT4 Protein of unknown function contains an
                     N-terminal epsin- like domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453241.1"
                     /db_xref="GeneID:2893555"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q6CS48"
                     /translation="MSFFKGLRRVGQSTTQLKVKQATDSNESYGATGTLMNELSVLTY
                     SEKSANEIYEVIRKRLMNGSSRLKNSHDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRH
                     LAYIEALKDYHCSNDKDKSKVKQIKSLSEDISKNLKEDDFLEKRRLDIIMFRSSISTP
                     GRKSTDNSHLNNRQPASVPLDEDILPEFKSVLQTRSLDLQRRKSTKYSTDRVRYLATL
                     AEEDDGP"
     gene            <334691..>334990
                     /locus_tag="KLLA0_D03971g"
                     /db_xref="GeneID:2892810"
     mRNA            <334691..>334990
                     /locus_tag="KLLA0_D03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453242.1"
                     /db_xref="GeneID:2892810"
     CDS             334691..334990
                     /locus_tag="KLLA0_D03971g"
                     /note="similar to uniprot|Q3E731 Saccharomyces cerevisiae
                     YLL018C-A COX19 Cytochrome c oxidase assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453242.1"
                     /db_xref="GeneID:2892810"
                     /db_xref="GOA:Q6CS47"
                     /translation="MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLV
                     KGENAPNCRLLAKEYLKCRMDNKLMDRDDWKHLGLPSDKKEANDVTKETTPTSGQ"
     gene            335455..335585
                     /locus_tag="KLLA0_D03993r"
                     /db_xref="GeneID:2892993"
     tRNA            join(335455..335492,335541..335585)
                     /locus_tag="KLLA0_D03993r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2892993"
     gene            <336499..>337833
                     /locus_tag="KLLA0_D04037g"
                     /db_xref="GeneID:2892931"
     mRNA            <336499..>337833
                     /locus_tag="KLLA0_D04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453243.1"
                     /db_xref="GeneID:2892931"
     CDS             336499..337833
                     /locus_tag="KLLA0_D04037g"
                     /note="highly similar to uniprot|P06106 Saccharomyces
                     cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
                     serine sulfhydrylase required for sulfur amino acid
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453243.1"
                     /db_xref="GeneID:2892931"
                     /db_xref="GOA:Q92441"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /translation="MPSHFDTLQLHAGQEKTADAHNPRAVPIYATTSYVFNDSKHGAQ
                     LFGLETPGYIYSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDN
                     IVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKY
                     NVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKYGADIVTHSATKWIGGHGVTVG
                     GVIIDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVL
                     SPFAGFLLLQGLETLSLRGERHGSNALKLAQYLESSPYVSWVSYPGLPSHSHHENAKK
                     YLENGFGGVLSFGVKDLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPY
                     FTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIADFEASFATVFNGQKPE"
     gene            complement(<338422..>343128)
                     /locus_tag="KLLA0_D04059g"
                     /db_xref="GeneID:2892750"
     mRNA            complement(<338422..>343128)
                     /locus_tag="KLLA0_D04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453244.1"
                     /db_xref="GeneID:2892750"
     CDS             complement(338422..343128)
                     /locus_tag="KLLA0_D04059g"
                     /note="similar to uniprot|P14772 Saccharomyces cerevisiae
                     YLL015W BPT1 ABC type transmembrane transporter of
                     MRP/CFTR family found in vacuolar membrane involved in the
                     transport of unconjugated bilirubin and in heavy metal
                     detoxification via glutathione conjugates along with
                     Ycf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453244.1"
                     /db_xref="GeneID:2892750"
                     /db_xref="GOA:Q6CS45"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CS45"
                     /translation="MIMLQVPNATCEFGLRPYISPEVNALNPCFISWVCVIFVAHFIA
                     IGGFQYVSLRNKETGPATFETKRFWTFRNMSIFHVIHMINVLFQCVLLLIQLSWVKDE
                     PTWTKWSISLNLFYVAIVYLNSTWLAYYKSSCAQGHGLFYFIIYSFVVAFEIGQRYFH
                     AGTERYNVIKNGASAMIVDILLWFNSMSIFCYDTFLFKCSPQLTNYFAVNNIYPPVNV
                     LAGISFTWMNKLIMDTYHANKIEDPSNMPLPPFDLDIAEATTAVEANWEYELWTDRKS
                     LLLALLKTFGPTIAIAMSYEVSRSLLSVIQPQLFRKFIEVFNPDSRDLPILNGFFVAI
                     GLFLLSILSTIISNQFFINIFEAGLKIRGSLMSLVYQKSLRLSAEAREDKANGDVLNL
                     MSVDVIRIQRFFENAQILVGSPIQLIGVLISLYVLLGNATIGGLVSIVIMVPINSYMT
                     RLYKKLFKTQMQYKDKRIKTVTEILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKK
                     IAIVSNFMFFCWNIVPLLVTCSTFVLFSYLTDQVLSPQIIFPSLTLFSMLNDALFTVP
                     TMISNIIEIGVSLKRLKGYLLAEELDTSFIEHARATASDPTVEISNAVFLWKSPKSAA
                     SSEDTDEEAEISSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQLPCVSS
                     DSASGVKPKVVIRADNLAYCPQQPWIMNASLKDNILFGYKYDEAMYKKTIKACQLLPD
                     LEILPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSII
                     DDVLDRQKGLLKNKTVILTTNAVNVLVHSDMIYLLKNGKIVESNSYEEVMSKDRNNGE
                     KSSLREIIEEFASNESEETAEKKSESSTIDDKNVGSSSEDDGDLEGAPQPPEHLLNYE
                     AAKNPDNNTITAYEEDQENADLARVASRRASIATLKPRPLIDMNKDERKTAQKAETKE
                     EGRVKSSVYLSYIKACGILGVALFFVLMISMKLLDLAKNFWLKHWSEDNLTHGANKDI
                     WKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPV
                     GRIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWFLLFNTILLGIYY
                     YYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAYKHANIFNYYNFENIQTN
                     INFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALASLGTSNPISAGLIGLLMSYALQV
                     SSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHY
                     TTKYRENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGI
                     DISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIER
                     IVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVD
                     RETDKIIQETIRTAFKDRTILTIAHRIDTVLDSDKIMVLDKGEVKEFDTPDNLLKNKE
                     SLFYGLCEKGGYLKEE"
     gene            complement(<344666..>348124)
                     /locus_tag="KLLA0_D04092g"
                     /db_xref="GeneID:2893154"
     mRNA            complement(<344666..>348124)
                     /locus_tag="KLLA0_D04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453246.1"
                     /db_xref="GeneID:2893154"
     CDS             complement(344666..348124)
                     /locus_tag="KLLA0_D04092g"
                     /note="similar to uniprot|P38995 Saccharomyces cerevisiae
                     YDR270W CCC2 copper-transporting P-type ATPase with
                     similarity to human Menkes and Wilsons genes;
                     Cu(2+)-transporting ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453246.1"
                     /db_xref="GeneID:2893154"
                     /db_xref="GOA:Q6CS43"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:Q6CS43"
                     /translation="MRKSHHIKVKLRDHTSVKSEETIKSVLGKTASSIKYLKDGDSIY
                     FKSNEDVRDIRNRLTRAGLIVDRISVNGEEDLEFKDLDLEAGSSSSIDAKESAGDDSI
                     PWRSDEAGKVHYRAQFVLGSNENIDTIINVIKGKSLVTSINHDENNLFAIVPNKNICQ
                     DIINVVRDHNISIQLKDILPVHTEKKYKVTASIGGITCAACASSITNAVSDLDFVSDV
                     AVNVVSKVGVFILDSDDQSKLDQLKETVEDCGFVYEAVGSPTLTNHISVKSPARHVTV
                     KIEGMFCSNCPVRTIKSLLDIANAELIIDNTDELTLKHPYIKFTYIPNVERGITIRNI
                     FSKITEELTTEEHKDIKVVIVKEVTLEEHLKEMAKKETWSIAKRLIAVTVMAIPTFAF
                     GIVGMALLPSSNKFREWVDEPTWVGNVSRVVWILFIISTPVYFFVADIFHRKAVKEIY
                     SLWKHSNNWKRRLFRFGSMNLLMSLGTTVAYFASIALLGIAASRPRDTSDSRMHKGLS
                     TTYFDSVVFLTFFLLIGRLLESLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVET
                     VQIQYLELGDYIKISPGQSPPLDSIILEGETEFDESALTGESIPMVRLRGDQIFAGTV
                     NVGSSSVIAKVSSFDGESLLDQIVNTVRDGQLNRAPIERLADILTGYFVPIIIFLAIL
                     TWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFAISVFVIACPCGIGLAAPTALFVGS
                     GMAAKFGILCRGGGAAFQEGCKIAIVCFDKTGTLTLGNEMKVTNYSLHGDEKLAKIGI
                     EVTRDMESGSRHPLAIGVKKFIDNTFGKKTGTVKVPDPVEITGGGLKGEIIIDNDLSL
                     PDARIWKEVDPEMAIVGNERLLRDYKCHLTSEQLKLLAEWKARGKSLMVTAIKSRSYF
                     GNDNFYPVMMCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDIDNV
                     IAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALASGSEL
                     AMTSCDFVLLSPINTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALPIAAGVIYPY
                     HNTRLSPVWASAAMALSSVSVLLSSLALKLYNPTRSLPSSFKSKDKESNSYLHQYQPI
                     RDYIMF"
     gene            complement(<348791..>350278)
                     /locus_tag="KLLA0_D04114g"
                     /db_xref="GeneID:2893126"
     mRNA            complement(<348791..>350278)
                     /locus_tag="KLLA0_D04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453247.1"
                     /db_xref="GeneID:2893126"
     CDS             complement(348791..350278)
                     /locus_tag="KLLA0_D04114g"
                     /note="similar to uniprot|P32457 Saccharomyces cerevisiae
                     YLR314C CDC3 Component of the septin ring of the
                     mother-bud neck that is required for cytokinesis septins
                     recruit proteins to the neck and can act as a barrier to
                     diffusion at the membrane and they comprise the 10nm
                     filaments seen with EM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453247.1"
                     /db_xref="GeneID:2893126"
                     /db_xref="GOA:Q6CS42"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CS42"
                     /translation="MAEVINDTVKSEAISLKHEDSVATGLDSVNQDNNVEQTFSDANG
                     DEIAPAVQESNGTLGQVLPDQPNLKVVRRIINGYVGFANLPKQWHRKSIRRGFNLNLL
                     CVGYKGLGKSTLINTLFNRELYEQDALSHGVQSLDLGDGNGNDVSVKKENGENGPAEE
                     NKVKIETVSAEIEENGVKLQLTVVDAPGFGDSIDNTDSWKPIVDEINRRFDQYLESEN
                     KIQRTTLQDNRIHACLYFIEPTGHGLKPLDLEFCKQVHSKCNLIPVIAKSDILTDEEI
                     VTFKATIKKQLEQANVQLFEPPQYSMLGDETSTENIFEKIPFAIVGSTEQVTTEDGRK
                     VRGRAYPWGVIEVDNTKHSDFVYLRDLLIRQYLEELRERTNKVLYEKYRSEKLLGLGI
                     KQDNSVFKNFDPETRQKEEKQLHEVKLAKLEAEMKAVFQQKVEEKEKKLQKSEAELFA
                     RHKELKDKLTSQLKALEEKKRQLELSLANQPTSSPIPAKKKGFLR"
     gene            <350976..>352124
                     /locus_tag="KLLA0_D04136g"
                     /db_xref="GeneID:2893462"
     mRNA            <350976..>352124
                     /locus_tag="KLLA0_D04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453248.1"
                     /db_xref="GeneID:2893462"
     CDS             350976..352124
                     /locus_tag="KLLA0_D04136g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453248.1"
                     /db_xref="GeneID:2893462"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019544"
                     /db_xref="UniProtKB/TrEMBL:Q6CS41"
                     /translation="MIAAVSNHTLQINCLTISVHYRRIESKMSDKFDKLLTEGAKHYA
                     GKNYELAVDSYADLNQLYDSENENPNPEYLFLYGKALYQLALSRSDVFGMGSNVKRDE
                     HNEEQDEDDSASKGPGLIQFGEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQKQDQ
                     EQEEEDQVEGQEEVDKDDFENAWEILELARSYYESSLKETPDNEDLKLKLSECYDLLG
                     EVSLECENFSQASHDFEECLKLRRELFETKDPIDRSIIESYYKISLALEFDPDQFKKC
                     TSNLQKCIELLKQRCKTVDKEDEDQKDLLNELQTKLKELEESEAQMQSLKNDLLSTIH
                     SVTASSTEASSAPAKSNEAPVNDLTSMVKKRKSNDISESAETSKKAKN"
     gene            complement(<353145..>354698)
                     /locus_tag="KLLA0_D04158g"
                     /db_xref="GeneID:2893398"
     mRNA            complement(<353145..>354698)
                     /locus_tag="KLLA0_D04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453249.1"
                     /db_xref="GeneID:2893398"
     CDS             complement(353145..354698)
                     /locus_tag="KLLA0_D04158g"
                     /note="some similarities with uniprot|Q03654 Saccharomyces
                     cerevisiae YMR213W CEF1 Essential splicing factor;
                     associated with Prp19p and the spliceosome, contains an
                     N-terminal c-Myb DNA binding motif necessary for cell
                     viability but not for Prp19p association"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453249.1"
                     /db_xref="GeneID:2893398"
                     /db_xref="GOA:Q6CS40"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6CS40"
                     /translation="MKPPKTKGKQNKRQDAAPTSSPKDIEESTSVKAESEDSVSTEST
                     ASDQMSTSSLTKKTIKGLWSAEEDKMLLSLIEVYGPSRWVEISHQLKTRTAKQCRERY
                     HQNLRPNLNKSPISIEEGDAIKGLVAKHGFRWTLIAKLLNTNRSDNSIKNWWKTNVKK
                     KQRNVFRDSNPSGTMAKDFDMMAGPEINPHLLHGGSPQFLKNHHPHDRDPSSSCESNS
                     PKSDCSSPIDHISNRRNYVSPIDQYGQRLQLHSHPHFVHMLPMGPNFIQRPLLPQDMH
                     NNHRGIAVQPYIPYPQYAPATHMSANMFPILVHNANVQVETVSNDNTHNNHNDNTTNI
                     NDGVSNTIHTQSINHGSDASTEIQHHMYASLPPPIGTYMGPIIPHSHLMPPQTLSQGA
                     GTIPAKIEETQPAQPIMQHPNLPVQQTQPQQLIRIPHGTGTETKDSKFVVPSSPMANT
                     SVQHMPMSNIPNSPAIQQNFSEKTEASTGVDTSHHVTEPPSNKLPSFEELTQKMKLNN
                     SSNNNPNLK"
     gene            <357299..>357532
                     /locus_tag="KLLA0_D04181g"
                     /db_xref="GeneID:9487522"
     mRNA            <357299..>357532
                     /locus_tag="KLLA0_D04181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999324.1"
                     /db_xref="GeneID:9487522"
     CDS             357299..357532
                     /locus_tag="KLLA0_D04181g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999370.1"
                     /db_xref="GeneID:9487522"
                     /db_xref="UniProtKB/TrEMBL:B5FV73"
                     /translation="MLSVSETTSRITEDATASNQRQKGERLFYGEAAKKNELEYELLK
                     LSPRDIVSPSSHPPLRTLVAGFSFVSSVLSFRL"
     gene            <362270..>363061
                     /locus_tag="KLLA0_D04202g"
                     /db_xref="GeneID:2893543"
     mRNA            <362270..>363061
                     /locus_tag="KLLA0_D04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453251.1"
                     /db_xref="GeneID:2893543"
     CDS             362270..363061
                     /locus_tag="KLLA0_D04202g"
                     /note="weakly similar to uniprot|Q12164 Saccharomyces
                     cerevisiae YLL023C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453251.1"
                     /db_xref="GeneID:2893543"
                     /db_xref="GOA:Q6CS38"
                     /db_xref="InterPro:IPR005344"
                     /db_xref="UniProtKB/TrEMBL:Q6CS38"
                     /translation="MSSSVGSTTITSRFLALTKTTKFAWFIGHFAVVLCSIFYWLSLR
                     STSLTEIWYRIIFLGAMESFGVLVYQTYGKALKKGDVRNGSGPVNFRQVIRDENVLYF
                     LLSATWLILSPRIAIATIPFFIISLFHALTYIVTDIASNVLQVEDVKKHPYLRFIDTL
                     VSDNHETSLNAICNSELLCLLYNFIRLLTFRSRSFIAFVAVFLFVRFKCYNSAHMKRS
                     IAKWEVRLDGVIAHPAVPHPVKTQYTNAKLLLRRAFITPTEKKGN"
     gene            <363732..>365654
                     /locus_tag="KLLA0_D04224g"
                     /db_xref="GeneID:2893121"
     mRNA            <363732..>365654
                     /locus_tag="KLLA0_D04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453252.1"
                     /db_xref="GeneID:2893121"
     CDS             363732..365654
                     /locus_tag="KLLA0_D04224g"
                     /note="highly similar to uniprot|P10592 Saccharomyces
                     cerevisiae YLL024C SSA2 member of 70 kDa heat shock
                     protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453252.1"
                     /db_xref="GeneID:2893121"
                     /db_xref="GOA:Q6CS37"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6CS37"
                     /translation="MSKAVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQAAMNPANTVFDAKRLIGRNFSDAEVQGDIKHFPFKVIDVAGKPQVE
                     VEYKGENKVFTPEEISSMILSKMKETAESYLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKDEGEKNVLIFDLGGGTFDVSLLTIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNQRALRRLRTACERAKRTLSSSA
                     QTSIEIDSLFEGIDLYTSITRARFEELCGDLFRSTLDPVEKVLRDAKLDKSQVHEIVL
                     VGGSTRIPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAVLTGDQSSKTQDLLLL
                     DVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVYEGERARTKD
                     NNLLGKFDLTGIPPAPRGVPQIEVTFDVDANGILNVSAVEKGTGKSEKITITNDKGRL
                     SKEDIERMVSEAEKYKEEDEKESSRIAARNQLESTSYSLKNTLSEAADKIEEADKETL
                     TAKCDEVIAWLDANTQATTEEFESQLKELQEVANPIMTKMYQAGGAPGGAAPGGFPGG
                     APPAPEAEGPTVEEVD"
     gene            366089..366219
                     /locus_tag="KLLA0_D04246r"
                     /db_xref="GeneID:2892867"
     tRNA            join(366089..366126,366175..366219)
                     /locus_tag="KLLA0_D04246r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2892867"
     gene            <368361..>368579
                     /locus_tag="KLLA0_D04334g"
                     /db_xref="GeneID:2893575"
     mRNA            <368361..>368579
                     /locus_tag="KLLA0_D04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453255.1"
                     /db_xref="GeneID:2893575"
     CDS             368361..368579
                     /locus_tag="KLLA0_D04334g"
                     /note="similar to gnl|GLV|CAGL0J01699g Candida glabrata
                     CAGL0J01699g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453255.1"
                     /db_xref="GeneID:2893575"
                     /db_xref="GOA:Q6CS34"
                     /translation="MRPTQFVLNAAKKKSGFSVPVELTPLFLAMGVALASGTWFSYKK
                     FFHDDSLRVSRKNPEQSALDKVLNQKAE"
     gene            complement(<369403..>371277)
                     /locus_tag="KLLA0_D04356g"
                     /db_xref="GeneID:2893389"
     mRNA            complement(<369403..>371277)
                     /locus_tag="KLLA0_D04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453256.1"
                     /db_xref="GeneID:2893389"
     CDS             complement(369403..371277)
                     /locus_tag="KLLA0_D04356g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453256.1"
                     /db_xref="GeneID:2893389"
                     /db_xref="GOA:Q6CS33"
                     /db_xref="InterPro:IPR006042"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="UniProtKB/TrEMBL:Q6CS33"
                     /translation="MDQVLADAVEQDNVKRAPVKDVVKKVVRKWTTKDGLLGDYDYAF
                     LFTPSYPFQEYLARKRGVELVHRDQPFFSLNADVPVVLGMILGLQHSLSMLAGVISPP
                     ILISTMINLDQSVQEYLVSASLIVSSLMSAIQITRVPIPFTSYYVGSGLISVLGTSFA
                     SITLVGNVFPMMYDTGFCPVSEDGTQLACPDGYGAILGTACVCGLLEVAMSFTPANIL
                     QSLFPKIVTGPVILCIAFSLIKSGFSDWAGGSGCVGAICPSEGAPMAGDWGSARFVGL
                     GFLVFSTIIIFEKYGAPIMKSCAVILGLLVGCIVAAACGYFNKTSIDAAPGGTFIWVH
                     TFKLSVYGPAVLPMLVLYIVLATEAMGDLTATCDVSRLETEGAEYESRIQGGVLCDGL
                     SGILSGLCTITPMSTFAQNNGVISITKCASRQVGYWCCFFMFLMGIVAKFGAALVAIP
                     KPVLGGMTTFLFTSVAVSGIKIISTIPLTRRDRFVLTCSLALGIGAVLVPTWFGTFFH
                     YNGSNNTLQGFLNAIVLIMESGFAVCAIVGVIMNQLLPQELDEELMDDIEIQQENLSM
                     LEGEDDQPLSLRVLSHKAKEAASESAHPAQDSITYPQSFELKEDVKVTEASSSDGERK
                     "
     gene            complement(<372640..>373542)
                     /locus_tag="KLLA0_D04378g"
                     /db_xref="GeneID:2893544"
     mRNA            complement(<372640..>373542)
                     /locus_tag="KLLA0_D04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453257.1"
                     /db_xref="GeneID:2893544"
     CDS             complement(372640..373542)
                     /locus_tag="KLLA0_D04378g"
                     /note="similar to uniprot|P53212 Saccharomyces cerevisiae
                     YGR021W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453257.1"
                     /db_xref="GeneID:2893544"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:Q6CS32"
                     /translation="MLKISASRSLGSGSVFSRRFLHGTRVVNAGHSKWANIKHTKAKN
                     DAERTKIYNKIANQISVAVKLGGSADPAMNIRLATAIELANKNNVTKKVIENAIKKGS
                     GTNDGASAGAEPCTYEGIGPAGVAFVVEALTDNKNRTVGLIRSTFNKFNGNMTPTLYF
                     FERKGYVVIEPKEDQPRDFDSVMDIVLEIDGVEDLEQDTPNSEDTTGESEPLSSQDEN
                     SSGNDASALFEVITEAQQTNKVAETLRNQGFHIREMGVEYVPREETAMSPVTDTELHA
                     KLEKFINQLEEIDDVTQIYSNIKE"
     gene            <374127..>374483
                     /locus_tag="KLLA0_D04400g"
                     /db_xref="GeneID:2893509"
     mRNA            <374127..>374483
                     /locus_tag="KLLA0_D04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453258.1"
                     /db_xref="GeneID:2893509"
     CDS             374127..374483
                     /locus_tag="KLLA0_D04400g"
                     /note="highly similar to uniprot|P39111 Saccharomyces
                     cerevisiae YGR020C VMA7 Vacuolar H ATPase subunit F of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453258.1"
                     /db_xref="GeneID:2893509"
                     /db_xref="GOA:Q6CS31"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:Q6CS31"
                     /translation="MADERNLIAVIADEDTTTGLLLAGIGQVSKESKEKNFVVYNEGK
                     TTKLELSDAFVKFTETRPDIAILLINQHIADQIRPLVDGYTNAFPAILEIPSKDHPYD
                     PEKDSVLRRVRRLFGE"
     gene            complement(<374631..>376199)
                     /locus_tag="KLLA0_D04422g"
                     /db_xref="GeneID:2893348"
     mRNA            complement(<374631..>376199)
                     /locus_tag="KLLA0_D04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453259.1"
                     /db_xref="GeneID:2893348"
     CDS             complement(374631..376199)
                     /locus_tag="KLLA0_D04422g"
                     /note="some similarities with uniprot|Q12114 Saccharomyces
                     cerevisiae YLR330W CHS5 Protein of unknown function
                     involved in chitin biosynthesis by regulating Chs3p
                     localization also involved in cell fusion during mating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453259.1"
                     /db_xref="GeneID:2893348"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:Q6CS30"
                     /translation="MVEVSLTVGKVDASLAILTTADHYVIEFPTVLLPESVEAGSVVT
                     ITVEQDLEQEIKQKKKFQSVQEQILAKYGTDPPAEPVLHLSNATQTSCVIHWDPIHLG
                     SSQLKSLILYKQGNRHQVITPGSNRDGTTDNNSLKISGLSVDFEYEFKLLLNTTSGKF
                     WSNTLKVHTHKMTDMSGITACVGPNTKLGDNISLDQIKRSLQNIGAKPLQDHVTLETT
                     HFIATEFEDSEGVTSDEELAHARDNNIPIVRPEWIRACELEKRIVGVRDFYLDSDPSN
                     FLNYKFTAAAPSSGDALKETAPEREPEQATSPDGTETTAKEVEVVEPIVPEETQPAPE
                     ENAPVVQEETELIVQEETEPAVQEEPESVVPEETEPAVSEVTPPQEAQEASKKVEEEP
                     ETLSSHEEPEAATPPTDQPQVLKQEEEEEAPASEAPTVGEEINVEASVEEVPVEVPAE
                     EQPTEIIDNTANETIEETAPTPLEAGETEADLTQPQTEETSPEAVDVTKESQTGANNT
                     NTKKKNKKKKKGKK"
     gene            <377424..>379379
                     /locus_tag="KLLA0_D04444g"
                     /db_xref="GeneID:2892714"
     mRNA            <377424..>379379
                     /locus_tag="KLLA0_D04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453260.1"
                     /db_xref="GeneID:2892714"
     CDS             377424..379379
                     /locus_tag="KLLA0_D04444g"
                     /note="highly similar to uniprot|Q00711 Saccharomyces
                     cerevisiae YKL148C SDH1 Flavoprotein subunit of succinate
                     dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which couples the
                     oxidation of succinate to the transfer of electrons to
                     ubiquinone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453260.1"
                     /db_xref="GeneID:2892714"
                     /db_xref="GOA:F2Z614"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:F2Z614"
                     /translation="MLRTVRGRRVGLAQANFKSLVQARKFSSQMVLRQTISANGDING
                     QQQEAGSSSSHGYNIIDHEYDCVVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHT
                     VAAQGGINAALGNMHKDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHFGV
                     PFSRTEEGRIYQRAFGGQSKEYGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFF
                     IEFFAMDLLTHNGEVVGVMAYNQEDGTIHRFRAHKTIIATGGYGRAYFSCTSAHTCTG
                     DGYAMVSRAGFPLQDLEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAP
                     TAKDLACRDVVSRAITMEIREGRGVGPEKDHMFLQLNHLPPSVLHERLPGISETAAIF
                     AGVDVTKEPIPILPTVHYNMGGIPTKWNGEALTIDEETGEDVLIPGLLACGEAACVSV
                     HGANRLGANSLLDLVVFGRAVAHTIADTLQPGLPHKPLPADLGKESIANLDKLRNATG
                     HRPTADIRLAMQKTMQKDVSVFRTQASLDEGVKNINAVDKTFVDVGTTDRSMIWNSDL
                     VETLELQNLLTCATQTAKSAAERKESRGAHAREDYPERDDVHWMKHTLSWQRDTGDDV
                     VLKYRKVIATTLDEKECPPVPPTVRAY"
     gene            <380305..>381462
                     /locus_tag="KLLA0_D04466g"
                     /db_xref="GeneID:2893325"
     mRNA            <380305..>381462
                     /locus_tag="KLLA0_D04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453261.1"
                     /db_xref="GeneID:2893325"
     CDS             380305..381462
                     /locus_tag="KLLA0_D04466g"
                     /note="similar to uniprot|P24309 Saccharomyces cerevisiae
                     YKL149C DBR1 RNA lariat debranching enzyme involved in
                     intron turnover required for efficient Ty1 transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453261.1"
                     /db_xref="GeneID:2893325"
                     /db_xref="GOA:Q6CS28"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CS28"
                     /translation="MKRLQVAIQGCAHGQLQHIYDSLKTLKTKPDILLILGDFQSLLT
                     KYDYKTCAIPPKYAKLGDFHKYYTGQLEAPILTIFIGGNHENMGQLTKIPHGGYIAKN
                     IFYMGACNVITLMGVRMAGISGIYNEFDHLRERPDWDQIDWNREKRSTYHVRDSEIVP
                     LAMMRERISLVMSHDWPTSIAKHGDLKKLLKQKPYFRDEINDNSLGSPLNWYLLKRLK
                     PIWWASAHLHVRFEATYKHDHKVNNDEIDLDIDLDLDSDLDLKPGISTQATSTKINTT
                     TKFIALDKCKGGNSFRHLTEITIDYDENHPTCQDRALYWDPEYLANLKYCLSIKDSLK
                     GKDLQQIPVDELQSNVEVGHVEDWSKYRIPVPQSYRSVIKQTEYVTEKFLQ"
     gene            complement(<381861..>382751)
                     /locus_tag="KLLA0_D04488g"
                     /db_xref="GeneID:2893331"
     mRNA            complement(<381861..>382751)
                     /locus_tag="KLLA0_D04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453262.1"
                     /db_xref="GeneID:2893331"
     CDS             complement(381861..382751)
                     /locus_tag="KLLA0_D04488g"
                     /note="similar to uniprot|P36060 Saccharomyces cerevisiae
                     YKL150W MCR1 Mitochondrial NADH-cytochrome b5 reductase
                     involved in ergosterol biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453262.1"
                     /db_xref="GeneID:2893331"
                     /db_xref="GOA:Q6CS27"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /translation="MFARLSRSNKFLPIALGVGAASIATAIILQRNYSIMNDTSKAFL
                     GDNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNVIRPY
                     TPVSDNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDSITL
                     LGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVKI
                     TYFVDKAEGNFEGETGFITKDYLSHQAPKPSEKNQVFVCGPPPFMKAYSGPKVSPQDQ
                     GELTGILAELGYSKSNVFKF"
     gene            <383229..>384221
                     /locus_tag="KLLA0_D04510g"
                     /db_xref="GeneID:2893066"
     mRNA            <383229..>384221
                     /locus_tag="KLLA0_D04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453263.1"
                     /db_xref="GeneID:2893066"
     CDS             383229..384221
                     /locus_tag="KLLA0_D04510g"
                     /note="similar to uniprot|P36059 Saccharomyces cerevisiae
                     YKL151C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453263.1"
                     /db_xref="GeneID:2893066"
                     /db_xref="GOA:Q6CS26"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR017953"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6CS26"
                     /translation="MLGLKSHHKELIKLSRNCVPKLTPQLYKGQCGKICVVGGCEEYT
                     GAPYFSAHAASIFGSDLVYLLCEKRAGLPIKGYSPNLMVHPYLGDTYSSTHGFQFEFE
                     KVASVVQRCHVLVVGPGLGRDEQIMQEVLQLVEEAPSLGDDNDRCLVLDADGLFLLAS
                     ENHTERMQKALKGYGDNRVVITPNAVELKRIMNALNVDSVEKVSEKLGCITVAKGQND
                     IIVNSQGERWENDVQGSMKRCGGQGDTLTGIIATMFGFSRAVHDFKLETIVEEGNGEN
                     LPWSKMAMLSCFIGSTATRMASRAAYDKVGRQLQTTDMNNMVGEVFNELYPPSQ"
     gene            complement(<384354..>385445)
                     /locus_tag="KLLA0_D04532g"
                     /db_xref="GeneID:2893364"
     mRNA            complement(<384354..>385445)
                     /locus_tag="KLLA0_D04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453264.1"
                     /db_xref="GeneID:2893364"
     CDS             complement(384354..385445)
                     /locus_tag="KLLA0_D04532g"
                     /note="similar to uniprot|P32910 Saccharomyces cerevisiae
                     YNR003C RPC34 RNA polymerase III subunit C34 interacts
                     with TFIIIB70 and is a key determinant in pol III
                     recruitment by the preinitiation complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453264.1"
                     /db_xref="GeneID:2893364"
                     /db_xref="GOA:Q6CS25"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:Q6CS25"
                     /translation="MRRGMVQLIELIIDERVRRLTNLQTDLLNHYLGLPLLLLGTQTV
                     YFPSKPIMNSLFNSTIKLSDPARELHEKMCSQETGKLFSQKELTSMLDNCSLSDLMQY
                     VQELLDKNLLKLVKQNKELKFQAVDAAEAEKKSGMSSDEALVYSYIEASGREGIWTKT
                     IKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPSIDVTGGPWFTD
                     SELDVEFINSLLTIVWRFTAERTYPNGFNNFSDENGRDALYSSNVKSYTTIEEILEFI
                     SESGISTEQLTKPDIRSLCEVLVYDDKLEKVSFDCFRVTLQSVLQMTQPVGGQQSSKR
                     EEYSIFSHGNSMAASSSDKDVLYFDEWTL"
     gene            complement(<385733..>388801)
                     /locus_tag="KLLA0_D04554g"
                     /db_xref="GeneID:2892892"
     mRNA            complement(<385733..>388801)
                     /locus_tag="KLLA0_D04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453265.1"
                     /db_xref="GeneID:2892892"
     CDS             complement(385733..388801)
                     /locus_tag="KLLA0_D04554g"
                     /note="similar to uniprot|P25371 Saccharomyces cerevisiae
                     YCR011C ADP1 Shows homology to ATP-dependent permeases
                     Active transport ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453265.1"
                     /db_xref="GeneID:2892892"
                     /db_xref="GOA:Q6CS24"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CS24"
                     /translation="MVAYRYLPSLFSFLWLVAYVSSEIIGQETSFRPGTLPERGGKKP
                     NNDQCPPCFNCMLPMFECKQFSECNSYNGRCECLEGFGGDDCSVPLCGALSDDNSKRP
                     MRSNETNTCECSPGWGSINCNVCQEDSVCDAFMPSGLKGTCYKNGMIVNQFHQGCNVT
                     NTKIVEILKGAIPQVTFSCNKTSELCNFQFWIDQVESFYCGLDTCAFEYDLQKNVSHY
                     KCENVKCKCVPGEMLCGRKGSIDISDFLTETIKGPGDFSCDLETKKCKFSEPSMNDLI
                     LTVFGDPYITLKCESGECVHYSEIPGYKIPDKDRLSTSSILVLVLSSVGIFAVASIAI
                     YFISKSPIFSNGPIKLSDGDDEDDFDLFKTNSSATLTFENITYEVSPAKNVTADVLNE
                     VTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIG
                     FVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEELRIFDIRDRVIGS
                     EYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHYNKT
                     LVLSIHQPRSSIFQLFDKLVLLSNGKMVYSGDAHKVNEFLKNEGYACPPDYNIADYLI
                     DVTFEPSKFVTRANIDDLEATLPTTEGLNPVHRVEPHRRSLTGSPTQTEWEHLALHRD
                     EFRDLLSQSENEGQTVGDVNTHLLHSLFKDGAYFQKLKFEINEILSAGINEELRIPQA
                     YKAATFLQQLSILSSRTFKNVCRNPKLLLGNYVLTVALGLFLGILYYNVENDISGFQN
                     RLGLFFFILTYFGFLTFTGLSSFSLERLIFIKERSNHYYSPLAYYISKILSDIIPLRV
                     VPPILLGLILYPLVGLNMNDNGFFKFEGILILFNLAISLEILTVGIIFEDLNNSIIIS
                     VLIILGSLLFSGLFINTKDINNILFKYLKNLSVFYYAYESLIINEVKSLVLREKKYGL
                     NIEIPGATILSTFGFIVQNLVFDVKILALFNVIFLIFGYFALKLIVIEQK"
     gene            complement(<389302..>390309)
                     /locus_tag="KLLA0_D04576g"
                     /db_xref="GeneID:2893498"
     mRNA            complement(<389302..>390309)
                     /locus_tag="KLLA0_D04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453266.1"
                     /db_xref="GeneID:2893498"
     CDS             complement(389302..390309)
                     /locus_tag="KLLA0_D04576g"
                     /note="similar to uniprot|P43599 Saccharomyces cerevisiae
                     YFR018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453266.1"
                     /db_xref="GeneID:2893498"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6CS23"
                     /translation="MLFVWFLLQLWFLQGCVCEFPFKSYYDSTLADLMSINETYSGPL
                     LSPFNKTRVPGSKGSKEVQEFVLDEFKSMNQNWAVELQNFEENGYEFTNMIFSLGSND
                     SYLALAAHYDSKLEPDGFIGGIDSAAPCAMLLYLSHFIDDVITEDLSVIDPTLLGQFT
                     GVKIIFFDGEEAFKEWTSTDSLYGSRHAAAKWEKDGTLDKMDLFVLLDLLGGKESITV
                     PNYTKAARAFYKNLLQIERTYNKFYGASDKIFQSSVSNNIRISDDQEPFFTRGVKTLH
                     LIPFPFPSSWHTLADDYAHLDEKHIHKWCIIMCEFIIKYWNPDKVPLHPFKPVIQEIT
                     S"
     gene            <390602..>396766
                     /locus_tag="KLLA0_D04598g"
                     /db_xref="GeneID:2893499"
     mRNA            <390602..>396766
                     /locus_tag="KLLA0_D04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453267.1"
                     /db_xref="GeneID:2893499"
     CDS             390602..396766
                     /locus_tag="KLLA0_D04598g"
                     /note="similar to uniprot|P34756 Saccharomyces cerevisiae
                     YFR019W FAB1 1-phosphatidylinositol-3-phosphate 5-kinase
                     vacuolar membrane kinase that generates
                     phosphatidylinositol (3 5)P2 which is involved in vacuolar
                     sorting and homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453267.1"
                     /db_xref="GeneID:2893499"
                     /db_xref="GOA:Q6CS22"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q6CS22"
                     /translation="MSQSSRDMSLLPDMGDGSNSDDGTNDNRNSSNNNNSKPEIPDFM
                     TQKPLLSRTTTEVDTNPVLSDMQISAPIGLELTNERRESSNGDDVQDNRMTIRSNIAL
                     PLPKLTKDAETPNLHSESLQRTLTNDSTTDFDVLSKTDSENPSLGQGEQPKSLHFSLG
                     NSARTKRSSIYESKSTVTAIPIRTPSNSNRNIHAYNHPHSYSDRDDVVSMKSVSSSLT
                     ASFSRSFLFGFYDKKQKGKSKKKNILSKEYWMKDESAKECFNCAKPFTTFRRKHHCRI
                     CGQIFCSSCSFLITGESFGYSGRMRICGKCYEHSMNYEDSSEEESEEEIIHDQVSSRN
                     IDDDAPSLNNDDIQSILTNVDDHKVHISTPEPLPRMAIPATKQGESLEISFHSKANNH
                     GYRKSRPRRGTQDRYALHNLEKLSPIPQEHADSKHSPERSLLINKNSQHGHMRPSFSS
                     YLSQKNGSALRKDTPNNPNVMKTLANNNFKFEFNYDMNNFQSYLQKERQPAGLSESKQ
                     LPLLSNRYSSPNFQSGFESSDEGSEDEASMSLYTALNETHKHDKNRSLTMRNSTNSSQ
                     RAEASLQRMRQRRKSKSRPGPINNNGRGEFSFMNLSAPNLVTVVNNDLVFSKNQNPQL
                     QKQKYDSNSKDARKSILNSSTWRRISLDKREELNDVCKLHLEALLQQALTDQEIPGEG
                     DWIAIFNKMIGQIQGIPLDARKAGDLDFKQQHVKIKRLPGGSVLDSMILNGVLYSKGL
                     PLKTMPRVVMNPRILLIMFPLEYQKHNNHVISIESVVAQEKEYLKKLVLRLQSLNPDI
                     ILTGTSASGYALQLFQEVGIVVQCNVKPQVIERISRFTGCDIVITMDKLSSNIKLGTC
                     ERFEVRTYIYGNLSKNYTFITGCKTQAGITLVLRGNTSEVLRKVKDVAEFVAYAVFSM
                     KLESSFFNDNFLQLNIEAYKHIQLLKKQNESFTGFFADFIEKFNRRILSVSPIVEFPV
                     PYLLQKARDVEQQLIEKTALVKKLQDCAEILEYKDSIDLSKMQLETALTQRDFKYLIG
                     FINNKECDALKLQFETLKKKWEIYSSLSHNMLGTGPHQSISVLYSVISRKTTTPCIGP
                     EIVTIDFFWENDISIGQFIENVVATAFRPCADGCGGLMIDHYRSYAHGNGKLDVIIER
                     LQSKMPMLKNLILTWSYCKKCGLSSPTLQLSEKSWNYSLGKYLELMFWSSPKNINSIG
                     NCTHDVAKDHLKYFSLNDLVVRMEYSGIDVHELITPTATITWNPGKDIKLKVELYYQI
                     LEKIDAFYGSVLERLNKLKIDSINDLKLNEAKERIVQLKVLVEDEKSTLGANMETIYT
                     GLEGDQHLQLNSIVRALHDNAAGWDNEFVEFEKEFLPTEKDIARITALQLKKMFTDFN
                     KMTEDNGIKEINGEDAEAEEKSKCMDTTSEEQRSDEESDASPPKPKSVQNAELPLIKS
                     ATTNTFSEETIGKVTGPRKQSMTSSLDRNLIRKNSNNSTYTQSSKDRNSDTKVGQLAN
                     FFDQIHFDSVTREFELQREMERLHMNKTKYQAMRAKSLKPLVEIYKNVQDAVEEPINV
                     DKGAKNQNSLVNSDNTQGTYDTAKPLNKGLENELEQSINQWSERVLQNQTGDQPVDIT
                     AKPSNEPLPPVTTITNANKDGTKLETQHVVMPSQKSSLLTTLSNFWADRSASFWKPLT
                     YPTSPTEHIFMDNNVIIREDEPSSLIAFCLSSNDYQRKVTAMIRNVRQTPGSFDSQNG
                     KPDLNTLKTESMETKLDADSHEISCKASNTDLEMIMTKKTGMHLRYQFQDGNTIMSCK
                     IFFFEQFDAFRKKCGCGEENFIQSLSRCIKWDSSGGKSGSAFLKTLDDRFVIKELSHS
                     ELDAFINFSSSYFEYMSQALFHDLPTALAKILGFYQIQIRNAATGKSFKMDVIIMENL
                     FYEKKTSRIFDLKGSMRNRHVEQTGKENEVLLDENMVEYIYESPIFVREYDKKLLRAS
                     LWNDTLFLAKMNVMDYSLVVGVDNQTHSLTVGIIDCIRTFTWDKKLESWVKEKGLVGG
                     STKEPTVVTPRQYKNRFREAMDRYILMVPDPWYQDTET"
     gene            complement(396972..397066)
                     /locus_tag="KLLA0_D04620r"
                     /db_xref="GeneID:9487368"
     tRNA            complement(join(396972..397017,397029..397066))
                     /locus_tag="KLLA0_D04620r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:9487368"
     gene            <397818..>399320
                     /locus_tag="KLLA0_D04664g"
                     /db_xref="GeneID:2892881"
     mRNA            <397818..>399320
                     /locus_tag="KLLA0_D04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453268.1"
                     /db_xref="GeneID:2892881"
     CDS             397818..399320
                     /locus_tag="KLLA0_D04664g"
                     /note="similar to uniprot|P43601 Saccharomyces cerevisiae
                     YFR021W ATG18 Phosphatidylinositol 3
                     5-bisphosphate-binding protein of the vacuolar membrane
                     predicted to fold as a seven-bladed beta-propeller
                     required for recycling of Atg9p through the
                     pre-autophagosomal structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453268.1"
                     /db_xref="GeneID:2892881"
                     /db_xref="GOA:Q6CS21"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MSNLPIINFINFNQNGSCISMGTSQGFKIFNCEPFGRFYQDEEG
                     GCGIVEMLFSTSLLAVVGMGDNPAMSPRRLRMLNTKRHSVICEVTFPTTILSVKMNKS
                     RLAVLLQEQIYIYDISNMRLLHTIETSMNAQGIMSMSPNSENNYLVYPSPPKVINSEI
                     KDHATTNNINIKKTDAVDDTIKKDYSLQVPSDITGQQQQQQPGVDPATSNNTANKIIK
                     NGDVIVFNLQTLQPTMVIEAHKGEIAALKLSADGTLLATASEKGTIIRVFNVENGSKV
                     YQFRRGTYPTKISSLSFSKDNQFLAVCSSSKTVHIFKLGKNTVDNKSNELNSDDEIED
                     DLVPRYGDEDEEDEEIDEEATSINSNHSSKEPVVDAKRSTVGRMIRKSSQRLSRKAAR
                     TLGAYFPIKVSSILEPSRHFASLKITTSSNQPIKAIAAIDDPIELSIKEYPDLFEKNA
                     SNNGDYQNSDTLTMVPIRVVSSEGFMYKYISDPERGGDCILLEQYSLLSD"
     gene            complement(<399588..>399950)
                     /locus_tag="KLLA0_D04686g"
                     /db_xref="GeneID:2893318"
     mRNA            complement(<399588..>399950)
                     /locus_tag="KLLA0_D04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453269.1"
                     /db_xref="GeneID:2893318"
     CDS             complement(399588..399950)
                     /locus_tag="KLLA0_D04686g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453269.1"
                     /db_xref="GeneID:2893318"
                     /db_xref="UniProtKB/TrEMBL:Q6CS20"
                     /translation="MVPVGRLNGISSRIDGSVRKMKNPPQKNEGSLDDPVGISDSPGY
                     LYMYRGAFAPTTLSNPHTVYVTCQGAYCIGGHLIPCERLCKALLFIIKPRAKKPNNVC
                     SGPICETLLVPVQVPRPA"
     gene            <400541..>402895
                     /locus_tag="KLLA0_D04708g"
                     /db_xref="GeneID:2893338"
     mRNA            <400541..>402895
                     /locus_tag="KLLA0_D04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453270.1"
                     /db_xref="GeneID:2893338"
     CDS             400541..402895
                     /locus_tag="KLLA0_D04708g"
                     /note="similar to uniprot|Q759V0 Ashbya gossypii ADR172C
                     ADR172Cp and weakly similar to YOR018W uniprot|Q02805
                     Saccharomyces cerevisiae YOR018W ROD1 Membrane protein
                     overexpression confers resistance to the GST substrate
                     o-dinitrobenzene as well as to zinc and calcium contains a
                     PY-motif which is required for Rod1p interaction with
                     Rsp5p a hect-type ubiquitin ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453270.1"
                     /db_xref="GeneID:2893338"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6CS19"
                     /translation="MKKTSRSLSLFDIRLEGTDHDVIVVKGTVDEAPSVLLSGSVVLS
                     VREPIYAKKISLTLYGVIKLNVTTMVQGPRGPAPRNVKYDRRFYELSLDDIDLHPHLV
                     DGSTVKKPLSRTNSSSSLGGLASLSTTSLKNFASSASHASVLPEGNYVFPFSTILPGS
                     LTESVEGLPNATVFYKLQATLERGKFASDISTKKHVRVVRTLTPDALELFETVAVDNT
                     WPQKVDYSISVPSKAIAIGSSTPINIMVVPLLKGLKLGPIKISLVEYSSYSAPYSNPN
                     GADRTILKVKIQDPLHHINNGEYDATNTTEFDFQDKWEINTSVRIPPNLSKCVQDCLI
                     LTNIKVRHKLKFVIALVNPDGHISELRASLPVQLFISPFVTVAVRNADNVDTNTSNSG
                     NNTDNEALEKDDLMFAHSNSEVNLNSVDIALNNDASAGPNTSLFAPPNYGNHVYDRLW
                     NNIMVEDTPVNSGTQSPAEFNQPPTLSHSSDVSELQRSLQQLRLEREMEEPDGSGLNL
                     DTQVPSRSALATPLSLQDVPSQLRVNDYFTLNSSNRNNHSVLNVPSHLRSPSQMDSPG
                     FDYLSRANSFEFKAGSPSRNDWEISSLSRVPSYDNAMKTASTMGELPPAYPSDGDALN
                     GGSTTFSVGSLERPKELHHRCQPEMHHCAHSKISPSMLINQSNQSSNSLTHMYADHHE
                     RELEDSQTTKHAGRPFLAKSTSTSALKNTASKHFGFSMTPLSHIARSATPPAKFSPLS
                     NSSNGIQTPKAVSNRNKVTSGSNKHQSFGSFTGILHKKDIDNEQ"
     gene            403068..403139
                     /locus_tag="KLLA0_D04730r"
                     /db_xref="GeneID:2893286"
     tRNA            403068..403139
                     /locus_tag="KLLA0_D04730r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2893286"
     gene            <404281..>405737
                     /locus_tag="KLLA0_D04752g"
                     /db_xref="GeneID:2893287"
     mRNA            join(<404281..404340,404457..>405737)
                     /locus_tag="KLLA0_D04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453271.2"
                     /db_xref="GeneID:2893287"
     CDS             join(404281..404340,404457..405737)
                     /locus_tag="KLLA0_D04752g"
                     /note="similar to uniprot|P25604 Saccharomyces cerevisiae
                     YCL008C STP22 Component of the ESCRT-I complex which is
                     involved in ubiquitin-dependent sorting of proteins into
                     the endosome homologous to the mouse and human Tsg101
                     tumor susceptibility gene mutants exhibit a Class E Vps
                     phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453271.2"
                     /db_xref="GeneID:2893287"
                     /db_xref="GOA:Q6CS18"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:Q6CS18"
                     /translation="MSDIHIPQPVLDWLFKVLQPTYSDPRSTFHDVVQVLASFQLRPR
                     TRVFTFPDGSSALLLSLYGTLDGVPIIVWIPKQYPVTVPYIYLDLNSLTGDLKIQVNQ
                     YLDISGQFFLPIFGAWSGQPGSLLQAIHQLLEIWHNYYPLFDATSMNAPPLPAKTNEG
                     LLKIESEVQQLPPKLNHHVPIIDASNNLKPVETGLQQLPPPIPKRPSVPTSSQQVDVN
                     CPISPPFGEYGNFVSSSAGPTLKDESPRIGSQTMIPNSAAEPKQETTFTFELPPDLID
                     DVTEIKSHSTHNELLHKLYELIDKLAVQDMINLKNYIGSHSFNIDAILTKYSSHKSYE
                     KDLIERVKHSIAENTTAITHEMKKLDEEMEKAKELENSIDPASIAIPETPAFVQLYNL
                     VARDHALNDAIGTVSQLFHREKISLNIMLRKTRELSFEQFKTRYLISKINDLLD"
     gene            <406024..>408846
                     /locus_tag="KLLA0_D04774g"
                     /db_xref="GeneID:2893293"
     mRNA            <406024..>408846
                     /locus_tag="KLLA0_D04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453272.1"
                     /db_xref="GeneID:2893293"
     CDS             406024..408846
                     /locus_tag="KLLA0_D04774g"
                     /note="some similarities with uniprot|P25386 Saccharomyces
                     cerevisiae YDL058W USO1 involved intracellular protein
                     transport coiled-coil protein necessary for protein
                     transport from ER to Golgi Integrin analogue gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453272.1"
                     /db_xref="GeneID:2893293"
                     /db_xref="UniProtKB/TrEMBL:Q6CS17"
                     /translation="MDELEYTGGKICGRLLPEGTSNNGETNEEQDLQEITDLSGVNET
                     LLSFEPFCPTLIDMPKRPGWLKRTIKSAGSTISKMRGSSSKPNRVTEKQKLTKNATQP
                     LATYHMNDITLSAMKSEESKPVSEEVEILSYSSVRSGFDNPPPLSATCDAHSANVIDE
                     SKIDSSSATAVDVNEMSENQHLGKKKDETKDKQDFCGDGNTRLSKIEKLLQNDRESKT
                     YVEKCSKFAKYYMESVKFRYEDLEKECIFDPNVFNINEPSPLQKFKDAENKEKIISDP
                     ESPAFCVENDHESSKVQLRRKVGFVAQDGHEIQLFDSNLPPCTTERNKNHTIPPTSNG
                     VLSTSNRIFKYTDSYNKFEDVTKLGPVPFPDLSLKERMTALFELVGAPEELKECNDLR
                     LSLTCLHPCLAKILGFLWRNINVGLKENNHLRNMVKRLEKQRLIDSTAHESKQEEFSK
                     LTTIHVQKLNDLERTLQEVEVQYSRQKAHNNSSLELVNTAMEGMTGVLNLFFSQEFYE
                     EWQKDTKDRIDSLMVYLNDICQYFSTMQTEMILKLEHNAEMNELTERCEFYTENCSLL
                     ERENESLKAVASAYRQLQDIVTEKNIIISSLEVENRSLKKQVETKAKDLELLSVKHER
                     EIAKLKDLSKAERGRILKVWDRTDYEKALDSKEEEIVKLNHRISLLDLIIDNKVTEIK
                     NNESRYRGLETKVAILSNENIVLKSKHDEVIKKKKEDLAFFNEKFQKRLLAMKREIDK
                     NADMYHNELQSYRTNYEKTLSSALKVTLKAESALSAIYSNNVDRFGSTNRTLNYFMKK
                     RDMFQNIRDNMVSNKPKPEYKPAITITSVSDGIENKDNRNEELHYISEQKQGFNDSLR
                     ELKVANVNSNCSSRSKHNAKQIIQKLREWKQNQNTSELSPDKEDSIFSTGIETDYSTS
                     NIAQLSTRNWASALKNNYNAKYLESI"
     gene            <409305..>410729
                     /locus_tag="KLLA0_D04796g"
                     /db_xref="GeneID:2893295"
     mRNA            <409305..>410729
                     /locus_tag="KLLA0_D04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453273.1"
                     /db_xref="GeneID:2893295"
     CDS             409305..410729
                     /locus_tag="KLLA0_D04796g"
                     /note="uniprot|O13473 Kluyveromyces lactis CBF5
                     Centromere/microtubule-binding protein CBF5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453273.1"
                     /db_xref="GeneID:2893295"
                     /db_xref="GOA:O13473"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /translation="MSDEFVIKPESVSPSSNTSEWPLLLKDYDKLLVRSGHYTPIPAG
                     ASPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCVDRATRLVKSQQGAGKEYVCIVRLHDALKDEKELGRGLENLTGALFQRPPLISAVK
                     RQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALSENDNLVTLHDVMDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAK
                     VKRCIMERDLYPRRWGLGPIAQKKKQMKADGKLDKYGRANENTPETWKKTYVSLENAE
                     PTTAPASKSEEKPLIKEVEKKEVEQKEESKEESKTPEEKKDKKEKKEKKDKKEKKEKK
                     EKKEKKRKADDDESSEKKKKKSKK"
     gene            complement(<411615..>412679)
                     /locus_tag="KLLA0_D04818g"
                     /db_xref="GeneID:2893163"
     mRNA            complement(<411615..>412679)
                     /locus_tag="KLLA0_D04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453274.1"
                     /db_xref="GeneID:2893163"
     CDS             complement(411615..412679)
                     /locus_tag="KLLA0_D04818g"
                     /note="similar to gnl|GLV|CAGL0H03707g Candida glabrata
                     CAGL0H03707g and some similarites with YNL007C
                     uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1 HSP40
                     family chaperone sit4 suppressor dnaJ homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453274.1"
                     /db_xref="GeneID:2893163"
                     /db_xref="GOA:Q6CS15"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CS15"
                     /translation="MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEK
                     FKEISEAFEILSDAQKREVYDTYGLEAARGNAPQFGGAGGPGGPGGPGGFSSGGFAGG
                     HAFSQDDAFNIFSQFFGGGGAAGGASPFGFSASGGSGDDFGFGGSSFHSSSGGMPGGM
                     PGGMPGGMPGGFSRQQARPEEEVVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKNQ
                     IDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTLPL
                     SFKESLLGFSKQVQTIDGKTIPITRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLIIKF
                     KIDYPTSLTPQQRQAIMDNF"
     gene            <413362..>414273
                     /locus_tag="KLLA0_D04840g"
                     /db_xref="GeneID:2893311"
     mRNA            <413362..>414273
                     /locus_tag="KLLA0_D04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453275.1"
                     /db_xref="GeneID:2893311"
     CDS             413362..414273
                     /locus_tag="KLLA0_D04840g"
                     /note="highly similar to uniprot|P41318 Saccharomyces
                     cerevisiae YNL006W LST8 Protein required for the transport
                     of amino acid permease Gap1p from the Golgi to the cell
                     surface component of the TOR signaling pathway associates
                     with both Tor1p and Tor2p contains a WD-repeat"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453275.1"
                     /db_xref="GeneID:2893311"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CS14"
                     /translation="MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDK
                     KYLAAAGHLHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW
                     DVRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNT
                     PLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSAD
                     VKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRL
                     WDLSTSEIVRQYGGHHKGAVCVALNDV"
     gene            complement(<414872..>417331)
                     /locus_tag="KLLA0_D04862g"
                     /db_xref="GeneID:2893149"
     mRNA            complement(<414872..>417331)
                     /locus_tag="KLLA0_D04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453276.1"
                     /db_xref="GeneID:2893149"
     CDS             complement(414872..417331)
                     /locus_tag="KLLA0_D04862g"
                     /note="some similarities with uniprot|P48743 Saccharomyces
                     cerevisiae YLR176C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453276.1"
                     /db_xref="GeneID:2893149"
                     /db_xref="GOA:Q6CS13"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6CS13"
                     /translation="MSSQQDQWVNHHNTLLQLASASANSPMIPRPESSQSNINLSSSN
                     STAQLQHILQHSLYPPPPAAMAHLHNGTTVNNGNGSTSSNMQFTQGFLPNPLPPINDH
                     QLAGGQSSPQTSQGHQQQHQQHQQQNMMRSITPLSVISPNGVVSALPNQVLHYQHMQD
                     MHLQQQQQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQQHQHQQHQHQQHQHQQQQQQ
                     QQFILQDQDQRWKKQKVDEAMQPVRTGAAVTSKRTTQENILKLVAMKNKDKPLSEYAS
                     VVRNAEIQVLNMDTSTHAKSEIQSAEQHRERERQVYALIWLMSNCVTDTESYVRRGRI
                     FAQYAASCAQNQLKPLSQATLGKLIRALFPFLKTRRLGMRGQSKYHYCGLKLVSPFAT
                     SSDLTPTGSSNSDTSSAMLSTSGTTSSHSNNENSISLKYEGDSQHSIDSQSDHSNGIK
                     SIQPNAMLGKQSSVSDPLNQLSEDISLDVTGNIQGHDAGVKPVLSAETSFNTCYDEGY
                     ALLPDFFAVTSEAKVELPIEFPDLQKFLPVNQSVDPDIASSVNSLYQVYCNTLFENIR
                     FMKFDDLPLTLQSFSSSSISSKMYNLFISEELYRWVHQSDLLTHKALTKMLSSLIVDF
                     NEIPEVVFNKLSDFSNEYMKMVEQSTMDLPLPMVTFKKSVAQAFCRLVKRLVKVIDNS
                     KKLSNIMSKQENRLSMLYVWEQNVKVSELINQEFSYFNHPALEKDMQELFSVQLLELL
                     KKTDEDFDLISFVKMVFGVLSNKSLPPRLLVLTFNSFTAACTKEILTNSNENFGLWWM
                     FKAFLDEWIFWYAEVGGFLKD"
     gene            <419435..>420391
                     /locus_tag="KLLA0_D04884g"
                     /db_xref="GeneID:2892740"
     mRNA            <419435..>420391
                     /locus_tag="KLLA0_D04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453277.1"
                     /db_xref="GeneID:2892740"
     CDS             419435..420391
                     /locus_tag="KLLA0_D04884g"
                     /note="similar to uniprot|P40693 Saccharomyces cerevisiae
                     YNL002C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453277.1"
                     /db_xref="GeneID:2892740"
                     /db_xref="GOA:P32102"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /translation="MSQPLNSNPEVLLRKRRNADRTRLEKQELAKKRKEQEEKQKRSK
                     KNRFVRAETIVATTLATEREKTRIRRVRDLENQKVKNDLSHIPSDRDFILRISEREAG
                     SKATSESELQDVDEEDEEDDGLIREKIVYDGEPSLLFVIRVKGPTAVKIPAKAYKVLS
                     LLRLVELNTGVFIKLTKDVYPLLKLVSPYIVIGQPSLASIRSLIQKRSRIMWQRPEDK
                     EPKEIILNDNNIVEEKLGDEGVICIEDIIHEISTLGENFSKCTFFLLPFKLNREVSGF
                     GAISRLNKLKMREQNKKTRQISNAATAPVIQVDIDSMISKLN"
     gene            <420903..>421991
                     /locus_tag="KLLA0_D04906g"
                     /db_xref="GeneID:2892896"
     mRNA            <420903..>421991
                     /locus_tag="KLLA0_D04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453278.1"
                     /db_xref="GeneID:2892896"
     CDS             420903..421991
                     /locus_tag="KLLA0_D04906g"
                     /note="highly similar to uniprot|P04173 Saccharomyces
                     cerevisiae YCL018W LEU2 Beta-isopropylmalate dehydrogenase
                     catalyzes the third step in the leucine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453278.1"
                     /db_xref="GeneID:2892896"
                     /db_xref="GOA:P23390"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /translation="MSKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLI
                     GGAAIDATGTPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYA
                     NLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKY
                     SVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQ
                     HQLIDSAAMILVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTN
                     KAFGLYEPCHGSAPDLPANKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG
                     VRTGDLGGSNSTTEVGDAIAKAVKEILA"
     gene            complement(<422549..>424042)
                     /locus_tag="KLLA0_D04928g"
                     /db_xref="GeneID:2892720"
     mRNA            complement(<422549..>424042)
                     /locus_tag="KLLA0_D04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453279.1"
                     /db_xref="GeneID:2892720"
     CDS             complement(422549..424042)
                     /locus_tag="KLLA0_D04928g"
                     /note="highly similar to uniprot|P25374 Saccharomyces
                     cerevisiae YCL017C NFS1 Cysteine desulfurase involved in
                     iron-sulfur cluster (Fe/S)biogenesis required for the
                     post-transcriptional thio-modification of mitochondrial
                     and cytoplasmic tRNAs essential protein located
                     predominantly in mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453279.1"
                     /db_xref="GeneID:2892720"
                     /db_xref="GOA:Q6CS10"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010240"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:Q6CS10"
                     /translation="MTMTLLRGVSVFSRRVPVAGGFGYLKRADISNVVLQGRTYASAK
                     VALAEDLTLETHTDNQAAAIEQANERAVSNPDVLDSGIHSLQHAYRESGEYGTRPIYL
                     DMQATTPTDPRVLDTMLKFYTGLYGNPHSNTHSYGWETNKEIEQARKYIADVIKADPK
                     EIIFTSGATESNNMALKGVSRFYKKTRNHIITTRTEHKCVLEAARAMKNEGYEITFLN
                     VDEQGLINLEELEAAIRPETCLVSVMAVNNEIGVMQPLKEIGELCRKRKVFFHTDAAQ
                     AYGKIPIDVNEMKIDLMSISSHKIYGPKGIGAIYVRRKPRVRLDPLISGGGQERGLRS
                     GTLAPPLVAGFGEAARLMMKEYENDSNHIKRLSDKLMNALLSIDHTILNGSADHRYPG
                     CVNISFAYVEGESLLMALRDIALSSGSACTSASLEPSYVLHALGKDDALAHSSIRFGI
                     GRFTTDEEIDYVIKAITERVDFLRELSPLWEMVKEGIDLNSIEWSGH"
     gene            <424550..>425374
                     /locus_tag="KLLA0_D04950g"
                     /db_xref="GeneID:2893435"
     mRNA            <424550..>425374
                     /locus_tag="KLLA0_D04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453280.1"
                     /db_xref="GeneID:2893435"
     CDS             424550..425374
                     /locus_tag="KLLA0_D04950g"
                     /note="similar to uniprot|P38921 Saccharomyces cerevisiae
                     YNL003C PET8 S-adenosylmethionine transporter of the
                     mitochondrial inner membrane member of the mitochondrial
                     carrier family required for biotin biosynthesis and
                     respiratory growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453280.1"
                     /db_xref="GeneID:2893435"
                     /db_xref="GOA:Q6CS09"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CS09"
                     /translation="MDSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG
                     GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVS
                     SSFGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTI
                     MREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKT
                     RIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVHSLF"
     gene            complement(<425543..>426661)
                     /locus_tag="KLLA0_D04972g"
                     /db_xref="GeneID:2892771"
     mRNA            complement(<425543..>426661)
                     /locus_tag="KLLA0_D04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453281.1"
                     /db_xref="GeneID:2892771"
     CDS             complement(425543..426661)
                     /locus_tag="KLLA0_D04972g"
                     /note="similar to uniprot|P25559 Saccharomyces cerevisiae
                     YCL016C DCC1 Subunit of a complex with Ctf8p and Ctf18p
                     that shares some components with Replication Factor C
                     required for sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453281.1"
                     /db_xref="GeneID:2892771"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="UniProtKB/TrEMBL:Q6CS08"
                     /translation="MSVNLYNKLEPETGYKLLQLSDDLLDAFQTGPVKFKALSDDAGN
                     VVLCSEDKTWVIKQRNHSNTVILMNEFAPTGGIPEDKINTFGLPRPGADWAGFSTLDS
                     ELEPRLVDGSIDVTQLDIYHGKDVPLTRKLTLQEFKDMCPCSEKEFVSKWFEVGGSVV
                     QGFACLLSERFMLKALHIILISCMAENLDVDSLSIDKVADVLAKDVKQGEPNLYTHEI
                     VTTVINKFGFKVESAETEPDDVRFRINMSLIARWYGVSALKKFAAKEPISEDEFMIQW
                     KGQFPPYFHCDLDICMLRGYFVRPLTNKIRYMSRTTLSLDAKERFKQLFHWQSTWEQA
                     DMVPYISDLNTKNLKIDTFIIKYARRKRVGNKVIISAR"
     gene            <427195..>431481
                     /locus_tag="KLLA0_D04994g"
                     /db_xref="GeneID:2892711"
     mRNA            <427195..>431481
                     /locus_tag="KLLA0_D04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453282.1"
                     /db_xref="GeneID:2892711"
     CDS             427195..431481
                     /locus_tag="KLLA0_D04994g"
                     /note="similar to uniprot|Q9HF61 Ashbya gossypii AAL016C
                     BUD3 Bud site selection protein BUD3 and weakly similar to
                     YCL014W uniprot|P25558 Saccharomyces cerevisiae YCL014W
                     BUD3 Protein involved in bud-site selection and required
                     for axial budding pattern localizes with septins to bud
                     neck in mitosis and may constitute an axial landmark for
                     next round of budding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453282.1"
                     /db_xref="GeneID:2892711"
                     /db_xref="GOA:Q6CS07"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR021895"
                     /db_xref="UniProtKB/TrEMBL:Q6CS07"
                     /translation="MDFFDQSSDISSQPQNSDSDWRIELPLNLLCDSVKDRDLLKRPD
                     DEWLTIFEKSVFFQGKDPLIWGSFLACVYLDPDTNKFGAFFIDKVGTTHFPNVNFHDN
                     SVYGPAVLNLSNRYKDSNVRKVLACSLLEKYATTDESIVQKITDGVPLKFEYDQTHSG
                     DLANGCKMVEYCTPGNLGKSIMLHGLICPRSVQSLLVDVVYENKPESIDANNELVFYL
                     GEQLEQLFDPLTEYSPEQTERVYTTPDFSPEEQTEKDEPLINSVCQELLTLQTNFTLS
                     IIEFLQKFLIPLRIDVLNEDIPTLSAAKLNRLFPPTIDEVTRINCIFLDALKSATPYG
                     SIEVLKACSVTVPYFYKAYSRHEAATKNFSKDIKLFLQKFKQVIPNSNTYTEMKIETI
                     IRGPQEKLMKIKLILERLWQCKTWSTPEIENDAQKNYTNIMEIVDSFGKLDSSTMSAY
                     NTRVFTPSGKILTELAKGWPLELQYKWLKRRIVGVFDVIDADNNSRRDLLVIFSDYIV
                     ILSIVDAEKYYSETDNKPLISDVLMNSLINEVALPSKIPKLQVVSHCYIDRILTSTTK
                     DNSIILTFLDPKQPESFVYKLASSKMKASHIEELCTKATILEKVTAFHLFKSNRCNFN
                     IYFTAHELEAYQNETIKSRFTLFLNCPPNIKQLEEHELDLAFFATLDTGKISLTKLTS
                     EGTSDNVEVTLDELVTVLTKELMSNYGKYTYSFKAPFYNELLRINEQLTKLIGHDFNL
                     VDIHDAPSIVTTPVVNDKTNGFQPVHKKDKSYGTITTFRSSVSDFKDNLLSNNAKSSK
                     ANKKFLKSNKDKSQTESKQSKRGGFISKLFSVFRKRKSPSKSQKRVVTKKDAGLARNI
                     SKDLPPISVPKKKGERVGSVIHNKNITPDPRPHSDNPYILSSSNSFKTVDSSEASCED
                     ANNVSALKNNAKPKSIYTQHQQARQSQVFNDDLFGDIVAPTSSVHDKNRADTIVQQDD
                     RTKDDGVKDTSVELSGGITPCSDVNNSFTSLEQNTRNVITIESTPTSITQVDKEQLEG
                     QPASSTYPSKDEDNTKSPIFPKINKYEIPKINFTKSPSFAELFKEMRMVLDESDEVVN
                     WRRLSSEVSLNEKYAIHIPTDKNLRSNKRLSAAVEVPEQDELSFHKDDVKSDQRTLDT
                     GVTLTKSSKLSGNFNVIKTSPVKIITRNELTMKRTSRSSNLNDDPPSFYTEDMSKNAR
                     LVELTFHSQEDLPESPFYTPQTEETKPSEHGHEETNVDHLVPPESTIKLPTETTNSQD
                     EPAPLLDDLEFSFFHMSFDNTNNTSTRESTMDTGDVFENKNVLPRKVAEPVFYKFDNF
                     TKSNESFFSAHDKVHPTAVENDDEPIWVSPSKLDMFDISNKSDTFFKSLQPPASKKAA
                     PKAAAFGALTDENNGKHDEPSFLRDSSYDYLGGVLAEDDETKPTRLQFSA"
     gene            complement(<431592..>433353)
                     /locus_tag="KLLA0_D05016g"
                     /db_xref="GeneID:2892889"
     mRNA            complement(join(<431592..432911,433342..>433353))
                     /locus_tag="KLLA0_D05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453283.2"
                     /db_xref="GeneID:2892889"
     CDS             complement(join(431592..432911,433342..433353))
                     /locus_tag="KLLA0_D05016g"
                     /note="similar to uniprot|P38922 Saccharomyces cerevisiae
                     YNL004W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453283.2"
                     /db_xref="GeneID:2892889"
                     /db_xref="GOA:Q6CS06"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CS06"
                     /translation="MSSYSRERSRSRSPVARSGNEDPRRGGYPDRSYRDDRRGNYSGD
                     NRRSEGYNRDTYSRDRDGDRYSGGRSVNRGYRSVGRDNGYENQGYNSGRYGRGRSSRY
                     DRGGAATAAAAAAKGDYGPKLARELDSPYDEKVNRNYANSIFIGNLTYNTTPEDLKEY
                     FGKIGEVRRADIITSRGHHRGMGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPP
                     PAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVT
                     DRDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDVKEGKGTSTRTAATGADTYI
                     PRQPRNEPPATLKPKPLDIDPLAITTGGDRNSVIFCENMPSSTTESDLYDLFGSVAPV
                     IITKLLLNPEGHFTRNSYCQFETPEDADICISKLDKYSYGDHELKVTYARF"
     gene            <433653..>435674
                     /locus_tag="KLLA0_D05038g"
                     /db_xref="GeneID:2892726"
     mRNA            <433653..>435674
                     /locus_tag="KLLA0_D05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453284.1"
                     /db_xref="GeneID:2892726"
     CDS             433653..435674
                     /locus_tag="KLLA0_D05038g"
                     /note="similar to uniprot|Q754A1 Ashbya gossypii AFR171W
                     AFR171Wp and weakly similar to YDR034C uniprot|P40971
                     Saccharomyces cerevisiae YDR034C LYS14 Transcriptional
                     activator involved in regulation of genes of the lysine
                     biosynthesis pathway requires 2-aminoadipate semialdehyde
                     as co-inducer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453284.1"
                     /db_xref="GeneID:2892726"
                     /db_xref="GOA:Q6CS05"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CS05"
                     /translation="MADTTPDTAVSNVTEPAKKKRKYSKNGCLECKRKKVKCDETKPM
                     CWQCTHLSLECVYKTKEFQFVVSGGPNKSRVNSKVTSVSDKKRKNKEDGDLHRKNMEH
                     HSSSDTRKLSNNERDVDFEHAATNAIGNDEDDLNALLNDALLFANDLFSKLPETDAVT
                     ANQGQQKSISSINDDIGGPVFNRWEEIEGMLGEVSKSELSYLKIFYDNVSYWLMPLAQ
                     SPDSNICNHILFQHVIRANKKHAREKSYLQSSMVSISAKYVYNVYGKEHDNIIRKHFL
                     RKALQQLYQEFESLSQESLGFSQIDSLNLCVLLLTLDSSTFGTQEWKFHLRGAKDLLM
                     KYNDNREMVTGSTGSTLLHRRTVTLARNWFCAIAIVACVAKGNHFFNEAEMEEMLDIG
                     SSDSSMSDNLMKQMGFISGNNYNTFLGYSKEGILLIKEVMKCLNADTGQDDNNDSFLN
                     VCSLLQASREYQFYPNTYGKVDTDNYSLIPSFTSDVASVVFHKLSVYSIYDSIHQTHV
                     ELLFVTYLLRSAKLPEDCSLVLNSCKRVWKMLEWMFSDCNLTIMEINMLTEQLEAGEI
                     YNYPSLREKLKFELTSRCIIVPMQKDFRLMMFQSSVILCAEKLILLDSNTLRLTRCKI
                     LAYFMTMAENLGAESAAISIAYLIRKWYPRPTTMLSQNEVDLADALPFS"
     gene            <436335..>437906
                     /locus_tag="KLLA0_D05060g"
                     /db_xref="GeneID:2892751"
     mRNA            <436335..>437906
                     /locus_tag="KLLA0_D05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453285.1"
                     /db_xref="GeneID:2892751"
     CDS             436335..437906
                     /locus_tag="KLLA0_D05060g"
                     /note="similar to uniprot|P53099 Saccharomyces cerevisiae
                     YGL186C TPN1 Pyridoxine transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453285.1"
                     /db_xref="GeneID:2892751"
                     /db_xref="GOA:Q6CS04"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:Q6CS04"
                     /translation="MKKSEVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPY
                     ERGTAKQFWHVAGLWLSAAGGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAA
                     YCSVMGPQSGCRQIVTARYLFGWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVSDG
                     KVPLWVGIIIVTVVSLLVSIFGIKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEF
                     SNSDIDSLTVKGCWLSFFSLCYSITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAV
                     PTTFVGVLGLLLASCSLSYEPWQAAYDEYGMGGLMNAGFSRWNGFGKFLVVVLILSLI
                     SNNIVNTYSAAFSIQLSSVMLAKVPRWIWAIGCTIFYLVCALVGRNSFSTILGNFLPM
                     IGYWISMYFILLVEENVIFRNWFHHLYKLEFPNDIEVKPHHKLRKLPRHIHRYNWDEW
                     DNSEVITRGLAASAAFCIGVAGVVLGMCQTYYVGPLAAKIGEYGGDLGMWLGMGFAGV
                     SYPPLRYCELKKFGR"
     gene            <438653..>439117
                     /locus_tag="KLLA0_D05082g"
                     /db_xref="GeneID:2893409"
     mRNA            <438653..>439117
                     /locus_tag="KLLA0_D05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453286.1"
                     /db_xref="GeneID:2893409"
     CDS             438653..439117
                     /locus_tag="KLLA0_D05082g"
                     /note="highly similar to uniprot|P04037 Saccharomyces
                     cerevisiae YGL187C COX4 Subunit IV of cytochrome c oxidase
                     which is the terminal member of the mitochondrial inner
                     membrane electron transport chain N-terminal 25 residues
                     of precursor are cleaved during mitochondrial import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453286.1"
                     /db_xref="GeneID:2893409"
                     /db_xref="GOA:Q6CS03"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="UniProtKB/TrEMBL:Q6CS03"
                     /translation="MLSLRQSLSKLFGPASRAFATTKVAGDQQVVKTATKLAEVNGAD
                     TLIGPGAKDGEVPTELDQATGLARLELLGKLEGIEVFDTKPLDSSRIGTMENPIIVES
                     YDDYRYVGATGSPAGSHNVMWLKPTDGQVARCWETGCVYKLKMVGVPQEGHH"
     gene            <440882..>441241
                     /locus_tag="KLLA0_D05115g"
                     /db_xref="GeneID:2892799"
     mRNA            <440882..>441241
                     /locus_tag="KLLA0_D05115g"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_453288.1"
                     /db_xref="GeneID:2892799"
     CDS             440882..441241
                     /locus_tag="KLLA0_D05115g"
                     /note="highly similar to uniprot|P39938 Saccharomyces
                     cerevisiae YGL189C"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_453288.1"
                     /db_xref="GeneID:2892799"
                     /db_xref="GOA:Q6CS01"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:Q6CS01"
                     /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNI
                     VEAAAIRDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQRPR
                     FNRDNKVSPADAAKKAL"
     gene            <441827..>443614
                     /locus_tag="KLLA0_D05137g"
                     /db_xref="GeneID:2892842"
     mRNA            <441827..>443614
                     /locus_tag="KLLA0_D05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453289.1"
                     /db_xref="GeneID:2892842"
     CDS             441827..443614
                     /locus_tag="KLLA0_D05137g"
                     /note="highly similar to uniprot|P15624 Saccharomyces
                     cerevisiae YLR060W FRS1 Beta subunit of cytoplasmic
                     phenylalanyl- tRNA synthetase, forms a tetramer with Frs2p
                     to generate the active enzyme; evolutionarily distant from
                     mitochondrial phenylalanyl-tRNA synthetase based on
                     protein sequence,but substrate binding is similar and
                     similar to gnl|GLV|YALI0E22979g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453289.1"
                     /db_xref="GeneID:2892842"
                     /db_xref="GOA:Q6CS00"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:Q6CS00"
                     /translation="MPTISVNKRQLFEALGKNYTNEEFDELCFEFGVELDEDTTEEAL
                     KTGEEPELKIEIGANRYDLLCIEGIAQSLNEFLGNVEAPEYKLSKPTTKLIIEESTTQ
                     IRSYACAAILRNVTFTEANYASFISLQDKLHSNLCRNRTLVAIGTHDLDTIKGPFHYR
                     AEKPTDIKFVPLNQSKEYDGAELIELYKQPEQKNNLGRFVHIIEDSPVFPVIYDDNNV
                     VCSLPPLINSEHSKISLNTKNIFIEVTATDRTKSEVVLDQIVAMFSRYCEDQFTVEPV
                     EIVSEHNNQSRVTPNFTPKIMDVKVDYINSCLGLTLSPEEISKNLKKMSLKATPSSDD
                     QNILHVEIPITRSDILHPCDIMEDAAIGYGYNNLPKGNQLSNANFVASALPINKISDI
                     LRIASSQASWLEVLPLTLCSHDENFKFLRMEDDNTKAVKLANPKTLEYQVVRTSLLPG
                     ILKTVKENRKHSLPIKVFEAGDVVFKNDKLERRAFNQRHWAAAYVGKTASFEIIQGLL
                     GKIMQTFRTQWLPDYGAGSTGRGYWIEKDDTLTTYFPGRGAKIMFRHKEGEEARQIGH
                     IGVLHPEVMSNFDIPYAGSYVEINSEAFL"
     gene            complement(<443727..>446465)
                     /locus_tag="KLLA0_D05159g"
                     /db_xref="GeneID:2893529"
     mRNA            complement(<443727..>446465)
                     /locus_tag="KLLA0_D05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453290.1"
                     /db_xref="GeneID:2893529"
     CDS             complement(443727..446465)
                     /locus_tag="KLLA0_D05159g"
                     /note="similar to uniprot|Q75BQ1 Ashbya gossypii ACR220C
                     ACR220Cp and weakly similar to YFL034W uniprot|P43564
                     Saccharomyces cerevisiae YFL034W Possible integral
                     membrane protein that interacts with Rpp0p which is a
                     component of the ribosomal stalk"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453290.1"
                     /db_xref="GeneID:2893529"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ9"
                     /translation="MSECHEDSEEDLGFALKELKLTKKLTSNQDGKDNKADMIESVGT
                     QSAAEEPNQTIYSSPESDGSEEEREEAVKEIAVRQADSSVDLRQQSQETGNVGKIIRE
                     EDENGSITDSDTSLEWQPMTTVASFDVYDENGELVLEGMNRTGSTLSLNEHSTPSQNQ
                     KSTFGYTKVDGEEQAQRSYLTNKRTDFLFNHKKLAVSSASLSMSLSRTSGTPDSQFLS
                     EDDEEEEAISSKNITTTDQLSITKDLLNDKEKFAYIACITVLVNEMCTRLVSIALSSH
                     NMTSKQKFAKRLQSLQKNMGHWRSLILNRLYAHLEIEPEEIKMLSRLSNDGIELSDLC
                     NCLKVTQHIDNPLAETSDIPELKTESKTDENIMTSKSLDIDVAWTIICDLFLLLVQDS
                     HYDARSRSLLINFAKVLNIDPLEICQFEKRVIEALELEQCTEDQVWDEKAHMDKRRKA
                     IKRKKLCYIGLATLGGSLVLGLSGGLLAPVIGAGFAAGLSTIGVTGAAGFLTGVGGTT
                     VVAVSSTAIGAKIGTTSMKRRMGSVRTFEFRPLQNNRRLNLILSVSGWMNGNEDDVRL
                     PFSTVDPINGDLYSLYWEPDMLRSTGQTMGILASEIVTQTIQQILGATVLTALMAAIQ
                     LPNILSKLGYLIDNPWNVSLDRAWAAGLVLADTLMAKNLGDRPITLVGFSLGSRVIYS
                     CLVELAKKGAIGIIENAYLFGSPVVYKRDEMILARSVVSGRFLNGYSNRDWILGYLFR
                     ATGGGLSTVAGISPINSVPDIENVDCSEIVDGHMSYRKKMPKLLKAIGMSVLSEEFVE
                     IEDPMDPEQVARQRKLVAELESAQEKLSDESHGKKKRKHKWLSKSSWFKPQKVEWQEM
                     YEQTLKDKTLGPEVNGDTEEGIATDVHKDQLIQEISKLKDEVQKDIDHSSRDIVEK"
     gene            <446903..>447755
                     /locus_tag="KLLA0_D05181g"
                     /db_xref="GeneID:2892759"
     mRNA            join(<446903..446914,447399..>447755)
                     /locus_tag="KLLA0_D05181g"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_453291.1"
                     /db_xref="GeneID:2892759"
     CDS             join(446903..446914,447399..447755)
                     /locus_tag="KLLA0_D05181g"
                     /note="similar to uniprot|P05749 Saccharomyces cerevisiae
                     YLR061W RPL22A Protein component of the large (60S)
                     ribosomal subunit, has similarity to Rpl22Bp and to rat
                     L22 ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_453291.1"
                     /db_xref="GeneID:2892759"
                     /db_xref="GOA:Q6CRZ8"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ8"
                     /translation="MAPNTARKQKITKTFTVDVSSPTENGVFDPASYAKYLIDHIKVE
                     GHVGNLGQAITVEEDGSVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNE
                     YKLAFYQITPEDEEEEEDEE"
     gene            <448206..>449249
                     /locus_tag="KLLA0_D05203g"
                     /db_xref="GeneID:2892825"
     mRNA            <448206..>449249
                     /locus_tag="KLLA0_D05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453292.1"
                     /db_xref="GeneID:2892825"
     CDS             448206..449249
                     /locus_tag="KLLA0_D05203g"
                     /note="similar to uniprot|Q12291 Saccharomyces cerevisiae
                     YLR063W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453292.1"
                     /db_xref="GeneID:2892825"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ7"
                     /translation="MGKHQQDKTKTLPVVNKDTVPGQDILDLFKVTFPDELYGDELDL
                     HEYVQAVKADLYERAYTKAFDSSKKRVAYCCRWSPSRAVAYSSLFASLKPVKNVLQCK
                     NPDDDDEEYDSESDDDTQEITKQLENLDIDPICSNVLCIGGGAGGELVALASIFAPSR
                     DYNSKFSADKKDMKCSRMNVQVVDIADWSDIVERIDDSIKSNWLRSQSDNFDISFKHA
                     DILSLTAEQLNLSSLNLITLLFTTNELFMENKAKSIRFLQKLNAQCSSGTYLLIVESA
                     GSFSHIEVGSKKFPIQFLIDTILQGKRGEEADGNWTLVGMDDSIWYRCDEKFDYRLKL
                     ENMRFFYRLYKKK"
     gene            <449550..>450470
                     /locus_tag="KLLA0_D05225g"
                     /db_xref="GeneID:2893526"
     mRNA            join(<449550..449572,449678..>450470)
                     /locus_tag="KLLA0_D05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453293.1"
                     /db_xref="GeneID:2893526"
     CDS             join(449550..449572,449678..450470)
                     /locus_tag="KLLA0_D05225g"
                     /note="similar to uniprot|P43563 Saccharomyces cerevisiae
                     YFL034C-B MOB2 Component of the RAM signaling network
                     localizes and activates the Ace2p in the daughter cell
                     nucleus to direct daughter cell-specific transcription of
                     several genes involved in cell separation Mob1p-like
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453293.1"
                     /db_xref="GeneID:2893526"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ6"
                     /translation="MSFFNSLKGFGRSSKKTKAINGQQLPQSNNGMYASSQNSNSKAS
                     LRRTQSPSRLAMMSSGHQQSQQSNSNVSNPESQEIMFLSEPFVRTALVKGSYKTIVQL
                     PKYVDLGEWIALNVFEFYTNLNQFYGVIAEYVTADAYPTMNAGPRTDYLWLDANNRQI
                     SLPAGQYIDLALTWINNKVNDQQLFPTKSSFPFPPNFLRDIQRIMIQMFRIFAHIYHQ
                     HFDKIIHLSLEAHWNSFFAHFISFAKEFNLIDRREMAPLELLIESFEHQGKII"
     gene            complement(<450769..>454560)
                     /locus_tag="KLLA0_D05247g"
                     /db_xref="GeneID:2893050"
     mRNA            complement(<450769..>454560)
                     /locus_tag="KLLA0_D05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453294.1"
                     /db_xref="GeneID:2893050"
     CDS             complement(450769..454560)
                     /locus_tag="KLLA0_D05247g"
                     /note="similar to uniprot|P13433 Saccharomyces cerevisiae
                     YFL036W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453294.1"
                     /db_xref="GeneID:2893050"
                     /db_xref="GOA:Q6CRZ5"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="InterPro:IPR024075"
                     /db_xref="InterPro:IPR029262"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ5"
                     /translation="MLRISRTNLGCRTAVRIHPRILQSSPVRLTTFRLASSVENSPVT
                     DLGFAKSSRASIQPNFTPFDSTTAGVEAHERTTYFNLWSLLEACLNAGYMDRAFSILQ
                     SLYESKVHAKFFIRDYNEYLLKYSTTVDNIDTLQEKLFNDLNNVFKDFSYDDRTLSIL
                     LHKSLSSLDKNMYNNCQKFLAMNLNGNRSILKNLDILTVSDYATLFRELKLINLTDIP
                     EAVRSIIEESEDPSNSLTISAKKGVVETLPKDAVELKPVDTFGLKAVRISLQGLSISP
                     EQRERIDEYLSDPSMQSMINGTTEKNINFFEIYKNLKTEEEQEAFNEFLDMINVERQR
                     ELENRSFDASKERWKYEFDQAASQGGLKLKKNLNVRLWEWYQQMLPVVRQEVALCQDL
                     LEKEQKAPNKQNSDRLKYGPYLLLVEPEKMCVITILELLKLQSSGGVTEGMRTARAVL
                     SVGRSIEMEFRSEKLLRSENKMFKEVNKRSHEFKMFVQNAKTALRNMHVEENMIQWPS
                     DVKAKIGSILISMLIHVSKVTVEGVDPITKEKVVGEAPAFCHTFQYRSGTKIGILKIH
                     RSLVNQLSAERMTTNIQPQHLPMLVRPRPWTNWNSGGYNYSQSTLIRSRDSPEQIAYI
                     KAVSEQGSIDNVYEGLNVLGNTPWTINEKLFNIVSEVWNTGEGFLDIPPVLDNFEFPP
                     QPARSEDPLILKEWRNKCRQMSNEFKGFKSYRCDSNYKLEIARAFLGEKFYFPHNMDF
                     RGRAYPLAPHFNHLGNDMTRSLLIFWNGKKLGTSGLQWLKIHLANLYGMDKCSFEERV
                     EFADTHLKEIRESAEHPLDGTRWWTKADKPWQFLATCIELNEALKLDNPENFISHQPV
                     HQDGTCNGLQHYAALGGDIEGARQVNLVPSDRPQDVYAFVAKLVTKRLENSAAAGDEQ
                     AAILKDLISRKVVKRTVMTNVYGVTFVGAADQIMKELDQYFDKPEESNELSRYLAKHV
                     FASIRELFHAAHLIQDWLGECAKKISKSVRLDFDLNQSKTINSSDLMTSVIWTSPLGL
                     PVVQPYRDLKKKQVQTNLQTVFITDPFAINPINPRRQQAGLPPNFIHSLDASHMLLSA
                     IQCGKAGLDFAAVHDSYWTHASEVDNMNRLLRQEFIKLHEVDLIERLKNEFDERYRDY
                     LEIVKISRDSALGQKILEVRADFAKKEGRNMTIADEIRMEKRRVELMRSDKPEDQAEA
                     ASMVTTVSCTLDYDMQQEEARSKTKVSQLTILTPLRLPEIPPKGEFDVQELLHSKYFF
                     S"
     gene            complement(<455261..>456610)
                     /locus_tag="KLLA0_D05269g"
                     /db_xref="GeneID:2892769"
     mRNA            complement(<455261..>456610)
                     /locus_tag="KLLA0_D05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453295.1"
                     /db_xref="GeneID:2892769"
     CDS             complement(455261..456610)
                     /locus_tag="KLLA0_D05269g"
                     /note="highly similar to uniprot|P02557 Saccharomyces
                     cerevisiae YFL037W TUB2 Beta-tubulin associates with
                     alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer
                     which polymerizes to form microtubules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453295.1"
                     /db_xref="GeneID:2892769"
                     /db_xref="GOA:Q6CRZ4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ4"
                     /translation="MREIIHLSTGQCGNQIGAAFWETICGEHGLDFEGNYHGIDDIQK
                     ARLNVYFNEASSGKWVPRSVNIDLEPGTIDAVRNSKIGTLFRPDNYIFGQSSAGNVWA
                     KGHYTEGAELVDSVMDVVRREAEGCDSLQGFQIAHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVVPSPKTSDTVVEPYNATLSVHQLVEHADETFCIDNEALYDICQTTLKLP
                     QPDYANLNHLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSI
                     GAQSFRSLSVSELTQQMFDSRNMMAASDPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQ
                     TRNSSYFVEWIPNNVQTAVCSVPPKDLDMSATFIGNSTSIQELFRRVGDQFSVMFKKR
                     AFLHWYTNEGMEEIEFSEAESNMNDLVSEYQQYQDATVEDDEELEFVDEQPMAENFE"
     gene            <457872..>458738
                     /locus_tag="KLLA0_D05291g"
                     /db_xref="GeneID:2892819"
     mRNA            <457872..>458738
                     /locus_tag="KLLA0_D05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453296.1"
                     /db_xref="GeneID:2892819"
     CDS             457872..458738
                     /locus_tag="KLLA0_D05291g"
                     /note="similar to uniprot|Q12144 Saccharomyces cerevisiae
                     YLR064W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453296.1"
                     /db_xref="GeneID:2892819"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ3"
                     /translation="MSEGSGNGSGNRYSNAAGQNGGNRPAQRPVAPLSAVFRTKLKQP
                     QFYWFLGHTLCLYYYIQYMLSFREQSVKTNYRKIMLYTVISYGIVLHQYVKSKQLRFQ
                     WSNLKQQIRQLDNLQYFTLSIVLLICSLSGGKTLTQTESSMVIYSLFHALNYFKENVL
                     PFIPMNPMLKGSLSNKISYFITNFNGSFFHAAVMSELVTMCKVCLMLPIQLISVLITF
                     NAKSLFTLLSIWAYAIFFKLRYNQSEQMRLLCNQNQMMIENFISTRLPMFMDKWLGIK
                     HLAKVFFDRILA"
     gene            <459496..>460110
                     /locus_tag="KLLA0_D05313g"
                     /db_xref="GeneID:2892728"
     mRNA            <459496..>460110
                     /locus_tag="KLLA0_D05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453297.1"
                     /db_xref="GeneID:2892728"
     CDS             459496..460110
                     /locus_tag="KLLA0_D05313g"
                     /note="highly similar to uniprot|P01123 Saccharomyces
                     cerevisiae YFL038C YPT1 Ras-like small GTPase involved in
                     the ER-to-Golgi step of the secretory pathway complex
                     formation with the Rab escort protein Mrs6p is required
                     for prenylation of Ypt1p by protein
                     geranylgeranyltransferase type II (Bet2p-Bet4p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453297.1"
                     /db_xref="GeneID:2892728"
                     /db_xref="GOA:Q6CRZ2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ2"
                     /translation="MNTEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVD
                     FKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTW
                     LQEIDRFGTAGVLKLLVGNKNDLTDKKVVDTEVAKEFADSIGIPFIETSALDSSNVEE
                     AFLIMTKQIKESVAKQQKDNGRAEDKSNVNLKGQSLTGSNGGCC"
     gene            complement(<460426..>460971)
                     /locus_tag="KLLA0_D05335g"
                     /db_xref="GeneID:2893101"
     mRNA            complement(<460426..>460971)
                     /locus_tag="KLLA0_D05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453298.1"
                     /db_xref="GeneID:2893101"
     CDS             complement(460426..460971)
                     /locus_tag="KLLA0_D05335g"
                     /note="similar to uniprot|Q6Q5C1 Saccharomyces cerevisiae
                     YLR065C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453298.1"
                     /db_xref="GeneID:2893101"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:Q6CRZ1"
                     /translation="MAGKSSKKIAAKNAAILKQLHVLVVAILSLTLLRKWFSNGLIST
                     LKPILFNVPMLLCLYILERTGRPKYEVSNAAHGKYKLVNEGFDLESGGLTEYMKDIVY
                     VSLFCNLGTVFFNTMKWWFLVLVCPAFIFYKLYYLKQQYFPGASASKADLAETTPAEP
                     SKSKRQLKREKRGDKSQVRYR"
     gene            <461726..>463633
                     /locus_tag="KLLA0_D05357g"
                     /db_xref="GeneID:2893427"
     mRNA            join(<461726..461735,462516..>463633)
                     /locus_tag="KLLA0_D05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453299.1"
                     /db_xref="GeneID:2893427"
     CDS             join(461726..461735,462516..463633)
                     /locus_tag="KLLA0_D05357g"
                     /note="highly similar to uniprot|P60010 Saccharomyces
                     cerevisiae YFL039C ACT1 Actin structural protein involved
                     in cell polarization endocytosis and other cytoskeletal
                     functions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453299.1"
                     /db_xref="GeneID:2893427"
                     /db_xref="GOA:P17128"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /translation="MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
                     VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPMNPKNNREKMTQILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVT
                     HVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEMQTASQSSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQ
                     TTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPE
                     RKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKCF"
     gene            complement(<464200..>465690)
                     /locus_tag="KLLA0_D05379g"
                     /db_xref="GeneID:2892748"
     mRNA            complement(<464200..>465690)
                     /locus_tag="KLLA0_D05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453300.1"
                     /db_xref="GeneID:2892748"
     CDS             complement(464200..465690)
                     /locus_tag="KLLA0_D05379g"
                     /note="weakly similar to uniprot|P43562 Saccharomyces
                     cerevisiae YFL040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453300.1"
                     /db_xref="GeneID:2892748"
                     /db_xref="GOA:Q6CRY9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CRY9"
                     /translation="MKNAFEVKRLIGLLVCIGFMLGMDTSSLSLFLGTSYFKEYFKQP
                     TALQTGMMTGANQIGGFVGCLMSGSLIELIGCKWCLCACSVIWTMGSVGSFFVLEVYT
                     MALSRFVKGIAVGILSVLASFYLMEVFSSNIRGQATALMQMALTISILSIYFLSMLLD
                     KIQGPLAFKITWGLEVIPSLLLLMLFQALPESPRWLYKHGYSNKDIDRSLAILRVKDV
                     EKLREKFVSETKQKPKLSYIIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMV
                     GFDDDVSSKLTAGPYIVNTIFTLVPVFLLDKFNRKVFIGWASVFLGGIMLLIGFLIGE
                     RERHVGDVVLRNIVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSW
                     FTGFALALMAPYLMQIVEWWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQD
                     ALSAEVEYEKIESDQSADFESIPERSGAPEPDSFVCTTTTTEVTER"
     gene            <466109..>466678
                     /locus_tag="KLLA0_D05401g"
                     /db_xref="GeneID:2892699"
     mRNA            <466109..>466678
                     /locus_tag="KLLA0_D05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453301.1"
                     /db_xref="GeneID:2892699"
     CDS             466109..466678
                     /locus_tag="KLLA0_D05401g"
                     /note="similar to uniprot|Q12133 Saccharomyces cerevisiae
                     YLR066W SPC3 Subunit of signal peptidase complex (Spc1p
                     Spc2p Spc3p Sec11p) which catalyzes cleavage of N-terminal
                     signal sequences of proteins targeted to the secretory
                     pathway homologous to mammalian SPC22/23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453301.1"
                     /db_xref="GeneID:2892699"
                     /db_xref="GOA:Q6CRY8"
                     /db_xref="InterPro:IPR007653"
                     /translation="MFSLNQRFQHVSSLALSCSFLVIALIAATSWLQLVKDNVFELES
                     QLSHIRSATRFAKQKRYGGSAVNPTEVSKIRFNADFDFSRLFNWNTKQVFAYVTAEYE
                     GDENPHTMNEITIWDKIIPSRDNATFTLSDIDAKYQLWDLESKITERPLTFKLHWNIQ
                     PWFGFLINGETTGSKTIELKKPVDKQKGK"
     gene            complement(<466943..>469792)
                     /locus_tag="KLLA0_D05423g"
                     /db_xref="GeneID:2892995"
     mRNA            complement(<466943..>469792)
                     /locus_tag="KLLA0_D05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453302.1"
                     /db_xref="GeneID:2892995"
     CDS             complement(466943..469792)
                     /locus_tag="KLLA0_D05423g"
                     /note="similar to uniprot|P32522 Saccharomyces cerevisiae
                     YLR067C PET309 Specific translational activator for the
                     COX1 mRNA also influences stability of intron-containing
                     COX1 primary transcripts located in the mitochondrial
                     inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453302.1"
                     /db_xref="GeneID:2892995"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q6CRY7"
                     /translation="MLRVSTLFGNQYIRRFSNGSIHLAKNPWLKRRSLEQLSKSLPAV
                     PTPVLEVVHKCSDDVPLDEEQRLTIKDYLTHEETEIPTVDRSILLKYLYGKKEYDMVE
                     TMAKLHLFDKDGYFLETSTVNNVQVYFEVLIQTKQLDKLTEEAVKYISQFSINKQGTS
                     VYMVNYLFVKLYQNFSPQDALYIWTKLVSVYYGHCELTSMDIYGPILNHLYYFFKASK
                     ESHQCVLPLLKRMQNEDGIMPASHLASTLITFFSSSRWFSEVERIWHWKVDRNLPIVA
                     SDLTAMMRSRCHFRDWDTVINLHHKYSLAQDDYMQFDYLLVALAKKQDWDRLKHQFDA
                     LFGIGELPTVNHYGVIMYALSMHGELELVEKLHGQLLRRDMTPSYAVLLSIINAHYNV
                     GDYNGAVREFALFKRYGIRPTSASYLIVLKAYKKMGSLDSCFRVLKTMSAENIPLNET
                     HFKIIIELCAKLDNYPVAEELFNIMATDYFIQPTGLTISALIRTFLKSKKYKEAWRLI
                     QKYENVVTVDKFKIVQQRIMYYVLTGDIENAEEQLKIYFRKKYKVNSNFYMILLQHLV
                     AGRKDYVAAEKVLDELVRANMSLIKPDHFNILLEEYNRIGYLEGISNIISKIVDNQIP
                     MNSKTLYFLVKSRFELNRKKRESPEFLLGWLEEILESIAKNKLNFTTRTIHPSVVTWP
                     MNFISRNDDPSKAVDLFTKYVKLFFPRSRDWNNKLVVLRSLLIVSAESGKWEDFDILF
                     TRYKDKLSFFQNQPSAVVPNNQLKAAFVGLFEYKIKRMRQLNEINRLPSLIEELENKG
                     YILSNNEWNEALWRMIRRKSTFDFAMKRINGMFIHGYTWIHRARSLRKRQDGKYNVNG
                     SSSSSSEQSKTNLYLKSEIYDLIMIQIDKYLRYNSKTLEREVKRLLIEYPYVMKQYLR
                     KPRNDISNWDIIEQNHSAYLRKLRSTYELVPLDEF"
     gene            <470419..>470853
                     /locus_tag="KLLA0_D05445g"
                     /db_xref="GeneID:2892858"
     mRNA            <470419..>470853
                     /locus_tag="KLLA0_D05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453303.1"
                     /db_xref="GeneID:2892858"
     CDS             470419..470853
                     /locus_tag="KLLA0_D05445g"
                     /note="similar to uniprot|Q12247 Saccharomyces cerevisiae
                     YLR068W FYV7 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin involved in
                     processing the 35S rRNA primary transcript to generate the
                     20S and 27SA2 pre- rRNA transcripts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453303.1"
                     /db_xref="GeneID:2892858"
                     /db_xref="GOA:Q6CRY6"
                     /db_xref="InterPro:IPR009149"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="InterPro:IPR017265"
                     /translation="MAKVEKKKFTKEYRLKEIQRNLTKKARLKKEYLKVLKDEGYSIP
                     EKPQYEKHDRSSVEAKKALNKQKVRDQREEHKLRKRTQKEKEQSFKEQEMKRIQLSKE
                     KQVERDRRAKKLTQRTKRGQPVMGPKINDLLDKINSDETYTR"
     gene            complement(<471053..>473320)
                     /locus_tag="KLLA0_D05467g"
                     /db_xref="GeneID:2893410"
     mRNA            complement(<471053..>473320)
                     /locus_tag="KLLA0_D05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453304.1"
                     /db_xref="GeneID:2893410"
     CDS             complement(471053..473320)
                     /locus_tag="KLLA0_D05467g"
                     /note="highly similar to uniprot|P25039 Saccharomyces
                     cerevisiae YLR069C MEF1 mitochondrial elongation factor
                     G-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453304.1"
                     /db_xref="GeneID:2893410"
                     /db_xref="GOA:Q6CRY5"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /translation="MFKRVGLIAGIAGPVAGSSRFSAVSFSKRAFSASSKRCTYEEER
                     AVLDEIQPLLSEKDIDASKKLRNIGISAHIDSGKTTFTERVLYYTGRIKAIHEVRGRD
                     NVGAKMDSMDLEREKGITIQSAATYCSWDKDNESYHFNLIDTPGHIDFTIEVERALRI
                     LDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGANPFRSIEQINNKLR
                     IPAAAIQVPIGAESELKGVVNIIDRVAIYNEGSNGEKLVTGPVPEDLKDLVEEKRALL
                     IETLADVDDEIAEIFLEEKEPSVDEIKAAIRRATIARKFSPVLMGSALANTGIQNVLD
                     AIVEYLPNPSEVLNTGLDIAKDETKVNLIPSSTQPFVGLAFKLEEGKYGQLTYIRVYQ
                     GKMRKGGYITNVKTGKKVKISRLVRMHSNDMEDVDEVGAGEICATFGIDCSSGDTFTD
                     GTLKYSMSSMFVPDAVISLSITPKSKDSTNFSKALNRFQKEDPTFRVRFDPESKETVI
                     SGMGELHLEIYVERMRREYNVECVTGKPQVSYRESIQSSAEFDYTHKKQSGGAGQYGR
                     VMGNLSHIENSNTNNFETAIVGGRIPDKYLAACAKGFEEACEKGPLIGHRVLGVNMLI
                     NDGAIHAVDSNELAFKTATMAAFRQAFLESQPVILEPIMNVSVTSPNEFQGNVIGLMN
                     KLQAVIQDTENGQDEFTITAECPLNTMFGFATSLRASTQGKGEFSLEFKHYAPASPQL
                     QKQLIADYQKKQQQK"
     gene            complement(<473992..>475845)
                     /locus_tag="KLLA0_D05489g"
                     /db_xref="GeneID:2892756"
     mRNA            complement(<473992..>475845)
                     /locus_tag="KLLA0_D05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453305.1"
                     /db_xref="GeneID:2892756"
     CDS             complement(473992..475845)
                     /locus_tag="KLLA0_D05489g"
                     /note="similar to uniprot|P43561 Saccharomyces cerevisiae
                     YFL041W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453305.1"
                     /db_xref="GeneID:2892756"
                     /db_xref="GOA:Q6CRY4"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:Q6CRY4"
                     /translation="MFVGTRKDAYGVRSVVRLVFVLLAVLSAFARAETTHVFNFTTGW
                     VNVNPDGVGEKKMIGFNGHWPIPDIHVNKGDRIEIYLTNGFDDLPTSLHFHGLFMNTE
                     LGNSNQMDGPEMVTQCPIQPGDTFLYNFTVPDQVGTYWYHSHSGAQYTDGMRGAFVIH
                     DPDMPFDYDEEMTILVSDLYDKPYYEVADFFLSQYNPTGAEPIPRNILFNHTTNNTIH
                     FDTDKTYLIRLINGGTFVSQYLFIEDHDMTIVEVDGVYVDPTKAKLLYIAAGQRMSIL
                     VKSKHTKSKNFAFMQIMDDEMLDVIPADLELNRTNTISYSSKNGEAKQAYIDSFKHFT
                     NDFHLVTRAKTELLDTYDYQIKLNVEMENLGDGVQYAFFNNITYVAPKVPTLLTALSA
                     GKLATNPAIYGDNINAFVLEYGEVVEIVVNNHDAGKHPFHLHGHVFQVVQKSGGREDG
                     EDPIDYDEKNPVSAYPEYPVLRDTVVVESLGHVVLRFQATNPGIWFFHCHVDWHLEQG
                     LAAVFIEAPLLLQERETLTESVLNTCKSGNIPTKGNAVGNEKDWFNLEGLPRQPAPLP
                     AGFTFKGYVAFFFSTAVGLWGIYTIAQYGLGEVVPDDQELAAQLKALLNNK"
     gene            complement(<476363..>477427)
                     /locus_tag="KLLA0_D05511g"
                     /db_xref="GeneID:2893070"
     mRNA            complement(<476363..>477427)
                     /locus_tag="KLLA0_D05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453306.1"
                     /db_xref="GeneID:2893070"
     CDS             complement(476363..477427)
                     /locus_tag="KLLA0_D05511g"
                     /note="similar to uniprot|P35497 Saccharomyces cerevisiae
                     YJR159W SOR1 Sorbitol dehydrogenase expression is induced
                     in the presence of sorbitol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453306.1"
                     /db_xref="GeneID:2893070"
                     /db_xref="GOA:Q6CRY3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CRY3"
                     /translation="MSGTQKAVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGS
                     DIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDE
                     TKSGHYNLCPHMAFAATPPYDGTLVKYYLAPEDFLVKLPDHVSFEEGACAEPLAVGVH
                     ANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNT
                     INSTKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVLKAGGSYVQVGMGK
                     DNINFPIAMIGAKELRVLGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDA
                     YNFNLEHGSEVVKTMIDGPE"
     gene            complement(<478454..>481450)
                     /locus_tag="KLLA0_D05533g"
                     /db_xref="GeneID:2893173"
     mRNA            complement(<478454..>481450)
                     /locus_tag="KLLA0_D05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453307.1"
                     /db_xref="GeneID:2893173"
     CDS             complement(478454..481450)
                     /locus_tag="KLLA0_D05533g"
                     /note="similar to uniprot|P19263 Saccharomyces cerevisiae
                     YLR071C RGR1 Component of RNA polymerase II
                     holoenzyme/mediator complex affects chromatin structure
                     and transcriptional regulation of diverse genes required
                     for glucose repression HO repression RME1 repression and
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453307.1"
                     /db_xref="GeneID:2893173"
                     /db_xref="GOA:Q6CRY2"
                     /db_xref="InterPro:IPR013947"
                     /translation="MTTDVAPGTMENETSKVMSLKHKAAYVPPPIPHVEMNQLPLSLL
                     LRNLTVFTAKEISQFFKLNVHTGGKTPFEKKLELLNMILFLRNQFLKLYVLVKWAKTL
                     KQNNFHSLIDLLNWFRNANMQVNNCTMALKQILGTMAGAKLPNPDLATSLEVLMLGRP
                     NLPNHGFNLNGSQSDNLTIPNKLILKRLRDLNTCLSIKISLMTIPSQLAKYEIKDGRI
                     VFTVKDEFELQLSTIDQNSPLFFVNINLLFNERLPLNLARLEKHINEILFKSTNPLCL
                     VYQFLHKYILTLQMYMIHVELNALGLNGKYSGGHLVHNYDSKKQIITIKYWLQSKIAN
                     TCKCVVGMDKETESIVLEWQNPDVNKETVTTRYHGLLNNIESIIDEITFNHAQMIRAD
                     LLRTDTFQEDNEDTTSTSLLFQIPTTCATVSQIQLKIDQVSGIFYFHNPSNLLLSYAR
                     QINQSSNTQDLITVLGRLKLDKVDSILRHMLDKTGWICSDVVRLKSSIVPSTDSTFSK
                     DIFVKLKDWPSNWFLVLTIISSTNTCIVEKRIGKILSVKGVWKLKYMDKKNVITSKLD
                     TMTYPKMLTLQISILNKIVNHMIIDSLNELKIKNKICTFTTEDSNILPPYIIRKDGKE
                     NTDNITVIALGLESFLEGSKALNTILESSMLLKIDYQKMDIELYGKFKTDNEMIRCQC
                     DELSIKFLEEDSLSFFMSENFGNLNDIMLYLSKFRKKLTQLIALTDVMDTLHSNFQSM
                     DFRVVELRPNEIRFKYLPMKDSPDNEDCVIRIVTNQEKVEKLDIKLSEHNPQAMIQRF
                     LDEKEGFAHNFIFHYLQFTLPLFRASKEADYTSSSPSTVKMHLFMHSLQEFHFLYRNH
                     KVGGELSFIIQLRSVVRTRHQENTQYFVRFAQDYSQPQLQQQHPLSKAIAEIQKNAFS
                     LALLKEQNSNTTSSTTTAGTATAGATMISTASSNKLLDLQDSSPTNAAVDWSSIKCVR
                     LGSALACSHDQILPLLLQFHKSISDC"
     gene            <482279..>484453
                     /locus_tag="KLLA0_D05555g"
                     /db_xref="GeneID:2893176"
     mRNA            <482279..>484453
                     /locus_tag="KLLA0_D05555g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453308.1"
                     /db_xref="GeneID:2893176"
     CDS             482279..484453
                     /locus_tag="KLLA0_D05555g"
                     /note="weakly similar to uniprot|P43560 Saccharomyces
                     cerevisiae YFL042C Due to a sequence change (deletion of G
                     at 46151) YFL043C is now part of YFL042C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453308.1"
                     /db_xref="GeneID:2893176"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q6CRY1"
                     /translation="MTDSDMEIPSRVNTTENDRRQSTSSSVFRTPLRRSRSGETSSLK
                     STPADPQLTETNGQSTSLRKYEECSDKRSTKEHLSNIMIQDQSSFDSQAQSQSNSFFK
                     DMVSTFSSSNNSVTEPEILAHRRENSGTITVSKLRPKSELPVGKPSLPLSELDLYDSK
                     LYVNEFYADTHYRFASDKRNNDFHQLFPKVPASERLLDDFSSALNREFLIQGRVYITP
                     MRVCFNSNLLGWVTSLEIDIKDIVSLEKTSTAGLFPNGICIHLPTEKHYFASFISRDT
                     TFKFLEIIWHTRKELDYLTLRPDQLSLNRSHSLNDFLTGTNSTCPPSRSSFAEADSAI
                     ESAIMSVDDSYPTNKSLSNLHEEDGDSAGEDESGDEDDYEEEDDDAEGEKLTSGDDYY
                     YDEEAIASDYEEKSVRRVYKLKKKSKFHYDGPYYFKATEFMYNPEENKETVLAELELN
                     APPGLVYQLMFSEECPDLILEFLKAQNSSQCSDIPPFDQVNPEGQHYRKYTYAKALNF
                     PVGPKSTKCLVSEHILYCAYDNYINIVNTTKTPDVPSGNSFSVKTRYMYRWKDNTSCV
                     LKISYWVDWTGSSWIKSMIDNSVNSGQVEATEKLLTIVEEFVKNNVEESEMKVNIQPR
                     KSLPQSRRVSKISKKSSKLAVQQPSTPSNLENKVHAALTKENIILSLLFIITLIMMFN
                     TLCQVRILRKLNKLMNTNSASVIEEIKDILNVYNELPMSNEE"
     gene            complement(<484697..>485266)
                     /locus_tag="KLLA0_D05577g"
                     /db_xref="GeneID:2893240"
     mRNA            complement(<484697..>485266)
                     /locus_tag="KLLA0_D05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453309.1"
                     /db_xref="GeneID:2893240"
     CDS             complement(484697..485266)
                     /locus_tag="KLLA0_D05577g"
                     /note="similar to uniprot|Q08003 Saccharomyces cerevisiae
                     YLR073C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453309.1"
                     /db_xref="GeneID:2893240"
                     /db_xref="GOA:Q6CRY0"
                     /db_xref="InterPro:IPR015063"
                     /translation="MKSSSHLKQEALNYRFNSNVPLKLYLTTCISIVEEAQNSARCNN
                     MERAYLLYIRYLDLCLNRLVHHSEVNTSVESLYKREYFQLLKLEVPAIMKITEELKIK
                     IDARYKSLANNVATSTYVRSPAVMTTNPSDEINLPSSFDEQKFNQSISWFNHSSKHFS
                     AQSDSNNEYPELPELNATSTSVTYTMPAL"
     gene            <485753..>486712
                     /locus_tag="KLLA0_D05599g"
                     /db_xref="GeneID:2893607"
     mRNA            <485753..>486712
                     /locus_tag="KLLA0_D05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453310.1"
                     /db_xref="GeneID:2893607"
     CDS             485753..486712
                     /locus_tag="KLLA0_D05599g"
                     /note="similar to uniprot|P43558 Saccharomyces cerevisiae
                     YFL044C YOD1 Yeast OTU Deubiquitinating enzyme 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453310.1"
                     /db_xref="GeneID:2893607"
                     /db_xref="GOA:Q6CRX9"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="UniProtKB/TrEMBL:Q6CRX9"
                     /translation="MRVKVSISGKSDKVLTVEAECDLETFQGLILSSYEDDLSLQSMR
                     YGFPPQSILFQGNEAKTLEELGICNGERIIVSLSKADEAIATRTQPSINASKANTLPN
                     KEVKKKPTGKSESVQIDSTRALQLHEVPDDNSCLFHAISYAVYKNISLSSELRGVVAS
                     EVRRDPFEYSDAILGRPNHEYSEWIMKHSSWGGGIEIAILSKHFQYAIYVLDVDARKF
                     EKFNEDLYDKFIIIAYNGVHYDTVEIFDGTQHQTVFDIGEKDTEFLLQKTQEIAKKMK
                     REGKSFNTARDSILCNTCGTTLIGEREVSKHAEKTGHVDFRQK"
     gene            complement(<486879..>487382)
                     /locus_tag="KLLA0_D05621g"
                     /db_xref="GeneID:2893451"
     mRNA            complement(<486879..>487382)
                     /locus_tag="KLLA0_D05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453311.1"
                     /db_xref="GeneID:2893451"
     CDS             complement(486879..487382)
                     /locus_tag="KLLA0_D05621g"
                     /note="similar to uniprot|Q08004 Saccharomyces cerevisiae
                     YLR074C BUD20 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453311.1"
                     /db_xref="GeneID:2893451"
                     /db_xref="GOA:Q6CRX8"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q6CRX8"
                     /translation="MGRYSVKRYKTKRRTKDLDLIYEELTSQKQIDSLLNQPIDETKP
                     GLGQYYCIHCAKYFETAYALKTHLKTKIHKRRVKELKGVPYTQQVADAAVGCGVNSFL
                     ARVEQIKSQIGPQKEENEKILTSHLDTTLANVSTTESTLPYLDGAVQEQAQQEAVVAE
                     GEIQMAD"
     gene            <488021..>488683
                     /locus_tag="KLLA0_D05643g"
                     /db_xref="GeneID:2893562"
     mRNA            <488021..>488683
                     /locus_tag="KLLA0_D05643g"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_453312.1"
                     /db_xref="GeneID:2893562"
     CDS             488021..488683
                     /locus_tag="KLLA0_D05643g"
                     /note="highly similar to uniprot|P41805 Saccharomyces
                     cerevisiae YLR075W"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_453312.1"
                     /db_xref="GeneID:2893562"
                     /db_xref="GOA:Q6CRX7"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:Q6CRX7"
                     /translation="MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVD
                     EFPLCVHLVSNELEQLSSEALEAARITANKYITKMTGRDSFHLRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRGAWGKPHGLAARVAIGQVIFSVRTKDNNKDTVIEGLRRARYKFP
                     GQQKIIISKKWGFTSLNREEYVKKRDAGEIKDDGAFVKFLSKKGSLEENIREFPEYFA
                     KA"
     gene            <492707..>493471
                     /locus_tag="KLLA0_D05709g"
                     /db_xref="GeneID:2892812"
     mRNA            <492707..>493471
                     /locus_tag="KLLA0_D05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453316.1"
                     /db_xref="GeneID:2892812"
     CDS             492707..493471
                     /locus_tag="KLLA0_D05709g"
                     /note="highly similar to uniprot|P07283 Saccharomyces
                     cerevisiae YFL045C SEC53 involved in synthesis of
                     GDP-mannose and dolichol-phosphate-mannose required for
                     protein assembly in endoplasmic reticulum
                     phosphomannomutase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453316.1"
                     /db_xref="GeneID:2892812"
                     /db_xref="GOA:F2Z6D6"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:F2Z6D6"
                     /translation="MSVSEFSHKEQPTTLVLFDVDGTLTPARLTVSDEVRDILKRLRE
                     KVVIGFVGGSDLSKQLEQLGSDVLDQFDYAFSENGLTAYRLGKELASQSFIEWIGEEE
                     YNKLAKFILQYLASIDLPKRRGTFLEFRNGMINVSPIGRNASTAERNEFEQFDKEHQV
                     RAKFVEALKKEFAHLSLTFSIGGQISFDVFPTGWDKTYCLRHVEADGFKEIHFFGDKT
                     YKGGNDYEIYVDDRTIGHSVESPADTVRILKELFDL"
     gene            complement(<493687..>494325)
                     /locus_tag="KLLA0_D05731g"
                     /db_xref="GeneID:2892900"
     mRNA            complement(<493687..>494325)
                     /locus_tag="KLLA0_D05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453317.1"
                     /db_xref="GeneID:2892900"
     CDS             complement(493687..494325)
                     /locus_tag="KLLA0_D05731g"
                     /note="highly similar to uniprot|P43557 Saccharomyces
                     cerevisiae YFL046W FMP32 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453317.1"
                     /db_xref="GeneID:2892900"
                     /db_xref="InterPro:IPR012439"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:Q6CRX2"
                     /translation="MIRSFAFPSYPRGFLGLRTLHTSRILYNDMETVHIRDTNHFRQR
                     LMDEGKFSEEQSNVIVNIMIDALRGGVAHVSQDLASREKLTKLTYQQRVDFSKLREQL
                     LTADRSEIHNLQNEHERIRKDLETMRNKLREEITKANAGFKLDLSLEKGRIREESSHH
                     DMQIKEIDTRIDQEVTNMKMQIDSVKTQVMQWLIGVCTGTFALVLAYVRLLT"
     gene            <494751..>496592
                     /locus_tag="KLLA0_D05753g"
                     /db_xref="GeneID:2892912"
     mRNA            <494751..>496592
                     /locus_tag="KLLA0_D05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453318.1"
                     /db_xref="GeneID:2892912"
     CDS             494751..496592
                     /locus_tag="KLLA0_D05753g"
                     /note="similar to uniprot|Q7LI62 Saccharomyces cerevisiae
                     YLR077W FMP25 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453318.1"
                     /db_xref="GeneID:2892912"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q6CRX1"
                     /translation="MFRPIVRCGANQATKISYSRCGHQFVNGFHSSAVTLLGKEPKYD
                     DAEIMAERLNNANYVGKRVKTDYQWKDKSEAQSEKEYFDRMEKLAKLYAVLQGLLFVG
                     GVSAIGTAYMMWPQIKNWWITEDIHVSDDVIEKLKEKKERRKLTDIPVVPADSADSSV
                     VGLYYWGQRLGTDSKKAVTKFPLRVPFFDGMKLRDVCLTDDGSYGNLAVDKDGNLFEW
                     DNSKCNLLLKDQNLVQIKVSNDVAYGLNKKGEVLVIPLKDKSLFSDKISWSRSLLLPW
                     KTYCRYSWKLDTRSAFRYSGEKKVIQFDVGSNHLVLLSNKGKAYTCATGTKHVENERS
                     KGQFGIPTFSQFDPYPELNRVYEIELLNTGIAGDHVTSRSISKIACGDYHTLACDSVG
                     ELYSFGLNTYGQLGQSISYDMEYVPFPKKVSSFSGHFEKHDFLKCVEINCSGNTSFVS
                     ILPQDVHRYFKNKDFAIDIDNDKDNITYFAFGNGIQGQLGNGHFKHSQSTPTRMKVIN
                     DLKDNTVNSDKRILIRDWYCGEQHAFVRLKNGEIMCWGYNENGQLGNGKKIKWDKPAY
                     IPRLLEPGERFNGKNLDILYDENNKLVISDEQSLRAGKEASCLFWKA"
     gene            complement(<496779..>497640)
                     /locus_tag="KLLA0_D05775g"
                     /db_xref="GeneID:2893055"
     mRNA            complement(join(<496779..497522,497638..>497640))
                     /locus_tag="KLLA0_D05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453319.1"
                     /db_xref="GeneID:2893055"
     CDS             complement(join(496779..497522,497638..497640))
                     /locus_tag="KLLA0_D05775g"
                     /note="similar to uniprot|P25385 Saccharomyces cerevisiae
                     YLR078C BOS1 v-SNARE (vesicle specific SNAP receptor)
                     localized to the endoplasmic reticulum membrane and
                     necessary for vesicular transport from the ER to the
                     Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453319.1"
                     /db_xref="GeneID:2893055"
                     /db_xref="GOA:Q6CRX0"
                     /translation="MNALYNHAIKQRSLLNKDLGKFEKELVTAPISLQGAIATTLVSF
                     EKTLHQYKEQYKQYQINSSDDNDETKLKYETRLQTLTQDYEDAKEKFTELKQKYSEIN
                     ARDQLFNQQASMVEETVMNKRNINAPPQTSFGIGALDQNSERMTINSAAGLPLYEGLR
                     KENSIFERGNAHLDRILQMGQESLEDIMEQNRVLQRLQSQMTKSLHVLGVSNETIEKI
                     NKRLFKDKLIFYIGLLLLILGIYFVLKWFG"
     gene            <498347..>499150
                     /locus_tag="KLLA0_D05797g"
                     /db_xref="GeneID:2893579"
     mRNA            <498347..>499150
                     /locus_tag="KLLA0_D05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453320.1"
                     /db_xref="GeneID:2893579"
     CDS             498347..499150
                     /locus_tag="KLLA0_D05797g"
                     /note="similar to uniprot|Q75CY2 Ashbya gossypii ABR240W
                     ABR240Wp and weakly similar to YLR079W uniprot|P38634
                     Saccharomyces cerevisiae YLR079W SIC1 P40 inhibitor of
                     Cdc28p-Clb5p protein kinase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453320.1"
                     /db_xref="GeneID:2893579"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW9"
                     /translation="MTPATPPSSRNKRSNKTDLLLATPERAAESDSSGMVTPGTVRVK
                     DRLQPPTRPMNLTSPCPALKTPEYTPHKNKHTKRRIEFDQEKLQPVSRVLFGSDFQVE
                     ETSNNRTLLPPKRTGIMESFKGVQSYNINDEYAVNNKFKLAKQEPGTPSDKITTFELA
                     RKWHNESGLNTSQSENEEENIHIEQQPTAVNQHSNLENPFLSNNIADEKLRKERKEKM
                     LLEDPDLEDTITYVNKGGKVVSKRHLTDDEKQRFKPTRLFAEEIDRHDG"
     gene            complement(<499409..>501472)
                     /locus_tag="KLLA0_D05819g"
                     /db_xref="GeneID:2893131"
     mRNA            complement(<499409..>501472)
                     /locus_tag="KLLA0_D05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453321.1"
                     /db_xref="GeneID:2893131"
     CDS             complement(499409..501472)
                     /locus_tag="KLLA0_D05819g"
                     /note="similar to uniprot|P43556 Saccharomyces cerevisiae
                     YFL047W RGD2 GTPase-activating protein (RhoGAP) for Cdc42p
                     and Rho5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453321.1"
                     /db_xref="GeneID:2893131"
                     /db_xref="GOA:Q6CRW8"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001875"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW8"
                     /translation="MPSFAESFWSPDFISGIEALFGKLHKGCDQNDLFIQLFASRMQY
                     EVEFGRHLCNINKGVDEFDALDSTCNSSLAGMIGQMVEEGNHHLKIASTIEMTVLGPF
                     TKWRQEHKQRVQYSEKILKTNARSFLKSKGFVEKLEQTYLNKCRLLEDFKRSTFNEDE
                     LSDAMKSLDLQREHEAKVLQEKEYQKFGVFGGIDYDYKGIKETLKLLLTKLPKHQYKV
                     PFISFTIENTNSGSEIVAFLMTHMSLKDIDHAELFGQDLLNHGFIKYCNGVGTTFANS
                     KKFQYQWKPYAYKFCNLSTTDANDDSLNEAESGIVNYFQKMTAGNEATYSSIHQPNFS
                     DNEKKLYKFVRDVEVSDSKYMKECKKLDSLRCSFEELIVDHYTFMEKCESDRLMAIRK
                     VTLDFCAAIGNTISSMKLTIEKLTDSEALIDPAADLLKTIEENRVGFFQPRVIPYNNY
                     YNPGSYQTFGIDLETRCRSDNRLVPLILSAILLYMDQAYPEMENDYKRAIVWTKPVKL
                     HEVHQLRQLLIKPFKEESEIIEILRSKKVEPSTVASVFKIYLLELPKSLITEDAYDIL
                     KVLYREYPPSDIKEETENQRVRGLTTALSTLSKSNMVTLDVITTHFERLIEIIRMNKS
                     EESQELAENLRDAISQEFANCLIHPILPTANELGYKVFEDLLRHRKKIFKELKRKGSN
                     PSSRG"
     gene            <501740..>502138
                     /locus_tag="KLLA0_D05841g"
                     /db_xref="GeneID:2893169"
     mRNA            <501740..>502138
                     /locus_tag="KLLA0_D05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453322.1"
                     /db_xref="GeneID:2893169"
     CDS             501740..502138
                     /locus_tag="KLLA0_D05841g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453322.1"
                     /db_xref="GeneID:2893169"
                     /db_xref="GOA:Q6CRW7"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW7"
                     /translation="MPFPKVSIVFCTKCKWNLRSAWYVQELLQTFGSELKEISLIPGE
                     PGEFKVLGYQTEGSQPIVIWDRVVDDGFPDSKYLKQRVKALIFNDEVAIGAHIDRKSK
                     SSSAKETLVSEKINQCSTDDQNTSCKDCET"
     gene            <502506..>503819
                     /locus_tag="KLLA0_D05863g"
                     /db_xref="GeneID:2893224"
     mRNA            <502506..>503819
                     /locus_tag="KLLA0_D05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453323.1"
                     /db_xref="GeneID:2893224"
     CDS             502506..503819
                     /locus_tag="KLLA0_D05863g"
                     /note="similar to uniprot|P43555 Saccharomyces cerevisiae
                     YFL048C EMP47 Integral membrane component of endoplasmic
                     reticulum-derived COPII-coated vesicles which function in
                     ER to Golgi transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453323.1"
                     /db_xref="GeneID:2893224"
                     /db_xref="GOA:Q6CRW6"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR016710"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW6"
                     /translation="MFVHWLAVLFAYITVANAAAIAEAELHESAVSDNDILDASHSLP
                     DLVHMNAVPSDWKTSGGLVLEEGRLRLTPSASSQSSIWHKTDYQIKDSFTIEWTFRSV
                     DFIGKSEGGLSFWLVEGKSAGGTSLFGGPEAFDGLQILVDSNGPVGSSVRGILNDGSK
                     KLTEKNVYDHSFAYCLLAYQDTTIPTTIRLSYDRKNNNLLKLQVDNRVCFQTRQIQFP
                     QNAKMKMGITAKNDANKESFEVLKVHTHNGLTKEVTIPNVNPMEQPRLVTKIINKDTG
                     KEDVVETDFMKMKGLANKVDNYELYKKLDKIEGKILANDISVINGKLIGILENQAAHL
                     RKLEYLSTTLEVIVASMGKEGEVNTESFKDLFVMNDKLEQLLQDQAKIREATKQSMEN
                     AGNGVSVDEIVKRLLMWILPLILIVLVMAYYTFKIRQDIVKVKLL"
     gene            complement(<503910..>505442)
                     /locus_tag="KLLA0_D05885g"
                     /db_xref="GeneID:2893590"
     mRNA            complement(<503910..>505442)
                     /locus_tag="KLLA0_D05885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453324.1"
                     /db_xref="GeneID:2893590"
     CDS             complement(503910..505442)
                     /locus_tag="KLLA0_D05885g"
                     /note="similar to uniprot|Q75CX8 Ashbya gossypii ABR244C
                     ABR244Cp and weakly similar to YFL049W uniprot|P43554
                     Saccharomyces cerevisiae YFL049W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453324.1"
                     /db_xref="GeneID:2893590"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW5"
                     /translation="MDSSTNSSVTAQVNPVPEYVIKNHELFILKTTLSILNNPELLSG
                     RLDKPPTKQLVLPSFTIKERLSDNNDSYVLGKGDQNGETKVDKQGRLHGERHYLFPTF
                     TYPCAENNNSENLYVLVRDLIRVLNLDVEQQEFLAQHPDLYPINAKHDIIEFLTQYKL
                     LPEGATAATYITARSAFLVFGAAILASGSRVIDDYWEQLSKEQGFQAQHRVYALSQKL
                     LDMVCSIDPRTRTAHSLGPPELPESKQAQAGVMSTSQPQFEDPFSTITELPPLEARKE
                     FLSNIAHGEQTAIISGQTIHGAIELSTIYKIPKYHYKNSFAAAQQHNVLDSPIGTHTH
                     PVESHNFGRGRKANYVPPEETDVLAQIPGWKFTQLPVTTNDELPTTFSAGGLPIYNKA
                     RLPARLKLLTPNQIKDLERSHDVVHLNTALGHVRKLRNTRWTKFWQYKAGAPVGLTED
                     QLSYYKEQYLQQVLNHVDVSIVPNETKNVDEKRTVKRVPNPNFLGYSNVSGFRPPYVE
                     KP"
     gene            complement(<505826..>506707)
                     /locus_tag="KLLA0_D05907g"
                     /db_xref="GeneID:2893463"
     mRNA            complement(<505826..>506707)
                     /locus_tag="KLLA0_D05907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453325.1"
                     /db_xref="GeneID:2893463"
     CDS             complement(505826..506707)
                     /locus_tag="KLLA0_D05907g"
                     /note="similar to uniprot|P34251 Saccharomyces cerevisiae
                     YKL107W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453325.1"
                     /db_xref="GeneID:2893463"
                     /db_xref="GOA:Q6CRW4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW4"
                     /translation="MKTNPDIVYTKAQKLIELNLDNKYVAIVGGTGGIGRELARVLAQ
                     KGAKVIVVGRTFRDENVEGIEFIQADLGLVSEASRVAELLPAEKLDLLIFTTGVLAPP
                     ARRETSEGLEEDLAVSYISRLVMMNHLVPRLKEHGEKKPRVFVMGFPGDNYMGDYRDL
                     NSEESYGAISTHMKTVAGNEALVLDFKNRFATVNFYGLNPGLIRTNIRDNYLGKDTWK
                     SRVVEWFIGMTNQTAEQYAEKLGPLLVAPELETHSGAMFDKNANPILPSKDFTDDYAR
                     NYIKASEELLANLKLAQ"
     gene            <507555..>508784
                     /locus_tag="KLLA0_D05929g"
                     /db_xref="GeneID:2893423"
     mRNA            <507555..>508784
                     /locus_tag="KLLA0_D05929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453326.1"
                     /db_xref="GeneID:2893423"
     CDS             507555..508784
                     /locus_tag="KLLA0_D05929g"
                     /note="highly similar to uniprot|P07267 Saccharomyces
                     cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
                     (proteinase A) required for the posttranslational
                     precursor maturation of vacuolar proteinases synthesized
                     as a zymogen self-activates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453326.1"
                     /db_xref="GeneID:2893423"
                     /db_xref="GOA:Q6CRW3"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW3"
                     /translation="MHLNFQSLLPLASLLLASFDVAEAKIHKAKIQKHKLEDQLKDVP
                     FAEHVAQLGEKYLNSFQRAYPQESFSKDNVDVFVAPEGSHSVPLTNYLNAQYFTEITL
                     GSPPQSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHEASSTYKANGSEFAIQYGSG
                     SLEGYVSRDLLTIGDLVIPDQDFAEATSEPGLAFAFGKFDGILGLAYDSISVNRIVPP
                     VYNAIKNKLLDDPVFAFYLGDSDKSEDGGEASFGGIDEEKYTGEITWLPVRRKAYWEV
                     KFEGIGLGEEYATLEGHGAAIDTGTSLIALPSGLAEILNAEIGAKKGWSGQYSVDCES
                     RDSLPDLTLNFNGYNFTITAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKY
                     YSIYDIGHDAVGLAKAA"
     gene            <509713..>511719
                     /locus_tag="KLLA0_D05951g"
                     /db_xref="GeneID:2893394"
     mRNA            <509713..>511719
                     /locus_tag="KLLA0_D05951g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453327.1"
                     /db_xref="GeneID:2893394"
     CDS             509713..511719
                     /locus_tag="KLLA0_D05951g"
                     /note="similar to uniprot|P28743 Saccharomyces cerevisiae
                     YPL155C KIP2 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453327.1"
                     /db_xref="GeneID:2893394"
                     /db_xref="GOA:Q6CRW2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW2"
                     /translation="MITKPVALPLHTSSYNSPKRLMRPPSTPNLRTSSTVRPRSTSSS
                     SSSQCSSPARSSSTKAASPIRGGRSSYQGTISVGVRIKPTHGKQDSWHVNNNSIIHEE
                     FGEFNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSKS
                     GPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQGKTLNSNIMVP
                     SSTLTNDLKLRDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSR
                     SHAVVLIRVFCTDEITGEQVMSTLSLCDLAGSERATGQQERRKEGAYINKSLLALGTV
                     ISKLSMESSGLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINT
                     IRFASRAKNISLAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGIS
                     SDTSLLRENELLKMKVEHYERLETLEPSILKDTELVEIIDMLPQDIGVMLETKLVNMD
                     SQLQESKRYISQLESARTRDASATAATAELLSNVSDIDLTQVLHEQEQELMQLHQSLE
                     RKDKMIEALKSAKRLRQQLAEYTGEAVSATDSDIEIGTATAANVLKPISPNASDLNRQ
                     ERPITIGSGTSITTTSDSSGTGSDYLKPVPKYSIASDVFPKSVL"
     gene            <512611..>513456
                     /locus_tag="KLLA0_D05973g"
                     /db_xref="GeneID:2893516"
     mRNA            <512611..>513456
                     /locus_tag="KLLA0_D05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453328.1"
                     /db_xref="GeneID:2893516"
     CDS             512611..513456
                     /locus_tag="KLLA0_D05973g"
                     /note="some similarities with uniprot|Q12498 Saccharomyces
                     cerevisiae YPL156C PRM4 Pheromone-regulated protein
                     predicted to have 1 transmembrane segment
                     transcriptionally regulated by Ste12p during mating and by
                     Cat8p during the diauxic shift"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453328.1"
                     /db_xref="GeneID:2893516"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW1"
                     /translation="MGLRSGKTSKKGNRLVVTSLVLFSVVLLILYSVGSDESFMNYKQ
                     FSLGTLQIGAEDDSDVSALPSIDGSISSISSGINYASTNIAADSIVEEKLVINEAEGT
                     KRMELRKHKVLSPKMTAPLESEVAPVIVEHGGSSGTGGITVSNERFSPSLGFQQILNT
                     SPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQEYIQLNRLATYK
                     SNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVADSKVSISKVD
                     IPSNS"
     gene            complement(<513734..>514645)
                     /locus_tag="KLLA0_D05995g"
                     /db_xref="GeneID:2893610"
     mRNA            complement(<513734..>514645)
                     /locus_tag="KLLA0_D05995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453329.1"
                     /db_xref="GeneID:2893610"
     CDS             complement(513734..514645)
                     /locus_tag="KLLA0_D05995g"
                     /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
                     YPL157W TGS1 TrimethylGuanosine Synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453329.1"
                     /db_xref="GeneID:2893610"
                     /db_xref="GOA:Q6CRW0"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CRW0"
                     /translation="MSWLLKTPKDLGCFEGIDGINNIKVRHRLKKHFFDDSYRINPYQ
                     RPNDKKLFKFWKNRATIFKLINNGNIYLTDELWFSVTPENLAQFTANYVRHCLPNGNC
                     IVDVFCGGGGNTIQFARLFEKVYGIDSNIDHLYCAYKNAECYNSAVKLKLIYGDWEES
                     LKKTLVKNLGKTPDCIFASPPWGGVDYLRQDTYDLEEHLQPSPLSKILSVFFSVCQNV
                     VLFLPRNSDLDQLSSITHDLLGPDEKCKVVYVKDNGYMKGILAFWGRPFYDFSEYYPT
                     EIEEEESHELNNKRSSKDLEIKMEDLY"
     gene            <516038..>517816
                     /locus_tag="KLLA0_D06017g"
                     /db_xref="GeneID:2893533"
     mRNA            <516038..>517816
                     /locus_tag="KLLA0_D06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453330.1"
                     /db_xref="GeneID:2893533"
     CDS             516038..517816
                     /locus_tag="KLLA0_D06017g"
                     /note="weakly similar to uniprot|Q99299 Saccharomyces
                     cerevisiae YPL158C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453330.1"
                     /db_xref="GeneID:2893533"
                     /db_xref="GOA:Q6CRV9"
                     /translation="MIRTPTRTKTKSYNGSQSEFRFPDVEVLAHLKLPEHGLNNHHLL
                     NEQLNKKPEDDIHSQHLSDYTTTNSNSGNSSNGYYSFANISDNTTNPDKLSAVKNTAC
                     AIGNNRYSYISSSGSSVHYPGTLAPDRTPRICPTNSPEFGRPLDGNFDMQCIPEAYST
                     VTSDFTLPTADNISFQFTLSSGNSTAMLKKRSTPSTKTRNATNLSEKRKSSVKRSTST
                     VSRRSNIKRSNAIRCKGGLLHYFTKLGKRVRLNLKKFHLALKRKLFTYKQRHFAKSDK
                     RTTSHLLRSNGYFANIKRSQSMRSMASYSDTSSPTVPSGLDIKNTPIVKHSSNINHRS
                     LRRTPSSIKRAASILTSSNSLIFSRSNSSVGRTDSTRLVRSQPSLNLNLAVRQPSIVV
                     KNKVIPLSQFDHDDYCIREEDEDEEDEDEYIIDTQKMQPLKSEMGSITSSLHDGDSVF
                     EDAMSSSASMESLSESVKILNANKAWDSYLRAVISQRILMRLQVAKFQASQDHHTYKE
                     LLDAIVTDYESDAIFSNNDAQTENDSMSECDSPHEFDTLTDSSRSTPAVVPQSLRESF
                     SSLANFQTSVKAGVRRNLTLPVGISI"
     gene            complement(<518035..>519357)
                     /locus_tag="KLLA0_D06039g"
                     /db_xref="GeneID:2893234"
     mRNA            complement(<518035..>519357)
                     /locus_tag="KLLA0_D06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453331.1"
                     /db_xref="GeneID:2893234"
     CDS             complement(518035..519357)
                     /locus_tag="KLLA0_D06039g"
                     /note="similar to uniprot|Q03649 Saccharomyces cerevisiae
                     YMR210W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453331.1"
                     /db_xref="GeneID:2893234"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV8"
                     /translation="MVLGELYSLLPWVQTVQQFLPDELLQFNSEPGKTAKSVSIKSLI
                     DKYAPEFQHNSKCVIPPFLCSGHMQTIFASMFTFESKHLVYYKRYILNYPDGGEGALD
                     VCVPQSLWKETGYVPKNQRNQLLPRYTYFDADEKFGSSDTKPMLIILHGLTGGSNESY
                     VRSLVDTITNEYNFEACVLNSRGCCQSSITTPFLYCGLWTDDVRFCVKELRNKFPNRK
                     FFLCGVSLGASMTANYLGQESDQSDVELGVVLGNPWDLTASSYHLERNLIGKYAYTPA
                     LAKNLVKLTTSHLDVLKQNPEMARMYADHLHEVKTVEEFDNFFTARMFGFNTSFEYYR
                     HGTSSNRLNKLRTPLLILNALDDPIVGCEALPYREVQSNPYTLMLTTTRGGHIGWFDM
                     NLDRWYVKPLCRLLHKFYTDISMQGLAPDLKSVDLPKENKFKNDRIIR"
     gene            <520082..>520831
                     /locus_tag="KLLA0_D06061g"
                     /db_xref="GeneID:2892758"
     mRNA            <520082..>520831
                     /locus_tag="KLLA0_D06061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453332.1"
                     /db_xref="GeneID:2892758"
     CDS             520082..520831
                     /locus_tag="KLLA0_D06061g"
                     /note="weakly similar to uniprot|Q99373 Saccharomyces
                     cerevisiae YPL159C PET20 Protein required for respiratory
                     growth and stability of the mitochondrial genome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453332.1"
                     /db_xref="GeneID:2892758"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV7"
                     /translation="MMFSNVRLGSRSIYVKNRISAVSLINGVRNQSSVNFQNNQMLQK
                     QNLKQSKLKSKRSKRKEDGDLVDSMKLEGKQESSASASSSPSAELGKDSEEKIIKMAT
                     KKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLEKL
                     SEPVPWVSSATGQEFFSEWDNVPSEIIKDLKPFHPPSIEETNNAKNKEAKEKLQKQIL
                     LNEQDKLINRKRGRKKPIIRLLDLKRKFEKE"
     gene            complement(<521215..>521565)
                     /locus_tag="KLLA0_D06083g"
                     /db_xref="GeneID:2892707"
     mRNA            complement(<521215..>521565)
                     /locus_tag="KLLA0_D06083g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453333.1"
                     /db_xref="GeneID:2892707"
     CDS             complement(521215..521565)
                     /locus_tag="KLLA0_D06083g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453333.1"
                     /db_xref="GeneID:2892707"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV6"
                     /translation="MGWHDSVSLQLVKEDCDKVFAEYFNDAEQFIVYSRQQDFDLDTC
                     MELCDTIETLNGSTLETRNDMLSAQFDFRTKLENYEALPSFETVEKIIHHSYSGNSCS
                     EAKNSKKSSKINDV"
     gene            complement(<522480..>525767)
                     /locus_tag="KLLA0_D06105g"
                     /db_xref="GeneID:2892696"
     mRNA            complement(<522480..>525767)
                     /locus_tag="KLLA0_D06105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453334.1"
                     /db_xref="GeneID:2892696"
     CDS             complement(522480..525767)
                     /locus_tag="KLLA0_D06105g"
                     /note="highly similar to uniprot|P26637 Saccharomyces
                     cerevisiae YPL160W CDC60 Cytosolic leucyl tRNA synthetase
                     ligates leucine to the appropriate tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453334.1"
                     /db_xref="GeneID:2892696"
                     /db_xref="GOA:Q6CRV5"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV5"
                     /translation="MSAATETKGLVLENTARRDALIAIEKKYQKIWAEEHQFEIDAPT
                     LDEENVSVDPEELQKKYPKFMSSFAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRA
                     LFPIGFHCTGMPILACADKLKREAELFGNDYSNVPAEDAEEEQEAKPAAQSDDVTKFK
                     AKKSKAAAKQGRGKYQFEIMLQLGIAREDVIKFADASYWLTYFPPLTETDCTSFGARI
                     DWRRSFITTDLNPYYDQFIKWQMKKLKDLGKIKFGERYTIYSEKDGQPCMDHDRQSGE
                     AVTPQEYLGIKIEVTEFAEEAKKIVAESTLDHSKKIYFVAATLRPETMYGQTCCFVSP
                     TINYGIFDAGDCYYITTERAFKNMSYQKLTPERGNYKPVVSVLGKHFVGSKIHAPLTP
                     YPELRILPMDTVIATKGTGVVTCVPTNSPDDYMTTQDLKHKPEYYGIDPEWINHELVP
                     VIHTDRYGDLTAKSLCEELKIKSPKDTNQLAEAKKLAYKEDFYSGVMIYGKYKGEKVE
                     TAKAKVKSDMIANNEAFVYNEPESVVISRSGDECIVSLEDQWYVDYGEEEWKKQAIEC
                     LEGMELFAPEVKNAFESVLDWLRNWAVSRSYGLGTRLPWDPKYLVESLSDSTIYQSFY
                     TIAHLLFKDYYGNEIGPLGIKAEQMTDEVFDYVFQHVDEVKNTDIPLESLQKLRREFE
                     YFYPLDVSISGKDLIPNHLTFFIYTHVALFPRKFWPKGIRVNGHLMLNNAKMSKSTGN
                     FMTLHDMVTKFGADASRIALADAGDTVEDANLDESNANAAILRLYNLKEWAEEMVKDI
                     GNLRTDSEYGFFDIAFENEMNSLIEQTYKQYAATNYKSAMKYGLFDYQAARDYYREAS
                     DVMHRDLVLRYIETQVLLLAPVAPHFADYIYREVLKKEGSVQNAKFPTVNKPVDIGIS
                     VSLEYVRDLQRSIREAEGQALKKKKGKGSDVDASKPAKLTLYIIETFPEWQTKYIDLV
                     RELFENQTLDDNKVVKTKVDPKDMKRAMPFISLLKQRLTTESPESVFTRDLLFNEIET
                     VKSTFDILKKSSQSIKISEYEILSLPYGSETAKNVFTNEEVTIQKSKAIENAIPGEPA
                     ILIKNVE"
     gene            complement(<526164..>527156)
                     /locus_tag="KLLA0_D06127g"
                     /db_xref="GeneID:2892715"
     mRNA            complement(<526164..>527156)
                     /locus_tag="KLLA0_D06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453335.1"
                     /db_xref="GeneID:2892715"
     CDS             complement(526164..527156)
                     /locus_tag="KLLA0_D06127g"
                     /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
                     YOR246C Protein with similarity to oxidoreductases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453335.1"
                     /db_xref="GeneID:2892715"
                     /db_xref="GOA:Q6CRV4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV4"
                     /translation="MWEEFDITKLPYYDPKVDNKVALVTGGNSGIGYYTVLHLYLHGF
                     KVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEKPHDGLMIRKTGKLEYLHIDLTDLN
                     SVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKDNFEIQMQTNYVSHFLLTMRLLPL
                     IKARKGRVITVSSLGHNLIFFNCNPGAQFNYWPSMFFMWCRYALAKTASIQFTKMLAI
                     KNPDILCMSLHPGLVMNTNLFSYCTRLPFVGIFFWILFQFVGYFFGVSNEQGAISTLK
                     CALSSDLSAETDNGAYFTTGGYPSKPSRVANSLDNAASTWIWTVHELRDRGHEI"
     STS             526248..527798
                     /standard_name="ha3288"
                     /db_xref="UniSTS:515673"
     gene            <527705..>528754
                     /locus_tag="KLLA0_D06149g"
                     /db_xref="GeneID:2892851"
     mRNA            <527705..>528754
                     /locus_tag="KLLA0_D06149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453336.1"
                     /db_xref="GeneID:2892851"
     CDS             527705..528754
                     /locus_tag="KLLA0_D06149g"
                     /note="similar to uniprot|Q03289 Saccharomyces cerevisiae
                     YDR459C likely functions in pathway(s) outside Ras"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453336.1"
                     /db_xref="GeneID:2892851"
                     /db_xref="GOA:Q6CRV3"
                     /db_xref="InterPro:IPR001594"
                     /translation="MAWSLGTLRVTSHPYFRLLIPFLTVLLQCYGVWAFCHQFCYLQL
                     YQRRNAKGACIGLIIVVLSLTFLIWYIWALMLVLGPGRQPTIPPFKIIPDSEIRTVSS
                     ESAVPDNSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIG
                     TVLGRLNYKLFVQFTFYLDLVVLILMISIATQMRQMKGSANGNVYAVFALACCALLMA
                     GPLFLTHIYYMCYNRTSIEIIEVNNKAKASRKFFCIYNPCDGYRYVIQFCPGENQDFW
                     NKGNILTNLKEFLGPNYLSWFIPSILTHKQSYGKSSANYYDLIGDCNEVMSEKFQKYM
                     IDKIERKEYVTRLVV"
     gene            complement(<528904..>531318)
                     /locus_tag="KLLA0_D06171g"
                     /db_xref="GeneID:2892744"
     mRNA            complement(<528904..>531318)
                     /locus_tag="KLLA0_D06171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453337.1"
                     /db_xref="GeneID:2892744"
     CDS             complement(528904..531318)
                     /locus_tag="KLLA0_D06171g"
                     /note="similar to uniprot|P15274 Saccharomyces cerevisiae
                     YML035C AMD1 AMP deaminase tetrameric enzyme that
                     catalyzes the deamination of AMP to form IMP and ammonia
                     may be involved in regulation of intracellular adenine
                     nucleotide pools"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453337.1"
                     /db_xref="GeneID:2892744"
                     /db_xref="GOA:Q6CRV2"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV2"
                     /translation="MNGFDIDNSMKQSQLEMPYPNEGEGGQHQNTHEFATSYDAEEDP
                     NDVDNHSISTHFSYHDGKSLLEQGIKKLALDHLHSNNASVDSNLGMKSQFPSYFGNSP
                     LDAAASVAAAGIPRHERRLSLSAQQAEPEVLISSPMSQKPSSSSSAQILDVERIKSAQ
                     YKMGLIADDGQHSYDSPSLELVELYSSVSDCRELREKYQTLSLQKHHQNPKNRPDWKI
                     YPPPPKPSYNAANKTVVKVSNLPDSKSFDINECEIPGLDEDVDFRLNSDEVYVLYDTK
                     TEDKKQAGNVFPTLREYYIDMEKIISVSSDGPAKSFAFRRLQYLEARWNLYSLLNEYH
                     ETAVSKKNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLRHSKDEKVIFRDEKIL
                     TLEEVFQSLKLSGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTDNY
                     IDGKYLAEITTEVISDLENSKYQNCEYRISIYGRSPDEWDKLAAWVVDNKLISHNVRW
                     LIQIPRLYDVYKKTGIVENFFDICKSIFLPLFEVTQNPQSHPKLHIFLQRVVGFDSVD
                     DESKVDRRFQKKYPKPTLWDSTQNPPYSYQLYYLYANIASLNWWRAKRGFNTLVLRPH
                     CGEAGDPEHLISAYLLAQGINHGILLRKIPFVQYLFYLDQIGIAMSPLSNNALFLTYD
                     KNPFQYYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELAKNSVM
                     QSGWEAQIKRHWIGKHFEKEGIEGNDLEKTNVPDIRVNYRYETLKTELELVKHFSSFA
                     SLSASK"
     gene            complement(<531646..>532026)
                     /locus_tag="KLLA0_D06193g"
                     /db_xref="GeneID:2892718"
     mRNA            complement(<531646..>532026)
                     /locus_tag="KLLA0_D06193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453338.1"
                     /db_xref="GeneID:2892718"
     CDS             complement(531646..532026)
                     /locus_tag="KLLA0_D06193g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453338.1"
                     /db_xref="GeneID:2892718"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV1"
                     /translation="MISDPRFQYDNVLFVDDDDTSETVIFNIRSWYLTLVGILVKYGS
                     QSISDATTMLDNSWLIKGFCCETYKQVCLYSHEYEYYWAMLVLHGDLFWRRGISGDLP
                     TGYDQWEQEYIRANGLAESIFEFS"
     gene            <532434..>533144
                     /locus_tag="KLLA0_D06215g"
                     /db_xref="GeneID:2892886"
     mRNA            <532434..>533144
                     /locus_tag="KLLA0_D06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453339.1"
                     /db_xref="GeneID:2892886"
     CDS             532434..533144
                     /locus_tag="KLLA0_D06215g"
                     /note="similar to uniprot|P40586 Saccharomyces cerevisiae
                     YIR042C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453339.1"
                     /db_xref="GeneID:2892886"
                     /db_xref="GOA:Q6CRV0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CRV0"
                     /translation="MSVLLNQFEQPVGKPIYDWTVRKLPEDIVVHGEHCLVESLDVNK
                     HAEDLFKAYNASPDSIWTYLPSEPRRTFSELKGYLEGLAKLPLSKTYAIINKKTGKAV
                     GTFSLIRTDINNGVIEVGFVLFSKDMQRTLISTEAHYLLMNYVFEDLGYRRYEWKCDS
                     LNKPSGNAAQRLGFKFEGTFRNAMIYKQRTRDTCWFSIIDEEWAVARTAFKNWLSKNN
                     FDQAGKQLESLLEIRSRL"
     gene            complement(<533640..>535472)
                     /locus_tag="KLLA0_D06237g"
                     /db_xref="GeneID:2892840"
     mRNA            complement(<533640..>535472)
                     /locus_tag="KLLA0_D06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453340.1"
                     /db_xref="GeneID:2892840"
     CDS             complement(533640..535472)
                     /locus_tag="KLLA0_D06237g"
                     /note="similar to uniprot|P32864 Saccharomyces cerevisiae
                     YOR370C MRS6 Rab escort protein forms a complex with the
                     Ras-like small GTPase Ypt1p that is required for the
                     prenylation of Ypt1p by protein geranylgeranyltransferase
                     type II (Bet2p-Bet4p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453340.1"
                     /db_xref="GeneID:2892840"
                     /db_xref="GOA:Q6CRU9"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU9"
                     /translation="MLNAERRPSMAERRPSFFSPGPDGSLQSTSLVVPHLAGIEDPLP
                     ETTPEQVDVLIAGTGLIESILSASLAWQGSTVLHIDSNNYYGDTWATMTIDQLKNWTN
                     QVNEDSDETRFYKDARLYVSGLVAQGKFKSKNFGIDLSPKILFAQSDLLSVLIKSRVH
                     QYLEFQSLSNFHTFENDNFERLTNSKQEIFTDQTLPLMTKRNLMRFIKFVLEWEKSTD
                     IWKPYAEQPLASFLVDKFKLEKPQVFELIFSIGMCRNLDTKTPEGLARIRRFLTSFDV
                     YGPFPVLYSKYGGPGELSQGFCRSAAVAGATYKLNHKLVSYDPNSQTAVFEDGSRVRV
                     TEKVVASPTQHPQNGGNIPPQKYEVHRLTCVVEKDCSQWFSEGESAAMVVFPPDSLKT
                     GNVEAVQVVILGSGAEVCEPGTCVWYFSTTQAGPRGDLDLDAALEAMINSILRESSDI
                     PNEDELVQINSNGVPLVNSVKLGQSFKELISKERVNFIMKLYYTQYTSTPPFDIVTPD
                     LFDLNKSKEFIPGASDNGILYTSLPSGEVSYDEVITAAKFLYEKIVGSDDDFFDLDFE
                     NDEPDLKNTNKTINSYDESAIADDEEDIQMMDSEPVEFAGEMEI"
     gene            complement(<536532..>538877)
                     /locus_tag="KLLA0_D06259g"
                     /db_xref="GeneID:2892837"
     mRNA            complement(<536532..>538877)
                     /locus_tag="KLLA0_D06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453341.1"
                     /db_xref="GeneID:2892837"
     CDS             complement(536532..538877)
                     /locus_tag="KLLA0_D06259g"
                     /note="similar to uniprot|P40309 Saccharomyces cerevisiae
                     YJL094C KHA1 Putative K /H antiporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453341.1"
                     /db_xref="GeneID:2892837"
                     /db_xref="GOA:Q6CRU8"
                     /db_xref="InterPro:IPR004771"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU8"
                     /translation="MANTVGGVLSGVNPFIYNSGSPITFFLIQAALILVLTNVLHVFI
                     SKLRQPKVISEVIAGIILGPTVFGQIPNYLTTIFPAGSVTGLNLVANLGIILFMFFLG
                     MEVDISFVKRNAKAAISIGLATLIVPFGFGCLFALPLYNAYMDGHGIEFKVFMVFIAV
                     SLSITAFPVLCRILTELRLVKERVGIIVLTSGTINDVVGWILLALCIILSNSQSDPVN
                     VVYILLCTFGWFLFCCYPVRLTLKWGFNRFHEFERDSPSTFATLLILVIVLLSAYFTD
                     IIGVHPIFGAFIAGIIVPRENNYVSKLTARMEDIPNLLMIPIYFTIAGLNVDLTLLNK
                     GSDWGYIFASIGIAVATKVVSGALLSKINGLCWRESLAVGVLMSCKGIVEIVVLTTGL
                     NAGIITKKVYAMFIFMALISTFITTPLTLWIFPDHYRNELKRQRTDGSTSEIVPNTVG
                     KTKDLKHMHFSTVELVINNAKAVALSLWFIKAFSSGQEEWKEMFTSDSGDLEKKHLKK
                     VLSTDTEALTVVSDDDESPLLVNARNLKLMSDRTAEILELTSLYNSLTSADNGLEMLR
                     VFSSLFGLKFKGEVMFSSLGEKVGYIGKIPVANNTTLLIPLNYPNGEQSESISRILSF
                     NDLPEDFFSTLSSKISSSLVLLFGTVVHQQPTSVLVYLLNSTLTGSDYMALFLGLVMG
                     LHAKTIKIVTVSEHLVALGELQEILRSSILIKLDITTISTNETDSAVASVDVFNDIEL
                     NNKSLVVLPQDSIKSTCLDDYSKVLVTKASKSGSTVAICHR"
     gene            <540031..>542289
                     /locus_tag="KLLA0_D06281g"
                     /db_xref="GeneID:2892868"
     mRNA            <540031..>542289
                     /locus_tag="KLLA0_D06281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453342.1"
                     /db_xref="GeneID:2892868"
     CDS             540031..542289
                     /locus_tag="KLLA0_D06281g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453342.1"
                     /db_xref="GeneID:2892868"
                     /db_xref="GOA:Q6CRU7"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU7"
                     /translation="MSIAISRKLLSNRKALYGEKELCSSDPIESIDDILFTFVAELNK
                     LGYQFSENAQDYLRTLSVNELTEFRSMAKTVLEEALGADVKYVPLFRKFPESIPDRSL
                     LVEAVYESLGDLTHLLFFNFYGYWSSSEYNGSWFGRQYPDLELQEAIKRPELITGKEL
                     TTLDIVGRGVVLELFENLANSKTSTSASDKEFINSVIATGNDWKSSLPEVIPSKENLV
                     HIIGCAATKSGPFDEELQKLFSTHIKTATDVLRLAASFSGSDVALTKHTRFKISNSQR
                     KFLLFALNKLDRETAMEDILRFLGLWLVLAKYLHVNAYASRYPNAAKMIQTIRGNQKS
                     IKTFNRTIETALRARKDLKNEGNMESSLESIIHILKARPGDFARRLDHLLRSYPSTEH
                     AQIVISFLDVASSVSTPLLLNLSTHFQYRHEISPIRVFLPKGSATNAIIEDEDERQTY
                     SSELCSNLYKGIDSVLIERFSKLEPLGNIFIDPILEDYIPPIGLRDASEALHTFGRGS
                     KMRFDKNSKVIRLFLYWENIKETQGAAHEGRVDVDLSCLQLSDNFENKGEIAYYNLAN
                     GAVTHSGDFTDATNGAAEFIDVKLDDIKEAFPETRYIAVTVNSYTGQKFNTFTAKAGF
                     MIRDNISGEHFEPKTVEQKFDLLSASRFNIPMVLDLYENTIIWLDLAISQNKIYNVNL
                     HEKTPLVGSLAKYALNIYREKCNLLKLMQLHGEARAQTVSAQHDPEKDYDHCFDENFA
                     SKTDEIVGNFLI"
     gene            <542884..>543486
                     /locus_tag="KLLA0_D06303g"
                     /db_xref="GeneID:2892782"
     mRNA            <542884..>543486
                     /locus_tag="KLLA0_D06303g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453343.1"
                     /db_xref="GeneID:2892782"
     CDS             542884..543486
                     /locus_tag="KLLA0_D06303g"
                     /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
                     YOR367W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453343.1"
                     /db_xref="GeneID:2892782"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU6"
                     /translation="MSYGIKPDVTSLDDDLKESRSKKFNKHDITEIKRWIYAIIEEQS
                     PDDSLLDALKDGTVLCKLANRLLKEETGVSDSMKWKSSRIAFVQMEQISMFLQFATKY
                     GVPQDELFQTVDLYEEKDPAIVYQTIKSLSRYANSKHPDLFPVIGPQLSTKRPRPPVK
                     GKPSHLKNVGWSTVEYGYMKGANQSTEGIVFGNKRDITMN"
     gene            complement(543828..543943)
                     /locus_tag="KLLA0_D06336r"
                     /db_xref="GeneID:2892956"
     tRNA            complement(join(543828..543872,543905..543943))
                     /locus_tag="KLLA0_D06336r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2892956"
     gene            complement(<544437..>545738)
                     /locus_tag="KLLA0_D06380g"
                     /db_xref="GeneID:2892973"
     mRNA            complement(<544437..>545738)
                     /locus_tag="KLLA0_D06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453345.1"
                     /db_xref="GeneID:2892973"
     CDS             complement(544437..545738)
                     /locus_tag="KLLA0_D06380g"
                     /note="similar to uniprot|P38355 Saccharomyces cerevisiae
                     YBR287W ZSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453345.1"
                     /db_xref="GeneID:2892973"
                     /db_xref="GOA:Q6CRU4"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU4"
                     /translation="MAGPSSTNPTGLSFSHLSYLTFESVLQVVIISFAGFWCAYTGLL
                     PKQGQKIVSLLNVDLFTPCLIFSKLAKSLSLAKILEISIIPLFYALTTGISFLSGKLL
                     SYLFGFDVDETNFVVANSIFGNSNSLPVSLTLSLAYTLPDLTWDQIPDDSRDNVASRG
                     ILYLLIFQQIGQVLRWSWGYNKLMRWSEDSVHHNHRISSQLESQATLGNDPNNVSSLS
                     LQSESTSAASQQEVNLRESPYYAGTFTKLKQQTCFYIAKVRSFMNPPLYSMLFSVIVA
                     SIPPLQHEFFQADGFINNTLSEAIAELGSVSIPLILIVLGSNLYPSGETAALTKNHKK
                     LVFASIMGRMVLPSCFILPIIAGCVKFIKVSILDDPIFLVVGFILTVSPPAIQLTQIT
                     QLNEFFEAEMANVLFWGYVVLTLPISIIIVSIAITVLQWAQ"
     gene            <547385..>549280
                     /locus_tag="KLLA0_D06402g"
                     /db_xref="GeneID:2893046"
     mRNA            <547385..>549280
                     /locus_tag="KLLA0_D06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453346.1"
                     /db_xref="GeneID:2893046"
     CDS             547385..549280
                     /locus_tag="KLLA0_D06402g"
                     /note="weakly similar to uniprot|P40358 Saccharomyces
                     cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
                     nuclear membrane fusion during mating localizes to the ER
                     membrane exhibits genetic interactions with KAR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453346.1"
                     /db_xref="GeneID:2893046"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU3"
                     /translation="MSVWYTWISLSLLIFHGLSSIDKVHGSDVDPICDLANVTKVIEA
                     QKFDRESIQEYQDLIPMIRTHCDGKQWDRIINQINYNLGITYLSLGQEPQALKSFNAV
                     IDSDESSFKELSVSRLNELNKKYADWNKISDPASKTDEELFNELYDSISTKLGKPDSM
                     EYLEAKFQEILTISPFSLKVRILYNDFLLDQIADVIDLNFAHKAVENIQTILDKFGNK
                     IELDKRLALHHELAVIQLFILNTQPQVSLRKCLNLDMDYQPCKDLMRVWNQISKVLPQ
                     PSRIMNADEYTDFDTEWNKISQFLLDNKRSVVKTYGMKEQNFEVLTKYHNDQIKKVLE
                     ERPLSSKTWTYENFDAQTDFMIYLNAALCESLDMQASSKKASKYCYNAMKQSLTPDEI
                     QNLKHYLKTFDSPHIIKELLTALFDTYPHISVNLLHSVAQKLSIAEKKHPGINSAEHW
                     AVLFKFAQDNNLAHSRLKFVKNLANVVTKTYHSIQQQQQQKQQQYFQQMFGNQQQYHQ
                     QQQHQQQQQFAEPNIKTDKDYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDE
                     QRQKNEEKMAEINEAYEILSDDDKRTKYDNARANSRNSRGAHGFEGHGGFKPFDKSAK
                     YHRKKQN"
     gene            complement(<549532..>551109)
                     /locus_tag="KLLA0_D06424g"
                     /db_xref="GeneID:2893078"
     mRNA            complement(<549532..>551109)
                     /locus_tag="KLLA0_D06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453347.1"
                     /db_xref="GeneID:2893078"
     CDS             complement(549532..551109)
                     /locus_tag="KLLA0_D06424g"
                     /note="similar to uniprot|P37302 Saccharomyces cerevisiae
                     YBR286W APE3 Vacuolar aminopeptidase Y processed to mature
                     form by Prb1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453347.1"
                     /db_xref="GeneID:2893078"
                     /db_xref="GOA:Q6CRU2"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR029514"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU2"
                     /translation="MKVAGIIGSIAAANIVGASILPQYIQEVFSTGEVSESLQNLSDF
                     FEDGSKSSVFTWPHLPYFLKPGVDSEKLQDSITIDQLNDTAWDLYHAANASTKQYGHP
                     TRVIGSKGHWKTIGYILSQLDEHKDYYDISVQSFPALTGKVNSFNLSFVGGDKVPTAT
                     PFALTPPVKGFLGKLIEIPNLGCDDIDYKSLVVPKNSIALIERGQCPFGRKSNLAGKH
                     GFKAALIYDNDPLSKDGIKGTLEKPDKHTVATIGVSYKEGKKLIAALELHQGDYSLYF
                     EVDSFVKNIKTKNIIADTKHGDPENIVALGAHSDSVSNGPGINDDGSGAISLLTVAKQ
                     LTGYKINNKVRFAWWAAEEEGLLGSVFYADHLSPEENSKIRLFMDYDMMASPNYEYQV
                     YDANNKDHPAGSKELKNLYIDYYQSKNLTYSLIPFDGRSDYVGFINHGIPSGGIATGA
                     EGINDENGLPFDKCYHSLCDDVSNLAFDAFLVNTQLIAHSVATYAKSLEDFPQRNLNV
                     TSENVADFSYRGSHLIL"
     gene            complement(<551644..>555915)
                     /locus_tag="KLLA0_D06446g"
                     /db_xref="GeneID:2893079"
     mRNA            complement(<551644..>555915)
                     /locus_tag="KLLA0_D06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453348.1"
                     /db_xref="GeneID:2893079"
     CDS             complement(551644..555915)
                     /locus_tag="KLLA0_D06446g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453348.1"
                     /db_xref="GeneID:2893079"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:Q6CRU1"
                     /translation="MRLSGMCISGFIASEIVLAYEHIYSNTSTVSSYSENVESEEQTT
                     TWVSVTSTTGQKEVVTTSPALVSLSTLTLDDVVTVFTTWCPLTETESGTASSAEVTGT
                     EPGTTSTEPEDTTEMSITSWQTVTISTEVCDEDYICTDTTYVHSVPIYVSVTDTDEET
                     DTTNKYSTEDLEHTATTPNTLTSSTILEEESSDALTQSTAADSESSEIIRSSTLTTAD
                     ERGVTITTVESSSLSTHTTVVNGVVTVYTTWCPLTETSASESVSTTEDVSTGESTESS
                     ESPTSTEDVSTDESTSTTEAASTSENVSTAESTESSESPTSTEDVSTGESTESSESPT
                     STEDVSTDESTSTTEAASTSENVSTAESTESSESPTSTEDVSTDESTSTTEAASTSEN
                     VSTAESTESSESPTSTEDVSTGESTESSESPTSTEDVSTDESTSTTEAASTSENVSTA
                     ESTESSESPTSTEDVSTDESTSTTEAASTSENVSTGESTESSESPTSTEDVSTDESTS
                     TTEAASTSENVSTAESTESSESPTSTEDVSTDESTSTTEAASTSENVSTAESTESSES
                     PTSTEDVSIEEWTSTESFESISESQLTSTDATTTVSQNGTTIESTSSDVPSISTAESE
                     TVEISTITTHKLVTVIISTEVCESKPCSPSTYTSVSTSEIVTSQTISPSSTPSSFTDS
                     TIHNTETVNSETSSGDFDTSVTSECSDEDCMQSFTTLKPTVSTDSESYDSHCDSCTTS
                     VIPITTTDSSGIETTHSTTAVLSTVTTTTNGVVTEYTTWCPLTETTSTSSTLFSVSTS
                     DEEESPKTTKTTSVCSSCETSEISLTSTNSEGSTTVVTTSAVLSTVTTTTKGVVTIYT
                     TWCPITEEDITSQSSTTSSDTAQASSVSSTTSGNSELPSSTETTSSESQLSTTLTEKC
                     SECITSHIPITSTDSHGSVTTKTTSAYLSTVTTTTKGIVTEYTTWCPINEESLTESTT
                     KSTSSSLSELPSTEVSTESTEQSSTETAIESTSSTKKSSIETTAESTSPRTTEQYSTE
                     TTMESTEQSSTETTTESTSTPSSSEQFSTETTIDTSETPLTETTEQPSETAVETASSP
                     TSEQPSTETTIESTPSSSSVPTTNSITSTTSETPTQSSITTESTDDTHTPESSPSLET
                     PVTIAPKCSDCVTSEISTVSTDSTGKEITYSTSAFLSTVTTTTKGIETKYTTWCPLSE
                     TSESSSSSSVTTPSTGSSSISTSASLDSTTSGTSPTDFTTELPSGTTIAPPAEITVTS
                     DERITSSWSSSTVFTPTTQEPSRGTSAPVETSSAINSEEPATVETAETVLPKSSTEST
                     PNIISTDTETSSSGVTRTTPATNVPNTTNKEEHTTTLATPTSPVSSSVPSSAAPSQSS
                     SAPVITTATSTQQTSSSVLVYEGNGNIASANVFVTLTTFVFYFLL"
     gene            complement(<556926..>557447)
                     /locus_tag="KLLA0_D06479g"
                     /db_xref="GeneID:2893081"
     mRNA            complement(<556926..>557447)
                     /locus_tag="KLLA0_D06479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453350.1"
                     /db_xref="GeneID:2893081"
     CDS             complement(556926..557447)
                     /locus_tag="KLLA0_D06479g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453350.1"
                     /db_xref="GeneID:2893081"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT9"
                     /translation="MLSLFPFKLSHSSSSSSKNQQGSSEVKDEFAFKFRETENEFLDI
                     ALMGKSKNKSLAKKTELRDQHSCNLTELPRELQEEVDLSVSEMIEFQNHASGRTFVDD
                     KKRLELQQKLDNVRAGYYSRNLEHVPLHQFIPDDYALDSFEEEKFDPKLFRKIKVDKR
                     RSKNILFSKANRA"
     gene            complement(<558598..>559203)
                     /locus_tag="KLLA0_D06501g"
                     /db_xref="GeneID:2893202"
     mRNA            complement(<558598..>559203)
                     /locus_tag="KLLA0_D06501g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453351.1"
                     /db_xref="GeneID:2893202"
     CDS             complement(558598..559203)
                     /locus_tag="KLLA0_D06501g"
                     /note="similar to uniprot|P40359 Saccharomyces cerevisiae
                     YJL072C PSF2 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453351.1"
                     /db_xref="GeneID:2893202"
                     /db_xref="GOA:Q6CRT8"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /translation="MALPRDLSIGFSPQEIQFLIENEPTRIMPRITTRKTKKQLAKDP
                     GAQWSLITCDDSTVNNMVAMNSCEVTLWLALLLKQQGKCNVVVPSWLTLQQLEKYLDF
                     ELKNPSRFSNLPWNWLVVSSLLFARCSDDFQDPVHLLRSKVQDLREVRLGKVNKGLQY
                     LNESHLQLENLSLMEINEMRPYACGIMDKLRTIHDSSNDTT"
     gene            <559526..>561184
                     /locus_tag="KLLA0_D06523g"
                     /db_xref="GeneID:2893520"
     mRNA            <559526..>561184
                     /locus_tag="KLLA0_D06523g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453352.1"
                     /db_xref="GeneID:2893520"
     CDS             559526..561184
                     /locus_tag="KLLA0_D06523g"
                     /note="similar to uniprot|P40360 Saccharomyces cerevisiae
                     YJL071W ARG2 Acetylglutamate synthase (glutamate
                     N-acetyltransferase) mitochondrial enzyme that catalyzes
                     the first step in the biosynthesis of the arginine
                     precursor ornithine forms a complex with Arg5 6p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453352.1"
                     /db_xref="GeneID:2893520"
                     /db_xref="GOA:Q6CRT7"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /translation="MIKTWIRCLTTEVRYHQPNAHGRSLVMSVLNSTVTKREAKDYLN
                     KYTDENNHHYCLVFLRHLSEYSDNVLSGFSKTVSRIQTLGLRPILIVDPLCQDISYQS
                     QRLDNHLHDQSLKSIIVLDPITIGERGSIDVKLPILNPHIIPIIEPYQYHEKEAFKKL
                     AGDPSRFLSSLVSNLPINIDKVFLISKYGGLPSVERHTNSHVFVNLSQEYRELRNSYQ
                     NQLEKLESIQVDNTEKNLVESLQLFLNQDKILSNSDQLKCHMEDLEIMNKTLSVLPHS
                     STGLITTILAGSKLSDNNPLVYNILTDRSLISSSLPRFKRSAAAQSKSWYELPSSNVE
                     EEVTSANDSVLVTTVFKKGIDIHIFDFRTLTDDNSIGLPPSQATQTGKSDPVSKKLDL
                     NKLNGIINSSFKRSLDLSHYLGRINGNIASIIVIGDYEGIAILTYEGPKDKQFVYLDK
                     FAVAQKLKGSLGISDIIFNLMFRKFPHELIWRSREDNVVNKWYFQRSTGVLHLSLDLG
                     NDDQKQSIFKLFYYGNPESESFHNVERLRDYAKYVRDITPSWHK"
     gene            561671..561742
                     /locus_tag="KLLA0_D06545r"
                     /db_xref="GeneID:2893048"
     tRNA            561671..561742
                     /locus_tag="KLLA0_D06545r"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:2893048"
     gene            <562063..>563340
                     /locus_tag="KLLA0_D06567g"
                     /db_xref="GeneID:2893049"
     mRNA            <562063..>563340
                     /locus_tag="KLLA0_D06567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453353.1"
                     /db_xref="GeneID:2893049"
     CDS             562063..563340
                     /locus_tag="KLLA0_D06567g"
                     /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
                     YPL123C RNY1 RNAse member of the T(2) family of
                     endoribonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453353.1"
                     /db_xref="GeneID:2893049"
                     /db_xref="GOA:Q6CRT6"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /translation="MLLNKGLLASLLAYTTTAFDLQHIFYKEQYSCPISLPASCSNNT
                     EIKDSCCFEFPGGIMLQTQFWDYIPPKGVSDPDELVRHLGPLDSFTNHGLWPDNCDGT
                     YAQFCNRESNIDDVWHLLNDDQFNGRDDLPINGTDLLETMDMYWKSNTGDDESLWVHE
                     YNKHGTCIRTLYPDCYKKWGVAGNSKKQAVYDYFRIAMKLFHDKDTYQTLKSAGIEPS
                     VEKSYTKLEISNALKEGHSGEVVHFLCDRHGSLNQIWYFHSLKGSLLGEKFVPISALP
                     KGSNCPDDNIKWYPKGHVPSSYRPPNGNHPGTRGVVRIGNGKGFLIKNGHWYLKGTPA
                     NFFLIEAPFGNYYLKTRMGYCGIDNSNKVLACNKNVAQAAQFEYDAKKGYIGYNGAYD
                     WYATKYPRGNQQAPVYAGSNDDGYNFQLKFVKA"
     gene            complement(<563451..>564272)
                     /locus_tag="KLLA0_D06589g"
                     /db_xref="GeneID:2893158"
     mRNA            complement(<563451..>564272)
                     /locus_tag="KLLA0_D06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453354.1"
                     /db_xref="GeneID:2893158"
     CDS             complement(563451..564272)
                     /locus_tag="KLLA0_D06589g"
                     /note="some similarities with uniprot|P33419 Saccharomyces
                     cerevisiae YPL124W SPC29 Inner plaque spindle pole body
                     (SPB) component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453354.1"
                     /db_xref="GeneID:2893158"
                     /db_xref="GOA:Q6CRT5"
                     /translation="MDVSQFLNNVENDDTLQNIRKEYLNSKRTLQELMTNQSPTKKME
                     FSKKPTLLQERNSNDYINRNVNSSKPTDDEFLRRQLREGLSRKPEPKISLPSLASDTN
                     RLDSIYSSVNKIDELEKKLYHHELQIQALKNELYQSNASNRALQNKVAELQDSVRMLA
                     ALSHSNVKADTDNSQLSANGKWTRHYAGPNSNGNGVYLDRPQSAPSTSSTSEWVANAL
                     HDSDDTRVLLGWKQPSSTRVDNSSNFHFPHNQPRNLSNFDDNTSRLIGVTGKTRN"
     gene            <565742..>568453
                     /locus_tag="KLLA0_D06611g"
                     /db_xref="GeneID:2893267"
     mRNA            <565742..>568453
                     /locus_tag="KLLA0_D06611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453355.1"
                     /db_xref="GeneID:2893267"
     CDS             565742..568453
                     /locus_tag="KLLA0_D06611g"
                     /note="similar to uniprot|P29461 Saccharomyces cerevisiae
                     YOR208W PTP2 Phosphotyrosine-specific protein phosphatase
                     involved in the inactivation of mitogen-activated protein
                     kinase (MAPK) during osmolarity sensing dephosporylates
                     Hog1p MAPK and regulates its localization localized to the
                     nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453355.1"
                     /db_xref="GeneID:2893267"
                     /db_xref="GOA:Q6CRT4"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT4"
                     /translation="MRMQMSMNMSPSGSTATSSPKIASPAMSNVNGSNGGQHGTSGGF
                     NTNGITGLCLETVNSHCLNINGVKGLRWQRPNSIYADLMEQPQVRDSCLNTVAITDLK
                     PDDSTFLLDLTSHGYPLKDFHTLHVSFPSTLLRRPRTTFHQLISTLHIETQALLKDRL
                     LSSDHIVIYDEHSTLHRCNQQTCSVIMKLIPFLNEQNPSYTISLIEGGPSSFNKQRFP
                     PNVAVPLPSFKISHPEDGKDNNGNSKHPNLKLHIPQVDESQISPNLISSASSTRMFIQ
                     SLKRDSIHYSPNSIKKYFVFHTPEVLPSHVPRWLSPYNTKNDSVVERIFEDFETLEAL
                     EVRRLEKCLMATNPSSNVNSAQNSNNNSSDNTNNSNNNNDNNNNNNNDTSSIRLPEKQ
                     SPHTELGKEYSLRSLQKEYKPNGNLDESDDDTLVMKHSNGSVDEKLRRDIKEELNDSN
                     KHNLIGKLNTVSPGLLPVLKNDADSGITVVSRSSQYPDASDINASNFNEKMANSDEEV
                     VETPLGNYQMTKGIQSFTKNRYSNILPYEHSRVRLQPSPLAEQLTLTSDQLSLLSAPK
                     SGKYDNLTPGGNRRRELELQTVDENAGYFSQDSSPTRLYSHPANRSETTATSETDYDT
                     EPFNDYFNANYLRLPQINPDFNYIATQAPLPSTIDDFWNVVLSKNLKVIISLNSYDEL
                     DMKKWDIYWNSKSIRKHEVKVTNTYEDVFDIPGCILRVMNVSKSDSRIQSPNKRTKFD
                     QLPVKNESRPHTVYQLQYTKWLDSCGINMRDFIHIYHIKNLLLNDPASLFNALNNKTE
                     DFLHTYRKLGLLSVNKNNSGSPVLVHCSAGCGRTGVFITLDFLLGVLDSRSNQSNKID
                     VWNMSADLIFIVVNELRKQRISMVQNLTQYLTCYESMLEFFYLKEHI"
     gene            complement(<568539..>571610)
                     /locus_tag="KLLA0_D06633g"
                     /db_xref="GeneID:2893523"
     mRNA            complement(<568539..>571610)
                     /locus_tag="KLLA0_D06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453356.1"
                     /db_xref="GeneID:2893523"
     CDS             complement(568539..571610)
                     /locus_tag="KLLA0_D06633g"
                     /note="similar to uniprot|Q02932 Saccharomyces cerevisiae
                     YPL125W KAP120 Karyopherin with a role in the assembly or
                     export of 60S ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453356.1"
                     /db_xref="GeneID:2893523"
                     /db_xref="GOA:Q6CRT3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT3"
                     /translation="MSTQLTELALVQVLEQASNPQYAGSEVQRQAEQQIKSWEILPGF
                     HYLLQSIYMDLSVSLQVRWLAIIQFKNGLDKYWRSTRINAITKDEKQQIRNRLFGMID
                     EPNDKLAIQNAQATARVARIDFPVEWPHLFEQVELLLNDESVWKDDVKVYNILIHLNQ
                     IIKTLGVARIGRCRPAMQSKIPLLFPLLTRIYMHYFNKWTNSASLESDDISKLQISYL
                     ALKVLRRVAVDGYESPQKDKSVVEFISLSEQHFQLLLKNYDNFKTVDMYEKFIKCYCK
                     LYFNLISASTANFVMMPSSKTILITFTTLIIERASDVYNENTESQTGFWETIAIRGFS
                     ILKKVINFITKKGAVTIKVRSDKSEVDAAIHKLTTEFLSEDLVKKLIDLLIDWYLRLR
                     PADLEAWSLDPEEWVNEQMSSSYEYQIRPCAENFFQDLIDSFQNLLTPYLLNKIDSEA
                     AQLSDSIDDFLKKDALFCAFQLSSHAITDMVDFNRLLETVFLPEASKSNSSPDQLRII
                     RRRVALIIDAWVTKSSDHSKQQCYQFFLHMFKTESDKVVQLSIVQAFRTMIDDWDFNK
                     SIFEPYLESFVVIFLQQLLPDVSLTETRLYVLNTLTDLIIQTKPLVNKQFLMQILEIV
                     PEFWQLACNEPTESILANVLLRLLRYLSISLGKYSYATWDISLTIIEAACNPNSPHTS
                     LLLEDGLELWHSLLQNYDPTEKSLDGRFLNASPFLLHCVENQTELLPISLEILKSYAI
                     LLPAQEFYSYPAFTEILKHAASYLLLLRDDSYTILLEIWDVLALSDEGENEMSLLFYF
                     SNNSVFKSIFNAIFLQEQLSAYQASQLFQILARISFNGPQNIINLLSDYLKSIDGPLE
                     NSRLPASQRKLVTNETSLDDVLKTFFEIWCKCYGSVYDPKLKKIHLLGISSLLKTGAT
                     PYLLEFKVILSIWVESLEEINESFSGDCEKYHLSDPDSSSDTNCEQARLHELIKKNDP
                     AHNVSIKGFISDTLSYLKSQMDDTSFQKLILSADPVLMENLQLFMSIKPHQ"
     gene            complement(<572219..>573502)
                     /locus_tag="KLLA0_D06655g"
                     /db_xref="GeneID:2893586"
     mRNA            complement(<572219..>573502)
                     /locus_tag="KLLA0_D06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453357.1"
                     /db_xref="GeneID:2893586"
     CDS             complement(572219..573502)
                     /locus_tag="KLLA0_D06655g"
                     /note="highly similar to uniprot|P39683 Saccharomyces
                     cerevisiae YOR209C NPT1 Nicotinate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453357.1"
                     /db_xref="GeneID:2893586"
                     /db_xref="GOA:Q6CRT2"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT2"
                     /translation="MEPVITSFLDTDMYKLTMHAAVYTHFKDVKVKYKYTNRSPQMTF
                     NKEAVEWLKGQFLLLANIRLTTEELKYIKEAIPYLPAEYLEFISNGGFEVNPKDEIKF
                     EAREIEGEPGHYELDISIEGLWIKTIWYEIPVLALVSEAYFKFVDTDWTYDGQVEKAY
                     AKAKKLLDHDIVFSEFGTRRRRSFKTQDLVMQGIINAAKDCDKSKYVLGTSNVLFAKK
                     YNVNPIGTVAHEWMMGIASITNDYLNANKNAMDYWIETFGMENAGLALTDTFGTDSFL
                     KSFYPPYSDAYIGVRQDSGDPILYTEKIAHHYNDVLKLPKFSKIICYSDSLNPDRAIE
                     YAQVAHKHGLKATFGIGTNFTNDFQRKSDVSVKSEPLNIVIKLLEVNGNHAIKISDNL
                     GKNMGDPETVRRVKEELGYVERKYAGDNEAHRWAA"
     gene            complement(<574289..>576844)
                     /locus_tag="KLLA0_D06677g"
                     /db_xref="GeneID:2892764"
     mRNA            complement(<574289..>576844)
                     /locus_tag="KLLA0_D06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453358.1"
                     /db_xref="GeneID:2892764"
     CDS             complement(574289..576844)
                     /locus_tag="KLLA0_D06677g"
                     /note="similar to uniprot|Q02931 YPL126W Saccharomyces
                     cerevisiae NAN1 U3 snoRNP protein component of the small
                     (ribosomal) subunit (SSU) processosome containing U3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453358.1"
                     /db_xref="GeneID:2892764"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT1"
                     /translation="MPNSSLPMYKLSVVSGGKVALPRIHNRSATRKSVSCLTQDGSAY
                     IVPFNNQFKVYSIDTRQCIKTLKFANNDILTSILDEPSVEVVHIEPIIDDEMDKIRVY
                     TNTAKVVILKYKGKLATEIKTWSLNITGELFAVLGDGKKLLTVQKTGNSYRYDLYENV
                     EEKEEESEVKHLETFENVLLSTWSNNNNYLALVYLNQETKKHVLIKSMVDNSSVQNFP
                     VPSTTSSTTINSHFVTALALDNDGQQLAIGFASGVINLINLPDLSHRLLKWHIDSVLS
                     LGFTNDNAYLLSGGWEKVLSFWQLATNMQHFLPRLNGVVLECLPVSDKYYSLVLQFAE
                     NNTNSDYQITLLNATDLSSILAINGPFPVFDTITNDVEQPISTVNSKSSVSSSNMLQS
                     KKKQKRKLLKRKKHDFTAPLSVHPSTKHLYLPHVSSLQSYDLYKNEQVSYQYVTSSVN
                     NAAGKVRLELTIQDPVVQDVKFTLDGFWMITYEVEYPPEGLLSSKELSHVLKFWKLDD
                     NKEWELKTKVLNPHGNNVPVTNITTAPNSINSSQGCLTADNNGGLKYWKFDSKQNNWC
                     LNRLLLPNYNHFSNSVQLAWSLDGSLIFHAFEDKLSTIEFSEFKLLEDENELPIERTL
                     DTPIQALTLVNDSTLIISTKTSLHSFNLLTQSTISSFDIYPYVNGVYKPGHFARLLAC
                     DANTGRIALAINQQAAGTDGNPTLQHKANILIFNSDLTEKLGSFEHNEYISSLVWNYA
                     ADFIFMDIQSRLGIVSTTTSSEMVDESNNDQAFESLHPDSFSEKLQELTRKKGLANTD
                     AEDGVDEDIDLEFINGNLSQNKTINMNSFTSLFENIDNVQMNTLFDRVMKIIT"
     gene            <577334..>577546
                     /locus_tag="KLLA0_D06699g"
                     /db_xref="GeneID:2892808"
     mRNA            <577334..>577546
                     /locus_tag="KLLA0_D06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453359.1"
                     /db_xref="GeneID:2892808"
     CDS             577334..577546
                     /locus_tag="KLLA0_D06699g"
                     /note="highly similar to uniprot|P22139 Saccharomyces
                     cerevisiae YOR210W RPB10 RNA polymerase subunit ABC10-beta
                     common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453359.1"
                     /db_xref="GeneID:2892808"
                     /db_xref="GOA:Q6CRT0"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:Q6CRT0"
                     /translation="MIVPVRCFSCGKVVGDKWEAYLNMLQEEELEEGTALTRLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLEKRD"
     gene            complement(<578072..>580723)
                     /locus_tag="KLLA0_D06721g"
                     /db_xref="GeneID:2892882"
     mRNA            complement(<578072..>580723)
                     /locus_tag="KLLA0_D06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453360.1"
                     /db_xref="GeneID:2892882"
     CDS             complement(578072..580723)
                     /locus_tag="KLLA0_D06721g"
                     /note="similar to uniprot|P32266 YOR211C Saccharomyces
                     cerevisiae MGM1 Mitochondrial GTPase related to dynamin
                     present in a complex containing Ugo1p and Fzo1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453360.1"
                     /db_xref="GeneID:2892882"
                     /db_xref="GOA:Q6CRS9"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS9"
                     /translation="MFANQCRRVLFRQLWMGPARTGALRFMVRPSIMSNVTNDMKGPF
                     ALTNKRFASFFPSMIGKMVRIPAYVGGGAAAFGSYVAYKVNEAGQFTQDQLSKFKDFT
                     GDVKDKLGDWFQRDGQSDDGGNSGDNNGSDAVAAATLLASLSDDENDDEGKTLKNQHD
                     EEESADGKRRKKNGNDEDEEDDDLEEAEDNTQDEMLNLTKQMIEIRSILNKVDSTSAN
                     LALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVNTPTSQEVTADF
                     PTMRIYNLKDFKEVKRILTEMNMAVPSTEAVSDDPIQLTIKSSRVPDLSLVDLPGYIQ
                     VEAVDQPIELKSKIRQLCDKYLEEPNIILAISAADVDLANSAALRASKVADPQGLRTI
                     GVVTKLDLVDAKTARAILNNRKYPLKMGYVGVITKSPSTTPVQRLFDNRSSGSHLFSK
                     KKTDPTETTAITQTKQFENEFFKEHKKDFTACQVSTKKLREKLIKILEVSMSNALEPT
                     SRLIQQELDDAAYLFKVEFNDRQLTPKSYLLNNIDVLKVAIKEFQEKFGRNDLKSILK
                     ADLDQKVLDLLAARYWKDLNLPELSTSQDLEDESSALYWHRKLELAQSSLTKIGVGRL
                     STSLVTNAIIQELNNILNQSQLRNHDLIKELVTNTAVNVLNSKYYSTADQVENCIKPF
                     KYEIDLEDRDWSLAQEHSVLLIKEELRQCNDRFNMIKNAVGNRKLNQVIQFLKQDPNR
                     KETLGFSALLLERGHEAMFLQDRSSLLNFRLKFLKNKCFSVTQKDKCPEVFLNAVSDK
                     LTSTAVLFLNVELLSDFFYNFPIELDKKLSLLSDEQVEMFAKEDVRIARHIELQKRKE
                     LLELALEKIDSILMFRKSYKGLSKRNL"
     gene            <583615..>585036
                     /locus_tag="KLLA0_D06765g"
                     /db_xref="GeneID:2892959"
     mRNA            <583615..>585036
                     /locus_tag="KLLA0_D06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453362.1"
                     /db_xref="GeneID:2892959"
     CDS             583615..585036
                     /locus_tag="KLLA0_D06765g"
                     /note="weakly similar to uniprot|Q02457 YPL128C
                     Saccharomyces cerevisiae TBF1 TTAGGG repeat binding
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453362.1"
                     /db_xref="GeneID:2892959"
                     /db_xref="GOA:Q6CRS7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS7"
                     /translation="MSDVVIEHDIHVFDSILRRLPEKTQILLKTLPLLDGVTVQLLRF
                     LSANSLRTILAIISDASPKAFPLEQDLYHSLLALFIKLVSLYNTKPQLLRVSHIFPGV
                     WHDHHPSPSFIQTHERYILLVLRKVNICLFLLTLLKELPFGISFLADNFIEVFCFNVD
                     SSKVEDLITANRSRIVYGRLLKPQTVLYLDLMTQYYISALVSSSTPHTSKSPLLDQVF
                     PDTILDDIKDKTIKYAGKYMQLQIQCTETDFKERCKRRKTAILECPDLQKLMKKYDWE
                     ECCKEVFSYGIKRADVLLYGRRGKGLSSVPSRTPTPVETIPAPVQSETLPVEEGESDL
                     VEELPNTINTTEAEVDVKSTVLRTNEPQRRIDLPVKPFKTKPKQKKMWTQEEEDCLKS
                     GLKQCGPAWAKILSLYGPGGTVSESLKNRSQVQLKDKARNWKMHYLKNMKPVPEYLEK
                     VTGDLERGLKSKKKPKSKPKPAV"
     gene            <586289..>587599
                     /locus_tag="KLLA0_D06787g"
                     /db_xref="GeneID:2892893"
     mRNA            <586289..>587599
                     /locus_tag="KLLA0_D06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453363.1"
                     /db_xref="GeneID:2892893"
     CDS             586289..587599
                     /locus_tag="KLLA0_D06787g"
                     /note="similar to uniprot|P18851 YOR212W Saccharomyces
                     cerevisiae STE4 G protein beta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453363.1"
                     /db_xref="GeneID:2892893"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:F2Z6D4"
                     /translation="MEVDSAEYAIRPQELIVHDYHYPNMNSAGTVEDKIRTAKTECKQ
                     LYDQINRIKGKIQDTQLMNLSHGVNSLHELNLQPVRTLKGHNNKISDVKWSQDSASVL
                     SSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISPSGNLVASAGLDNHCSVYRVSRD
                     NRIQQNVISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGD
                     VLTMDLPPANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGE
                     SFMAGSDDGSARLFDLRSDCQISTYSFSDGLLQQHQLQQQHHPHPHSHAYSRIQKNRY
                     GSSSSSTSSYPIVKTPQSLNFKESCIEDQGVISIDFSSSGRLMYACYADYGCAVWDII
                     KGEMIGKVDGHRNRINAVKTSPDGMAVVSSSWDMTLKVWTPVHQ"
     gene            complement(<587709..>588275)
                     /locus_tag="KLLA0_D06809g"
                     /db_xref="GeneID:2893062"
     mRNA            complement(<587709..>588275)
                     /locus_tag="KLLA0_D06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453364.1"
                     /db_xref="GeneID:2893062"
     CDS             complement(587709..588275)
                     /locus_tag="KLLA0_D06809g"
                     /note="similar to uniprot|Q75C19 Ashbya gossypii ACR098C
                     ACR098Cp and some similarites with YPL129W uniprot|P35189
                     Saccharomyces cerevisiae YPL129W TAF14 Subunit (30 kDa) of
                     TFIID TFIIF and SWI/SNF complexes involved in RNA
                     polymerase II transcription initiation and in chromatin
                     modification contains a YEATS domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453364.1"
                     /db_xref="GeneID:2893062"
                     /db_xref="GOA:Q6CRS5"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS5"
                     /translation="MQLFILDEEGNEQPATLFDYVTYHLHPTFERPLRKLTEPPFTLD
                     EQGWGEFELKIIAKVKFCSTTYTFHHELSFDNNAYNVDYEGRFPYHQTKLREELLNSG
                     SVPIYNEDEISLGQVTNLQRAINLISVSDVDTIQKVINTIVTFPPVSEEIAKRRHQED
                     DIVILLSQIPNQLLNKICRLVEASSAAS"
     gene            complement(<588834..>589712)
                     /locus_tag="KLLA0_D06831g"
                     /db_xref="GeneID:2893065"
     mRNA            complement(join(<588834..589595,589704..>589712))
                     /locus_tag="KLLA0_D06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453365.1"
                     /db_xref="GeneID:2893065"
     CDS             complement(join(588834..589595,589704..589712))
                     /locus_tag="KLLA0_D06831g"
                     /note="similar to uniprot|P35189 Saccharomyces cerevisiae
                     YPL129W TAF14 Subunit(30 kDa) of TFIID, TFIIF, and SWI/SNF
                     complexes,involved in RNA polymerase II transcription
                     initiation and in chromatin modification, contains a YEATS
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453365.1"
                     /db_xref="GeneID:2893065"
                     /db_xref="GOA:Q6CRS4"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS4"
                     /translation="MVSTVKRTVRIKTKQSVLPDVPPPVENFPMRQWTIELVLLDEQG
                     NEIPATIFDKVVYHLHPTFANPHRTFTEPPFRIEEQGWGGFELLISAHLLEKGGEKKI
                     THDLHFMKDAYEIDHVIQVPTNKPLLRAELEKSGPVDEVASTAAATPNATATAATTPG
                     DKRKASTVNGDVKTKKAKTASASTVKGSVNLEKLAFGLTKLNEDTLVGVVQMITDNKT
                     PEMNITNNIEEGEFVIDLYSLPESLLKSLWEYVKKNTE"
     gene            complement(<590221..>590778)
                     /locus_tag="KLLA0_D06853g"
                     /db_xref="GeneID:2893217"
     mRNA            complement(<590221..>590778)
                     /locus_tag="KLLA0_D06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453366.1"
                     /db_xref="GeneID:2893217"
     CDS             complement(590221..590778)
                     /locus_tag="KLLA0_D06853g"
                     /note="similar to uniprot|Q12032 YOR215C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453366.1"
                     /db_xref="GeneID:2893217"
                     /db_xref="GOA:Q6CRS3"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /translation="MLRCVIPSVRATATTRTFVRFASSQGYIDGIAALKQDLKKAMLA
                     KDNLRKTTIRGVLSTIKNKEIDSKDKDLDEFVLYDVYAKLISQRKDSIAEFVKNKRED
                     LVEKEANEIKILENYQTALPVASREEVDARVVQILTDLKESEPSIQLKQVFGKIDWKT
                     LPGELKASPAAIRSSISSQFKKVFQ"
     gene            complement(<591141..>592529)
                     /locus_tag="KLLA0_D06875g"
                     /db_xref="GeneID:2893243"
     mRNA            complement(<591141..>592529)
                     /locus_tag="KLLA0_D06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453367.1"
                     /db_xref="GeneID:2893243"
     CDS             complement(591141..592529)
                     /locus_tag="KLLA0_D06875g"
                     /note="similar to uniprot|Q12234 YOR216C Saccharomyces
                     cerevisiae RUD3 Golgi matrix protein that is involved in
                     the structural organization of the cis-Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453367.1"
                     /db_xref="GeneID:2893243"
                     /db_xref="GOA:Q6CRS2"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS2"
                     /translation="MAKNKKKGNNSNNKSKSAGSAKDVKATEPVQEVVPENDGAKAVA
                     VPDDSLENSDGADQSTVEAVVTVKTDDKPSKPEPEEQQSHEATTNSNAEAEPHSDSEE
                     NDLQRVKEERDQYELKYNTLLSKISSMKTVFSQMKQAQQELENTREQLNEYENQNINL
                     KQKLKSADSEIQEDKQTISILNDEIVNLNKECENLSNECSEFKSKIKELESKLNEASN
                     EESNITSCLKSEVKSLKSQIDNLEIIINNEAQDKRDLEEQIADYKQQLEQSDETKKQL
                     DNIMSNLEKQINDNNTTIETLTKQRTTEVNQFTEEIAQLTKNNEEKATEINSLRAKVA
                     SMSEDVALKEKFEREVKERVLQIGKLRHEAIILNEHLTKALAMLKQNNDSESVDKELI
                     SNLFISFVTIPRGDPKKFEVLELISSFLNWDTDKKTQAGLIQNMSNTNSESRTQNFVS
                     LWTEFLEKESEK"
     gene            <592913..>595420
                     /locus_tag="KLLA0_D06897g"
                     /db_xref="GeneID:2893249"
     mRNA            <592913..>595420
                     /locus_tag="KLLA0_D06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453368.1"
                     /db_xref="GeneID:2893249"
     CDS             592913..595420
                     /locus_tag="KLLA0_D06897g"
                     /note="similar to uniprot|P38630 Saccharomyces cerevisiae
                     YOR217W RFC1 Subunit of heteropentameric Replication
                     factor C (RF-C) which is a DNA binding protein and ATPase
                     that acts as a clamp loader of the proliferating cell
                     nuclear antigen (PCNA) processivity factor for DNA
                     polymerases delta and epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453368.1"
                     /db_xref="GeneID:2893249"
                     /db_xref="GOA:Q6CRS1"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS1"
                     /translation="MGDITDKLRAAKNKRAGHGTNHASPKKPKKVKSQAAETIDLDLD
                     DDELELLASQPRRSRSNTTAADEKEQSPAKKPRISEPSSNGLTKPDVSRVKKSDSPQT
                     VKELLDSIPSVDLDNVTTKEATQFSWKGAGGDGSGASSELEIPEGQANCLLGLTIVFT
                     GTLPNLDRSTSENLAKRYGARVTKSISKNTSVVVLGEEAGPKKLENIKKLGIKAIDEE
                     GFKRLIAGMPAGGGDNQQADKARRKLQEQQEQAMKEAEQMAKEQEEREKKDKLSVGKD
                     VNLSSKSTVTEDSKLWTTKYAPTDLRQLCGNKGAIQKLKTWLESWSSGKKPSMRAVML
                     SGPPGIGKTTAAHLVAKSLGYDVLEKNASDVRSKGLLNASVKFALDHKSVIGMFKSIS
                     DDHYSKNGKRFVIIMDEVDGMSGGDRGGVGQLAQYCRKTNTPMILICNERNLPKMRPF
                     DHSVLDIPFRRPDAQAVKARLMTIAMREKFKLDPNVIDRLVSVTRGDMRQIINLLSTV
                     TTTSKSIGSDNIKSLSDNWEKNVALKIFDITPKLLSGGIYTENGAKQFPLYKKMELYF
                     DDFDFTPLMIQENYTSTTPTLLRKGQTHLNAVAAAAESISEGDLVDKKIRSAEQQWSL
                     LPLHAVLSTVRPASMVAGNVTRRINFSAFLGQNSKTGKFYRLLQDIQYHTRLSTSTNK
                     MGLRLQYMPTMKRHLLDPLLRDGSAAIENVINFMDDYYLSKDHWDSIMQFYVGTDDTT
                     AALKSIPSSTKSAFTRAYNNVSHPTPIMKLGVSTGRATAAARPDFEDVVDNDDEVPVE
                     EENPKDEDEIDFKKDKFIKQVGKKKTKSKTKKVSSKK"
     gene            complement(<595450..>598068)
                     /locus_tag="KLLA0_D06919g"
                     /db_xref="GeneID:2893254"
     mRNA            complement(<595450..>598068)
                     /locus_tag="KLLA0_D06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453369.1"
                     /db_xref="GeneID:2893254"
     CDS             complement(595450..598068)
                     /locus_tag="KLLA0_D06919g"
                     /note="similar to uniprot|P33894 Saccharomyces cerevisiae
                     YOR219C STE13 Dipeptidyl aminopeptidase Golgi integral
                     membrane protein that cleaves on the carboxyl side of
                     repeating -X-Ala- sequences required for maturation of
                     alpha factor transcription is induced by a-factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453369.1"
                     /db_xref="GeneID:2893254"
                     /db_xref="GOA:Q6CRS0"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CRS0"
                     /translation="MTTTHKRTNPHMFLQRLNSSVSSLSTIPQGEQVVNFELDSFQES
                     DSERLSKGSPHDELDVERQLSVWDYGSYSNKWIVWIKWLTVLLIGTLGTILIMNIFFQ
                     GIYLGTATDDTTYLINKRGFTIDAFLNGTFVSREDTFKFIAPPAIEYIPKEKDSGLYL
                     TMEKNSQKDDIIVAKRLNDKDFRKLISPLQFTFNEHKYSLESISIDYSLDYAILGSNV
                     IKEYRHSSSGLYWLYNLKTSVLTPVKGKDSKSPHPRLSYCHFSPSYRYIYFVEDNDLH
                     VQSLDDQGDIYRITSDGSNYVLNGRTDWVYEEELLADDVAVWWAPDDSKLAFSRIDDA
                     KVSNYNYQTFINGKQTPTLRSMKYPLPGASNPVICLFLYDLTNNSLNAIKETTEEEGI
                     LLYYAKWVDNNNLLFKVSDRESKILDTMIFNSENNQTKRLLTRDANTYNGWIEKCKEI
                     IVVRRKGQDINTGFLDILPDKNGYHHIFHFASSEDTNPRQITEGSWEVKEILGVEGES
                     EIVYFQSNLFHPMGLQLHTASLKDNSATLNLQQTEVLEYSKFTLSTSCKFAIKQYLGP
                     DVPYTYAGDLWQLLNASEDDHSKILLTKNEHIEEAIQMYDYPVTDYKEITLEDYTEIN
                     YVEIKPKTFEPEKKYPLLVYVYGGPGSETFNTKFSSALEESISSSINAIVLKIEPRGT
                     GGKGWNFKSWANRNIGFWEPRDIINVTKKYIETQKDVIAQDKVAIWGWSYGGFTTLKT
                     LEFDKGSVFKYGVSVAPVTDWKYYDSVYSERYLGSPLSSDAYDKNAKIKDYDSFKFTK
                     RFLLMHGTADDNVHIQNTYELIDNFNLHSVRNYDMHIFPDSDHSIYFHNAQRMVYEKI
                     YFWIKDAFLGRLDSLE"
     gene            complement(<598560..>599453)
                     /locus_tag="KLLA0_D06941g"
                     /db_xref="GeneID:2893411"
     mRNA            complement(<598560..>599453)
                     /locus_tag="KLLA0_D06941g"
                     /product="60S ribosomal protein L5"
                     /transcript_id="XM_453370.1"
                     /db_xref="GeneID:2893411"
     CDS             complement(598560..599453)
                     /locus_tag="KLLA0_D06941g"
                     /note="highly similar to uniprot|P26321 Saccharomyces
                     cerevisiae YPL131W RPL5 component of the large (60S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="XP_453370.1"
                     /db_xref="GeneID:2893411"
                     /db_xref="GOA:Q6CRR9"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR9"
                     /translation="MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKY
                     NTPKYRLVVRFTNKDIITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATG
                     LLLARRTLQKLGLDETYPGVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIF
                     GALKGASDGGLYVPHSENRFPGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEER
                     YRELFKGYLADDIDADAVEDIYADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVK
                     LTREERKARVAAKISALAPQE"
     gene            <599738..>600223
                     /locus_tag="KLLA0_D06963g"
                     /db_xref="GeneID:2893448"
     mRNA            <599738..>600223
                     /locus_tag="KLLA0_D06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453371.1"
                     /db_xref="GeneID:2893448"
     CDS             599738..600223
                     /locus_tag="KLLA0_D06963g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453371.1"
                     /db_xref="GeneID:2893448"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR8"
                     /translation="MQQCAKQLLICNHVIYPFKENHFFFPFFLFWCLGDKQIKYRISA
                     SHCLLAVPYSRQKLESLSGLSIKGKCQAINFAYDRKLSLVIISVKCNRISLRLGSNYC
                     YQYHFNLNSNAGAQLNLMLISFPILLNWRSVFLDPFDMCLVHTDKISRCLPHFVTKPQ
                     I"
     gene            <600527..>601303
                     /locus_tag="KLLA0_D06985g"
                     /db_xref="GeneID:2892830"
     mRNA            <600527..>601303
                     /locus_tag="KLLA0_D06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453372.1"
                     /db_xref="GeneID:2892830"
     CDS             600527..601303
                     /locus_tag="KLLA0_D06985g"
                     /note="similar to gnl|GLV|CAGL0J04158g Candida glabrata
                     CAGL0J04158g and weakly similar to YOR220W uniprot|Q12044
                     Saccharomyces cerevisiae YOR220W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453372.1"
                     /db_xref="GeneID:2892830"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR7"
                     /translation="MGQPKKTQILVTDLDSEKFNEGWPRSLEETLFQKQFPHITPEYY
                     SPLPFLHRIVIILSSEDEAVRVFQFVQNYVREVLGLTDCKVYLTESLISKPRSKSVDD
                     KDVNSTAAAAAAASAAVKTQSQSQSQSQTTSDSTESSNHSGKKPVLKVNTSYSSSSVT
                     QSEDKNNTISSPSSLSPEQPLSPTKVKLRDDQEEYFYMEPAPQPAHEPTIASANSNIK
                     IDTPVQTEDLRNKSLQAGTAADSDSAIHPRSPSITITSMF"
     gene            complement(<601656..>602441)
                     /locus_tag="KLLA0_D07007g"
                     /db_xref="GeneID:2892876"
     mRNA            complement(<601656..>602441)
                     /locus_tag="KLLA0_D07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453373.1"
                     /db_xref="GeneID:2892876"
     CDS             complement(601656..602441)
                     /locus_tag="KLLA0_D07007g"
                     /note="similar to uniprot|P19516 YPL132W Saccharomyces
                     cerevisiae COX11 Mitochondrial membrane protein required
                     for assembly of active cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453373.1"
                     /db_xref="GeneID:2892876"
                     /db_xref="GOA:Q6CRR6"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR6"
                     /translation="MLKFFLRAALPASGIRTSTINRTRFYRTTRLLRNNGTGNKFDLS
                     KLTREEIKEIRDYKISAARRYKDRTVAFYFTSIAVLFLGLAYAAVPLYRAICARTGYG
                     GIPITDKRKFTDDKLIPVDSNKRIRISFTSEVSQILPWKFVPQQREVYVLPGETALAF
                     YKAKNNSDKDIIGMATYSITPGESSPYFNKIQCFCFEEQKLAAGEEVDMPVFFFIDPD
                     FASDPSMRNIDDIILHYTFFKAHYADGSAVSDAAAKPEVITSQ"
     gene            <602763..>604367
                     /locus_tag="KLLA0_D07029g"
                     /db_xref="GeneID:2892736"
     mRNA            <602763..>604367
                     /locus_tag="KLLA0_D07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453374.1"
                     /db_xref="GeneID:2892736"
     CDS             602763..604367
                     /locus_tag="KLLA0_D07029g"
                     /note="similar to uniprot|P19541 Saccharomyces cerevisiae
                     YPL133C RDS2 Regulator of drug sensitivity Transcriptional
                     regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453374.1"
                     /db_xref="GeneID:2892736"
                     /db_xref="GOA:Q6CRR5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR5"
                     /translation="MVETKVVKKRKKVNKACVFCRRSHMVCDEQRPCSRCVKRSIGHL
                     CRDEDPEGALPGTVEHSSSSGLELRVPKVDVDNTAGLVDSSRVSLSAPHQLPTAHDHN
                     HDRSLDHQREVQQAQQQQHQHHLDIQPIPAHLAQVMPEHQGSHNPSHTAHGNTTTAGP
                     AAVVHPAHEGVPSINNTTGNNLNSVHGSNMHHALSGTSLGRISSLNQPLFLSEHIGSE
                     FSSLNEFLTMLEDPMLIEPGTPIQHHMNAQITAADHPAQATDQPEYHSQQPLVAHEVT
                     TQPNNMNNSQHPMHTQMQSPVHSNVQNAGGMSPPLLPDDQQPTPKENFFLTAADPSTE
                     INPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSSKQRILKPLSIIRPA
                     FRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLV
                     DCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGRQRRP
                     CCFSFTIRRDRYNIPICIVGNFIPIS"
     gene            complement(<604505..>605476)
                     /locus_tag="KLLA0_D07051g"
                     /db_xref="GeneID:2892801"
     mRNA            complement(<604505..>605476)
                     /locus_tag="KLLA0_D07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453375.1"
                     /db_xref="GeneID:2892801"
     CDS             complement(604505..605476)
                     /locus_tag="KLLA0_D07051g"
                     /note="similar to uniprot|Q12283 Saccharomyces cerevisiae
                     YOR221C MCT1 Predicted malonyl-CoA:ACP transferase
                     putative component of a type-II mitochondrial fatty acid
                     synthase that produces intermediates for phospholipid
                     remodeling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453375.1"
                     /db_xref="GeneID:2892801"
                     /db_xref="GOA:Q6CRR4"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR4"
                     /translation="MSGRLLSFPGQGSKVLLDRLQRWAANVSGFKDVSLIDRFTGTLE
                     QPETIAACSNLLYSNWLTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIE
                     IASFRNQLMVEATQRYLEKCRITDDSFELWAVTNVRSKNLRKDLSAVLDSNITNSSVD
                     KPCSIKLANDNAVNQCVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVL
                     RSIQEPLYDFIWDTLKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNI
                     VNFVDSCKNISSLSSVEKAYHFGPGTSIGKLIERNLKTCDISHNFID"
     gene            <606857..>607750
                     /locus_tag="KLLA0_D07073g"
                     /db_xref="GeneID:2892787"
     mRNA            <606857..>607750
                     /locus_tag="KLLA0_D07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453376.1"
                     /db_xref="GeneID:2892787"
     CDS             606857..607750
                     /locus_tag="KLLA0_D07073g"
                     /note="similar to uniprot|Q03028 Saccharomyces cerevisiae
                     YPL134C ODC1 Mitochondrial inner membrane transporter
                     exports 2-oxoadipate and 2-oxoglutarate from the
                     mitochondrial matrix to the cytosol for use in lysine and
                     glutamate biosynthesis and in lysine catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453376.1"
                     /db_xref="GeneID:2892787"
                     /db_xref="GOA:Q6CRR3"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR3"
                     /translation="MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGG
                     SGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG
                     AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGIL
                     AMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLL
                     STPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGG
                     GILLVVFTGVMDFFRTVHEKK"
     gene            <608975..>609715
                     /locus_tag="KLLA0_D07095g"
                     /db_xref="GeneID:2892875"
     mRNA            <608975..>609715
                     /locus_tag="KLLA0_D07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453377.1"
                     /db_xref="GeneID:2892875"
     CDS             608975..609715
                     /locus_tag="KLLA0_D07095g"
                     /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
                     YOR223W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453377.1"
                     /db_xref="GeneID:2892875"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR2"
                     /translation="MSLSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRR
                     MCRQLKPTETRGKRLRFIKNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTAEE
                     LINEDNLDDDFSNTNENGTTQAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMPNQ
                     QQRDIRQLEEQWMETGVNDPQGQQFNSIGIANWKSNMDLLIGLSIGSLLGVFSLLLLK
                     QQGLFSQRQKMSIVAGLIFNIAWWIRSF"
     gene            complement(<609913..>610569)
                     /locus_tag="KLLA0_D07117g"
                     /db_xref="GeneID:2893001"
     mRNA            complement(<609913..>610569)
                     /locus_tag="KLLA0_D07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453378.1"
                     /db_xref="GeneID:2893001"
     CDS             complement(609913..610569)
                     /locus_tag="KLLA0_D07117g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453378.1"
                     /db_xref="GeneID:2893001"
                     /db_xref="InterPro:IPR019560"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR1"
                     /translation="MSEIIDMVETDTDIPVQKSDPINDEEFPDSTDSNIRYAAYASRL
                     RTIALTAHRYVAYTSDIGESFRPVFPQAVVKLGYGISWLYILGDVSYITYRAKLKQEG
                     YQLPSGWKPWDELSENNKVLKSNVSPDWKMVGLERLIFQSVASMGLPAFTIHSLVKYS
                     GNWFNKQYPKNAMLRTWGPISIGLAVVPMLPYAFDKPIEHFLSKYVFPGNHRHSQKHE
                     "
     gene            complement(<611102..>611539)
                     /locus_tag="KLLA0_D07139g"
                     /db_xref="GeneID:2892934"
     mRNA            complement(<611102..>611539)
                     /locus_tag="KLLA0_D07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453379.1"
                     /db_xref="GeneID:2892934"
     CDS             complement(611102..611539)
                     /locus_tag="KLLA0_D07139g"
                     /note="highly similar to uniprot|P20436 Saccharomyces
                     cerevisiae YOR224C RPB8 RNA polymerase subunit ABC14.5
                     common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453379.1"
                     /db_xref="GeneID:2892934"
                     /db_xref="GOA:Q6CRR0"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CRR0"
                     /translation="MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINS
                     ELFPIKTQDQLAVMITTSLQLDGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFE
                     EVKGNKDLLAVYYSFGGLLMRLEGNYRLLNNLKQENAYLLCRK"
     gene            complement(<612348..>612890)
                     /locus_tag="KLLA0_D07161g"
                     /db_xref="GeneID:2893074"
     mRNA            complement(<612348..>612890)
                     /locus_tag="KLLA0_D07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453380.1"
                     /db_xref="GeneID:2893074"
     CDS             complement(612348..612890)
                     /locus_tag="KLLA0_D07161g"
                     /note="similar to uniprot|Q03020 Saccharomyces cerevisiae
                     YPL135W ISU1 Conserved protein of the mitochondrial
                     matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453380.1"
                     /db_xref="GeneID:2893074"
                     /db_xref="GOA:Q6CRQ9"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /translation="MFRGQMFAVQRMGSALMHGGGGGTRIIGVAAARATAPTVGSSPS
                     MASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVI
                     ENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAE
                     DAIKAAIKDYQAKRPTTQLK"
     gene            <614450..>618286
                     /locus_tag="KLLA0_D07216g"
                     /db_xref="GeneID:2893071"
     mRNA            <614450..>618286
                     /locus_tag="KLLA0_D07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453383.1"
                     /db_xref="GeneID:2893071"
     CDS             614450..618286
                     /locus_tag="KLLA0_D07216g"
                     /note="similar to uniprot|Q12276 Saccharomyces cerevisiae
                     YOR227W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453383.1"
                     /db_xref="GeneID:2893071"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ6"
                     /translation="MPNSLDLDVEVDWLYKGKKKVRANRRLDSSSAPPATPSAPAPAS
                     TSVPTPAPGSAGVAEATPGAGTDGAGPENSASSEPAQTPTPAAKTRNRSSSHSQASLS
                     QTAANSPNTSGRSLKPSSAVLRRSSSLGEKPKKSLFGSLFNRKPLQPLESHTNVSSTS
                     SSVPAPVTSSSSASGHSASTASSSSSPTQASTTAAPASSSSSSSSSRGIPIPINISQF
                     ASHRQQISQFLKEPNSPEVKDMAPIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTF
                     AVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPSSHGNDQHGALP
                     ASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLKPSTSTDLKP
                     SANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKESSGSSNGTGSE
                     HGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQTLKFLN
                     PRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVF
                     DERGWKLLCKFLMRNKSLTKLDISQTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKPL
                     EELLLNGVSFANNLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMS
                     ENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELSK
                     LPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKC
                     KELLHVSMMNQPQESWAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVR
                     NAQKSIDSNWQLDELSSQDDLLFDGELISETAGNILDKLNDSAKLQEDSTKRYLLKRY
                     WEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYI
                     QELNYAKNKDDDNYSSSDERPVLKHVDSERIMYAKPLVDPIDQDIDQELEHEQDSNSA
                     KPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFVQQQRSIYP
                     ENTPMSKYQQQQQHKHAQRKEPQLSQIVEKPREQVQTSQKTGQPAATPTASTPPTSSN
                     SIPALSKSAASAKLIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGIQ
                     VEPPADAKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNVDET
                     YDKLLNNLSRVRSNRG"
     gene            complement(<618435..>619286)
                     /locus_tag="KLLA0_D07238g"
                     /db_xref="GeneID:2893153"
     mRNA            complement(<618435..>619286)
                     /locus_tag="KLLA0_D07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453384.1"
                     /db_xref="GeneID:2893153"
     CDS             complement(618435..619286)
                     /locus_tag="KLLA0_D07238g"
                     /note="similar to uniprot|Q12106 Saccharomyces cerevisiae
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453384.1"
                     /db_xref="GeneID:2893153"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ5"
                     /translation="MTAAKLTPLKPIPTKHIDPDLAKTPEDASVNLVLNIKKWLRWTQ
                     KWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSKLIWTGISIHIL
                     SGFALRIMRKLPTSSKTHNAESLLDTQSLAQSRIGLVGGLSGYFIGIKRNLQYNPQEL
                     TGWLLTPVLFFHGALMKWLPNTAKVDIDFDFVKWLLDKDRGALVRIGLGYGPLVALIG
                     LGSYHIIAGTVQYMHVRSLKTRKRIMNFILLLICTGYIGISRLGSEIVFGMDKYYRPI
                     LRTLSLS"
     gene            <619630..>620658
                     /locus_tag="KLLA0_D07260g"
                     /db_xref="GeneID:2893174"
     mRNA            <619630..>620658
                     /locus_tag="KLLA0_D07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453385.1"
                     /db_xref="GeneID:2893174"
     CDS             619630..620658
                     /locus_tag="KLLA0_D07260g"
                     /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
                     YPL138C SPP1 Subunit of the COMPASS complex, which
                     methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453385.1"
                     /db_xref="GeneID:2893174"
                     /db_xref="GOA:Q6CRQ4"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ4"
                     /translation="MSLPSWCPRYDSRKHDPKTGEEVYCICKKPDTGELMVGCDGCDD
                     WFHFSCLKIPEKYRDLVFSFYCSYCSAGITGPALINGGKLPKTLWKRKCRLPECYTEC
                     DANSRSKYCSKKHAVQYVQSIVDKLNLPGVDKIALLRQLLNETTSLEEFKTLGRDKLP
                     EVTSPLSKDQYSKLLENDQHLNKLINEHDELVSVKLSKLNEEDAVIEKYVNWIGEVNE
                     RLSPHFNQPTGRKKSKSASKVTICGYHNEFTIPRSVEEFLDKLLQLKEDENSNITSVD
                     GVCVKTKCAKHQDWITLSQNDLSEQKDSLENVKRRLDLLISVRTNQLRISFFEQEMSN
                     RVLPGVKT"
     gene            <621115..>622467
                     /locus_tag="KLLA0_D07282g"
                     /db_xref="GeneID:2893268"
     mRNA            <621115..>622467
                     /locus_tag="KLLA0_D07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453386.1"
                     /db_xref="GeneID:2893268"
     CDS             621115..622467
                     /locus_tag="KLLA0_D07282g"
                     /note="similar to gnl|GLV|CAGL0M02563g Candida glabrata
                     CAGL0M02563g and weakly similar to uniprot|Q12206 YOR229W
                     Saccharomyces cerevisiae WTM2 WD repeat containing
                     transcriptional modulator 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453386.1"
                     /db_xref="GeneID:2893268"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ3"
                     /translation="MATDIRTNKVKNEEFKIWKKTIPSLYEHISTLQPKIFSPSESAQ
                     SPERRVLFTELISEEADKGLLNTSIYYSQRSEIYEIGVQLPIGAYTSHDDKELPQPRY
                     SEFFSEPANAKWVFEGQSIASFKANHSTSALIVMSKKGTLAWYNGSSKKPLKSLERSS
                     EKDVTADFDISTDGKYVVRFESPVPESAQSGTKITVINNTDNIGDVLHTITLPNTKQA
                     RCVKFHTATLFSTVTEDNLLRFWDIRARDEMLFSLALHSISSSSEGSTAGSEVEDDGT
                     INVVEASKQFDTLFITGSDAGVIKLWDLRSIAARNSTEVKDATEIVTLYQLDNDPVVD
                     IQFSPLEPECFLTVGASGNVYHWDISYLINESEQQGEDSADSDEIYQDDIQEHSLKFL
                     HTGGGRRSAYKPDNTVLIKGSVTQHPLIRDIIGTVDGDGYLTIYKGFYGRDGEVAESE
                     "
     gene            <623352..>624749
                     /locus_tag="KLLA0_D07304g"
                     /db_xref="GeneID:2893278"
     mRNA            <623352..>624749
                     /locus_tag="KLLA0_D07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453387.1"
                     /db_xref="GeneID:2893278"
     CDS             623352..624749
                     /locus_tag="KLLA0_D07304g"
                     /note="some similarities with uniprot|P32490 Saccharomyces
                     cerevisiae YOR231W MKK1 Mitogen-activated kinase kinase
                     involved in protein kinase C signaling pathway that
                     controls cell integrity upon activation by Bck1p
                     phosphorylates downstream target Slt2p functionally
                     redundant with Mkk2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453387.1"
                     /db_xref="GeneID:2893278"
                     /db_xref="GOA:Q6CRQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ2"
                     /translation="MASMFRPPESRRTNSKPPKLSLPPQLVSNSKPITDIRDEKLRQP
                     PSKSVPSSATPTSSASASSARTLKNRPVPPPTASSVTPLSSTNSGSAMGSLSNKLHGL
                     KINTDHLPTSGSQQSTQSADSMTSNLISMYDSEPTTSSSTSLVNHGKESEIIEHDRDD
                     STDELESDIWQTYKIHEQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTIATIENDGS
                     EKQIFRELQFNKSCKSDFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGG
                     RIGEKVLGKIAESVLRGLFYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNS
                     LATTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHSPFDTDKLAANMPPIE
                     LLMLILTFTPELKDEPEQGIVWSKSFKSFLDYSLKKDSKDRPSPRQMLQHPWMVGQTK
                     KHVNMKKFIQTCWAD"
     gene            <625107..>625838
                     /locus_tag="KLLA0_D07326g"
                     /db_xref="GeneID:2893518"
     mRNA            <625107..>625838
                     /locus_tag="KLLA0_D07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453388.1"
                     /db_xref="GeneID:2893518"
     CDS             625107..625838
                     /locus_tag="KLLA0_D07326g"
                     /note="similar to uniprot|P38523 YOR232W Saccharomyces
                     cerevisiae MGE1 Protein of the mitochondrial matrix
                     involved in protein import into mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453388.1"
                     /db_xref="GeneID:2893518"
                     /db_xref="GOA:Q6CRQ1"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /translation="MRPSTRFLRSVTRTVPIGFRSTTVPFVSSTLRSSAATSNQFSAR
                     FSGVRFYADEAKKEEPKDENDAAAAEEDANLTEEQKKIKDLETKLDAKTKEASEFKDR
                     LLRSVADFRNLQEVTKKDIQKAKDFALQKFAKDLLESVDNFGHALNAFKPETLEQSQE
                     LSDLYTGVKMTRDVFEKTLKKHGIEQLNPIGESFDPNKHEATFELPQPDKEPGTVFHV
                     QQIGYTLNDRVIRPAKVGIVKDNEN"
     gene            <626999..>629728
                     /locus_tag="KLLA0_D07348g"
                     /db_xref="GeneID:2893535"
     mRNA            <626999..>629728
                     /locus_tag="KLLA0_D07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453389.1"
                     /db_xref="GeneID:2893535"
     CDS             626999..629728
                     /locus_tag="KLLA0_D07348g"
                     /note="similar to uniprot|Q03002 Saccharomyces cerevisiae
                     YPL141C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453389.1"
                     /db_xref="GeneID:2893535"
                     /db_xref="GOA:Q6CRQ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CRQ0"
                     /translation="MSTEAHRHTYYGGPTTNTESSHHIHTSHAHNCSNGSSRRHSSSH
                     NGRRRQVTFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKE
                     VKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAA
                     CRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTS
                     CGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLY
                     NYITKTSLKFPEYINPIPRDILRRILVSDPSKRITVELILKHQWLQPHALFLSLKPED
                     WDIKAKAEISNIFRPPPSQSSQSAYSRPHSNSSVSSSEKRNSLIIDSTLHLQPVPPHE
                     SQSHAIAKPSSPSSDLRSSPIKRVNHSRSNSAASIALQAVVDAEREFFQSSQSILQIS
                     GVQSIEQSPNTRVQTYTATRSLAHNNSSSLMNRNSIIVEVSPNKEVISSSSSSAIPGM
                     SYSASRESYISTSPVRNAAQSPKFVPGSFTSNTSHHNNKFGSSQQSRPRPTSYHPISS
                     SYLEMQPSNSQNNFITTTNEFSYIPRTVNANNYIDSTRAISPELNGRTVDGTSPPLNS
                     RNFQSGIIRRGSFSASKPSPSVDLNNVEGDLIKTDAEDHKKLKQQRRKSQRYSTVILD
                     NSIATVQEETEEPITAYDANIKKPVENSNNLTKEFGKIVINEPRKEDAHIPISKPESE
                     HLQKPPQQHQSQASIARADSHSKKEKRFSLLSFYSYYNNSKTSVSSDSSGGRRVSANS
                     QKTNERISSVKSNGIPSRNVSGSINQFETSKPRVSSNPSNRTNYRHSMLPPKSSQVID
                     ASAKRMNRSSVMVSSAKDITSSDGTASKEHKEQREPSTAKRVFDFFKRRSMRV"
     gene            complement(<630095..>631894)
                     /locus_tag="KLLA0_D07370g"
                     /db_xref="GeneID:2893548"
     mRNA            complement(<630095..>631894)
                     /locus_tag="KLLA0_D07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453390.1"
                     /db_xref="GeneID:2893548"
     CDS             complement(630095..631894)
                     /locus_tag="KLLA0_D07370g"
                     /note="similar to uniprot|P40445 Saccharomyces cerevisiae
                     YIL166C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453390.1"
                     /db_xref="GeneID:2893548"
                     /db_xref="GOA:Q6CRP9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP9"
                     /translation="MESVRNKRYINSEQIPWISVIESGSSCSQSWLWLKREFCYSIRS
                     YKPANQHYKSLAMADSDKRRAEVDVKRVSISSFDVEIRSQDSLTSDNPFSDPKIAEYY
                     RALYDDSKYESRSAFDPEFTWTKEEEQKVVRKLNIRVALVACYLFVALQLDRGNLSQA
                     VVDNLLEDLGMNRNDYNLGNQIFYISFLLAEIPSQLISKRLGPDIFIPIQICSWSVVA
                     MAQAAMHNKTGFFICRCLIGALEGGFIADLVLWLTYFFTSKEFSIRLSWFWTSLSLVQ
                     ILSAILAYGILRMRGIGGLAGWQYLFLLEGILTFFIGLTGFYLMVPSAVQTKNWMHPK
                     GWFTEREEKIVVNRVLRDDPSKGDMHNRQPISFKLIWSAISDYDLWPIYFIGLIAYVP
                     TNVLTTYLTLTLKSVGFSTFNVQLLSIPYQVIHIIFLLGITWFSERVKQRAYMGIISA
                     VWNAFFLAILRWWKGSLVEAWPTFALCTLLLGSPYVHAICVSWVSRNSNSIKTRALSS
                     ALYNMAVQVGAIYSAQIYRENDKPLYHTGNTVLFSLAVVTTPIFLFVKWYYHKRNKDK
                     EAIWSKMSEDERIEYIHNTTDTANKRLDFRFAE"
     gene            complement(<633063..>634027)
                     /locus_tag="KLLA0_D07405g"
                     /db_xref="GeneID:2892749"
     mRNA            complement(join(<633063..633367,634009..>634027))
                     /locus_tag="KLLA0_D07405g"
                     /product="60S ribosomal protein L33"
                     /transcript_id="XM_453392.1"
                     /db_xref="GeneID:2892749"
     CDS             complement(join(633063..633367,634009..634027))
                     /locus_tag="KLLA0_D07405g"
                     /note="highly similar to uniprot|P05744 Saccharomyces
                     cerevisiae YPL143W RPL33A Ribosomal Protein of the Large
                     subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="XP_453392.1"
                     /db_xref="GeneID:2892749"
                     /db_xref="GOA:Q6CRP7"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP7"
                     /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLVKIEGVANPEDAKFY
                     LGKRVAYVYRCSKEVRGSKIRVIWGKINRTHGNSGVVRATFRSNLPAKTFGASVRIFL
                     YPSNI"
     gene            635016..635415
                     /gene="SNR17"
                     /locus_tag="KLLA0_D07408r"
                     /db_xref="GeneID:9487403"
     ncRNA           635016..635415
                     /ncRNA_class="snoRNA"
                     /gene="SNR17"
                     /locus_tag="KLLA0_D07408r"
                     /product="U3 RNA"
                     /note="C/D snoRNAs SNR17 (U3 RNA)"
                     /transcript_id="XR_002633576.1"
                     /db_xref="GeneID:9487403"
     gene            complement(<635851..>637941)
                     /locus_tag="KLLA0_D07414g"
                     /db_xref="GeneID:2892742"
     mRNA            complement(<635851..>637941)
                     /locus_tag="KLLA0_D07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453393.1"
                     /db_xref="GeneID:2892742"
     CDS             complement(635851..637941)
                     /locus_tag="KLLA0_D07414g"
                     /note="similar to uniprot|Q75BZ7 Ashbya gossypii ACR122C
                     ACR122Cp and some similarities with YHR176W uniprot|P38866
                     Saccharomyces cerevisiae YHR176W FMO1 Flavin-containing
                     monooxygenase localized to the cytoplasmic face of the ER
                     membrane catalyzes oxidation of biological thiols to
                     maintain the ER redox buffer ratio for correct folding of
                     disulfide-bonded proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453393.1"
                     /db_xref="GeneID:2892742"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP6"
                     /translation="MAPVATVGLNNTLDGVAHALKQTKSSEGTFPEAENVQDMKKILH
                     EEDFYNKEVYPPILHEAVSDDLPLEKVYGVNVTASPELIADESKIGPLVDEWFEQFNV
                     LMNKINSGSTSVSEEDWSRLFGNHGTWRDHLGVTFDLHSFIGLENLSNDLQPLLSKAK
                     LSNFQLDKLADYRYTSGYGKVLMHEPKSGRPPVEWVQVYYTFENKLGSGKGIARLTAV
                     YDEKLQKSTLKAFTFYTGLEDYKEYPEAIFGNRPEGVNHGQHVGRESWVERRAKESTF
                     TEDHQPTVLIVGGGQGGLTVAARLKMFGVNSLIIEMNPKIGDNWRNRYKFLVLHDPVW
                     YDHLPYLNFPPSWPIFTPKDKIGDWFEGYAKTMDLNYKCSSMVTGATFDDVSNKWTVQ
                     VKDFNTGKIITYTPDHLVMATGHSGEPRMPKFQDQELFKGKIVHSSKHGSGAEFSGGK
                     ALVVGGCNSAHDICQDFYEQNVDVTMLQRSSTCVITVEHGMYHNIRGVYDETGPLTET
                     ADRIFHSMPLSLLNGVMQQQYRASCQDDVELLKALERRGFKTNAGYGGTGLFGLYFRQ
                     GSGYYIDVGCSKLICDGKVKIKQGQSIKRFLPSGTGVEFTDGTILEGLDVIVMATGYT
                     NMKETARRLFGDRVADRLDPVWGLDKEGELKTIWRDSGHPNFWYMGGNLAVSRYYSKR
                     LALRIIQQVKGLEY"
     gene            complement(<639179..>639625)
                     /locus_tag="KLLA0_D07436g"
                     /db_xref="GeneID:2892938"
     mRNA            complement(<639179..>639625)
                     /locus_tag="KLLA0_D07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453394.1"
                     /db_xref="GeneID:2892938"
     CDS             complement(639179..639625)
                     /locus_tag="KLLA0_D07436g"
                     /note="weakly similar to uniprot|Q6Q5F7 Saccharomyces
                     cerevisiae YPL144W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453394.1"
                     /db_xref="GeneID:2892938"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP5"
                     /translation="MTTLTFQDTWTSFEGTPTSVRCTTSPHRDPIVSQDRKTALSIAI
                     YLNCGDLSSGDSRTYLQGYCYGIEFVGRVQSTPKSNEVCVADLIESNDHQIHDLIHKV
                     TRILVLKYHRPCYVQIASKTAEFTLNGADQINMLQNITKCIDRNVK"
     gene            <639883..>640581
                     /locus_tag="KLLA0_D07458g"
                     /db_xref="GeneID:2892927"
     mRNA            <639883..>640581
                     /locus_tag="KLLA0_D07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453395.1"
                     /db_xref="GeneID:2892927"
     CDS             639883..640581
                     /locus_tag="KLLA0_D07458g"
                     /note="similar to uniprot|P07807 Saccharomyces cerevisiae
                     YOR236W DFR1 Dihydrofolate reductase part of the dTTP
                     biosynthetic pathway involved in folate metabolism
                     possibly required for mitochondrial function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453395.1"
                     /db_xref="GeneID:2892927"
                     /db_xref="GOA:Q6CRP4"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012259"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP4"
                     /translation="MSCKPSVCCVVACLMPGYGIGYQGSLPWRLSKEMKYFRQLTSAT
                     RDSSMRNAVVMGRKTWESIPAKFRPLPNRLNVVVSRNCQLDINDEQTQFTKSRVGDDD
                     DDDGGDDATLYAGDLSRAIDQLIANSKILGLETIYIIGGGDIYRQCIPMSHNLFITKI
                     VPDLGMPVPPMDTFLDREQIESQFKEQPHHKLQEIVPKEVSLPQFSADSSSAPTISEK
                     GFTYSFTLWSRDTQ"
     gene            <641278..>642525
                     /locus_tag="KLLA0_D07480g"
                     /db_xref="GeneID:2892926"
     mRNA            <641278..>642525
                     /locus_tag="KLLA0_D07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453396.1"
                     /db_xref="GeneID:2892926"
     CDS             641278..642525
                     /locus_tag="KLLA0_D07480g"
                     /note="similar to uniprot|P35844 YPL145C Saccharomyces
                     cerevisiae KES1 Member of the oxysterol binding protein
                     family which includes seven yeast homologs involved in
                     negative regulation of Sec14p-dependent Golgi complex
                     secretory functions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453396.1"
                     /db_xref="GeneID:2892926"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP3"
                     /translation="MSQYASSSSWTSFLKSISSFNGDLSSLTAPPFILSPVSLTEYSE
                     YWAEHPDLFLEPSFITEPDSDGTPPELLRMLAVVKWFISTLKSQYCSRNESMGSEKKP
                     LNPFLGEVFVGKWNNKSNPEFGETVLLSEQVSHHPPITAYTIFNDKNQVSLEGYNQVK
                     ASISKMSLNVKQYGHAILNFGKLNEQYLITLPPLHIEGLLAASPFVELEGKSYIQASN
                     GLYCSIEFSGKGYFSGKKNSFKARIFKSFNDSNDKHNALYTIAGQWSKISHISSGKSK
                     SGETVFYDASKLSVETLTVKSIEEQHPLESRKAWQLVAAATKSGNFDLIHQEKTKLEE
                     KQRELRREEEAKGIDWQRRWFKDYDYSEKDPDTFTKLAILANISVKNLPSGTLVSEEK
                     KDANMLHWRFDHESWDKETEIKL"
     gene            complement(<642751..>646482)
                     /locus_tag="KLLA0_D07502g"
                     /db_xref="GeneID:2892899"
     mRNA            complement(<642751..>646482)
                     /locus_tag="KLLA0_D07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453397.1"
                     /db_xref="GeneID:2892899"
     CDS             complement(642751..646482)
                     /locus_tag="KLLA0_D07502g"
                     /note="similar to uniprot|P32908 Saccharomyces cerevisiae
                     YFL008W SMC1 Subunit of the multiprotein cohesin complex
                     essential protein involved in chromosome segregation and
                     in double-strand DNA break repair SMC chromosomal ATPase
                     family member binds DNA with a preference for DNA with
                     secondary structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453397.1"
                     /db_xref="GeneID:2892899"
                     /db_xref="GOA:Q6CRP2"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP2"
                     /translation="MGRLIGLELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMD
                     AISFVLGVRSNQLRSSALVDLIYRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSE
                     EEPRSAYVSCVYQKDDLDEPTKFTRTINTSGDSVYKINDRAVSYKKYNEELESENILV
                     KAKNFLVFQGDVERIASQGPESLTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAH
                     NSRKKVQNDLKSFKEGVQRDEQYRTSLEIRDQLKHNFILWELFHILKRRKKLVDSLTV
                     SKTETTALKNKLSDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVG
                     SERLATIKRIHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHAN
                     LNKFNLSEEDLKQYELLKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTR
                     ERISDELQVDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKNKEYELNF
                     SLRDVLLKIDDLNADQRETKKERKLRENVSMLKRLYPGVKGLVHDLCHPKKEKYAIAV
                     STILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTIDVNPPSLPVSNVQGCL
                     LTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQ
                     MTGGTAQKNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKSRELENEISLLNN
                     EISSLRTQITQLERTLSGKNVEIKHNEDLITTEYEPQLKSFTQRIEELKSKLTKLESE
                     KDVLQEQIFRPFTDKYGFSIKDYEQGTGEIMRKHSKELQQFQKQILTIENKLEFEKDR
                     LGATAARHTKALSDMDKLKEALGSLEKQEDIITEKIKNADSKISQEQQLVAIQQKELD
                     EKVHNLISFDSNIAEIQSSMQAARRKVDEIKEDIETLDLEQLGILKNCKVSNIELPLL
                     DSSLEDISIDVLDSNNTGIISDLEYDFTSLPEKYRLNDGEEVKEEFESEIKKVEEKLE
                     ILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHV
                     DKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYL
                     SGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIV
                     ISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYDED"
     gene            complement(<647018..>647425)
                     /locus_tag="KLLA0_D07524g"
                     /db_xref="GeneID:2892915"
     mRNA            complement(<647018..>647425)
                     /locus_tag="KLLA0_D07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453398.1"
                     /db_xref="GeneID:2892915"
     CDS             complement(647018..647425)
                     /locus_tag="KLLA0_D07524g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453398.1"
                     /db_xref="GeneID:2892915"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP1"
                     /translation="MSLQQEGSSSASSSSSRISQRNKQVGSQSEENLTVEALRTQELS
                     VGLIVSAFVLVLSCGVIFLLGVNIVIQYRTINWGYVPKAILKMTYILLSVVSIFYINK
                     FNLYFFRLMNNRDTSNAYASIPQLEPVQMKTGV"
     gene            complement(<647984..>649927)
                     /locus_tag="KLLA0_D07546g"
                     /db_xref="GeneID:2893122"
     mRNA            complement(<647984..>649927)
                     /locus_tag="KLLA0_D07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453399.1"
                     /db_xref="GeneID:2893122"
     CDS             complement(647984..649927)
                     /locus_tag="KLLA0_D07546g"
                     /note="similar to uniprot|P07834 Saccharomyces cerevisiae
                     YFL009W CDC4 F-box protein required for G1/S and G2/M
                     transition associates with Skp1p and Cdc53p to form a
                     complex SCFCdc4 which acts as ubiquitin-protein ligase
                     directing ubiquitination of the phosphorylated CDK
                     inhibitor Sic1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453399.1"
                     /db_xref="GeneID:2893122"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CRP0"
                     /translation="MDLNRHATPGVPQYPLQNVPVPYRYQLHPQPASQSKRSIHYPLQ
                     QLDDDSDSDGQYHKKLKPNQQAVSSPNLIEDQDGPLPISPIASPCHTPEVEEPSIDEV
                     IGTTVARLSSTTSHPNALTSLIFGLVSNMDRTQLSDLVSIITDNLKRDLFQSLPNEIT
                     VKILLNLSSEDIFACLLVNRNWNRLIEEAPVVWKWLMLNEGFVTEDQFPSYCNSLPSK
                     YKHLINPDDRFRLDFLENNWCLQNWYDPNYKPGRTCLDGHSTNVVTCLQFENNYIITG
                     ADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCT
                     HVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPE
                     ENPYFVGVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLYILTGHTDRVYS
                     TIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALV
                     GLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSFHHTNLAAITSFSMNDNILVSGSERQ
                     FNVYNLRTGKLIHRKLLTDSEQVWGIKLNNRKLVAAIESVGHSYVEILDFAARNGDKT
                     IRTRTRTRVDHQIYRTSLWSSTL"
     gene            <650626..>651738
                     /locus_tag="KLLA0_D07568g"
                     /db_xref="GeneID:2893156"
     mRNA            <650626..>651738
                     /locus_tag="KLLA0_D07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453400.1"
                     /db_xref="GeneID:2893156"
     CDS             650626..651738
                     /locus_tag="KLLA0_D07568g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453400.1"
                     /db_xref="GeneID:2893156"
                     /db_xref="GOA:Q6CRN9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN9"
                     /translation="MSVCIVGAGVIGLSSALRLLETRPDIRTITIVSEQFPQDQPINH
                     TFTSPWAGAHFRPFPHRDSDYASDKRESEYTRVTYNYFKRKSKQWLSEATVEFMNGID
                     WLENPSIEYQRLGAGYNGSSLEKFQQQDSNLPAGVTFGCSYETWCLNAPLYLLFLYDQ
                     VMKKSEQQNVNIRVKRIKLEKLKDICELYPDVNIVVNASGCGLQWEGGLDPKCFLVRG
                     QTLLLDVGDKHDTIPYAHATITHQAKSGDWTFVIKRPGKNGKKAYYILGGTKQPGDYS
                     VMPRDTDTEKLIGRGKKLFPELLENFEIKNVNVGFRPLRVGGSRVELEFNKSPDGEQM
                     PVIHAYGLGGMGFETSMGVAYHIQKLYNNVFSTSKL"
     gene            <651918..>652211
                     /locus_tag="KLLA0_D07579g"
                     /db_xref="GeneID:9487344"
     mRNA            <651918..>652211
                     /locus_tag="KLLA0_D07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999325.1"
                     /db_xref="GeneID:9487344"
     CDS             651918..652211
                     /locus_tag="KLLA0_D07579g"
                     /note="highly similar to uniprot|Q6D0Z1 Erwinia carotovora
                     subsp ECA3657 Putative exported protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999371.1"
                     /db_xref="GeneID:9487344"
                     /db_xref="UniProtKB/TrEMBL:B5FV74"
                     /translation="MHLSNEVSGAVRTFTYFMVSGTHYMLKGVDYISLYGEEPSAIEQ
                     AYAIFMNVLEIDEQGKVINVKHAEKRATDYIRSYCESTFEVDPPFEDWEVQLY"
     gene            <652790..>654859
                     /locus_tag="KLLA0_D07590g"
                     /db_xref="GeneID:2893220"
     mRNA            <652790..>654859
                     /locus_tag="KLLA0_D07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453401.1"
                     /db_xref="GeneID:2893220"
     CDS             652790..654859
                     /locus_tag="KLLA0_D07590g"
                     /note="similar to uniprot|Q750H9 Ashbya gossypii AGL028C
                     AGL028Cp and weakly similar to YFL013C uniprot|P43579
                     Saccharomyces cerevisiae YFL013C IES1 Subunit of the INO80
                     chromatin remodeling complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453401.1"
                     /db_xref="GeneID:2893220"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN8"
                     /translation="MAKRVYDPIHDTYQIQVTPEPPVLSQPRPDGNEEEDRDSDSTQS
                     EPSQSAAISMPDSSNDENKYYEKESTVSADSPNSALPSDSQHSVIPPPPPMELVQYPG
                     NERKSKHSHAMNFMTTTLRPKPKAKEPSRYTRHLKKSDGEPFTRKDIQYEFLSNLLSD
                     TRQIFSNPFQDFFPLEYTPEEGKVVNVTDVDYNARTFIKTEKLTFSQIYILTIASSSK
                     CSKVLRDKLLFDHHVAFSTCILSLLVNMGRLNTTVNFFLEMTSQLRTFHSIPCLQHYS
                     SDPKSLQDTPRIKSILKTIPLGSDTPIEFHKWYAADYPRNPSEWVNPVSLIFAFCEQH
                     AILDWNIIIPNCKPKTSLYQLFDDNNYSPQLRVNLFLWLMYIHMETNLTPESLQSSKP
                     LFQVEPNGTFLLTASHLEHDIDTPVEVTYGEEQLEKRISFLNQTGAERTIVQQTMETP
                     PTGPDDEPLDPEAALEEPVPAPPPPKPKQSRATSKEKGGKSQPVIIQQDTQRKKRQSN
                     AAGSKNNSEENNNNSESKAAIRAKIQQDKDERVQQKIDLDKNFKIRDDLTQTQLRTKL
                     IEAHKITNKKNHELGLVKLFDEFEDVPLATIIGIRGKKRKKFSDGILGYETDMLGVLR
                     HSKRTMLKRLREKRGVPNPEEENSSAVQEATTEPKVMAESTAETLAADPTEKVENERN
                     GTAFHDS"
     gene            complement(<654909..>655721)
                     /locus_tag="KLLA0_D07612g"
                     /db_xref="GeneID:2893227"
     mRNA            complement(<654909..>655721)
                     /locus_tag="KLLA0_D07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453402.1"
                     /db_xref="GeneID:2893227"
     CDS             complement(654909..655721)
                     /locus_tag="KLLA0_D07612g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453402.1"
                     /db_xref="GeneID:2893227"
                     /db_xref="GOA:Q6CRN7"
                     /db_xref="PDB:3ZXU"
                     /translation="MDFTSSSGVLDSERNTGSNDSDEPSSHSDVIETEELKLIKLQEH
                     KNNLLRQRSELLDQLSQTRVVEPRSVQLDDKLLLKLLRRNDNAVSDSSQSSNNPLPRV
                     LPSLNIEQRKKYLDITLNDVTVTCEKDMILLRKGSFTASFRIAVENESIRSMAIDLNA
                     FEVELQPIIQYAEDTQNVNVAMMAVVQFLRIKELHEQMISKIVEASKFIRASNNTITL
                     NDLEVSFHCYWNLPSPYPETLILTNKVQKILDFLIYQYGIQLGVIKYGSTII"
     gene            complement(<656256..>656576)
                     /locus_tag="KLLA0_D07634g"
                     /db_xref="GeneID:2893432"
     mRNA            complement(<656256..>656576)
                     /locus_tag="KLLA0_D07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453403.1"
                     /db_xref="GeneID:2893432"
     CDS             complement(656256..656576)
                     /locus_tag="KLLA0_D07634g"
                     /note="similar to uniprot|P22943 Saccharomyces cerevisiae
                     YFL014W HSP12 Plasma membrane localized protein that
                     protects membranes from desiccation induced by heat shock
                     oxidative stress osmostress stationary phase entry glucose
                     depletion oleate and alcohol regulated by the HOG and
                     Ras-Pka pathways"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453403.1"
                     /db_xref="GeneID:2893432"
                     /db_xref="GOA:Q6CRN6"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="InterPro:IPR016360"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN6"
                     /translation="MSDSARKNFGDKVSESVKPDSQKGYLEKGKEVVTDQADKLAGKV
                     QPQENKGLGQTVHDSAQEGKDDATGKSFGETAQEYVDEAKNKLGEAAEYISKQVHGGE
                     EGTK"
     gene            <658179..>659594
                     /locus_tag="KLLA0_D07656g"
                     /db_xref="GeneID:2893611"
     mRNA            <658179..>659594
                     /locus_tag="KLLA0_D07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453404.1"
                     /db_xref="GeneID:2893611"
     CDS             658179..659594
                     /locus_tag="KLLA0_D07656g"
                     /note="similar to uniprot|P35191 Saccharomyces cerevisiae
                     YFL016C MDJ1 Protein involved in folding of
                     mitochondrially synthesized proteins in the mitochondrial
                     matrix localizes to the mitochondrial inner membrane
                     member of the DnaJ family of molecular chaperones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453404.1"
                     /db_xref="GeneID:2893611"
                     /db_xref="GOA:Q6CRN5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN5"
                     /translation="MFKRYLLQYPRQFHTARLLRQEFKDPYKVLGINKNSSQSDIKKA
                     YYKLAKKYHPDINKEEDSQKKFHDLQNAYEILSDEDKRKQYDQFGAAAFSQAGGAGGP
                     GGAYGGAGAGGAQGFGGFGGFDFGGLNFEDLFGSAFGGGGGGGAGGRRAGSHGAGFGG
                     SDFVREYKGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHSRSVCP
                     TCHGTGTQVHVRAGFQMASTCQTCDGEGSTIKDSDKCGTCHSHGFKLNSNKTITVDLP
                     HGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLTRGDLLIRVRVRKDTRFQVSNNYDII
                     YTQEIPITTAALGGVIEVPTVEEEKIRLKVSSGTQHDQVIRIPNKGVPRGARGDRGDM
                     LVKFKIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGSSAKDNSSSADKDTVENN
                     EGTIKKLENFLSNTLKKIRGE"
     gene            <660137..>660436
                     /locus_tag="KLLA0_D07678g"
                     /db_xref="GeneID:2893500"
     mRNA            join(<660137..660160,660239..>660436)
                     /locus_tag="KLLA0_D07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453405.2"
                     /db_xref="GeneID:2893500"
     CDS             join(660137..660160,660239..660436)
                     /locus_tag="KLLA0_D07678g"
                     /note="highly similar to uniprot|P40204 Saccharomyces
                     cerevisiae YFL017W-A SMX2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453405.2"
                     /db_xref="GeneID:2893500"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN4"
                     /translation="MTSPDLRKYMDKKLILQLNGNRKIIGILRGYDAFLNLVLDNPIQ
                     IFEEGEVQMGPQTVVRGNSIVSIEPLDSL"
     gene            complement(<660561..>661127)
                     /locus_tag="KLLA0_D07700g"
                     /db_xref="GeneID:2893532"
     mRNA            complement(<660561..>661127)
                     /locus_tag="KLLA0_D07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453406.1"
                     /db_xref="GeneID:2893532"
     CDS             complement(660561..661127)
                     /locus_tag="KLLA0_D07700g"
                     /note="similar to uniprot|P43577 Saccharomyces cerevisiae
                     YFL017C GNA1 Evolutionarily conserved
                     glucosamine-6-phosphate acetyltransferase required for
                     multiple cell cycle events including passage through START
                     DNA synthesis and mitosis involved in
                     UDP-N-acetylglucosamine synthesis forms GlcNAc6P from
                     AcCoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453406.1"
                     /db_xref="GeneID:2893532"
                     /db_xref="GOA:Q6CRN3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN3"
                     /translation="MNHDKRTFIVSLLHQQLILPFISTIILPLIGILTMSLPEGYTIR
                     RTKKDDFSGVTSVLKVLTMVGDVSQDQFHSLIDHWDSVTIGDIPMYNSTVIVDTNGEV
                     VATGNVLVEKKVIHECGLVGHIEDIAVRKDQQGKKLGLILIQYLYKLANEYGCYKVIL
                     DCDESNVGFYEKCGLKKAGVEMQIRFDK"
     gene            complement(<661143..>661655)
                     /locus_tag="KLLA0_D07722g"
                     /db_xref="GeneID:2892884"
     mRNA            complement(<661143..>661655)
                     /locus_tag="KLLA0_D07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453407.1"
                     /db_xref="GeneID:2892884"
     CDS             complement(661143..661655)
                     /locus_tag="KLLA0_D07722g"
                     /note="weakly similar to uniprot|Q12155 Saccharomyces
                     cerevisiae YLR050C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453407.1"
                     /db_xref="GeneID:2892884"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN2"
                     /translation="MSKEQRDSRKTQLWKINLWKIWYAVNIPIITFLDSNAVLPPYLQ
                     YTKGLLDGYIDNFNDFLTANPPNWLKYMTIIEILFQLPVAIYCLYQLLNLSKSKTIKR
                     TLFTVDRLSKCYAFNVITTTSFCIWYVWAYGYYPATMNTDHVSLSNPDKLALTMVYVP
                     YVLIPALFFV"
     gene            complement(<662166..>663647)
                     /locus_tag="KLLA0_D07744g"
                     /db_xref="GeneID:2892721"
     mRNA            complement(<662166..>663647)
                     /locus_tag="KLLA0_D07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453408.1"
                     /db_xref="GeneID:2892721"
     CDS             complement(662166..663647)
                     /locus_tag="KLLA0_D07744g"
                     /note="similar to uniprot|P41948 Saccharomyces cerevisiae
                     YNL142W MEP2 Ammonium permease involved in regulation of
                     pseudohyphal growth belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4) expression is under the nitrogen catabolite
                     repression regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453408.1"
                     /db_xref="GeneID:2892721"
                     /db_xref="GOA:Q6CRN1"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN1"
                     /translation="MSEFTGIPTDTGTGGNSLDTDLNTPYDKANMAWIMVAGSFVWLM
                     VPGIGLLYSGLSRKKHALSLLWASIMTISVVTFQWYWWGYSLVFSHNTRGNGFIGTLS
                     EFGFKNVLGAPSAAGTVPDILFAWFQGMFAMVTGILMVGGACERARLFPMMVFLFLFI
                     TIVYCPIACWTWNPEGWLATLGALDYAGGGPVHICSGHGALIYALILGRRNDPLTKSG
                     VPKYKPHSVTSVVLGTVFTWIGWIGGFNPGSAGNATIRAWYSAYSTNLAAACGALTWM
                     FIDYFRSGRKWTTVGLCSGAISGLVGITPAAGFVPLWASVIIGIVTAAGCNLAVDLKN
                     LLKIDDGLDVYALHGVGGCIGSVLTGIFAADYINALAGVESSPIAGGWINHNYKQVGY
                     QLAAVCATIAWTCVVTACLLLILDRIPFLRLRLRPEEEELGTDEAEIGEFTYEEDAVY
                     IPEPIRSKSIAEAPPANIDDKIHTGNNSSSELQSEPKTTSANA"
     gene            complement(<664947..>666416)
                     /locus_tag="KLLA0_D07766g"
                     /db_xref="GeneID:2892835"
     mRNA            complement(<664947..>666416)
                     /locus_tag="KLLA0_D07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453409.1"
                     /db_xref="GeneID:2892835"
     CDS             complement(664947..666416)
                     /locus_tag="KLLA0_D07766g"
                     /note="similar to uniprot|P41948 Saccharomyces cerevisiae
                     YNL142W MEP2 Ammonium permease involved in regulation of
                     pseudohyphal growth belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4) expression is under the nitrogen catabolite
                     repression regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453409.1"
                     /db_xref="GeneID:2892835"
                     /db_xref="GOA:Q6CRN0"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:Q6CRN0"
                     /translation="MSEFTGIPTDTGTGGNSLDTDLNAPYDKADMVWIFIAGSFVWLM
                     VPGIGLLYSGLSRKKHALSLLWASIMTIAVVTFQWYWWGYSLVFSKTRGNGFIGTLSM
                     FGFKDVLGAPSAVGVVPDIVFAWFQGMFAIATGILMVGGACERARLFPMMVFLFLFIT
                     IVYCPIACWTWNPEGWLAALGALDYAGGGPVHICSGHGALMYALILGKRNDPLTKSGV
                     PKYKPHSVTSVVLGTVFTWLGWIGAFNPGSAGNTTIRAWYSAYSTNLAGSCGALTWMF
                     IDYFRCGRKWTTVGLCSGAIAGLVGITPAAGFVPLWASVIVGIVTAAGCNFAVDLKHI
                     LRIDDGLDVYALHGVGGCIGSVLTGIFAADYINALAGVESSPIAGGWINHNYKQVGYQ
                     LAAMCASVAWTCVVTACLLLILDRIPFLRLRLRPEEEELGTDEVEIGEFTYEEDAVYI
                     PEPIRSKSIAEAPAAIIDDKVQTGNSSSEELQSEPKTNA"
     gene            <667841..>668506
                     /locus_tag="KLLA0_D07788g"
                     /db_xref="GeneID:2892785"
     mRNA            <667841..>668506
                     /locus_tag="KLLA0_D07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453410.1"
                     /db_xref="GeneID:2892785"
     CDS             667841..668506
                     /locus_tag="KLLA0_D07788g"
                     /note="similar to uniprot|P38842 Saccharomyces cerevisiae
                     YHR140W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453410.1"
                     /db_xref="GeneID:2892785"
                     /db_xref="GOA:Q6CRM9"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:Q6CRM9"
                     /translation="MTRNGYVLLLSLACVFTTTYGLIQCTQIKLPSNLATAGHKQFLT
                     NISAVVTIVNGALNTVNQLLGNKGTLHFWSREFTFPIATCLETIVCVIYWPLRIFFIP
                     LIMHGVQDSSRSPLPMHVDIAIHLLPIIYLCLDYFFLKEAPFQIAGWKVFLSLPLLGL
                     TYRIYLDSIIGPSGSYPYPFLDVPEPYKSVIFVTVSLSSGGLYILYQKFHRNQRSVSL
                     KRD"
     gene            complement(<669095..>671251)
                     /locus_tag="KLLA0_D07810g"
                     /db_xref="GeneID:2893513"
     mRNA            complement(<669095..>671251)
                     /locus_tag="KLLA0_D07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453411.1"
                     /db_xref="GeneID:2893513"
     CDS             complement(669095..671251)
                     /locus_tag="KLLA0_D07810g"
                     /note="some similarities with uniprot|P53894 Saccharomyces
                     cerevisiae YNL161W CBK1 Protein kinase involved in cell
                     wall biosynthesis required for efficient apical growth
                     proper mating projection morphology bipolar bud site
                     selection in diploid cells and cell separation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453411.1"
                     /db_xref="GeneID:2893513"
                     /db_xref="GOA:P31034"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /translation="MYGGYSNQNYYQQPSGRPNDFQQQGNMPFSEPSQPMFSTNYMKQ
                     QGSQPSLQDRLTQQQSQPQSHNNQYYPNGGFTDVPNLNYPATPPPTQSIYSHNNNSNS
                     KVYQSAQHTSPGQYSVASESGLYIPPPLQQQQNGQQSPVRSVHQQTQQTPPTFTQQQS
                     SSQPQSPQHNTYHAQQQQQQQQQQQQTQQAQQQGQRQTQQQSQQQAQQQNGSANNYMY
                     FERRPDLLTKTTQDKAAAVKLKIENFYQSSVGYAIERNQRRLELESELASQDWSEERK
                     NRQLASLGKKESQFLRLRRTRLSLDDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTL
                     LKSEMYNKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTML
                     IRWQIFTEDVTRFYMAECILAIEVIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTG
                     FHKTHDSSYYKKLLQEDEAKKQQQQQQQQQQLNLQKPQLPNETNNGNRNTMLVDAIHL
                     TMTNRQQMQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIG
                     WPPFCSETPQETYRKIMNFEQTLQFPDDIHISYEAEDLIRRLLTHSENRLGRHGGADE
                     IKAHPFFSGVDWNTIRQVEAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAARQREQ
                     MMTQQQGVPQSNAKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<671772..>672682)
                     /locus_tag="KLLA0_D07832g"
                     /db_xref="GeneID:2892940"
     mRNA            complement(join(<671772..672088,672679..>672682))
                     /locus_tag="KLLA0_D07832g"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_453412.1"
                     /db_xref="GeneID:2892940"
     CDS             complement(join(671772..672088,672679..672682))
                     /locus_tag="KLLA0_D07832g"
                     /note="highly similar to uniprot|P02405 Saccharomyces
                     cerevisiae YHR141C RPL42B Proteins component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_453412.1"
                     /db_xref="GeneID:2892940"
                     /db_xref="GOA:P31027"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /translation="MVNVPKTRKTYCKGKECRKHAQHKVTQYKAGKASLYAQGKRRYD
                     RKQSGFGGQTKQIFHKKAKTTKKVVLRLECMSCKTKTQLALKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <673829..>674782
                     /locus_tag="KLLA0_D07854g"
                     /db_xref="GeneID:2892936"
     mRNA            <673829..>674782
                     /locus_tag="KLLA0_D07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453413.1"
                     /db_xref="GeneID:2892936"
     CDS             673829..674782
                     /locus_tag="KLLA0_D07854g"
                     /note="similar to uniprot|P38843 Saccharomyces cerevisiae
                     YHR142W CHS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453413.1"
                     /db_xref="GeneID:2892936"
                     /db_xref="GOA:Q6CRM6"
                     /db_xref="InterPro:IPR022057"
                     /translation="MSFGDFSKICQRTPLPLCSVVKSAKQMVLTNDTTIKNSRLDIID
                     LGIIPVCYARSIDVANTMIFEIGNAFINIVAFFLLIIIIYNVRRKVTAIGRSEYSYFF
                     QTCLVLIIFTLIVDCGVSAPGSSAYPYLVSVQLGLAGACCWMLSVLGLLGFRLWEDGT
                     FKSMLLLYGMSFGGFILNFVVSIVTFKEWIQRKSDMSTDTMGLFTVMYVINALALLIY
                     IICLLIVSVKVLQNYWATGAILLGVFFFVAGQVLIYAFSNNICEGMNHYLDGMFFGSL
                     CNLFAIMMLYKNWDMSTDDDLEFSVSIDSTEYSTFNSDIKL"
     gene            complement(<674961..>675176)
                     /locus_tag="KLLA0_D07876g"
                     /db_xref="GeneID:2893187"
     mRNA            complement(<674961..>675176)
                     /locus_tag="KLLA0_D07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453414.1"
                     /db_xref="GeneID:2893187"
     CDS             complement(674961..675176)
                     /locus_tag="KLLA0_D07876g"
                     /note="similar to uniprot|Q3E7A8 Saccharomyces cerevisiae
                     YNL162W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453414.1"
                     /db_xref="GeneID:2893187"
                     /db_xref="UniProtKB/TrEMBL:Q6CRM5"
                     /translation="MSKPKNDLKCPQCQSNLQRCLIQQNYAVTICTNETCQYPFNSNE
                     IINDLSFISDRDILRAAKSRLEDEQRK"
     gene            <675451..>678831
                     /locus_tag="KLLA0_D07898g"
                     /db_xref="GeneID:2893525"
     mRNA            <675451..>678831
                     /locus_tag="KLLA0_D07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453415.1"
                     /db_xref="GeneID:2893525"
     CDS             675451..678831
                     /locus_tag="KLLA0_D07898g"
                     /note="similar to uniprot|P53893 Saccharomyces cerevisiae
                     YNL163C RIA1 Cytoplasmic GTPase involved in biogenesis of
                     the 60S ribosome; has similarity to translation elongation
                     factor 2 (Eft1p and Eft2p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453415.1"
                     /db_xref="GeneID:2893525"
                     /db_xref="GOA:Q6CRM4"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRM4"
                     /translation="MSRAGPETSKRLQADPSCIRNICILAHVDHGKTSLSDSLLASNG
                     IISQKLAGRVRYLDSRPDEQLRGITMESSAISLYFRVLHKQESSDEPLVNEHLINLID
                     SPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWIEKLKPILVLNKIDR
                     LISEWQLTPQEAYAHLSKVIEQVNSVIGSFFAGERSLDDESWRERLEQNIDAEYVERD
                     DSDLYFNPMDNNVIFASAVDGWGFNIGRFAKFYQEKLGAKRENLQKVLWGDFYMDPKT
                     KKIINQKGLKGRNLKPLFVSLILDNIWMIYDNILNQHDPDTLTKITNALNIKIQPRDI
                     RSKDYKNLLRTIMGQWVPVSTAVLLSVVEKLPSPVDSQRERIDTLLGNSVGYELTDKD
                     LIEGVRKCDKIAPVCAYVSKMLSIPKDELPLQAAGGPLSIDAVIARSRKAREEAMKAA
                     KQAEMLDTMKKKSLDQDETHKQNKDDAFERVFDSTVTPDIDVIKANAIKSKQAVRNTE
                     NDEITVVTEAAPKFDLGIDFDYEDEEAEANIDTSEGGLADFIPQDIDPNDPLASMFEY
                     EEEDPFASESETVEDLNADAASVDEFTLEDSNEILIGFTRLYSGTLKVGQQISVLGPK
                     YNPSNPTEHIETAEISSLYLFMGRDLVPLDECPAGNIVGVGGLAGKLLKNGTLIECGV
                     SGVNLAGLNLHSQPIVRVALEPVNPTHMNRLVHGLQLLNQADPCVETYMTDNGEHVLC
                     TAGELHLERCLKDLKERFAGIEITSSEPVIPYKETFVAIPEMNPAKNAELGRGYTQGF
                     LANYRLRFRALPLPSSVIKFLLDNEHTLNEVMDKTVDSTQKSDKRSSLISQLKSLFKE
                     HVEHSDSTEWNDTFEKCVNEIAVFGPKFSGPNILVDLTDSVRKFDGRSGKFAYEYSII
                     NGFQLSVSEGPLAKEPVQGMCIVLEEIKEMTEAEMDMITEVGYQRSIPNFAGRLITKT
                     RDLVHESMMDWSPRLMWAMYTCDIQASVEVLGKVYAVVQQRRGRITSEELKEGTPFFQ
                     IEARIPVVEAFGFSEDIRKKTSGAAQPQLVFAGFESIDLDPFWVPKTEEELEEMGEIA
                     DKENIARKYMNDIRRKKGLFVDEKVIQNAEKQRTLKRN"
     gene            <679160..>680167
                     /locus_tag="KLLA0_D07920g"
                     /db_xref="GeneID:2893181"
     mRNA            <679160..>680167
                     /locus_tag="KLLA0_D07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453416.1"
                     /db_xref="GeneID:2893181"
     CDS             679160..680167
                     /locus_tag="KLLA0_D07920g"
                     /note="weakly similar to uniprot|P53892 Saccharomyces
                     cerevisiae YNL164C IBD2 Component of the BUB2-dependent
                     spindle checkpoint pathway interacts with Bfa1p and
                     functions upstream of Bub2p and Bfa1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453416.1"
                     /db_xref="GeneID:2893181"
                     /db_xref="GOA:Q6CRM3"
                     /db_xref="InterPro:IPR026231"
                     /translation="MGNGNASIEFVSENGPIDFSVMMQEGVKALTKILSTHLQDNPDL
                     INEKSMKVIFKDNNGKLEPVFAPSEGNSGLINGNDQDENYDEDRDIEEANEDYEVIEF
                     DNEGNYHVCAKGTQNRAIGYDEKVYSKSEHYADSTDTHDYDEDGIINEDNNQLLPKDK
                     WNGHMTRLKNGAISSAEHEVVFEHDNGDNTTFSPAETINDGHMDKRDRSHMHHSGHSE
                     KTGGSCACQENKDSFKYPDHVPNSAPNFRALLQHTVNGKQMCPFCEYYVVFGTPPAYI
                     MRWASSKISAEHSQYKMNDQIVDGDSGDMDRNLDSVETNEMNKQQTKKKKKKSKRKSK
                     R"
     gene            <681139..>681933
                     /locus_tag="KLLA0_D07942g"
                     /db_xref="GeneID:2893450"
     mRNA            <681139..>681933
                     /locus_tag="KLLA0_D07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453417.1"
                     /db_xref="GeneID:2893450"
     CDS             681139..681933
                     /locus_tag="KLLA0_D07942g"
                     /note="some similarities with uniprot|P38844 Sacharromyces
                     cerevisiae YHR143W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453417.1"
                     /db_xref="GeneID:2893450"
                     /db_xref="GOA:Q6CRM2"
                     /db_xref="InterPro:IPR026225"
                     /translation="MQFKKSSIVSFLSLLGSLTKAAAEVRLVTMDGVVYSYQVVTSTI
                     KPATTYVETIYYTTTYVEAVTLTNHAVTSTTRESVVTSTLSSTSLLPETTEESTQEDE
                     QTTDFTSTTDVESTTDVTSTTAETATLEPTTSDETYTTELTPTTSVKTTLENDDSTSV
                     ITTKSTSKANTQSISRKTSTLTPTVTSETTESTSAETLSSTDKSTSTSSSSVLEPMVT
                     NTDCQVVYEYTDDDEYYSTVEISGTESVDAATTYTKTRTVYATISS"
     gene            complement(<682226..>683278)
                     /locus_tag="KLLA0_D07964g"
                     /db_xref="GeneID:2892725"
     mRNA            complement(<682226..>683278)
                     /locus_tag="KLLA0_D07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453418.1"
                     /db_xref="GeneID:2892725"
     CDS             complement(682226..683278)
                     /locus_tag="KLLA0_D07964g"
                     /note="weakly similar to uniprot|P53891 Saccharomyces
                     cerevisiae YNL165W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453418.1"
                     /db_xref="GeneID:2892725"
                     /db_xref="UniProtKB/TrEMBL:Q6CRM1"
                     /translation="MNRFRSRYGQNNQDSRSNADDQNTLMSFPHSTPGEMESVFSESS
                     TIGDFERLGFVNRSPRFASNRTVIFASVMLSKGFFAWENQDTFDTFISNRRKLDKCLD
                     SGKGWPLFHYVSVGFKSYFRKSTPVSKIYKYKVVDNDKVDDIKEPNKELLHQNEKRSL
                     FKVEFCNVFRNVINSEGIVYHKFVCFQPDGIRCSVLMMNSIGRRNTDCQVYEPITDSL
                     LNLRWIGTTGYTSVFGANDLKLVILDDQVPHLSSRASQERDNDRRDSQRSEHARSQSK
                     MPVWAMYSRTTSILPIPRHRVLKLATFQISEVENAEQVPFTSELLTCMSMYLHELESR
                     KERRSPLTSAPMISMV"
     gene            <683732..>684730
                     /locus_tag="KLLA0_D07986g"
                     /db_xref="GeneID:2892826"
     mRNA            <683732..>684730
                     /locus_tag="KLLA0_D07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453419.1"
                     /db_xref="GeneID:2892826"
     CDS             683732..684730
                     /locus_tag="KLLA0_D07986g"
                     /note="similar to uniprot|P53890 Saccharomyces cerevisiae
                     YNL166C BNI5 Protein involved in organization of septins
                     at the mother-bud neck may interact directly with the
                     Cdc11p septin localizes to bud neck in a septin-dependent
                     manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453419.1"
                     /db_xref="GeneID:2892826"
                     /db_xref="UniProtKB/TrEMBL:Q6CRM0"
                     /translation="MDSEQVKKRMSQIELEISEMNEMIDKNLSIHETTVKTKQDVSSD
                     DQDEDYLELQKLTANQVDQFVQNAIKSDGEDEVPETLSSGRETALQAEEREDIKEEKP
                     GTQLEAAVVAEVVAEVQTEPTAEKAIPAVSVTSVPAKRIPSEKIEVSTSTEEDEAAAA
                     ATIVPNTDKSSTYPAPAAIGHTQNGTVPRAPNTDSSNIPTSPRILTPKSNPFRVVHVG
                     SQPSSRNASRNSSRVSSTSSDISDINFEQLQQNYNSLSVKCTKLQKEIDYLHKFKNES
                     TLTLEDRRKLITAIEKLQEYLDKKNKQRYDTGVILSRQIRKNVDMGANGQFWVGRS"
     gene            <684998..>685210
                     /locus_tag="KLLA0_D08008g"
                     /db_xref="GeneID:2892762"
     mRNA            <684998..>685210
                     /locus_tag="KLLA0_D08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453420.1"
                     /db_xref="GeneID:2892762"
     CDS             684998..685210
                     /locus_tag="KLLA0_D08008g"
                     /note="highly similar to uniprot|P40422 Saccharomyces
                     cerevisiae YHR143W-A RPC10 RNA polymerase subunit
                     ABC10-alpha common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453420.1"
                     /db_xref="GeneID:2892762"
                     /db_xref="GOA:Q6CRL9"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL9"
                     /translation="MSREGFQIPTNLDAAAAGAAQSRTATLKYICAECSSRLSLSRTD
                     PVRCKNCGHRILLKARTKRMVQFEAR"
     gene            <685876..>687540
                     /locus_tag="KLLA0_D08030g"
                     /db_xref="GeneID:2893553"
     mRNA            <685876..>687540
                     /locus_tag="KLLA0_D08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453421.1"
                     /db_xref="GeneID:2893553"
     CDS             685876..687540
                     /locus_tag="KLLA0_D08030g"
                     /note="weakly similar to uniprot|Q02100 Saccharomyces
                     cerevisiae YNL167C SKO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453421.1"
                     /db_xref="GeneID:2893553"
                     /db_xref="GOA:Q6CRL8"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL8"
                     /translation="MNINEKPVTSFDLEPNPFEQSFASTKKGPVASNGEIPVKNASIG
                     SNSGNAIVTTGASTGVNPPHSNAPVLDNKARLLMNISAGVGATAAGAVAGTVAGGAEA
                     VKSPPRYLTTNKPPTIQSPPILSPGGSRRLPPLNISPNAAISNSLHGQTSPGAFYLNL
                     PKTGLTPNESNIRSGLTPAVMSNGNNNPSNNPTVPTNEIVPGQNNLSAIPVALTSSSG
                     LTPGRFTPMLNSLLNMPSEEPVFPMVNGSNSINNANINSSNVNTIDSNNQAKDESNTS
                     YSNRSPNSSSNNSNILSTHSNTTHSLMSNHPSQVILAADIPLDKVKNPVEIMKTVYSN
                     SNSSITYNNSNNSEPSQSKNAITSQSQRKSSTNNTASNEPAESKENVNGTSSKVSKPT
                     SKKRKASTSSKSKSKVSPNDSDHHSETPYDIDSYPGDTDADRARKRKEFLERNRIAAS
                     RFRKRKKEYIKRIEADVSFYESEYNDLSACLASLTGISPHNNSMGNPSLINSLKQALI
                     TQDLKSALQVCDMLEHTVLKTKYVQRNGVNTRELAHRSEDMDDSDA"
     gene            <687922..>688707
                     /locus_tag="KLLA0_D08052g"
                     /db_xref="GeneID:2892757"
     mRNA            <687922..>688707
                     /locus_tag="KLLA0_D08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453422.1"
                     /db_xref="GeneID:2892757"
     CDS             687922..688707
                     /locus_tag="KLLA0_D08052g"
                     /note="highly similar to uniprot|P53889 Saccharomyces
                     cerevisiae YNL168C FMP41 The authentic non-tagged protein
                     was localized to mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453422.1"
                     /db_xref="GeneID:2892757"
                     /db_xref="GOA:Q6CRL7"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL7"
                     /translation="MSYEYLNRAKKIICIGRNYAAHIKELNNATPKQPFFFLKPTSSL
                     VTPVGPMSKSRLNPEESATFNGLNEDGSNPGPIYVPKGTIIHHEVELALVVDKHLSNL
                     NKESFGPEQVWDSISGVSLALDLTARNVQDEAKKKGLPWTIGKGFDTFCPISHFIPKE
                     ELFNKTNLQDSFRLSCSVNGQLRQNDSTSLMLNPLHTILQHISTMISLEPNDIVLTGT
                     PAGVGELHPGDTIECELYQDDKLLVSFEFDCEQRPGPYEYKEV"
     gene            complement(<688785..>689807)
                     /locus_tag="KLLA0_D08074g"
                     /db_xref="GeneID:2892789"
     mRNA            complement(<688785..>689807)
                     /locus_tag="KLLA0_D08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453423.1"
                     /db_xref="GeneID:2892789"
     CDS             complement(688785..689807)
                     /locus_tag="KLLA0_D08074g"
                     /note="similar to uniprot|P06773 Saccharomyces cerevisiae
                     YHR144C DCD1 Deaminase required for dCTP and dTTP
                     synthesis expression is cell cycle regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453423.1"
                     /db_xref="GeneID:2892789"
                     /db_xref="GOA:Q6CRL6"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL6"
                     /translation="MLIGISGTLFSDVEIVGQALSEIYDAPWLDVETLGGWDTLLDYG
                     TKNFTKSYVVQGIDSMVILEKLAKRPFFVHIAVDCTLARRLENWRNALNDGTNVVVNG
                     GSKGKDHAPLNCHSIEQILESMDFFDYAKEDSLTSINERSLIKVVFHSTVPFESVKKQ
                     LYEQLNNVIDSKSLTAPLRPCWDTYFMKLANLAASRANCMKRRVGCVIVRDCRVVATG
                     YNGTPRNMKNCNQGGCSRCNDGDDKSLHTCLCLHAEENALLEAGRDRVGPNAILYCDT
                     CPCLTCSVKIVQTGIKEVVYSHSYRMDEQSLKVLRDGKVTVRQHKLIDERTTIHIGRT
                     DISVPR"
     gene            <690272..>691750
                     /locus_tag="KLLA0_D08096g"
                     /db_xref="GeneID:2893570"
     mRNA            <690272..>691750
                     /locus_tag="KLLA0_D08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453424.1"
                     /db_xref="GeneID:2893570"
     CDS             690272..691750
                     /locus_tag="KLLA0_D08096g"
                     /note="similar to uniprot|P39006 Saccharomyces cerevisiae
                     YNL169C PSD1 Phosphatidylserine decarboxylase of the
                     mitochondrial inner membrane converts phosphatidylserine
                     to phosphatidylethanolamine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453424.1"
                     /db_xref="GeneID:2893570"
                     /db_xref="GOA:Q6CRL5"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL5"
                     /translation="MIGISRNVSLTMSRIPWPQVPQRVSGPYLKNKTKMLLSQRFMSS
                     GPIVRPENSKKRMVKWVVATSFTLIISSYLINQHYQRIKVAESGDVVEGDSQDKVKGK
                     YRIKIFNNNWLFFCYSTLPLNAISRLWGQVNSLNLPTWVRPWSYKLYATLFHANLDEM
                     DDPDLSHYENLSQFFYRTIRPETRPIDFDENVVVCPSDGTVLQFGIIDPHLGHIEQVK
                     GMTYSVKEFLGTHGHPLLQRTPSEEKLGQDTKTDNDHREFARINDIPYSLNDIIGHTP
                     GSQSEDHLQPFDYKMEKNQAISDQDSSKTFTLLGELSPNYVKQKLSSTDTQLYFAVIY
                     LAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFVLNERVALLGHWKHGF
                     FSMTPVGATNVGSIKLNFDKELITNEKTQRHCKPHTCYEATYENASKVLGGVPLIKGE
                     EMGGFMLGSTVVLCFEAPREFNFKINVGDKVKMGQPLGKVEQ"
     gene            complement(<691907..>696760)
                     /locus_tag="KLLA0_D08118g"
                     /db_xref="GeneID:2892923"
     mRNA            complement(<691907..>696760)
                     /locus_tag="KLLA0_D08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453425.1"
                     /db_xref="GeneID:2892923"
     CDS             complement(691907..696760)
                     /locus_tag="KLLA0_D08118g"
                     /note="similar to uniprot|Q754Q1 Ashbya gossypii AFR021W
                     AFR021Wp and weakly similar to YNL172W uniprot|P53886
                     Saccharomyces cerevisiae YNL172W APC1 Largest subunit of
                     the Anaphase-Promoting Complex/Cyclosome (APC/C) which is
                     a ubiquitin-protein ligase required for degradation of
                     anaphase inhibitors including mitotic cyclins during the
                     metaphase/anaphase transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453425.1"
                     /db_xref="GeneID:2892923"
                     /db_xref="GOA:Q6CRL4"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL4"
                     /translation="MEHGASDLPRLSETAGIGQLWVDNNSVEWWSEGSCLRRYNFDTP
                     VIFSGFKRWDDLGLTLCIVLKDAVHFHYLSDNDSFVVSLPFHTSKACIFKNGLILQRV
                     MQPDTLDYNANFENYRFICITHPMSPFGSIQFPSTASPTDLNDIELIYFPKADSFGVA
                     LFYQRTTEQLFFYSIQLLQDSSDSVTLKSPTLSLDSSNSVRKKSYGNLAPNTPGSSAS
                     LSNAIQRRKTSDIPYGFNNNNLNNNLRKRSAYNRRATSTNWTAEDTNSEMTNTLHVSA
                     KLAQTPNRMNSSSLSKRSMSTNVERIMEMTPTMNAPDQSISSDISKDVYLTKITAVKV
                     PSLSSKGKVVSTKMGDKQAIGILDNVNGWGKIWIFNLNNSVMTNVRFKAFGYSPISMT
                     KTMDIKPGIVRDVCVYNSEDLIGYFAFLQKDTLILYNPYLEITSPEFQLHVSSPDDCY
                     YISDSYMIISSSNSWEIVPSPHTYPTGNALKSIFIGIKYVLHETFHLFLAIWQAQRSE
                     LEKSNTSPLHVADSDQDFIALQNTILLNLDNCNDTFAHPLYKEDPSWLAKVTMCLHLM
                     REEFQLNIYELEIVNKLARLLTNLTSLMNWPQIWIDYYHSPEDRLHPLTIVFDQPIDE
                     PPSIFKTLYSARQQSHVPLTPFITLSRLINDDSCDIDDIVTPLTNKMLKLFQSLTGNT
                     TLNLLQLLGQLNIGKTELEALPVGIYVPLKRLLLDVENEIDHVDENVDIDLIDRTDLR
                     IIKDFISSQQQKKLPGQFKSQNISNIASSEPRSILQIYKQIAEKSLNVSSKSSKIESI
                     NYDMISTKKPIFNHKELFLDFVKTLSYSKTHSVDLPKLKLDYSNLLILKKRTATAMAY
                     RALTSGFGYAASFLCSDPTLNQHNFVEDSLSLSFHFDVDDTVISLEKNSFPDDILGWG
                     AFHRGVAKGLALDTDKKPLTSGWLNFNNQDVLDPEYGGFLLGLGLNRHLSVLGEWQLY
                     NFLSPKNTYVSIGLLLGMCVSMRGSMSLKMTKVLSVHVLALLPPGSSNLNIDYKIQSA
                     GLVGLGILYENTHNRRISELFSNELTSSININDENVPDEGYRLACGIGIGLINMGCGE
                     KSTNPKAGGDFDDYNSHHPKGSIDPQDTNEGDRSFDFSFKSGTMDPKIIEKLVNIVVS
                     VNDVGEDWMPVNSQLGALIALMLVFLKTNCQTIADTISVSKPKEEVDSSIYTRPDLFI
                     YREWCVNMIMWDKIPLDWRWILEILPRSFDPKNVTSDILPIYYRIAGRCLSVGVKGAS
                     SNSISLREGLCRILDMFLPMYQYSLEKRVDSQLLFKGITNLINCVVLAMSLIMAGSGD
                     IEVYKRIRYLHSVSHGRNSYLYSMSRKDPSNTFEEVEEEILNIGIAERPKNVDYDNHY
                     GKFMTTNMCMGFLFLGLGHYALRTANIKDLSYLIISVIPTFNSPYYLQETKYLWRLAM
                     SERFLLVRDATTEELISDVPLLITSKDTKSNEVLHEMKSPCLLPVIESIVRIQVRAPM
                     YYPLTLEFGENKLNIDKFFEKGCFIHVKKRSIEDYGKLGEKTAKNDLKAMYYKSLLTQ
                     RTANSLLGDTSEEKKSFYEEFCSKNVEDLELAHYQNPTQEFNLNLLTGLDSFDFELEI
                     WRKRHDL"
     gene            complement(697048..697169)
                     /locus_tag="KLLA0_D08140r"
                     /db_xref="GeneID:2892942"
     tRNA            complement(join(697048..697084,697133..697169))
                     /locus_tag="KLLA0_D08140r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2892942"
     gene            <698125..>699495
                     /locus_tag="KLLA0_D08184g"
                     /db_xref="GeneID:2892943"
     mRNA            <698125..>699495
                     /locus_tag="KLLA0_D08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453426.1"
                     /db_xref="GeneID:2892943"
     CDS             698125..699495
                     /locus_tag="KLLA0_D08184g"
                     /note="weakly similar to uniprot|P38845 Saccharomyces
                     cerevisiae YHR146W CRP1 Protein that binds to cruciform
                     DNA structures"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453426.1"
                     /db_xref="GeneID:2892943"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL3"
                     /translation="MVEYTFTWPKGPQEVVVTGNFDNWTGSLPLVKQPSGDFSLTMPL
                     PPNDDDKFVFKFIVDGEWVVSDKYEKDSSAGPINNVIYTSKIVGTTTGSTFIPESALS
                     AKTSQKPKSQPAPGSNKKGKKKKVKVKKRIRKDKRTGEQTVISEERTELNSDGEEESE
                     EVSTTATNSKEVTPLPPQTATTEPADDEEATAPVPAVLPSKENQQTTLGEPGIAIVPN
                     PNEIAAFKEVRNVDAQKLNEQLNAELKEKEADKKETLDQQAEETAAVTAAATAAAAEN
                     PTDDVAPVIQSATEPAVQTEQLEQEKAVAEPETVPTQDATIPNTHIESQVTDGSDVVE
                     EVGIITSPEQEAELVQRTLDPKIGGEAELLIAEGEVPKDSIPAVQEQVEKIADEAIEA
                     NTKIADNVTEDVKKTAEEAKTTTNNAANKVTNNATSTNTPTKTAAKPEKKKKKGFFSK
                     LKKIFN"
     gene            <700152..>701327
                     /locus_tag="KLLA0_D08206g"
                     /db_xref="GeneID:2892916"
     mRNA            <700152..>701327
                     /locus_tag="KLLA0_D08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453427.1"
                     /db_xref="GeneID:2892916"
     CDS             700152..701327
                     /locus_tag="KLLA0_D08206g"
                     /note="similar to uniprot|P53883 Saccharomyces cerevisiae
                     YNL175C NOP13 Protein of unknown function, localizes to
                     the nucleolus and nucleoplasm; contains an RNA recognition
                     motif (RRM) and has similarity to Nop12p, which is
                     required for processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453427.1"
                     /db_xref="GeneID:2892916"
                     /db_xref="GOA:Q6CRL2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL2"
                     /translation="MSDSSKEVKKVDDAVSQVLKDPTKKRKAEDEIEIDLNQSVPLSK
                     KQKRLLRRGKVTIEELNAKYNIDSKSIEEYKKETAEKQDNEDTSNKKEGSSEETNVEE
                     EKITSKPNKEKKFGVWVGNMAFDTVKEDIIRFIVAKTKENDEGGAITEKDIVRINMPL
                     TKNDNKKLRNKGFAYIDFKTEKQMEAVVGLSESALNGRNLLIKNAGSYEGRPDKNDLV
                     AASKNPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFK
                     DETGATNALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAREPRKPSFDIKTTQP
                     SSSAAPPPIRERRAPSYSNRQPSHKDSNNRLKSSVALASAQRGSAAIVPSQGKKTTF"
     gene            <701887..>703053
                     /locus_tag="KLLA0_D08239g"
                     /db_xref="GeneID:2893160"
     mRNA            <701887..>703053
                     /locus_tag="KLLA0_D08239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453429.1"
                     /db_xref="GeneID:2893160"
     CDS             701887..703053
                     /locus_tag="KLLA0_D08239g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453429.1"
                     /db_xref="GeneID:2893160"
                     /db_xref="UniProtKB/TrEMBL:Q6CRL0"
                     /translation="MLFNTTTDGTDYSSVVSSSDTLTESSESFSQSVASLRTDYINPD
                     SGNSTQQPHGMKTRTVLVYPNRSHSDSDSPGIVSPSTVWVPPSTDDSTSHTDVDTAMV
                     TVLEMSSGPSNIVMQTIYPENTATQEYTSVEGTEATATVPTPTWLTLTTEVPSSETVV
                     YYTRDFIFTDTSTTFTKGLPTLTVIPTEATFTTPTGPVVTDTSFYERWLSGALDSNST
                     SSGSNKDTIIGGVIGSVGGLALMILVIYLLFRKRRRRNLIEHEKSFSHDIGRKMGYDD
                     IGTFIAQSQQTTKTTTRVSTTAHNNNKVSKSLPSVPPYVADSVRRPQTTNPFDDEYVV
                     SIADPESQTPSTTSLHSSFVSSSTDEGTHDTEMSVTYDENPQNAHGYLTELIEH"
     gene            <703455..>704354
                     /locus_tag="KLLA0_D08261g"
                     /db_xref="GeneID:2893185"
     mRNA            <703455..>704354
                     /locus_tag="KLLA0_D08261g"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_453430.1"
                     /db_xref="GeneID:2893185"
     CDS             703455..704354
                     /locus_tag="KLLA0_D08261g"
                     /note="similar to uniprot|P53881 Saccharomyces cerevisiae
                     YNL177C MRPL22 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_453430.1"
                     /db_xref="GeneID:2893185"
                     /db_xref="GOA:Q6CRK9"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK9"
                     /translation="MLSRTVTSLFGLGKASGVRSFQASALQLQKSAQGSLFGEVTDGV
                     NPLKDDDPNKLSNKLTTATELSDDLDAATQLAEAKKKVTAANDTQLQKYIEEQDPMIK
                     SLPEFLLPRVKKEFYEQQVRLNGGFYDKSVRPKDRSLRLTNEELEVLEPSVYVKSYRV
                     KSSMKKATQLLRLLNGLDAKKALTQCHFSDKKVARDVAELLERGINDGVKLGLDANDL
                     YISQIWTGSDGFWQKRVEWKGRGRRGLIEHPYVHIKCILKTKSVTKRRLEHEAKLKEQ
                     RKKPWVQLADKPIRGSMGGVYKW"
     gene            complement(<704597..>705205)
                     /locus_tag="KLLA0_D08283g"
                     /db_xref="GeneID:2893191"
     mRNA            complement(<704597..>705205)
                     /locus_tag="KLLA0_D08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453431.1"
                     /db_xref="GeneID:2893191"
     CDS             complement(704597..705205)
                     /locus_tag="KLLA0_D08283g"
                     /note="similar to uniprot|Q02774 Saccharomyces cerevisiae
                     YDL212W SHR3 Endoplasmic reticulum packaging chaperone
                     required for incorporation of amino acid permeases into
                     COPII coated vesicles for transport to the cell surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453431.1"
                     /db_xref="GeneID:2893191"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK8"
                     /translation="MGLTYKDFCAVGTALIIGSTTFLMGIFFSNQPYDYNILFNPAAT
                     PEHFENALKHYQTLFYTAKPTLYMLGAVAIVGVIGSLIRVYKPNPDLQLFEYGSLALY
                     VLGICVFLTNIKTGVESAVYHNWGEVSEAQGIAVVASSNIIILIVFAGVLVLQGGLWY
                     STWEYEQRLDQWRKDQLKESAANQQKAEKTTEPAKTESKKKK"
     gene            complement(<705625..>706338)
                     /locus_tag="KLLA0_D08305g"
                     /db_xref="GeneID:2893244"
     mRNA            complement(<705625..>706338)
                     /locus_tag="KLLA0_D08305g"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_453432.1"
                     /db_xref="GeneID:2893244"
     CDS             complement(705625..706338)
                     /locus_tag="KLLA0_D08305g"
                     /note="highly similar to uniprot|P05750 Saccharomyces
                     cerevisiae YNL178W RPS3 Protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_453432.1"
                     /db_xref="GeneID:2893244"
                     /db_xref="GOA:Q6CRK7"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK7"
                     /translation="MVAIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     KTEIIIRATKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQA
                     ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHS
                     GQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKALPDAVTIIEPKEEEPVL
                     EPSVKDYRPTEPVEAAESA"
     gene            <708240..>709004
                     /locus_tag="KLLA0_D08327g"
                     /db_xref="GeneID:2893221"
     mRNA            <708240..>709004
                     /locus_tag="KLLA0_D08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453433.1"
                     /db_xref="GeneID:2893221"
     CDS             708240..709004
                     /locus_tag="KLLA0_D08327g"
                     /note="similar to gnl|GLV|DEHA0F04004g Debaryomyces
                     hansenii DEHA0F04004g and weakly similar to YNL180C
                     uniprot|P53879 Saccharomyces cerevisiae YNL180C RHO5
                     Non-essential small GTPase of the Rho/Rac subfamily of
                     Ras-like proteins likely involved in protein kinase C
                     (Pkc1p)-dependent signal transduction pathway that
                     controls cell integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453433.1"
                     /db_xref="GeneID:2893221"
                     /db_xref="GOA:Q6CRK6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK6"
                     /translation="MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTI
                     ALPDPYNPDSEPQIFKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVY
                     DKWFPEIKHSTNFENLDLYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQ
                     IQELVNKLGLMGYVECSAATQVGVREVFEKAVDCVVFEPDRLVRESLQQKQQAQDSQQ
                     KPKTKQVNKKNTTAQPESSTKPQKSKRSIKRKCTIL"
     gene            complement(<709391..>710608)
                     /locus_tag="KLLA0_D08349g"
                     /db_xref="GeneID:2893262"
     mRNA            complement(<709391..>710608)
                     /locus_tag="KLLA0_D08349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453434.1"
                     /db_xref="GeneID:2893262"
     CDS             complement(709391..710608)
                     /locus_tag="KLLA0_D08349g"
                     /note="similar to uniprot|P53878 Saccharomyces cerevisiae
                     YNL181W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453434.1"
                     /db_xref="GeneID:2893262"
                     /db_xref="GOA:Q6CRK5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK5"
                     /translation="MPLNILGAAVFDGVDSIPYLRPVLTWSPYLAFIGAIKYWSGGPS
                     NTWERNLHGKLYIVTGGTTQSMGTSVVLDMARRGAQMIVLCRKIDEWSEEWCEQMREL
                     TGNELIYLEQCDLSDLFEVRKFATKWLDNAPPRRLDGIIVMSGDCEPWGLRKKKTSTD
                     GIEIQMATNYAGVFHLLNLMKPSFKAQPPDRDVRIIVTTCFLQAMGKCNVEDPLWLHA
                     PFKNSRELFSSSKLQLSLAMLHLQRLLITEAGNSAKDGRSGKNVTVTVVQPGLMRSPS
                     LRRVVSNGSVLLLLILYCVILYPFLWLLTKSGYRGAQTIIYSITTPELEEVNRTDDEV
                     KYIANCSIVNFARKEFYDKELQEKLYENTIKQIESVEKKMAAQRNQASKKETKDQKKN
                     TKPNPKKASTKKD"
     gene            <710885..>712411
                     /locus_tag="KLLA0_D08371g"
                     /db_xref="GeneID:2893425"
     mRNA            <710885..>712411
                     /locus_tag="KLLA0_D08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453435.1"
                     /db_xref="GeneID:2893425"
     CDS             710885..712411
                     /locus_tag="KLLA0_D08371g"
                     /note="similar to uniprot|P53877 Saccharomyces cerevisiae
                     YNL182C IPI3 Protein required for cell viability
                     computational analysis of large-scale protein-protein
                     interaction data suggests a possible role in assembly of
                     the ribosomal large subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453435.1"
                     /db_xref="GeneID:2893425"
                     /db_xref="GOA:Q6CRK4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MDEQVIFTSNTAGTVATLHSLEQSSLRQCQTESKFSSCVVKQKY
                     LFVAQSRKALIQVYDLHGSNKRESVEQRLPVPEVLQALECVDEDGLLLGATDSGKLYI
                     WQLASGNLLNVKPMAHYQGIVKIKSICHGKYIVTAGSDSRLIFWQTMDLVQKDEPKPL
                     FIIHDHSLPVTDFIFSNTLGHSLDGKLYTVSKDMSLRCYQVSVDHEPTCIATFTFPSS
                     LNCVSLDTADRAIYVGTDTGVIQIPLYYKVSNSKIINLLQPNESKIYSITEITPGAME
                     PDLSSREKLFSIGQILCARIVHNNTTSVATSLDGSLLVSGDSTGKCTVTEIFSNQPLK
                     EIRALSTNDSTGPVSNLIVFPVTQQSESLLDVTKIVKPWKFPNLQRAIVDRKHGINDV
                     YVQFHENSVHNVLPVSDFDSYLDTVASEEHIFHQTGSINSTVNRVGQTKASMTATAKE
                     SKVSSDDDIYKSKDKQIAQLNGTVASLTDAYKELRKMHEDLMKEHQQLLSKNGTQTEN
                     "
     gene            <712747..>713409
                     /locus_tag="KLLA0_D08393g"
                     /db_xref="GeneID:2893598"
     mRNA            <712747..>713409
                     /locus_tag="KLLA0_D08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453436.1"
                     /db_xref="GeneID:2893598"
     CDS             712747..713409
                     /locus_tag="KLLA0_D08393g"
                     /note="some similarities with uniprot|Q07623 Saccharomyces
                     cerevisiae YDL213C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453436.1"
                     /db_xref="GeneID:2893598"
                     /db_xref="GOA:Q6CRK3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK3"
                     /translation="MSEEQKLTKKQLKAQQFKKSKDERETDKEDKKRKREEEEKQKLE
                     QDQTSKKKRKTRRGKGGKGTKKGNRFIVFVGNIGRETTASQLQAHFKASSPDHIRMRQ
                     DKGIAFLEFDGDKDHKNIQRRMDVALLQHKTMLGDRKINVELTVGGGGNSATRLEKLR
                     TKNDKLDIERNQRMAKLISDSRGNKKTDQDSESNGAEKNEPKKPSSVPAGIHPDRARF
                     IK"
     gene            <714473..>716797
                     /locus_tag="KLLA0_D08415g"
                     /db_xref="GeneID:2893401"
     mRNA            <714473..>716797
                     /locus_tag="KLLA0_D08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453437.1"
                     /db_xref="GeneID:2893401"
     CDS             714473..716797
                     /locus_tag="KLLA0_D08415g"
                     /note="similar to uniprot|P22211 Saccharomyces cerevisiae
                     YNL183C NPR1 Protein kinase that stabilizes several plasma
                     membrane amino acid transporters by antagonizing their
                     ubiquitin-mediated degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453437.1"
                     /db_xref="GeneID:2893401"
                     /db_xref="GOA:Q6CRK2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK2"
                     /translation="MSSLTKLLQEKRNQEPSSKSALTSSLKGSLAESRNSNSQSHAGH
                     PNGTVVSSPMEIRDGAGGSDTTVTQVDSNDDGSLEASYEFSQSFVNANSAHTATMYGS
                     SVPNRSRSGSILISSGKFPQDTNGRGVPGRLGTSIGRHTTSTSVISNNLPSLSSSIPY
                     SAPNSNTTNDSTVNSAESSASSSWLDKHGSLPSNIAAIDSNVISSPKVESVEPRFVIS
                     KQKLQQKSNMNHDTGKPVSRSSSLSSQLGSFFFSKNKDNEPSLVASSYGAGVSQTNNY
                     YNNSNSNSNTNSNNNNNSSAIPSSSTSHGSSIPKPIRARASSIYNSSRQPTASYNEHV
                     LGSPQSLHENLSQNQYTPKSRHSSVADLKRFFKKHGNSSASYSESPPISANFSNASGA
                     SAGFAPGSLGSNDVVYAASHVPALPFSKRYLKTGENLGAGAGGSVRLMKRISDNQVFA
                     VKEFRPKFEHESKRDYVKKITSEYCIGTTLRHPNIISTIEIVYENNRIFQVMEYCDYD
                     LFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQGIVKLIDFG
                     AAEVFSYPHSKTLIESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACMVLKKF
                     PWKIPKLKDNSFKFFCSGRDCDSLSALVTKTPKPPSYDNAVQSDEPAESTSKSNNPSD
                     PNNTNIGPQRLLHSLPEETHHIIGRMVDLAPACRANIEEVLNDPWIQSIDMCTVEVDN
                     QGNYVVHPGMDHKHTQVDQSEAHIAGLEKKKKAK"
     gene            <717270..>717719
                     /locus_tag="KLLA0_D08437g"
                     /db_xref="GeneID:2893006"
     mRNA            <717270..>717719
                     /locus_tag="KLLA0_D08437g"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_453438.1"
                     /db_xref="GeneID:2893006"
     CDS             717270..717719
                     /locus_tag="KLLA0_D08437g"
                     /note="similar to uniprot|P53875 Saccharomyces cerevisiae
                     YNL185C MRPL19 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_453438.1"
                     /db_xref="GeneID:2893006"
                     /db_xref="GOA:Q6CRK1"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK1"
                     /translation="MSKVLKNVIVKLIVGAGQAAPSPPVGPALGSKGIKAIDFCKEFN
                     ARTANFQPGTPIPVLINIKPDRTFSFEMKSPPTGYLLLKALSLEKGHGQPNISNPDNV
                     CGELSLKHIYEIAKIKKTDGRHAALELEGIVKSIIGVAKSMGIKVVP"
     gene            complement(<718046..>720298)
                     /locus_tag="KLLA0_D08459g"
                     /db_xref="GeneID:2893253"
     mRNA            complement(<718046..>720298)
                     /locus_tag="KLLA0_D08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453439.1"
                     /db_xref="GeneID:2893253"
     CDS             complement(718046..720298)
                     /locus_tag="KLLA0_D08459g"
                     /note="some similarities with uniprot|P53874 Saccharomyces
                     cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
                     deubiquitinates ubiquitin-protein moieties may regulate
                     silencing by acting on Sir4p involved in
                     posttranscriptionally regulating Gap1p and possibly other
                     transporters primarily located in the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453439.1"
                     /db_xref="GeneID:2893253"
                     /db_xref="GOA:Q6CRK0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CRK0"
                     /translation="MTDSVKPLVDRIVSQPLEFKKAVQEDSYNVGGEGSSYIMISSST
                     QKQQQEAKEGDEHQLEHGHHQGIAATATASRKEKVVKPSSFAEALKMYTTKKSAANAA
                     ESKPNRSSQLPITASHVTPSGKLSIGLSNELLLSDDDYHGSSTEDEEHPIVSLLENKV
                     TPDSNEMSGSGSSSASSSSAATSAPVSSSDDDDEDEDEDEVFHEANEFVQPSLALAAP
                     AEQPGNVDEDEDSDDSSFHASSASAEDEDDENDEDVSAEEKEELKLEATEHAAASSCQ
                     FKGVSSSSTAAASESKPEEEENGEEEEEDEELKHKSPQPLSPTPPTTLQDKSSFYQFN
                     ESINDHGSNKPQRIVKNWGSKLTQLKPRGLLNHGVTCYTNAAVQAMVHIPAIQHYLFQ
                     LLRGNFKDTVKSNCVSMLLAETTMRMWSSDSTKNTYINPDKLINALEDINCMMSAWNQ
                     EDSHEYFMSLMSRLQEDSVPKGHKMTESIIYDVFGGLLQQSVKCSNCGEISTTEQPIY
                     DLSLHLKGRKTTDQDQNSVGQDNSIDNSVDQQQSSKRRFSIEKSIRDFFNPELIKRVD
                     NKEGYTCEKCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDL
                     TEYCHESISSLPVRYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEK
                     QLLKEPNAYFLVYTRLTPKSVPLSSQSSNKSTDLGIPQLQRPPSSHSSSQNNSKRKNK
                     KKNKKRRISP"
     gene            <722139..>725237
                     /locus_tag="KLLA0_D08481g"
                     /db_xref="GeneID:2893422"
     mRNA            <722139..>725237
                     /locus_tag="KLLA0_D08481g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453440.1"
                     /db_xref="GeneID:2893422"
     CDS             722139..725237
                     /locus_tag="KLLA0_D08481g"
                     /note="similar to uniprot|P33327 Saccharomyces cerevisiae
                     YDL215C GDH2 NAD()-dependent glutamate dehydrogenase
                     degrades glutamate to ammonia and alpha-ketoglutarate
                     expression sensitive to nitrogen catabolite repression and
                     intracellular ammonia levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453440.1"
                     /db_xref="GeneID:2893422"
                     /db_xref="GOA:Q6CRJ9"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ9"
                     /translation="MLKTPLPDISTLSISSIADYYNFEFPGKSAQKEQVVDLLDQQGF
                     IPDTLLENEVDWFYEGLGIDDYFFSKEVPETIANVISTLYASKVESFAQNHQKLQVEK
                     AIINDSHAMFLDTNHHLDTEIDSKFLDSEEHHYRLISFLAENSLKLSFVYQNEYPTGN
                     ASSIELTDEQLTSGDIDSISDVTMITMTSQENKKLYGQLIHHVSQREGPVIKTFNSVA
                     NANEVRMCIAFKRSSTKGYYSALSSLLNYYQLKHSKLYVDTFANDVSIISIYLDKSQQ
                     DHDILKELGLSLLQVEREASLLYAIPQNSFKDLYQSRQFSPQESIYAHIGSIFINHFI
                     NRLGSSYDSLIRQLNVKPDDTLLNELLANLKRKLRTETYTQQMIIHVLHKYKEIVSKL
                     YKSFAQVHYPTKTSATGSGNQKLQMTLSYQRLSQLEPFQSEEEFNLYLNKVFPNDSPD
                     LLILRTLNLFNKSILKTNFFITRKVAISFKLDPALILPKSEYPETPYGIFFVVGNTFK
                     AFHIRFRDISRGGIRIVVSRSQDVYDKNSKSVIDENYGLASTQQKKNKDIPEGGSKGV
                     ILLNPGLTSSKDTFNAFSQYVDSVIDILIKDPLKENYVDLYGKEEILFFGPDEGTAGF
                     TNWATLHAKRRGCPWWKSFLTGKTSSLGGIPHDEYGMTSLSVRSYVNALADHAGFQNE
                     KTYKFQTGGPDGDLGSNEILLSTENEAYVGLVDGSGVLCDPEGLDKHELINLAKQRVM
                     VSSYDKSKLSKKGFFVSVDDIDVMLPNGVLVANGTTFRNTFHYEVFKFVNHIDLFVPC
                     GGRPNSIDLNNLHYFINKENNKSKIPYIVEGANLFISQPAKLELERHGAILIKDASAN
                     KGGVTSSSMEVLAALSLNDEDFVGKFVSTDGKTNTELYKSYVKQIQEKIQFNARQEFG
                     QLWKLNKATGLPMSHLSNVISETINKLNDDLIESDELWSNDLKLRNYLLLNKIIPKLL
                     TDVAGPEQILKQIPDSYLKALLSSYLSSHFVYEFGTDVNMGKFLEYIGNLKREASDLE
                     IV"
     gene            <725605..>726726
                     /locus_tag="KLLA0_D08503g"
                     /db_xref="GeneID:2892990"
     mRNA            <725605..>726726
                     /locus_tag="KLLA0_D08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453441.1"
                     /db_xref="GeneID:2892990"
     CDS             725605..726726
                     /locus_tag="KLLA0_D08503g"
                     /note="some similarities with uniprot|Q12468 Saccharomyces
                     cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)
                     COP9 signalosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453441.1"
                     /db_xref="GeneID:2892990"
                     /db_xref="GOA:Q6CRJ8"
                     /db_xref="InterPro:IPR000555"
                     /translation="MSSIKFHEKSLKEVTRWIQANEDINTETSLSSSSDSSTTIPVID
                     HLPARIPYATDLKRNPCHFQKCLISRLATTKMLSHAVDGGDIEVMGMLVGYTSNDMIV
                     VKDCYSLPVQGTETRVNAHMESYEYMVQYLDAFVTKEDKIVGWYHSHPGYGCWLSNID
                     IQTQSLNQNYQDPYLAIVVDPKKSLSGNTLDIGAFRTLPSKDNNEHVDYYPLNIQLYQ
                     NSLDVNISKLKLKFKVDPAIQNNPNEPELMKELHECVENWFHAKKVMKSTVGFNAIGS
                     TVVNETEIGNEDFTHERSNSISSTSSLTTRHTTDVEMDDQESAQSSLDIPANVIPGMQ
                     FQEAEIKHEYELKKKKLLLLKVKQYQKLRTYRQLFNASE"
     gene            complement(<726710..>727945)
                     /locus_tag="KLLA0_D08514g"
                     /db_xref="GeneID:2892901"
     mRNA            complement(<726710..>727945)
                     /locus_tag="KLLA0_D08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453442.1"
                     /db_xref="GeneID:2892901"
     CDS             complement(726710..727945)
                     /locus_tag="KLLA0_D08514g"
                     /note="similar to uniprot|P53873 Saccharomyces cerevisiae
                     YNL187W Non-essential protein with putative leucine-rich
                     nuclear export signal (NES) sequence that fits the
                     consensus sequence recognized by Crm1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453442.1"
                     /db_xref="GeneID:2892901"
                     /db_xref="GOA:Q6CRJ7"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MQTIASTLDCYYGTNCNSLWSLEEELSRKFSAYAKNYEFPKLHR
                     SYFHSVERYCPVICSQLTWSHDGTSICGVFDDFGIRQYLIPEDPLVDHWVPFTRWFVN
                     GSIISSVVHPRYSLYEEDSAYQTILCSSRDLPIKLYSLRSDSINETSLYHYSTVNEEN
                     EAFETAYSMTILQDTMHFMTGSVRNRITMYDYNRHKPIWQHQWTKQSCGKSSQKAIVS
                     CFDEYNEVHDNVRFAGTYKTEVLRIDTRSTKSELISERDSLDSWSNGIYQVIKSDNGH
                     YLYCIKRNAREIDVIDTRMLKSRINILELPFKIGKQKFKASLNSAKGLLIGSYDGQVA
                     CWDKDCIEFGGLDPLQTAGTGIKPTNNILISDENVRVNCIATNPVDPNTLAISTSTDK
                     FADDEGMTLKTSVKLIRMH"
     gene            <728219..>728809
                     /locus_tag="KLLA0_D08536g"
                     /db_xref="GeneID:2892887"
     mRNA            <728219..>728809
                     /locus_tag="KLLA0_D08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453443.1"
                     /db_xref="GeneID:2892887"
     CDS             728219..728809
                     /locus_tag="KLLA0_D08536g"
                     /note="highly similar to uniprot|Q12328 Saccharomyces
                     cerevisiae YDL217C TIM22 Mitochondrial inner membrane
                     protein involved in import of proteins of the ADP/ATP
                     carrier (AAC) family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453443.1"
                     /db_xref="GeneID:2892887"
                     /db_xref="GOA:Q6CRJ6"
                     /db_xref="InterPro:IPR003397"
                     /translation="MVYRGFGLDQVSPPENKPFDQLSPEEQGEKGAQMMVEFMTSCPG
                     KAAISGVTGFALGGVFGLFMASMAYDTPLHTPAPTNAPGLPNKVKELADLPLKQQIKI
                     QFSDMGKRSYSSAKNFGYIGMIYSGVECVVESLRAKNDIYNGVAAGCLTGGGLAYKSG
                     PQAALVGCAGFAAFSTAIDLYMRNENKKPPKDDFDE"
     gene            complement(<728936..>729700)
                     /locus_tag="KLLA0_D08558g"
                     /db_xref="GeneID:2892807"
     mRNA            complement(<728936..>729700)
                     /locus_tag="KLLA0_D08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453444.1"
                     /db_xref="GeneID:2892807"
     CDS             complement(728936..729700)
                     /locus_tag="KLLA0_D08558g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453444.1"
                     /db_xref="GeneID:2892807"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ5"
                     /translation="MSSMPEFLNLRSPQRKISDSRIKRINKMFDAKIKDEVSVVSNNS
                     TSVLQDICGPLNISEEEDTVKYKSSSNVTTPGSVSSSETFDDEVNPQFMPKLRSKQSI
                     VQLSQHNTPKKSNTFPKRRQLKEKLGDPLPLPYLDPQQKMEVGRDLESRWNTIISNAK
                     VRQTKAEPVNKAKRVLEAPSFESQRKISRKVFQSSEITTLESQLKDTSAKLDRLIDIL
                     QDKETLIGKSMTYEPVIWLSCIIILVLCNVWVYHYL"
     gene            complement(<730189..>731805)
                     /locus_tag="KLLA0_D08580g"
                     /db_xref="GeneID:2892712"
     mRNA            complement(<730189..>731805)
                     /locus_tag="KLLA0_D08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453445.1"
                     /db_xref="GeneID:2892712"
     CDS             complement(730189..731805)
                     /locus_tag="KLLA0_D08580g"
                     /note="highly similar to uniprot|Q02821 Saccharomyces
                     cerevisiae YNL189W SRP1 karyopherin alpha homolog of 60
                     kDa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453445.1"
                     /db_xref="GeneID:2892712"
                     /db_xref="GOA:Q6CRJ4"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ4"
                     /translation="MDGDTSSKFVPEYRRTNFKNKGRFSADELRRRRDVQQVELRKVK
                     RDEALAKRRNFNAPVGNDSDDENDDDDDQDSSFYRQLQQELPAMLEQIHSNDLQQQLA
                     VTVKFRQVLSREHRPPIDLVISTGVVPTLVQFMSENQPEMLQLEAAWALTNIASGTSE
                     QTRVVVDAGAVPLFIQLLYSNSVEVKEQAIWALGNVAGDSTDYRDYVLQCGAMQPILY
                     LFELNKTSLIRTATWTLSNLCRGKKPQPDWSIVSQALPTLSKLIYSMDTETLVDACWA
                     ISYLSDGPVNSIQAVVDARIPKRLVELLSHQSTLVQTPALRAVGNIVTGNDLQTQIVI
                     NCGALAALRNLLASPKESIRKEACWTISNITAGNTEQIQAVIDANLIPPLIRLLETAE
                     YKTKKEACWAISNASSGGLHKPEIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDAIEN
                     ILKMGEMDREVRGIAVNENADFIEKAGGMEKIFNLQSNANEKIYEKAFKIIEKYFSDE
                     DDVVDESMAPQTAGNTFGFGSNVNQQFNFN"
     gene            complement(<733382..>733897)
                     /locus_tag="KLLA0_D08624g"
                     /db_xref="GeneID:2892950"
     mRNA            complement(<733382..>733897)
                     /locus_tag="KLLA0_D08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453447.1"
                     /db_xref="GeneID:2892950"
     CDS             complement(733382..733897)
                     /locus_tag="KLLA0_D08624g"
                     /note="some similarities with uniprot|P53872 Saccharomyces
                     cerevisiae YNL190W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453447.1"
                     /db_xref="GeneID:2892950"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ2"
                     /translation="MKLTSVVAAFFAVSVVAAQQENSETTTTTTNTHRYGRFDKTSPS
                     STPTSTGTHRYGRFNKTAPSSSPTSTGTHRYGRFNKTAPSSSPTSTGTHRYGRFNKTA
                     PSSSPTSTGTHRYGRFNKTAPSSSPTSTGTHRYGRFDKTNNREAETANDADLVKFSSS
                     FLVAGIAAYLL"
     gene            complement(<734915..>735775)
                     /locus_tag="KLLA0_D08646g"
                     /db_xref="GeneID:2892909"
     mRNA            complement(<734915..>735775)
                     /locus_tag="KLLA0_D08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453448.1"
                     /db_xref="GeneID:2892909"
     CDS             complement(734915..735775)
                     /locus_tag="KLLA0_D08646g"
                     /note="weakly similar to uniprot|Q7LGR3 Saccharomyces
                     cerevisiae YDL218W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453448.1"
                     /db_xref="GeneID:2892909"
                     /db_xref="GOA:Q6CRJ1"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ1"
                     /translation="MSNIERAAPETQPDTEPVVAVPLTDEPVVAAPAPATVPDTTVPA
                     SQPVDVQPMSEPVIQETPSSKSYFPYTSSLFHNIVRGLQSMFTSLVLSLTATSIAKAS
                     WGDSKTNFGLAVSVMTFVYFLAGGIFWGFASASARSAVPVSVFFGLEAFFVLMWFCAF
                     VVLADNFSHSCNYGSFFWTSSSSDDWSVSCKAGKAAAAFAAFAWLFFVVSFIIYIFNV
                     LRPVLSHYGSSGWLKTNAVELNPWTFLSGTFIFNNFVAQEDFKHEEGLPETATNSTYE
                     PQNQVPPTTV"
     gene            complement(<737071..>738165)
                     /locus_tag="KLLA0_D08668g"
                     /db_xref="GeneID:2892975"
     mRNA            complement(<737071..>738165)
                     /locus_tag="KLLA0_D08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453449.1"
                     /db_xref="GeneID:2892975"
     CDS             complement(737071..738165)
                     /locus_tag="KLLA0_D08668g"
                     /note="similar to uniprot|P53871 Saccharomyces cerevisiae
                     YNL191W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453449.1"
                     /db_xref="GeneID:2892975"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CRJ0"
                     /translation="MCRFLIYKGKEPIKLSHLLTRPEHSIIKQSFDSRLRIDRTRPIN
                     GDGFGVAYYSEDPELDGPCLFKAITPAWNNQNLETLAEKTKSRLVLAHVRASTYGTLS
                     ETNCHPFTYHNLTFMHNGGIGNFHRFKRKLLNHIGDKYLLMIQGSTDSECAFALLLDT
                     LERMGYDPASEQQRVKAKRSGGTKRSSGRSSNHVIIREALLKTIDLLKQWTQEAADSS
                     DTFEPSLLNFAVTDGDCVVISRYITSSTDEAPSLHFSCGSSFVESGPGEYRMERLDRN
                     QDVIMVASEPLTFERGDWTAVPTNSILTIRNQTVLLHPVIDEYYQADPLYARSSTLAE
                     SKGLMGSVPVSSPVDPKVPPLERDRRVYIT"
     gene            complement(<738466..>738918)
                     /locus_tag="KLLA0_D08690g"
                     /db_xref="GeneID:2893082"
     mRNA            complement(<738466..>738918)
                     /locus_tag="KLLA0_D08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453450.1"
                     /db_xref="GeneID:2893082"
     CDS             complement(738466..738918)
                     /locus_tag="KLLA0_D08690g"
                     /note="highly similar to uniprot|Q07648 Saccharomyces
                     cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr) deacylase
                     functions in protein translation may affect nonsense
                     suppression via alteration of the protein synthesis
                     machinery ubiquitous among eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453450.1"
                     /db_xref="GeneID:2893082"
                     /db_xref="GOA:Q6CRI9"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /translation="MRIVLQKVSEASVTVGSAVVSQIKHGYMLLVGIGTDDKLEDIDK
                     LSKKILTFRGFDDDAGYGWKRNISEVDGEILCVSQFTLMARTSKGTKPDFHLAQRGEL
                     ANELYGQFMDKLKAGLGDDKVQNGVFGAMMSCKLTNEGPVTIIFDSKA"
     gene            complement(<739348..>741447)
                     /locus_tag="KLLA0_D08712g"
                     /db_xref="GeneID:2893137"
     mRNA            complement(<739348..>741447)
                     /locus_tag="KLLA0_D08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453451.1"
                     /db_xref="GeneID:2893137"
     CDS             complement(739348..741447)
                     /locus_tag="KLLA0_D08712g"
                     /note="similar to uniprot|P16603 Saccharomyces cerevisiae
                     YHR042W NCP1 NADP-cytochrome P450 reductase involved in
                     ergosterol biosynthesis associated and coordinately
                     regulated with Erg11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453451.1"
                     /db_xref="GeneID:2893137"
                     /db_xref="GOA:Q6CRI8"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI8"
                     /translation="MPAGLDNLDFAVLCALALAVVAYFGRDTLKAVFSSDDSLTSVSS
                     TSRDIVEVAKENDKNYLVLFGSQTGTGEDYAKKFAKELIAKFQLKVMCVDVEKYDFDN
                     LSQLPSNIPVSFFISTYGEGDFPDGAVALEEFLRDAEADSLSNLKYTLFGLGNSTYEF
                     FNGASKKTEKYLKDAGANLIGKFGIADDGAGTTDEDYLSWKDATLDALKDVLHLDEHE
                     EKFEPAYQYEELEQYYDESVSHGEPTTAYLPENTIKGPFTHNQPFLAPVVKSRELFKN
                     TDRNCIHAEFDLEGSNLKYTTGDHLGVLPSNSDEHVKQFLTTFSLKEDTVFDLISTDA
                     TVQPPFPVPTSIGAAVRYYLEITGPVSRSIFGQLVEFSPNEEVKAKLVQLSKDKEEFA
                     KQITSKHFNLADAVLYLSNGKPWSSVPWNFLLETLPHMQPRYYSISSSSSTEPGVVHV
                     TAVVENQPNPTEEGKKITGVATNLLRNIQLVQNKVDLYELEKNEKEGRTPTPSLSVHF
                     DLNGPRNLYKNFKLPVHIRHSQFRLPSNPNTPVIMIGPGTGVAPFRGFIRERVAYKEH
                     HKDDGEAISQLGKHILFYGSRNQNDYLYAEEWPEYAKKLGECFEMVVGHSRLGGDSKK
                     RTYVQDLLIQRREDVFKMIKDGAFIYVCGDAKGMAQGVHKALVQIISEGNKVSEEDAT
                     NIIKMMKTTGKYQEDVW"
     gene            complement(<742009..>742932)
                     /locus_tag="KLLA0_D08734g"
                     /db_xref="GeneID:2893129"
     mRNA            complement(<742009..>742932)
                     /locus_tag="KLLA0_D08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453452.1"
                     /db_xref="GeneID:2893129"
     CDS             complement(742009..742932)
                     /locus_tag="KLLA0_D08734g"
                     /note="similar to uniprot|Q05541 Saccharomyces cerevisiae
                     YDR288W NSE3 Essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453452.1"
                     /db_xref="GeneID:2893129"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI7"
                     /translation="MSDENNNSHTQVNHALETVGNLMVRFVLAQCESQTGNTVITRSK
                     MLQKLKEIIDEEKVKSIPFSTVYGYVDDKLNEIFGYHLFGVLAKKTDKRSFSQTQDEG
                     TPDEANNSVEDAKARGNHFILVRSGMEAIPQRYHKFILDHASAIYRKTVHQVTYIGKE
                     YSASSNPTLDNEIGNNTELALKGIIAITICIVIFSKNNILETELSDQHGKFGISTEGH
                     DIPIIDMNHKDLLNLLVRNNYLTRTVEKAADLGQELAIYSIGKRTLVEFPKESLTKMC
                     QEMLDLDDSQLELIENTVNVLAGDAYGAFRP"
     gene            complement(743262..743333)
                     /locus_tag="KLLA0_D08767r"
                     /db_xref="GeneID:2893206"
     tRNA            complement(743262..743333)
                     /locus_tag="KLLA0_D08767r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2893206"
     gene            complement(<743690..>744019)
                     /locus_tag="KLLA0_D08789g"
                     /db_xref="GeneID:2893225"
     mRNA            complement(<743690..>744019)
                     /locus_tag="KLLA0_D08789g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453454.1"
                     /db_xref="GeneID:2893225"
     CDS             complement(743690..744019)
                     /locus_tag="KLLA0_D08789g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453454.1"
                     /db_xref="GeneID:2893225"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI5"
                     /translation="MRVKPVCFMAVCLPHGTGTACSIYVVFTSNSQTLSILFLVSVYA
                     KASTCLNADIILKSDMDQFLINLKVRLNDSSTKTPTLVVCLKNERQKPRHYLKPENSP
                     FMQLIRK"
     gene            complement(<744046..>744615)
                     /locus_tag="KLLA0_D08811g"
                     /db_xref="GeneID:2893257"
     mRNA            complement(<744046..>744615)
                     /locus_tag="KLLA0_D08811g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453455.1"
                     /db_xref="GeneID:2893257"
     CDS             complement(744046..744615)
                     /locus_tag="KLLA0_D08811g"
                     /note="similar to uniprot|P40892 Saccharomyces cerevisiae
                     YJL218W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453455.1"
                     /db_xref="GeneID:2893257"
                     /db_xref="GOA:Q6CRI4"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI4"
                     /translation="MTRSEKEKMLIGEPYLCMDPELVEERLKARQLVYDFNQSKPEDE
                     ELRKRILDQLLGKHYNAFIEPNFRCDYGSNITVGKNFYANFDCIMLDVCKIEIGDDVL
                     LGPGVHIYTASHALDPIERSKGVEFGIPVKIGNRVWIGGNVTILPGVTIGDNAVIGSG
                     SVITKDVDANVVVAGNPAKFIKHIELNKK"
     gene            complement(<745179..>745304)
                     /locus_tag="KLLA0_D08833g"
                     /db_xref="GeneID:2893245"
     mRNA            complement(<745179..>745304)
                     /locus_tag="KLLA0_D08833g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453456.2"
                     /db_xref="GeneID:2893245"
     CDS             complement(745179..745304)
                     /locus_tag="KLLA0_D08833g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453456.2"
                     /db_xref="GeneID:2893245"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI3"
                     /translation="MSSDVVYRSTFSSASHELKMPCHLSTLLECFLEGTFNCQVL"
     gene            745312..745383
                     /locus_tag="KLLA0_D08844r"
                     /db_xref="GeneID:2893424"
     tRNA            745312..745383
                     /locus_tag="KLLA0_D08844r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2893424"
     gene            <745975..>747300
                     /locus_tag="KLLA0_D08866g"
                     /db_xref="GeneID:2893390"
     mRNA            <745975..>747300
                     /locus_tag="KLLA0_D08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453457.1"
                     /db_xref="GeneID:2893390"
     CDS             745975..747300
                     /locus_tag="KLLA0_D08866g"
                     /note="similar to uniprot|P29704 Saccharomyces cerevisiae
                     YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase
                     (squalene synthase) joins two farnesyl pyrophosphate
                     moieties to form squalene in the sterol biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453457.1"
                     /db_xref="GeneID:2893390"
                     /db_xref="GOA:Q6CRI2"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI2"
                     /translation="MGKVAELLSHPLELKAALKLKFLRKPLFPDVVIEESADLTRCHE
                     LLKLTSRSFAAVIMELHPELRNAVMLFYLVLRALDTVEDDMTIDPKIKIPVLREFDSK
                     LDLPSWYFDGNGPNEKDRAVLVDFPCILNELHKLKPEYQRVIKEITGKMGNGMADYIL
                     DENFNLNGLQTVADYDLYCHYVAGLVGDGLTQMLVLAGFGSNDLYDENVHLYEDMGLF
                     LQKTNIIRDYAEDLADGRSFWPKEIWSLYAEKLSDFAKPENTQQGLYCINHLVLNAMT
                     HIESVLHYLASIHEQSSFQFCAIPQVMAIATLSLVFANPKVMHENVKIRKGTTCYLIL
                     KSRTLRGCVEIFQYYLRDIKKRLTVEDPSYLKLNIQISKIEQYIESMYQEQLPLGVKP
                     QETLIYKKVLDRTEYDSKVAVIEEDEEFKFNLGFTMFLTFIAAVYFYSK"
     gene            complement(<747666..>750551)
                     /locus_tag="KLLA0_D08888g"
                     /db_xref="GeneID:2893542"
     mRNA            complement(<747666..>750551)
                     /locus_tag="KLLA0_D08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453458.1"
                     /db_xref="GeneID:2893542"
     CDS             complement(747666..750551)
                     /locus_tag="KLLA0_D08888g"
                     /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
                     YMR185W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453458.1"
                     /db_xref="GeneID:2893542"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019414"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI1"
                     /translation="MSNKLTEVLSRKLDFVSDTPIDAFFQELDEFLKPIKHNDDIGDI
                     YESLNLSNKELIEKLAKFLTRLCSLVAEKQQENADIIPISLHDMKDFDTLINLLVIHG
                     ITANLPIDIGIPIEQRRLDVFKEENKLYKVPNGKIADVETLKVALLAFESIFLHTPEN
                     NYVRKIILKGGPGYSDTMIGYMALMCTTGNAAFEEKLRKMETIKDTYSLFEIYSLLLS
                     TIKNDKAKAWPLNRLSLLVIERSDGLISLIDFVIGLREDVQVDTSKFERVNQIVTSKP
                     RSISSVEYFDKLFVQIYEGLTHIDKPILVSCLNGLVTAFYLKNKRIVKDFLFSKIYGI
                     LYNLDSKDISVKELNDMINVLISLERTPYVEVINEMILGHNNGQSFYLNLWIYSMFLK
                     NHQKIAPDGAKDHYYNIILGLIKTYMVITEGYKYLHVILLNMVNYDHDSWEYKIDLET
                     HLAYITVKEQRISEDLGIGKLSVEEETTKRFQKLFMDIDPAVELFIELLARIDDQQVN
                     KSIFSAVINNWLMQEPRNSSESNQSLNFVNDERNNSFADSLQSMIFLKVLEKMNEVFK
                     SNMLAEPADLLVIILQILDFTRDSKEISVEPDSDDEDEDDAANLTNFTENNDGDMIIN
                     DNTLEVALKLINSIIPTFHSAYSPKEKELLSSIQKKIEPFVSRDDCKELYDQISDVLL
                     LPTSQAEANSSNEQDKALLKKALTNVNDPLVPIRAHGLLQLRQLIEKKSPLIDVKKVF
                     AIHITQLHDQDAFIYLNVIRGLGVLVQFAPNETLDLLLQFYRACRNKNSVDDILKVGE
                     VFIHYVSVQGKSFSGPKAAKLIEVCLENIRAKDQLDNRIRMSSMSILGQCLESNALGI
                     RGLIADILDCAFGILTFETGNDTDDINIKKNSAIMRRSAVHVVYDLMLNSGLNLFPEN
                     YPPEKIKSTLEYVATQDDDYLVCEQIKTVSNHLEALLQEKVIGGLAN"
     gene            <750828..>751448
                     /locus_tag="KLLA0_D08910g"
                     /db_xref="GeneID:2892797"
     mRNA            <750828..>751448
                     /locus_tag="KLLA0_D08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453459.1"
                     /db_xref="GeneID:2892797"
     CDS             750828..751448
                     /locus_tag="KLLA0_D08910g"
                     /note="similar to uniprot|P46683 Saccharomyces cerevisiae
                     YPL239W YAR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453459.1"
                     /db_xref="GeneID:2892797"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CRI0"
                     /translation="MSLHTGPLDQEDQEAIIVDARAGDLESLKDIFTTLIDPSALIEC
                     TDELSKSSALHMAAANGHFEVVKYLLSIFPKDKLKEWVNKQNETGNTALHWASLNGKL
                     DIVQLLCEEYEADPFIRNNFDHDAIYEAENNGQEEIETYYLKKFDVEPESTENEEETS
                     SEKEGEQASQPASIDNVQFREGTEIEQVTKEATEALREQTEKLQLE"
     gene            <751943..>752779
                     /locus_tag="KLLA0_D08932g"
                     /db_xref="GeneID:2892948"
     mRNA            <751943..>752779
                     /locus_tag="KLLA0_D08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453460.1"
                     /db_xref="GeneID:2892948"
     CDS             751943..752779
                     /locus_tag="KLLA0_D08932g"
                     /note="similar to uniprot|P09064 Saccharomyces cerevisiae
                     YPL237W SUI3 Beta subunit of the translation initiation
                     factor eIF2 involved in the identification of the start
                     codon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453460.1"
                     /db_xref="GeneID:2892948"
                     /db_xref="GOA:Q6CRH9"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH9"
                     /translation="MTDVAADLGFDPTMKKKKSKKVVPEELIAASTEGTDDLFAGLKK
                     KKKKSKEGEETTEKQVDDISDALGELKLKKKKKKAAAAESSVDDFEKQLEQAGISVDD
                     IAKEATPTEIDSSIQQDVGLPYQDLLSRFFKILNTNNPELAGDRSGPKFKIPPPICQR
                     DGKKTIFANIQEISEKLQRSPEHVIQYLFAELGTSGSVDGQKRLVIKGKFLPKQMENL
                     LRRYILEYVTCKTCKSINTVLKKEQSNRLFFLVCKSCGSTRSVSSIKTGFQATVGKRK
                     RM"
     gene            complement(<753196..>753723)
                     /locus_tag="KLLA0_D08954g"
                     /db_xref="GeneID:2892919"
     mRNA            complement(<753196..>753723)
                     /locus_tag="KLLA0_D08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453461.1"
                     /db_xref="GeneID:2892919"
     CDS             complement(753196..753723)
                     /locus_tag="KLLA0_D08954g"
                     /note="similar to uniprot|Q755G7 Ashbya gossypii AFL144C
                     AFL144Cp and weakly similar to YMR184W uniprot|Q03233
                     Saccharomyces cerevisiae YMR184W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453461.1"
                     /db_xref="GeneID:2892919"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH8"
                     /translation="MESSGMNRTRSFQNCRETEIPGYNDCPSFIYPGAASIAPKRIVS
                     QSVDTSGNTRMATVPPPSMKRKVSEKLRSTESLDTSIVALSKQELSDKYQWITSLPSN
                     LQDKEFSFYKTKVDKVLENVLENEGTRYALSEIFANLNDSKRVTDLITKWMLSDMSVN
                     SWCPSFRKLIENAQI"
     gene            <755870..>756586
                     /locus_tag="KLLA0_D08976g"
                     /db_xref="GeneID:2892966"
     mRNA            <755870..>756586
                     /locus_tag="KLLA0_D08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453462.1"
                     /db_xref="GeneID:2892966"
     CDS             755870..756586
                     /locus_tag="KLLA0_D08976g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453462.1"
                     /db_xref="GeneID:2892966"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH7"
                     /translation="MFGTERLLRNQTNGEGESRQFAAVTMNDNVTRYAKIQSNLSRYE
                     DWESRQNSKMDQTIQDINEIFESMNYKVSKKIYNGKKKSNQPKLIPGCKCSNTPVQRN
                     ECKRLQLWKLANIFDFGQINGKQQHIECTTEARCRSSSLSTGMSMGNADEKWYNYLPE
                     AVCNKLQSVDSITSNTSSLREAKSDTATNAYQNLLGVPPPQIIEPSLRTTRSASSGLR
                     HNKQIQLLLHDLISGDICDT"
     gene            complement(<756649..>758505)
                     /locus_tag="KLLA0_D08998g"
                     /db_xref="GeneID:2893556"
     mRNA            complement(<756649..>758505)
                     /locus_tag="KLLA0_D08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453463.1"
                     /db_xref="GeneID:2893556"
     CDS             complement(756649..758505)
                     /locus_tag="KLLA0_D08998g"
                     /note="weakly similar to uniprot|P38273 Saccharomyces
                     cerevisiae YBR131W CCZ1 Protein involved in vacuolar
                     assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453463.1"
                     /db_xref="GeneID:2893556"
                     /db_xref="GOA:Q6CRH6"
                     /db_xref="InterPro:IPR013176"
                     /translation="MSVQFIVLFRDDDDNKDDSCKLLLYHDLTAHMLSTNEKEQKIGI
                     IKGMWRFSNEFSQSNDYCHVELDSYSMLVLEVEPSYYLALGFENTHNSQWPKYKVRLS
                     QCYQFFAMQHGKMQDIEDKTLSGLLNEHFIPFWDEINLIPDYFLMQDINTAIDDKMFP
                     CCQFADALNSISEVKDWQNYLKNNVLLSEENYLNIKDVCVYHLPKNNKNTKEYGFITN
                     FDPQFKSLPTLSNWLVGIDSMYGTVSSHGLAGTMSLTETEQQIELDAEEAHHEQPPNI
                     KTVWDNVTLPITFTMDALKDIGQLTGVSNSLSLFTNMKPSWNLWSSSSENGAGSAKLD
                     DKDEYSWLISPLNPSFLPKVYQMRKFYLQFDDWSQYNILFWKFKDVIVAVIVDPSFKK
                     ISEESFLMKLQEELWNGISLFYENTGFEKRQCSFDYTILFKEEGKYYSSIPRWKNGLD
                     ESDTALKLVIKGLDETLQFLTNNANRKSSVATVTEVGHDMSLTDHPIPSDPSKGEDGT
                     EKTDKSESSIFSKLNESQLVELNKELMVILGTRSLTVWYKDANTKERMLKLNNGLMVY
                     LLENNRKLVLIIKNWFIDSQQKTKSKRSTDMIESLGKDVSTWWNRIKDHEPL"
     gene            <758818..>760410
                     /locus_tag="KLLA0_D09020g"
                     /db_xref="GeneID:2892804"
     mRNA            <758818..>760410
                     /locus_tag="KLLA0_D09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453464.1"
                     /db_xref="GeneID:2892804"
     CDS             758818..760410
                     /locus_tag="KLLA0_D09020g"
                     /note="similar to uniprot|P20424 Saccharomyces cerevisiae
                     YPR088C SRP54 Signal recognition particle (SRP) subunit
                     (homolog of mammalian SRP54) contains the signal
                     sequence-binding activity of SRP interacts with the SRP
                     RNA and mediates binding of SRP to signal receptor
                     contains GTPase domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453464.1"
                     /db_xref="GeneID:2892804"
                     /db_xref="GOA:Q6CRH5"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR006325"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH5"
                     /translation="MVLADLGKRINNAVTNAISNEQTDYETTVQSMLKEIATALLEND
                     VNIRLVSRLRENIKNTLLSNANVNAKFTNAQTKKLIQKTVFDELCNLVDCEVTSPFQP
                     KKRQSNVIMFVGLQGSGKTTSCTKLAVYYSKRGYKVGLVCADTFRAGAFDQLKQNAIK
                     AKIPFYGSYTEPNPVKVAKDGVDKFKKEKFEIIIVDTSGRHQQEDSLFQEMVEISQAV
                     KPKQTIMVLDASIGQAAEHQSKAFKESADFGSIILTKMDGHARGGGAISAVASTNTPI
                     IFIGTGEHIHDFEKFSPKSFVSKLLGIGDIESLMERFQTVSDQDDAKNTLENIQQGKF
                     TLLDFKNQMQTIMKMGPLSNIANMIPGMGNMLNQFSEEETSKKMKTMVYIFDSMTKKE
                     LESDGRIFIDEPSRLVRVAKGSGTTVFDIEMLLMQQQMMARMAQTTKQMGGLPTKGGM
                     PPKAGMPSIPGMPSIPGMPNISPQMMQQAQQRMRQNPGMMNKMMSMMKGSGGGMPNMQ
                     DIMGMMQDPSMQEMAKQFSGGM"
     gene            <760795..>761832
                     /locus_tag="KLLA0_D09042g"
                     /db_xref="GeneID:2892922"
     mRNA            <760795..>761832
                     /locus_tag="KLLA0_D09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453465.1"
                     /db_xref="GeneID:2892922"
     CDS             760795..761832
                     /locus_tag="KLLA0_D09042g"
                     /note="some similarities with uniprot|P38272 Saccharomyces
                     cerevisiae YBR130C SHE3 Protein that acts as an adaptor
                     between Myo4p and the She2p-mRNA complex part of the mRNA
                     localization machinery that restricts accumulation of
                     certain proteins to the bud also required for cortical ER
                     inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453465.1"
                     /db_xref="GeneID:2892922"
                     /db_xref="GOA:Q6CRH4"
                     /translation="MKMTEAQEFLTPTKGVNSSKFNINHGHFITNLENQESPSKLGAY
                     TPGKYSTSRVIESLHKQIDELTSTNLKMTSQCHQLVNELESSGKKQNKQLETISRLQT
                     ENMNLNAILDRKTNRMNELESSLKKQTVFNEDAAKKNLELEETVKKLSLENEKLTEQS
                     TLYKIQYEAIVDAHQSYKQFFTNETSTLRNDLMSLKQSMTKQLESKTKEVLAIDEKIQ
                     NKLESLDSAQESFKKHASEQIEDNIKELRLDSWQSSLREAQALLKEYKSQAQAEGITI
                     QEQPKASIPQLRNPKRKTSGQKRTSFYGTPTGFSIPSNKQTPPSSSSTQLPGLKRASS
                     IRISSDPNRNR"
     gene            <762314..>763231
                     /locus_tag="KLLA0_D09064g"
                     /db_xref="GeneID:2892716"
     mRNA            <762314..>763231
                     /locus_tag="KLLA0_D09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453466.1"
                     /db_xref="GeneID:2892716"
     CDS             762314..763231
                     /locus_tag="KLLA0_D09064g"
                     /note="similar to uniprot|P38271 Saccharomyces cerevisiae
                     YBR129C OPY1 Protein of unknown function overproduction
                     blocks cell cycle arrest in the presence of mating
                     pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453466.1"
                     /db_xref="GeneID:2892716"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR016609"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH3"
                     /translation="MGQQTFEDNEEIIYSSYLVKKPTVSKSISSTKQLAKNWTNWSVK
                     KTKYNHKYWCVLRKTQFSYYKDESERVAEKVIPIQDILGCRAYGDNKLDIFTKGMTLR
                     FKSPDADVIRSWVQSINELLPHLNNYGSESDLEIAESDDEQIEGEQADEHGIQKTTQV
                     VKENKDTNSTSDIKSINNGVVEEDKKFFEFYDALKPSHLIQSGVIHAKNKRSLTGRKW
                     KSYKCELTNRSLKLYSIKTGDCRYSVPMENVVDCIEVDSKDPLFAVITFNQRLKLKAN
                     DEDELVDWIINTKSCVMVRNSLAAHTKRS"
     gene            <763408..>764607
                     /locus_tag="KLLA0_D09086g"
                     /db_xref="GeneID:2892955"
     mRNA            <763408..>764607
                     /locus_tag="KLLA0_D09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453467.1"
                     /db_xref="GeneID:2892955"
     CDS             763408..764607
                     /locus_tag="KLLA0_D09086g"
                     /note="weakly similar to uniprot|Q06822 Saccharomyces
                     cerevisiae YPR085C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453467.1"
                     /db_xref="GeneID:2892955"
                     /db_xref="GOA:Q6CRH2"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MPFTLRYHTCGVTSLLHWNDEQDVPTLISGDEKGSILVWNLLSR
                     KPYYKYTCRGQIVSFQQLNDLIIATSKDHTLRILKFPSTLTTKEGFPDYSLPELELIY
                     EIPVNTLNFANTAVEQVDTNNYRLWCCNTQDSETIDIYEFDLRDSKSLKRIHRALSLY
                     EVISGLVDPSTMKFDKLGTTMKFIIYEGIIYLGFESGFVIGLRLTQGLHIVYISSANY
                     PEPVLDLTVGKDLGKVISSSTNSSLGLHTPNINTESHNNVSSKDVVVDDSTIHSEMVN
                     IPINKVSHIQQVDNLLIAASWSGRTVVFDINGNKVLASILKERGQVLIDDNPYGNASL
                     PENSTKVKISAMTCIPKFNTVNPSCTSEGTRRRWIRFYKETWCLIGYADGSIKATEVT
                     FDNLITA"
     gene            complement(<764634..>765998)
                     /locus_tag="KLLA0_D09108g"
                     /db_xref="GeneID:2893132"
     mRNA            complement(<764634..>765998)
                     /locus_tag="KLLA0_D09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453468.1"
                     /db_xref="GeneID:2893132"
     CDS             complement(764634..765998)
                     /locus_tag="KLLA0_D09108g"
                     /note="similar to uniprot|Q06821 Saccharomyces cerevisiae
                     YPR084W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453468.1"
                     /db_xref="GeneID:2893132"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRH1"
                     /translation="MTERPIRVVILGGSSTGKTSFASRLTVNLVHEVHYPTRKQTNWL
                     FTFKPSSPLARFLMDRKCHARLKNRTRGEITAPLIESPELTSRLLLSPFIFNIIMQEY
                     KYARDHNIKDDADLKRDNHVYKYLDSHDEINEKNVNLMTNSNGNIASDQHCKNSLSID
                     EFQKRYNLEAFRRLGYIPPSYTDISIDIIDTPGFNPDMVVPFLELSLFSNLGKPRLRG
                     LADEPRKPVSTQPILVASGAAELNGRVDGYFLVYSLVPELNKIDALPSYTDANADSHD
                     ISPLHSASSNASNNRKNSWSEFDDGGFSLLTTIRNCFLDAWKEYRNYQKLTKDSAETD
                     IYSLMQNLKQMWKSEVHTKENQRKKLITTLKDINLAPDAPDSPPPIIIIGTHMRHDLA
                     SPVLLQWGKDLALQWNCGFVGLDSMTDDNVDVAFAMLLREIIERDTAICKKRTKKSTL
                     GRLL"
     gene            <766400..>767323
                     /locus_tag="KLLA0_D09130g"
                     /db_xref="GeneID:2893581"
     mRNA            <766400..>767323
                     /locus_tag="KLLA0_D09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453469.1"
                     /db_xref="GeneID:2893581"
     CDS             766400..767323
                     /locus_tag="KLLA0_D09130g"
                     /note="some similarities with uniprot|P38270 Saccharomyces
                     cerevisiae YBR128C ATG14 Subunit of an autophagy-specific
                     phosphatidylinositol 3-kinase complex (with Vps34p Vps15p
                     and Vps30p) required for organization of a
                     pre-autophagosomal structure ATG14 transcription is
                     activated by Gln3p during nitrogen starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453469.1"
                     /db_xref="GeneID:2893581"
                     /db_xref="GOA:Q6CRH0"
                     /db_xref="InterPro:IPR018791"
                     /db_xref="InterPro:IPR023261"
                     /translation="MIHCGICGSPKIPNVEFLCAHCINGSPSILLRDKLKLLLLRQEV
                     EQLKHDVGEQLEAGFAGNGQFGKQLQKLDVYNEKRRLIKLRQRVQLVKNKIDVKRNRY
                     QELERYLKDEDHFDKDKKVFDVEEIVNDEALTMSKLSQVLQRKQTALFKELCQWFRIE
                     KCDEDVNNNNNVSAYTIWGVPMINLKYSNEMDRDKQVISMRYIHQFINFSFNIWLFEG
                     ISDVSIENEQNVIQNYSQLIYDTLRLLQVRKLVSESVSIRDILIRYDLDGMIYYLSKS
                     KYLSSLDDASNSYPPTLQNIKQLVASMIPSI"
     gene            <767715..>769268
                     /locus_tag="KLLA0_D09152g"
                     /db_xref="GeneID:2893138"
     mRNA            <767715..>769268
                     /locus_tag="KLLA0_D09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453470.1"
                     /db_xref="GeneID:2893138"
     CDS             767715..769268
                     /locus_tag="KLLA0_D09152g"
                     /note="highly similar to uniprot|P16140 Saccharomyces
                     cerevisiae YBR127C VMA2 Vacuolar H ATPase regulatory
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453470.1"
                     /db_xref="GeneID:2893138"
                     /db_xref="GOA:Q6CRG9"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005723"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022879"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG9"
                     /translation="MSTLTDKQLFDLNKKAVTEGFKIKPRLNYNTVGGVNGPLVILEK
                     VKFPRYNEIVNLTLPDGSVRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGENLR
                     IPVSEDALGRIFDGSGRPIDNGPKVFAEDYLDINGSAINPYARIYPEEMISTGISAID
                     TMNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGV
                     NLETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVL
                     TILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIP
                     ILTMPNDDITHPIPDLTGYITEGQISVDRQLDNKGIYPPINVLPSLSRLMKSAIGEGM
                     TRKDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFIAQGAY
                     EDRTVFESLDQAWSLLRIYPKEMLNRISPKILDEFYDRARDEDEDEDDDDEEAVSADK
                     KPKESQSLI"
     gene            complement(<769519..>771084)
                     /locus_tag="KLLA0_D09174g"
                     /db_xref="GeneID:2893194"
     mRNA            complement(<769519..>771084)
                     /locus_tag="KLLA0_D09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453471.1"
                     /db_xref="GeneID:2893194"
     CDS             complement(769519..771084)
                     /locus_tag="KLLA0_D09174g"
                     /note="similar to uniprot|Q06820 Saccharomyces cerevisiae
                     YPR083W MDM36 Mitochondrial Distribution and Morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453471.1"
                     /db_xref="GeneID:2893194"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG8"
                     /translation="MSYKDPILSQFKNKDTIDAKVITELIEDARVQNTSDRTQIINDE
                     LHERTVEKCKESLSIYTDLVKLSFLLAKSWDLKTLEQTVMLRFGLQDIIGTSELASSG
                     NKSQGEDFDRDIALKTISKCDKLSVALEQLSLDSRSVMVFIKQATETNDVTVLLSDAM
                     TLLLEIWFLCGHQLRKLKRKVAAFFMRSKLLLIDYELELINNTNMDKMTKANLESLKE
                     TISSYKSFIKVLLQQLRDAETVDDQSEFEECLAIFMDVEGMYQAFNFTWLLEENSTLL
                     TNSEHYYAKAQQESDQHDLQELSGINSFIDNSLIDEEEEGKTQSESAEEPGDDLDDLV
                     PSSDKLHFSQGRSRRLSNMSGTSDISLMMEKTSLTKELPHLLQAFNNAKKLANDLESV
                     RELGSTTPPTFSPFSSPNCSSSMSLDNSTTMNSSILSNHIGIKTPTTSGSSKVLESLA
                     HRQQEFPYASSSPLNPSPLSKLEMSQQLIRQDMLKLMSQTPNNANAATISAKVPGFGS
                     NILNNLYGIGSKN"
     gene            <772795..>773673
                     /locus_tag="KLLA0_D09196g"
                     /db_xref="GeneID:2893237"
     mRNA            <772795..>773673
                     /locus_tag="KLLA0_D09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453472.1"
                     /db_xref="GeneID:2893237"
     CDS             772795..773673
                     /locus_tag="KLLA0_D09196g"
                     /note="similar to uniprot|P14682 Saccharomyces cerevisiae
                     YDR054C CDC34 Ubiquitin-conjugating enzyme or E2 together
                     with Skp1p Rbx1p Cdc53p and an F-box protein forms a
                     ubiquitin-protein ligase called the SCF complex which
                     regulates cell cycle progression by targeting key
                     substrates for degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453472.1"
                     /db_xref="GeneID:2893237"
                     /db_xref="GOA:Q6CRG7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG7"
                     /translation="MSGKNTAASLLLRQYRELTDPKKAIPSFHIALEDDSNIFLWNIG
                     VMVLNEESIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSG
                     NPTSDEPDEETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVK
                     LEVERSKQDIPQGFVMPESTKAYVSQRKANEGIDTIKETVADNFWYDSDEGDEDVDIY
                     AYEDSEDEEDNDDVFSKDSSNLNFSKKANKNDIDSDEDEDLVPEEAEDSLDESVMDRR
                     SKLMEESEELEDAEMK"
     gene            complement(<774788..>775198)
                     /locus_tag="KLLA0_D09218g"
                     /db_xref="GeneID:2893455"
     mRNA            complement(<774788..>775198)
                     /locus_tag="KLLA0_D09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453473.1"
                     /db_xref="GeneID:2893455"
     CDS             complement(774788..775198)
                     /locus_tag="KLLA0_D09218g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453473.1"
                     /db_xref="GeneID:2893455"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG6"
                     /translation="MTRTLELLQELTNLIRLETNDGSIDSEVFQNDNELLNWDQILQQ
                     LIDLMKHDYLSRKNMMIQLKAKELNIKELNIEVANLKKSLKEFGHLKYHLHKQLELND
                     KLQQQVEQYRNEFRELESEIKGIRGSMPDKNIRR"
     gene            complement(<775848..>778094)
                     /locus_tag="KLLA0_D09240g"
                     /db_xref="GeneID:2893600"
     mRNA            complement(<775848..>778094)
                     /locus_tag="KLLA0_D09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453474.1"
                     /db_xref="GeneID:2893600"
     CDS             complement(775848..778094)
                     /locus_tag="KLLA0_D09240g"
                     /note="weakly similar to uniprot|P28006 Saccharomyces
                     cerevisiae YOR178C GAC1 Regulatory subunit for Glc7p
                     (protein phosphatase I) for glycogen synthesis regulatory
                     role also predicted for glucose repression and ion
                     homeostasis potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453474.1"
                     /db_xref="GeneID:2893600"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG5"
                     /translation="MDSSHSTLTLHSNVSDWLSSPTSSSASPGPMGFGSGFFHQENDS
                     VETITLDNRHRRVSNSNKTVPYPETPRSGFGITHGCSNAGHSIDSFSNNSNSNNNDNN
                     DDDKNNSNTNDSNDDNGDDITKCISNLSVYDLLSSTQTASSSSENSSSDTSDGGSETD
                     IEMDHSQKLAIKSALSVNNAPVASTASSAITGKLYRQTSHPPIMRKLKSSLKLSSASS
                     QSSISSSKSVRFASELTKVKRFDSSREPVTISNETSPQVSPLDHESPNSRASSASTSY
                     ASNLVSNLDPSDSFWFGTQLSKMNLPLSKSIPKFSLSDSDNDLDDSDSDFDVDYLNDQ
                     LNNNYHYMPSNNSKFSSNNNSNSNSVPSSSSNSNTFSHNSFKFRMNGSNDTMTDYDFN
                     NNSNSFNKENINHQNGFNFNFNTSPTKDPIQIKSWILKGTNIKKFYPTSLDINQDLSK
                     YLQGNNIKLHECNSLQLSQGKLTGLIYVNNLSFEKFIEIKFSFNGWKDIHYVTANFKR
                     TITDTVDEFQFLINLSSFVYFLKVKNLILFNSLISPLTIQLCCRYDVNGETYYDNNNY
                     ENYQVSLDAITNLKQKSKKKSNRHRLLKSSSIMKRSLSSDNFTTDGNYKFASLSPVPS
                     SVDHTKLVPPKLGRRFSEDTDFFNSSPLKNVSPNYTTTPLNQKDPKYDELIKSYCFYD
                     PNSAAASSSDKSNRSMTTETVPTSDTNSTTNSTGSPAFLNSNLPSENCIPSKRDSPKL
                     DTMKSSKC"
     gene            <780273..>782513
                     /locus_tag="KLLA0_D09262g"
                     /db_xref="GeneID:2893501"
     mRNA            <780273..>782513
                     /locus_tag="KLLA0_D09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453475.1"
                     /db_xref="GeneID:2893501"
     CDS             780273..782513
                     /locus_tag="KLLA0_D09262g"
                     /note="similar to uniprot|P29496 Saccharomyces cerevisiae
                     YLR274W CDC46 Component of the hexameric MCM complex which
                     is important for priming origins of DNA replication in G1
                     and becomes an active ATP-dependent helicase that promotes
                     DNA melting and elongation when activated by Cdc7p-Dbf4p
                     in S-phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453475.1"
                     /db_xref="GeneID:2893501"
                     /db_xref="GOA:Q6CRG4"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008048"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG4"
                     /translation="MSFDKPEIHTTRVLAGEELSSNENSEIIKSFKSFILEFRLDSNF
                     VYREQLRNNLLVHKYFLDVNTEHLIGYNEDLYKKLQDEPIDIIPLFEQAITQVAKRIV
                     LLSQDSDIDPETALSNFPLCQLILNSSSMEIPLRSLDSDHVSKIVRITGIIISSSVLT
                     SRATQLSLMCRSCKHMTTLKLNNFQNLNNNNVQLPRECLADRSNETDETAASCGPDPY
                     LIVHESSQFIDQQFLKLQELPESVPIGELPRNLLMTCDRYLTNQVVPGTRVTIIGIYS
                     IYQSKNKSINSSGNKAVAIRNPYVKVIGIKHLSNNPLNNSLSMFSESEEQEFLELSQR
                     PDLYELFANSIAPSIYGNTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTA
                     KSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPTTREFYLEGGAMVLADGGVVCI
                     DEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPVYGRYDDLKSPG
                     ENIDFQTTILSRFDMIFIVKDDHNEARDIQIANHVMNIHTGRTQQNDPNDNSNSNNEI
                     PIETMKRYVSYCRLKCAPRLSPEAATKLSSHFITIRKQLQESERHSNERSSIPITVRQ
                     LEAIIRITESLAKLELNPVATEKHVDEAIRLFQASTMDAASQDPINSQENDTTMLSQI
                     RRIESELKRRLPIGWSTSYKTLQREFVVNKKLPQYALDKALYLLERHDSIQLRHQGQN
                     IYRSGV"
     gene            <782856..>783188
                     /locus_tag="KLLA0_D09284g"
                     /db_xref="GeneID:2893060"
     mRNA            <782856..>783188
                     /locus_tag="KLLA0_D09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453476.1"
                     /db_xref="GeneID:2893060"
     CDS             782856..783188
                     /locus_tag="KLLA0_D09284g"
                     /note="highly similar to uniprot|Q06217 Saccharomyces
                     cerevisiae YLR275W SMD2 U1 snRNP protein of the Sm class"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453476.1"
                     /db_xref="GeneID:2893060"
                     /db_xref="GOA:Q6CRG3"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG3"
                     /translation="MADTYIPKTDLSRSELSRDELTQLEEFEMKYGPMSLIRESMLQR
                     TPVIISLRNNHKLIARVKSFDKHCNMVLENVKEIWTENVNGKKVNRERFVAKLFLRGD
                     SVIIVVKT"
     gene            <783852..>788465
                     /locus_tag="KLLA0_D09306g"
                     /db_xref="GeneID:2893061"
     mRNA            <783852..>788465
                     /locus_tag="KLLA0_D09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453477.1"
                     /db_xref="GeneID:2893061"
     CDS             783852..788465
                     /locus_tag="KLLA0_D09306g"
                     /note="similar to uniprot|P04821 Saccharomyces cerevisiae
                     YLR310C CDC25 Membrane bound guanine nucleotide exchange
                     factor (GEF or GDP-release factor) indirectly regulates
                     adenylate cyclase through activation of Ras1p and Ras2p by
                     stimulating the exchange of GDP for GTP required for
                     progression through G1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453477.1"
                     /db_xref="GeneID:2893061"
                     /db_xref="GOA:Q6CRG2"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG2"
                     /translation="MERPQDEGMNPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFA
                     GDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTKSIKDTSSSRKIFPLNYHGSNA
                     FNNRPSSHGSRRNSLRIGSPSGNMNIRSTSGSRRGSLVSTGNFRRKSLGTTTFHDNHD
                     NAINSGQTLLSTSPSNSASSVNNSSPSSHLKQDYQFDMNRRSFSHSRSKPNATSKSRS
                     ASTSSSRNSYCRSSESLSKARSHSESRNSDHSYSKHSVSSIRSPHTLHESEINILSTK
                     EVEMLLNNMSRQEVVPVWTPVLTTSNNLLYFNKEMNIYCTSLPISRTPELSLKSVFPP
                     NENLVDLQARSLESDFLPNTQVMDLESVISSQHRNLHDASPINPMVVISGNSSQKQPN
                     TPSGPKPDLSQPCPSPGRSPSMHSNPTQSNEKNEEAGPKNSQPLAPKPLPQSNSRMFY
                     SLSSDMKTWTELKNSTIYYLKASHNHFFKQNQPSFYQNFSKASTYIFYHQLACNLARK
                     ELIKRNVVKDIRKILRKLIKVVFRINVNASVYFNSSSKIVMNSSDIKKFNGDMLTSNR
                     DTLNNGTRTSEAFVLPNNIEFPDLRNVSTSTTTSFNPNASLDSSHQGTMTSETIQISP
                     DSPRASIPTNTTQTSNMLIDEETGIVLNSLFNVIHTDFTNIFKLVNNLHNIIIDSVSP
                     DDALVQIYPRFIRNSFEGIVWTKSDPSFASKSEDSSDISNKSDQGNASSSFFPESLSS
                     LMFSGRQYSSSSSRTVNSNLEKQNSSGSIGKIHNKLRARSKGSKPARYPLNHTTLNLL
                     RDKLSLISNIYKTDNSAILSSVDGGKLVELSMGTYNGLKESAAFLNIIDKLDLQFFFN
                     LKRCHSNENLEKEFHEFSESSMTNAVPILLEYYDLKQALHDITIRYVMDTQNLSLRDP
                     FVFCSMRGELSQFSKGSHAELFQLVQEEKKSNSLYEHLVSQDVEINGMSFLDTQEVLH
                     EAATRYYNIATLISVIIEQLIVERENVINYAARMMNNDFMDVLLKDEQYEYDENLSSS
                     VTISQTMSDDQETQQSSKASMFLSSTLDSKSPTFLQHSFVDELPWFLDSEHETELIYS
                     PNGHIKGGTRLALIEHLTNHKSIDAFFNIVILTTFRSMFSTAEFLRYLFKRFDLSPPE
                     GLSYEEYNVWVDRKQKPIRIRVINIIKAWLTDYWNDCYYEDSQDSLDELNTVVNMAIL
                     DEISGAAELRPLVERKIAVNELKLKRKDYEPKPSPTPPPALKNGLSKTSATFRLRKHK
                     LTDFDPITFAQQLTLEEHILYSAIDQFECLDRIWGKKVCDFGGSANISNFITSSNHLT
                     DFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPIFRLKKTF
                     DRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHDVPCVPFFGVYLSDLTFTASGNP
                     DNLNNNPNLFNFSKRLKIVMILNEIMSFQKITYKLKHSEEVKLFLEAEMENILSIEKQ
                     YELSLKIEPRVDVSSSFNSAEYNTPTDLSKAGSKKLRFGRLRK"
     gene            complement(<788565..>791705)
                     /locus_tag="KLLA0_D09328g"
                     /db_xref="GeneID:2893056"
     mRNA            complement(<788565..>791705)
                     /locus_tag="KLLA0_D09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453478.1"
                     /db_xref="GeneID:2893056"
     CDS             complement(788565..791705)
                     /locus_tag="KLLA0_D09328g"
                     /note="similar to uniprot|P38990 Saccharomyces cerevisiae
                     YER129W PAK1 Upstream kinase for the SNF1 complex
                     partially redundant function with Elm1p and Tos3p members
                     of this family of kinases have functional orthology with
                     LKB1 a mammalian kinase associated with Peutz-Jeghers
                     cancer-susceptibility syndrome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453478.1"
                     /db_xref="GeneID:2893056"
                     /db_xref="GOA:Q6CRG1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG1"
                     /translation="MVEEIDLPPDIRWQLMDESKMHKPANPRRKSSIFGSMHREEFPM
                     SNTSSTDSLDLLLEKQRQRQLNHPLHQNHIRTVLGSHLNSGQRITYGPVKETNTVSLE
                     YDPISKRKVLNTYEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFNDKFSN
                     RFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKGEIKW
                     CPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDGIV
                     KISDFGVSLAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEP
                     IISFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVFEPYQKIEQCQVSQV
                     ECKEEYEEAQNLLNKLLEKNPKKRMAIQDAKKHPWVCWDFNHNDYMSDQEKSLKLIEQ
                     SNFHRSPSEQVEQICISEHEVDTAVGGIGHKIKNAVGKFLPSTKSNDESNTNSVNEFN
                     DSGNNKYIDGCLNSCASYTDNGNLILSEETYISPKDSTGYGNEGTNLVEDSSSVPVHD
                     VSAREIFQQELQRFDNRRDPDSIVSLPVNSSFASLDSFYIDHYAPRQLSEHSFQGPLA
                     QQQKFEAFDRPPIGPFSKPNSNGRVPTQTAFRIPSPNALQLDTLTMGSGISGRNIRSN
                     LHSPILSPTGTLSRRTSNEFPNAALGSRLRKPASLHTYDKNQSAFTNPRVPGDNPYRR
                     SQTLQCQRNTRKPSIVFDGLQESDGDSQSTNSHIEPSNVFQMGSESEDENDIDNGFYL
                     SDNHSDAESLPFEFGIDSEHGSVLSLRDLTEGGRTTTNSYTELRSTNNSSEPPEHLRL
                     FGKHLVDTSIPEKVTSSPLKKSSETAIPIISSDYVDAFTEVEGVPEEMLNMIPEMQPE
                     LRTTSSQHTNNCNGLFQQFSSNVLPTTQESSVDHVITMNNSNEAKFFLKNLLSSTKSP
                     RTNSFGNIRSPKLKNNGPDRLATDIFVNHYSGNKDNNNIPVDKGDNENNTSTSRYRSK
                     SVSVGLLADKEADNSL"
     gene            complement(<792405..>794096)
                     /locus_tag="KLLA0_D09350g"
                     /db_xref="GeneID:2892992"
     mRNA            complement(<792405..>794096)
                     /locus_tag="KLLA0_D09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453479.1"
                     /db_xref="GeneID:2892992"
     CDS             complement(792405..794096)
                     /locus_tag="KLLA0_D09350g"
                     /note="highly similar to uniprot|P47079 Saccharomyces
                     cerevisiae YJL008C CCT8 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453479.1"
                     /db_xref="GeneID:2892992"
                     /db_xref="GOA:Q6CRG0"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6CRG0"
                     /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQINKSIAAIREIHQMCLT
                     SMGPCGRNKIIINHLGKHIVTNDAATMLRELEIVHPAVKVLVMASEQQKIDMGDGTNL
                     VMVLAGELLNVSEKLIALGLSPVEIIQGYTMAKNFTLAELDKMSVLDIKNKHEKSELI
                     KVIKPVIASKQYGSEDILSSLVSDAVAHVLLPNSNYFNVDSIRVVKIMGGSLTNSSVI
                     KGLVFNREPEGHLKSLPQGEKHKVAVFTCPIDISNTETKGTVLLHNAQEMLDFTKGEE
                     QQLDQMMKEIAETGVRCVVAGAGVGELALHYLNRYNILVLKVPSKFELRRICRVCGAT
                     PMPRLGAPTPEEIGIVETVKTKEIGGDRVTIFKQEENENTRTATIILRGATQNNLDDI
                     ERAIDDGVNAIKGLMKQDGGKLVPGAGATEIELVSRISNYGEKTPGLMQLAIKQFAVA
                     FEVVPRTLAETAGLNVNEVLPNLYAAHSQKTASNEINDGLYQGIDIDNNTPECIKDIR
                     DEGIYDLLAAKKFAIDVATEAAKTVLSVDQIIMAKRAGGPAVPKGPKPGNWDQDD"
     gene            794667..794739
                     /locus_tag="KLLA0_D09372r"
                     /db_xref="GeneID:2892998"
     tRNA            794667..794739
                     /locus_tag="KLLA0_D09372r"
                     /product="tRNA-Met"
                     /db_xref="GeneID:2892998"
     gene            <795025..>797436
                     /locus_tag="KLLA0_D09394g"
                     /db_xref="GeneID:2892780"
     mRNA            <795025..>797436
                     /locus_tag="KLLA0_D09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453480.1"
                     /db_xref="GeneID:2892780"
     CDS             795025..797436
                     /locus_tag="KLLA0_D09394g"
                     /note="similar to uniprot|P47061 Saccharomyces cerevisiae
                     YJL029C VPS53 Required for Vacuolar Protein Sorting Vps53p
                     is a hydrophilic protein that is peripherally associated
                     with the late Golgi and forms a stable complex with Vps52p
                     and Vps54p."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453480.1"
                     /db_xref="GeneID:2892780"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF9"
                     /translation="MISESLEYDPLHDLQQIFSKQESLSDIDNLVLLTEKCKFNLEER
                     VRESNNTSSEVNSLEDNYDFHKLFEKINSTKSLSQITEATISDLTHDISDLDNAKRNI
                     TRSMTCFENLKILSDAYVNSKKYMQAEKYIEMCGPFKVMHSLSVSFHEYKSLDEFCKF
                     LNQIHRLESDTLLVCERVTKEVLRDGSNSKYDSKTMKDGICCLADTNKHYKERIVQLC
                     LDSLLYEIKEIFQIDDEAGSLENLSRRYIFFKKVLNNFQSTFSEYFPSEWEIPLKLTD
                     SFFTMTSNDLKTLLKRDLSGTTSIDLFMQSLQTTLEFEKYISVKFSHIYEGKISTCFE
                     PYLKLWVRHQDSSLNAKMLTYLNETKLPAKNESLVVPSSADLFRTYRHILSQTFSLIE
                     GGNKSTIMVELAVFFVKWLNEYYEKILKPLLLPEDTQIDDKNEVVKYTVLLVNTADYC
                     ANTIDQLQDKLCEYLENDEPNINKVAAIFEPTRQKYMDLVSGGINLLLNRILKKDLEF
                     VWREFTNTNWANTMVEDYSRYVTTLQSILLPTRSENSTFYSTVSQFNRDLYGWNFIDK
                     TIDLIAISFESQIIKLLKPALPYGTLNSKRQFDVKQVINIAEQLLLDVQLLKTTLHSL
                     PESLPQHDTSAKRVTKHIDSNVEKLMHLLKLLVSPIDPDTTYLETYYAITASQNTNSN
                     FWAFILALKGVPWDLALWKRVWSEFQQSDDDTQPMKPDDLIFNPRELQNFIYNLSRVS
                     DPSWKTFLEEDLKIKPVPRPDLSVAIQSSPSPPTGSPSPKIPGHKLNEIKNLMSNSSF
                     FFKKG"
     gene            <797743..>798336
                     /locus_tag="KLLA0_D09416g"
                     /db_xref="GeneID:2892777"
     mRNA            <797743..>798336
                     /locus_tag="KLLA0_D09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453481.1"
                     /db_xref="GeneID:2892777"
     CDS             797743..798336
                     /locus_tag="KLLA0_D09416g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453481.1"
                     /db_xref="GeneID:2892777"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF8"
                     /translation="MIPFFYIMIFFTIAESTLTDAEFKEIDMFIDVVGESHFALMFPV
                     ELIRTDLNDTFDPKQVYDIFDELAEERKEFQIVKELDIPEFVAEPLYDRLTYLSVKLD
                     NGYTVNLANEIAIIQDIIQIAAESDNIKLDFTALLRVKEELRVDMAAVSKLKLFKTCL
                     LSNLFPFMQEECEGLLRQKLIEHLKIWIEVWKRHQDD"
     gene            complement(<798454..>799044)
                     /locus_tag="KLLA0_D09438g"
                     /db_xref="GeneID:2892732"
     mRNA            complement(<798454..>799044)
                     /locus_tag="KLLA0_D09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453482.1"
                     /db_xref="GeneID:2892732"
     CDS             complement(798454..799044)
                     /locus_tag="KLLA0_D09438g"
                     /note="highly similar to uniprot|P40958 Saccharomyces
                     cerevisiae YJL030W MAD2 Component of the spindle-assembly
                     checkpoint complex which delays the onset of anaphase in
                     cells with defects in mitotic spindle assembly forms a
                     complex with Mad1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453482.1"
                     /db_xref="GeneID:2892732"
                     /db_xref="GOA:Q6CRF7"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF7"
                     /translation="MDLISLKGSTRIVTEFFEYSINSILYQRAVYPAEDFATVKKYDL
                     SLLKTQDTELKQYIREILRQVHRWLLGGKCHQLVLCIVDKDDGETIERWKFNVDSHSN
                     KNDTDDDMNIPLEETQKEIRAVLRQITASVTFLPELKNEGNYTFNVLAYTDSNANVPL
                     EWTDSDSKEIAKGESVQFKSFGTSAYSVGAEVTYKF"
     gene            <799233..>800305
                     /locus_tag="KLLA0_D09460g"
                     /db_xref="GeneID:2892878"
     mRNA            join(<799233..799235,799325..>800305)
                     /locus_tag="KLLA0_D09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453483.2"
                     /db_xref="GeneID:2892878"
     CDS             join(799233..799235,799325..800305)
                     /locus_tag="KLLA0_D09460g"
                     /note="highly similar to uniprot|Q00618 Saccharomyces
                     cerevisiae YJL031C BET4 Alpha subunit of Type II
                     geranylgeranyltransferase required for vesicular transport
                     between the endoplasmic reticulum and the Golgi provides a
                     membrane attachment moiety to Rab-like proteins Ypt1p and
                     Sec4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453483.2"
                     /db_xref="GeneID:2892878"
                     /db_xref="GOA:Q6CRF6"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF6"
                     /translation="MHGVTRREWTKELLRKKREKERQEILDYRELSDEVLELKNKRVA
                     NKDSLLKTTQLLNINPEFNTIWNYRREIIKLLAPSLDQTFWDGELAFTMDKLKVRPKV
                     YWIWNHRVWCLEHYPNSPLKIWLKELAIVGKLLEMDARNFHGWHYRRYIVSTVERLSG
                     NCLNSQEFEYTTAKINQNISNFSAWFQRTNIIEHMLARDQIADKESFIDDEFQYIKNA
                     MFTDAEDQSVWTYLIWFIKESALKEHMTSEKYSSMLKELTEIIELINDDDISFSGKDN
                     IWCLKTLLVIEFIQKDILKEDIKSKSREYLDKLIIIDPLRKNRYLYQIRAL"
     gene            complement(<800338..>801309)
                     /locus_tag="KLLA0_D09482g"
                     /db_xref="GeneID:2892735"
     mRNA            complement(<800338..>801309)
                     /locus_tag="KLLA0_D09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453484.1"
                     /db_xref="GeneID:2892735"
     CDS             complement(800338..801309)
                     /locus_tag="KLLA0_D09482g"
                     /note="similar to uniprot|P46962 Saccharomyces cerevisiae
                     YJL006C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453484.1"
                     /db_xref="GeneID:2892735"
                     /db_xref="GOA:Q6CRF5"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF5"
                     /translation="MSNQSDLILSRPYLTKSQLQKSQKYNIPDRRTYNQKRILVFKYL
                     CQLCVHLKLPRKVLEATMYFYHRYHAFNKFETEMCYDVGTSCLFLSCKQVETFKRLGE
                     VCSTALKIRNVPRVTPDMVDAFKKRVMQMELRVLETCSFDYRVNNEVHIDEFIVKIGR
                     ELSLPYSCCRLAWLIAFDVLKLELLITVPPHTIALAVLKLACELLNETKWPNVRYNLF
                     ETDAASFHEAYFDILNFYINVFDACDLKDHETVKSLNLKIETFIEIKKTAGPEQGLKV
                     DPIALDKDDYVSKERNFAVKERRYVLNQNSLQEESISTKKRSISEVE"
     gene            complement(<801783..>804095)
                     /locus_tag="KLLA0_D09504g"
                     /db_xref="GeneID:2892880"
     mRNA            complement(<801783..>804095)
                     /locus_tag="KLLA0_D09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453485.1"
                     /db_xref="GeneID:2892880"
     CDS             complement(801783..804095)
                     /locus_tag="KLLA0_D09504g"
                     /note="highly similar to uniprot|P20448 Saccharomyces
                     cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
                     helicase high-copy number suppression of a U14 snoRNA
                     processing mutant suggests an involvement in 18S rRNA
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453485.1"
                     /db_xref="GeneID:2892880"
                     /db_xref="GOA:Q6CRF4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAKKQKHNTQQRKLIRERDSQKIKDLETKVEEYNPKIAKANLFQ
                     DLPISEQTLKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIPVIEK
                     LYREKWTDMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFEKERI
                     SRINILIGTPGRILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPAS
                     RQTLLFSATQSQSLDDLARLSLTDYKQVGTMEVLNANSSSATPESLQQSYIEVPLPDK
                     LDILFSFIKSHLKSKLIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETL
                     DKFSRAQHVCLFSTDVVARGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEGKSL
                     IMLTPEEEEGFLKRLKTKNIEPSRLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFI
                     SYVRSIYIQKDKEVFHFDKIPLEQFANSLGLPGAPKIKMRGMKSIEKAKELKNTSRQL
                     LTLAKANDEGDVIKENKPEVRTRYDKMFERKNQTVLSEHYLNVTKAQAHDDEDEDFIM
                     VKRQDHELNEAELPELLVPTSKRAQKKALSRKATLASNGNPTKVKFDDDGKAHPVYEL
                     EDEQDFRQNGNSEKQKEEFLSKEAELMAKVDVEDKQVAKEKRQEKKRKRLEAMRKEME
                     ADMEDSDYEDEPVAYLGTGNLSDDMQSGADTEDDSQDERQPRKKSKYADSSEDEEEEE
                     RTTERDRIIEVEEPQTLEDLESLTANLIGS"
     gene            <804422..>805075
                     /locus_tag="KLLA0_D09526g"
                     /db_xref="GeneID:2892848"
     mRNA            <804422..>805075
                     /locus_tag="KLLA0_D09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453486.1"
                     /db_xref="GeneID:2892848"
     CDS             804422..805075
                     /locus_tag="KLLA0_D09526g"
                     /note="similar to uniprot|Q07930 Saccharomyces cerevisiae
                     YLR016C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453486.1"
                     /db_xref="GeneID:2892848"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF3"
                     /translation="MEYTVIYGSNGAKRMSIKREGSRYRYDHETKRSRYEGAQKKVIL
                     PIFEPSGLLELESHQKKGIQLKHVEPKDAISPHDFYKKLKVPKWDQIRYELVVYRKGV
                     KGEVSKTKLHDKSCYIIGRGLGQSLRRFESDGEEIILADIPIQEESCSKEHCAVQFRQ
                     VGESLIPYLIDLDSSNGTCLNDSAVPSARYIELKSSDIIHVSEDPNDSDYELIFLAV"
     gene            complement(<805863..>807614)
                     /locus_tag="KLLA0_D09559g"
                     /db_xref="GeneID:2892944"
     mRNA            complement(<805863..>807614)
                     /locus_tag="KLLA0_D09559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453488.1"
                     /db_xref="GeneID:2892944"
     CDS             complement(805863..807614)
                     /locus_tag="KLLA0_D09559g"
                     /note="similar to uniprot|P16474 Saccharomyces cerevisiae
                     YJL034W KAR2 ATPase involved in protein import into the ER
                     also acts as a chaperone to mediate protein folding in the
                     ER and may play a role in ER export of soluble proteins
                     regulates the unfolded protein response via interaction
                     with Ire1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453488.1"
                     /db_xref="GeneID:2892944"
                     /db_xref="GOA:P22010"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MFSARKSSVGWLVSSLAVFYVLLAVIMPIALTGSQSSRVVARAA
                     EDHEDYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVSFTDDERLIGDAA
                     KNQAASNPKNTIFDIKRLIGLQYNDPTVQRDIKHLPYTVVNKGNKPYVEVTVKGEKKE
                     FTPEEVSGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNILR
                     IVNEPTAAAIAYGLDKTEDEHQIIVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGG
                     EDFDYKLVRHFAQLFQKKHDLDVTKNDKAMAKLKREAEKAKRSLSSQTSTRIEIDSFF
                     NGIDFSETLTRAKFEELNLALFKKTLKPVEKVLKDSGLQKEDIDDIVLVGGSTRIPKV
                     QQLLEKFFNGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETT
                     GGVMTPLIKRNTAIPTKKSQIFSTAVDNQKAVRIQVYEGERAMVKDNNLLGNFELSDI
                     RAAPRGVPQIEVTFALDANGILTVSATDKDTGKSESITIANDKGRLSQDDIDRMVEEA
                     EKYAAEDAKFKAKSEAR"
     gene            <809203..>810870
                     /locus_tag="KLLA0_D09581g"
                     /db_xref="GeneID:2892953"
     mRNA            <809203..>810870
                     /locus_tag="KLLA0_D09581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453489.1"
                     /db_xref="GeneID:2892953"
     CDS             809203..810870
                     /locus_tag="KLLA0_D09581g"
                     /note="similar to uniprot|P38778 Saccharomyces cerevisiae
                     YHR050W SMF2 Divalent metal ion transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453489.1"
                     /db_xref="GeneID:2892953"
                     /db_xref="GOA:Q6CRF0"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:Q6CRF0"
                     /translation="MSSSLQFKKVAGSDGSSAWNTNDQQYNAFVHEGDTDTPTYVKTF
                     QNCVRILKKYARFVGPGLMVSVSYMDPGNFSTAVAAGSAHRYKLLFSVLVTNILAAFW
                     QCLCAKLGAVTGLDLAQNCKKHLPPTLNLVLYVLAEVAIIATDLAEVVGTAISLNILF
                     KIPLPLGVILTVVDVLVVLLAYKPNGSLKLVRWFEAFVSLLVFATVVCFAIELFSVHI
                     DSVGEVFKGFLPSKAVFESDGLYLSLAILGATVMPHSLYLGSGVVQPRLRDYDIKQGH
                     YIPSQNDEDNNHDNYKPSIDAIHDTLNYTMAELLVSLFTVALFVNCSILIVAGATLYG
                     VTSNNAHEADLFSIYNLLSETLSKTAGTIFVLALLFSGQSAGIVCTLSGQMVSEGFLN
                     WTVAPALRRALTRVVAITPCLILVLVAGRNGLSGALNASQVVLSLLLPFVSAPLIYFT
                     SNKNIMRVPWAIDCSQEPSNLFALQNLSSSNLATDDATVIAHDTDDEVDAHLINSPEP
                     LSDESVHYKDFSNSIFTTVVAVIVWIFISGLNFYLLISFANGQDVHL"
     gene            <811234..>813696
                     /locus_tag="KLLA0_D09603g"
                     /db_xref="GeneID:2892908"
     mRNA            <811234..>813696
                     /locus_tag="KLLA0_D09603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453490.1"
                     /db_xref="GeneID:2892908"
     CDS             811234..813696
                     /locus_tag="KLLA0_D09603g"
                     /note="weakly similar to uniprot|P46949 Saccharomyces
                     cerevisiae YGR196C FYV8 Protein of unknown function
                     required for survival upon exposure to K1 killer toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453490.1"
                     /db_xref="GeneID:2892908"
                     /db_xref="InterPro:IPR026248"
                     /translation="MDDIARQHYQDNAKMSDNITRHKSQRWVSASKANYDGADWDAYS
                     SNSEDEGLTNNIPQLPQVNIPESNNIAKSSSPDPSIGTCLRSDSLNTSVRSGNKSVND
                     DLDSLMHQISQEMTAKDEDVNNTSDPEDEDDAELKVSKTGYFAAYVNDEDTDDRESVK
                     SDIESAKLAESATEINKTDNAKAESVSEVESVAESVKRAKVEVEPVQIVNVGEESFKG
                     DDSEAESVKRADVEVEPFKIVSAEEEPLKGDDTEVELFKNAASEVETSQISVELQDEM
                     IDPTTEIPSRIQGDVAISDDKGSKDAVDEDNWSKSDSHPESIGSQDKEEMPPSSINSL
                     PSESQLSIQHSKEGDSNDSDSLLNGYGSEPSLMKDNASPVKLRKTSKTDLSYHDGYSS
                     ESSGEEKERAISEVSLGQYVVHSAESFKFRNPVRNSVLDSSDDDIDYTDEDGDLEVTK
                     SGYFAAMVDEDKEIDDSDRHTLNNNDTDGLTADSDVNSITESVTKRLSQSSITQSDVP
                     DQNSENDVGGYSDSSEDEEDGPQKLAFSTRESINLGKWKPDTDAFRSGFVTETIDINN
                     PPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDGESQFNAFPHDVASDDDDLKTIADT
                     KTIYDNQTIYNVPALIANNASAPALPTNIQITNESTDYVSSNDTIFKHVNGEAPKGES
                     KLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEYDSGL
                     QSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILSKKNSVANTVNQNVTHLKK
                     KMFSSSMREKSKGLFSSIGKKL"
     gene            complement(<813773..>814510)
                     /locus_tag="KLLA0_D09625g"
                     /db_xref="GeneID:2892925"
     mRNA            complement(<813773..>814510)
                     /locus_tag="KLLA0_D09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453491.1"
                     /db_xref="GeneID:2892925"
     CDS             complement(813773..814510)
                     /locus_tag="KLLA0_D09625g"
                     /note="highly similar to uniprot|P46948 Saccharomyces
                     cerevisiae YGR195W SKI6 superkiller ExtraCellular Mutant
                     Ribosomal RNA Processing homolog of RNAse PH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453491.1"
                     /db_xref="GeneID:2892925"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE8"
                     /translation="MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQ
                     GNNKIITLVAGPQEPSSRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQA
                     SLVRTFEKNLMLHLYPRTSIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSG
                     VSVGLYDTTPLLDLNSLEENAMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGI
                     AGTHRIRDLMDKELRKHGKTRVENSSN"
     gene            complement(<814829..>816037)
                     /locus_tag="KLLA0_D09647g"
                     /db_xref="GeneID:2892962"
     mRNA            complement(<814829..>816037)
                     /locus_tag="KLLA0_D09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453492.1"
                     /db_xref="GeneID:2892962"
     CDS             complement(814829..816037)
                     /locus_tag="KLLA0_D09647g"
                     /note="similar to uniprot|P47088 Saccharomyces cerevisiae
                     YJR013W GPI14 Glycosylphosphatidylinositol-alpha 1 4
                     mannosyltransferase I involved in GPI anchor biosynthesis
                     requires Pbn1p for function homolog of mammalian PIG-M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453492.1"
                     /db_xref="GeneID:2892962"
                     /db_xref="GOA:Q6CRE7"
                     /db_xref="InterPro:IPR007704"
                     /translation="MHRKVILLLTVSLLLRIGFFSYGIFQDSHFDVKYTDIDYFVFHD
                     AAGYVNNGQSPYLRDTYRYTPLLSFLLLPNYYLKWIHMGKVFFVLFDLITGVMIIKLL
                     QGSCQLTKQLILASIWLLNPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFY
                     GLSIHFKIYPIIYALPIGIYLLLSSHNRNCIWRLFMIGISTLIGITAPTYFMYKLYGS
                     EFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLP
                     YLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVV
                     CIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVFFLINVYLLGVFITDIKSRTS
                     FQDNQHKKNI"
     gene            <816343..>816750
                     /locus_tag="KLLA0_D09669g"
                     /db_xref="GeneID:2893075"
     mRNA            <816343..>816750
                     /locus_tag="KLLA0_D09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453493.1"
                     /db_xref="GeneID:2893075"
     CDS             816343..816750
                     /locus_tag="KLLA0_D09669g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453493.1"
                     /db_xref="GeneID:2893075"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE6"
                     /translation="MENKEEATELSYDELMDIIVNNKPVPNVVDVPDIILDQSLATEH
                     HLKPRLKPWEQAKDVPVMGGLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQ
                     KQLKGYESSTGLKGRGRSSAALSDQSSNHTDKV"
     gene            <817452..>818999
                     /locus_tag="KLLA0_D09691g"
                     /db_xref="GeneID:2893128"
     mRNA            <817452..>818999
                     /locus_tag="KLLA0_D09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453494.1"
                     /db_xref="GeneID:2893128"
     CDS             817452..818999
                     /locus_tag="KLLA0_D09691g"
                     /note="weakly similar to uniprot|P47084 Saccharomyces
                     cerevisiae YJR003C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453494.1"
                     /db_xref="GeneID:2893128"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE5"
                     /translation="MSYLVRRQFCSSSRVFDKLIKKPWSESLERVLTLESVPESFRNN
                     KALYSLEPYELSATFKNILKQGDLTPNQRIQVHNKLIEELTKFDFAVAAIHLKELEQI
                     SGPLSVPAFIQVLENNPGRVKSSWEYFEENFSTVKLSDDALITVLNRLVNFDPIDIRD
                     GKKVMTVTDVARSIHIINLIRDKPKISHEVWNKLIENIILSNTSVVLPKVFEIIPLQL
                     DIPETSEELTHLQLYVLLHLKNLRDLFETEQNTFIRLFSLVGTHDTVPITEKEAQAYE
                     SFVKDFNAIGENLGLESSDLVASKIGTGSTFEEMLSFIKQAEIDKKQLSFAKMLLRYL
                     GMHKGDTKRALEFYHEYLMAHPSHADELMYELFLSFAYQSFAHSNDKFLQVAESLIPP
                     DSCDEHKLNVLRCLILVNSKFNVDRSLDIFNKNIQSISKEKSPITNTSDAALLCEDLV
                     LAFLRNKDRDFAHVIFEGAAREKIIDGPTAVKRVKNILTLYGESIEEKNCTEIMDKEI
                     ERVLKSL"
     gene            complement(<819182..>819817)
                     /locus_tag="KLLA0_D09713g"
                     /db_xref="GeneID:2893090"
     mRNA            complement(<819182..>819817)
                     /locus_tag="KLLA0_D09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453495.1"
                     /db_xref="GeneID:2893090"
     CDS             complement(819182..819817)
                     /locus_tag="KLLA0_D09713g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453495.1"
                     /db_xref="GeneID:2893090"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE4"
                     /translation="MKVILENKRYQKEAGFPEPNSDQVNKSRGRKSNSGLPNTKGTNP
                     LVVIMQDYKDGQVTRNPDNVKIGQISVIKQTDFGATSAGQKIALKDSHTTEAARKTLD
                     YTGPAASLVKNNLKRTASASDERCQLLFKNCNVPASTPEAKCKKQRSGDTTNKKKLHK
                     TFRFVNVETELRNRDQGKPTFKIKKPPTLEQKSVKQASLMGLFSSKIGKHP"
     gene            <820211..>822199
                     /locus_tag="KLLA0_D09735g"
                     /db_xref="GeneID:2893141"
     mRNA            <820211..>822199
                     /locus_tag="KLLA0_D09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453496.1"
                     /db_xref="GeneID:2893141"
     CDS             820211..822199
                     /locus_tag="KLLA0_D09735g"
                     /note="similar to uniprot|Q92280 Saccharomyces cerevisiae
                     YLR002C NOC3 Protein that forms a nuclear complex with
                     Noc2p that binds to 66S ribosomal precursors to mediate
                     their intranuclear transport also binds to chromatin to
                     promote the association of DNA replication factors and
                     replication initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453496.1"
                     /db_xref="GeneID:2893141"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE3"
                     /translation="MGRKRSQKEIQERLAKRRKDADALLETGLFQTEDVEVDDRMPSK
                     SSWDDDEQDYELKPRTLKGQDDEDAVEGLPIKRNGKVERNIIKSQRNDVRKSKEDEAD
                     NESNDEEENSKDGAASSGEEEDDNEVPDTEETIIELKETIAELVERIMEEAEENTAAL
                     TRLRKMAGSKNPNTAKFSILALVTVFKSIIPGYRIRPLTELEKKEKVTKEVARLRSFE
                     ENLVFNYKAYVDLLARLSRTPNNDTPINVNLGNIATNAAIELTSSSMHFNFRSELLTI
                     LIRRISKPNPSIDPFYHKAIKTIEGILNEDEEGNVSVEVIRLLSKVLKTRNYNVDESV
                     INVLLSLDILHDYDPNTKTEEEFKMKLRKKDRVHLSKKEKKARKERKLIEEEMRAAEQ
                     AVSAEERERNQAEILKLTLALYLNILRSDITKLVGSVLEGLAKFGHMANFDLLGDFLV
                     VMKELIANAELDNLSSSEVRKVLLCIVTAFSLVSNHTHMKLSMDLSSFVDALFTVLPY
                     LSFDADIEFSHKSLRLADPLNNELVKPSVNVSTKAELLLKALDHVFFRSKSGTKQRAA
                     AFTKRIYMALLHTPEKTSIALLKFLDKLTTKYPEVLGLYSTDDRIGNGEFRIDTDLPS
                     RSNAEAATIWENSLLVKHYSPSVVKGVRSLFHKSQEHK"
     gene            complement(<822299..>824125)
                     /locus_tag="KLLA0_D09757g"
                     /db_xref="GeneID:2893250"
     mRNA            complement(<822299..>824125)
                     /locus_tag="KLLA0_D09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453497.1"
                     /db_xref="GeneID:2893250"
     CDS             complement(822299..824125)
                     /locus_tag="KLLA0_D09757g"
                     /note="similar to uniprot|P47083 Saccharomyces cerevisiae
                     YJR002W MPP10 Component of the SSU processome, which is
                     required for pre-18S rRNA processing, interacts with and
                     controls the stability of Imp3p and Imp4p, essential for
                     viability; similar to human Mpp10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453497.1"
                     /db_xref="GeneID:2893250"
                     /db_xref="GOA:Q6CRE2"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="InterPro:IPR012173"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE2"
                     /translation="MSQFLEILKTNPVGLLSQDALESKEPLSAVKTYFDEVINLNKNN
                     GNSKTTLDEIVVDGLDANQVWWQSKIILDNVQGDIMEKIAELKVDNENDMSEESSGDE
                     DDASNVENSNEMSADEAPVSEESAIEEEEEEAENEELVLDEEQQFSEPEPLELHEKEE
                     DKLENESDSEPDDQFVEAQESPQAIEDKFGVNDQFFNLDEFNRQTLEAENRSQDADEE
                     DEDDEEVDYFADVPSEEDEEALYYDDFFDKPSNKKSSQDRRPGPSKKAEAEEDESFDE
                     SEYDDAMEEAKLDLFADEDDDFQGSDEETAEQPLSTFERQQLELKRQIESLEKEAVAE
                     KKWALKGEVKARDRPEDALLTEDLEFERTAKPVPVITAEVTETLENMIRRRIKEEDFN
                     DLQRRVISDISGYNNKPRFELSDVKSSKSLAEIYEDDFKGVTEDTEISEELQKSHDEI
                     SELYKDLVYKLDALSSAHFIPKPIKKDLEVRVQTAAISMEDAQPLTMSSGSTLAPQEI
                     YKVGKSENSNEITLKNGVVMSRDELSREDKNRLRRAAKRKRSKLSAKRAEQPRKKSKT
                     DDVLNTLTKSKNITVIDKKGAKTDVKGNIKKDNASGNINFKL"
     gene            complement(<824518..>826404)
                     /locus_tag="KLLA0_D09779g"
                     /db_xref="GeneID:2893175"
     mRNA            complement(<824518..>826404)
                     /locus_tag="KLLA0_D09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453498.1"
                     /db_xref="GeneID:2893175"
     CDS             complement(824518..826404)
                     /locus_tag="KLLA0_D09779g"
                     /note="similar to uniprot|P47082 Saccharomyces cerevisiae
                     YJR001W AVT1 Vacuolar transporter imports large neutral
                     amino acids into the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453498.1"
                     /db_xref="GeneID:2893175"
                     /db_xref="GOA:Q6CRE1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE1"
                     /translation="MVQEVDPEHQSLKADSSSAAQVHYVSIPINKDRRFGAGVGAGSS
                     NDYPDYLDGSSEMPTQYQGIRRRTSILDQPIGSFRGVNSLGRFATSFQRANSFKAIEM
                     NADRERSYIGADGDECYDPDTLGFSHHGRKLSFAITGPGTVSIKPSIADLYGAMSRRS
                     SIQAGTPYGNFENPIDESDGLQSVFSHDSMGPHHLTEYSFDDSGNAVGPEADAIILKQ
                     VETKAGKVITVIAGQSTAPQTIFNSINVLIGIGLLALPLGLRYAGWVLGVPILFIFAF
                     ATFCSAQLISRCLDADPSISTYGDLAYAAFGPKGRALISFLFAMDLLACGVALIILFG
                     DSLNALFPEYSVNFFKFVAFFAVTPPIFLPLSVLSNISLLGIISTIGTALLVVFCGLL
                     KQYSPGSLLQPEATSMWPNSFKEFCLSLGLLSACWGGHAVFPNLKSDMRHPEKFTRCL
                     KTTYSITIVTDIGIAVVGFLMFGNLVMNEVTRSVLLTPGYPPFVYGLISTLLSLIPLA
                     KTPLNARPIVSIFDSMFNVVHIDETKPASKVFFAKATRIFNRIMVNVMFVIIAILFPE
                     FDKIIAFLGAALCFMICFILPCLFYKRICYKTIKSWELIACNITILISAVLSTLGVYA
                     SFTS"
     gene            <827563..>830193
                     /locus_tag="KLLA0_D09801g"
                     /db_xref="GeneID:2893273"
     mRNA            <827563..>830193
                     /locus_tag="KLLA0_D09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453499.1"
                     /db_xref="GeneID:2893273"
     CDS             827563..830193
                     /locus_tag="KLLA0_D09801g"
                     /note="similar to uniprot|Q07895 Saccharomyces cerevisiae
                     YLR001C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453499.1"
                     /db_xref="GeneID:2893273"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:Q6CRE0"
                     /translation="MKVSLIYQLFSLFVISPFVGIVLFAAAFGDDDDFPFSTVIDILS
                     QNPEFSTFLRLIQREGHVPTLNAMDNYTLFAPVNSAFIDDDESSIGADFVLENYILSD
                     DVLIISNIAPGTYLLQSESYPMSLYKGNDGKSALNDVIHIVDPNLSPNFQNATVHGID
                     AFIKKPPTLYDLVSSHVDTEREPITLMKHLIESSYQDIDSMEVDRFKLQPFVNGSTIF
                     LPTDKALRKFFNDIELSYLFDLSDSEFTVPARKQDIEVLIKKITVNKLFGGVIRQNDD
                     IIENKNGEPLTVFSKNKGRDLVVNGSAALMSNLIYDQGIVHVVSDLPIVDTDLDFNAE
                     KYLMGLNASSFVEELYIREFQRLIEDPNTEQTIFVTKDALFESSAAGGLSKAQLLYHF
                     IEHKVNLTDDFKDGVFPTRLYESMYCSSNKKLGGKCQRMKISKFGEHLYLNEKFHVLN
                     LDPILIDNTMIYIVDDNLMLPGDLIPSVNPFFHCSKSLKFLQQLNLLDLKPNKEGYTL
                     LLPCFNSWSEMQLVTDYLQRNISAMNILMKNYVLNGLIYSDDSNNTMNTTNLYGEEVL
                     VEIGTSNSSTDYLPLSLSTVDHEIELKKSFDMIFNQGVVHPVNEVFFPENLDIHLRHL
                     IETIGTYDFLVFLEKYPEFNDILTGSAPYSLLIPTQRSLLMEGIDLNYTKLEKFLKLH
                     ILPENQTSLLLECADKIDTTAGESLKCREASDNVLLLSVIDGIDKEVRILKKGCTSNN
                     SASCVFLIDRPISVNWLSKERYSITLPALSFALGTVLGTMFLFSLLLCVIVTCAHKKP
                     SKGYKSRRASDAENNEEEPLIPSENSSAVVPNSSYQATVNAARNHNQVSPTFESSYSS
                     NAKTAPMKVGQNITEGLARD"
     gene            complement(830546..830627)
                     /locus_tag="KLLA0_D09823r"
                     /db_xref="GeneID:2893429"
     tRNA            complement(830546..830627)
                     /locus_tag="KLLA0_D09823r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2893429"
     gene            complement(831051..831132)
                     /locus_tag="KLLA0_D09845r"
                     /db_xref="GeneID:2893407"
     tRNA            complement(831051..831132)
                     /locus_tag="KLLA0_D09845r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2893407"
     gene            complement(<831834..>834218)
                     /locus_tag="KLLA0_D09867g"
                     /db_xref="GeneID:2893408"
     mRNA            complement(<831834..>834218)
                     /locus_tag="KLLA0_D09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453500.1"
                     /db_xref="GeneID:2893408"
     CDS             complement(831834..834218)
                     /locus_tag="KLLA0_D09867g"
                     /note="similar to uniprot|P32567 Saccharomyces cerevisiae
                     YMR165C SMP2 Protein involved in respiration and plasmid
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453500.1"
                     /db_xref="GeneID:2893408"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD9"
                     /translation="MQYVGRAFDSVSKTWSSINPATLSGAIDVIVVEHPDGELACSPF
                     HVRFGKFQILKPSQKKVEVLVNGQSTDIPMKLGDSGEAYFVFETLADLEGIPDELISS
                     PVVSAASSPESKPTTKDDALEEPDFLDINDSKIERPTTPTPIQRITKTLTQKQIPSTV
                     DNNGDLLLDIEGYKTSKNKVNDTDELLKQLLYDELGEDVDLSEFVKEDEKGNIRIVNP
                     TDPCWATSPPNSPPMTSSDSLYSEHQSVLGYSSNEGTPSFSTDNSRVEVPSAATATTH
                     FIKTIRLTSKQLKCLDLSNGENDLTFSVDKGRAIITAKLFYWKWDDPIVISDIDGTIT
                     KSDALGHVLTMIGKDWTHPGVAKLFTEIRGNGYNIMYLTARTAGQSDSTRSYLRSIVQ
                     NGCTLPIGPVILSPDRTMAALRREVILKKPEVFKIACLKDMKALYFPESNNRKDDADE
                     MPTPFIAGFGNRITDALSYRTVGIPSSRIFTINPDGEVHMELLELAGYKSSYIHINEL
                     VDHFFPPVKKYPFVAEDARSISTTPGSPYGTNIMHDEKSFYRANDEKYTDVNYWREPI
                     PDLDELSDLSNDSEKATSPSKEIYNEGIRNSTTNGTANQTNKNRLSVHEPREGNDTEL
                     LLTPRRKSDPDNIGQRMYLNLGSPLSSPVLKVQDSDLDMNTNSPYNNGYSNNSELSQK
                     NQQPLKRHSSSENSILTFDHLSARTPSTLEVQPVNVYNDGSGPVMGQLQSQTSRRNTN
                     SSNSNNNSFDKEIPSDEKGHNPDQHFSEQESLTTDQGSENISDEYEDEFDEDEF"
     gene            complement(<834904..>835998)
                     /locus_tag="KLLA0_D09889g"
                     /db_xref="GeneID:2893319"
     mRNA            complement(<834904..>835998)
                     /locus_tag="KLLA0_D09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453501.1"
                     /db_xref="GeneID:2893319"
     CDS             complement(834904..835998)
                     /locus_tag="KLLA0_D09889g"
                     /note="similar to uniprot|Q03829 Saccharomyces cerevisiae
                     YMR166C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453501.1"
                     /db_xref="GeneID:2893319"
                     /db_xref="GOA:Q6CRD8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD8"
                     /translation="MFSLSSSIPVVGTHDHPSEGILKSQQQSKRHGSTVPPPSGGKTN
                     ADSTENAYSPIVHCMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTI
                     ILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFLG
                     DFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGY
                     KATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITT
                     PLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFI
                     WTSIQSSIMLLLYQVALKTLDSKLSDEKKL"
     gene            <836851..>838023
                     /locus_tag="KLLA0_D09911g"
                     /db_xref="GeneID:2893178"
     mRNA            <836851..>838023
                     /locus_tag="KLLA0_D09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453502.1"
                     /db_xref="GeneID:2893178"
     CDS             836851..838023
                     /locus_tag="KLLA0_D09911g"
                     /note="similar to uniprot|P43122 Saccharomyces cerevisiae
                     YDL104C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453502.1"
                     /db_xref="GeneID:2893178"
                     /db_xref="GOA:Q6CRD7"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD7"
                     /translation="MFNCYKSLPRSLVFRRAYRVLAIETSCDDTCVAILDRGTKDRPA
                     DVLCHLKSTLDSVEYGGVIPTRAHEHHQKNIASVVKSALKTTKSQNKIDLVCATRGPG
                     MPGSLSVGLDVGKALSVAWDKPFIGVHHMLGHLLIPRLETDGLKPQYPFITLLVSGGH
                     TMLVLSTDVDKHEILCDTIDIAIGDSLDKTARELGIKGNMIAKEMESFINEEDINVVR
                     AGITSVKPMRLPTPLKNQNGRMNMQAFSFSPFLTAVRQHLSQPIGEYTAEERRYMAYQ
                     VQESIFNHIITKLNLVLKLNSKRLSNVKHFVCSGGVGANMRLRHRLETDLIRNFDSFH
                     YPKLEYCTDNAVMIGWAGIELYESLGLTSDLSVTPIRKWPLTDILNVPGWIMKTQY"
     gene            complement(<838199..>839356)
                     /locus_tag="KLLA0_D09933g"
                     /db_xref="GeneID:2892724"
     mRNA            complement(<838199..>839356)
                     /locus_tag="KLLA0_D09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453503.1"
                     /db_xref="GeneID:2892724"
     CDS             complement(838199..839356)
                     /locus_tag="KLLA0_D09933g"
                     /note="similar to uniprot|P43124 Saccharomyces cerevisiae
                     YDL105W NSE4 Nuclear protein that plays a role in the
                     function of the Smc5p-Rhc18p complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453503.1"
                     /db_xref="GeneID:2892724"
                     /db_xref="GOA:Q6CRD6"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD6"
                     /translation="MSEVGNRRSSKRRRTEAFAVKVDKEEERKEFDIIQRYRALEHEV
                     QHDRLQMTRDGDVRVMSKRLDEIEHLFGDLQSLNVNKNAVLAQDSKAMKTISELLSLS
                     MSTVKFDESGRLIKLEDILNSAKKFMLKEYLEVTGMTEPEYGGSVEEEELADETHEPV
                     NDFGDKRTSEVDNDDVSAFKTRQKRSNYLSQFGNYTEFNQFNWFKMGTLYQNLSLTPF
                     TIDHMLGPLYVEKTVRKQREIRARDPVAELSTAERVTKESLNESQDETTPSHVRKCYK
                     VLKEKEGEQQINLFKYIIDPNSFSKSVENLFYTSFLIKEGRLVLEDDPDGYPAVRIKE
                     QLPDDSREREIEKQRRNDSRQNHIIFQMDIPTWRKLIKKFGITEPFLNKDT"
     gene            <839640..>841814
                     /locus_tag="KLLA0_D09955g"
                     /db_xref="GeneID:2892977"
     mRNA            <839640..>841814
                     /locus_tag="KLLA0_D09955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453504.1"
                     /db_xref="GeneID:2892977"
     CDS             839640..841814
                     /locus_tag="KLLA0_D09955g"
                     /note="similar to uniprot|Q2I041 Saccharomyces cerevisiae
                     YMR167W MLH1 Protein required for mismatch repair in
                     mitosis and meiosis postmeiotic segregation and spore
                     viability forms a complex with Pms1p and Msh2p to repair
                     mismatched DNA human homolog is associated with hereditary
                     non-polyposis colon cancer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453504.1"
                     /db_xref="GeneID:2892977"
                     /db_xref="GOA:Q6CRD5"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD5"
                     /translation="MSGRIKPLDVSVVNKIAAGEIVIAPVNALKEMMENSIDAKATMV
                     DILVKDGGIKLLQITDNGCGIDKDDLPILCERFTTSKLEVFEDLSKIETFGFRGEALA
                     SISHIARVTVTTKTEKDQCAWKASFSEGKILGQPKPVAGKTGTIITVEDLFYNIPSRL
                     KALRSPGEEFNKILDVIGRYSINNNNVGFSCKKFGDSKVALMIKADLSTKDRVRIVFG
                     ANVSTNLMELNIDITDDVQRNGLLSASGFVTNLDFTNKKPIPPAFFINGRLVSCDPMR
                     RSFYQIYSNFLPKGNKPFIYFSLTIKPQNVDVNIHPTKREVRFLNEEEIIDRLAILLQ
                     DKLASIDTSRTFKTASSVSNPYQVQLIGSSNESQDSPSTNLKMKRQENKLVRIDSSQV
                     KITNYLRSTKFEFGASKNKTKKMNIEKIADDNDTTLQNDGMEIENDIEASYGDETSTQ
                     HTTLRNNTYYIVPKQRVQVNLTSIKKLKQAVDEQSHSELTNIFANLTYVGIVDETRRL
                     ASIQCDLKLFLVDYGSICNELFYQIGLSDFSNFGKIMLFDEDETEAGFNITKILENID
                     TLRIETIQEIIEKLTSMKEMMNEYFSIEIETNDGGWNKARIKSIPLLLKDYNPPLSKL
                     PFFLYRLGTQVNWEDEMECLDGILRQLALFYIPPIIEKIHENDPEHLSSTYAAEMNEL
                     TDTMDHVVFPVIKRRLLAPKILLKDVVEVANLPGLYKVFERC"
     gene            complement(<841852..>843756)
                     /locus_tag="KLLA0_D09977g"
                     /db_xref="GeneID:2892846"
     mRNA            complement(<841852..>843756)
                     /locus_tag="KLLA0_D09977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453505.1"
                     /db_xref="GeneID:2892846"
     CDS             complement(841852..843756)
                     /locus_tag="KLLA0_D09977g"
                     /note="similar to uniprot|P40969 Saccharomyces cerevisiae
                     YMR168C CEP3 Essential kinetochore protein component of
                     the CBF3 complex that binds the CDEIII region of the
                     centromere contains an N-terminal Zn2Cys6 type zinc finger
                     domain a C-terminal acidic domain and a putative coiled
                     coil dimerization domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453505.1"
                     /db_xref="GeneID:2892846"
                     /db_xref="GOA:Q6CRD4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD4"
                     /translation="MSKPKISLTKGKHPCTFCQARKVKCDRSLPACQNCIERNVTELC
                     EYDDNGSRKRARLADDVNLYDKKLFNIWNQYERLWIHDTLGQCQQGVYMGIAFPLDVS
                     EYNNTKDFYGYECLFSKESIFKILDHSLERLGWLYFGFFTDISELPYQMERYWNEYES
                     MNINLENEEATTRQTTFKKSADQILWDLVLRSVIVMTIYYMPAKSILSLVDIDAIEKY
                     PLDFSESNEGVDELKKKYEIFDYCLRHTLNKVLRTIFTLPPDVRTLQIFLILSNTNFL
                     QIYPSLGNNILVHCIHLAKVLGIKDFKLKINDSGSTRLQKLSMHNIWFRLSTVDYMRS
                     SPNKIIALHTDNSSALTRKTLFTHCSIDSIDVYDVESNLEVLRWKITSLDRDLEVSEP
                     SLKTLKAMKELLGLLDRKTSVSNDASFNTKFESFFLKLQCNFVMWKILRYEFMQYGVT
                     NGLQKLCCPARRIIALVANFLKEDYFEYTTHPFCVHILCVIAGFFSFYCIFHEADEVR
                     DLRNDAVGLLKLLFDPLRPVISCFFSNLSRLEELRHIWKSVEITDQANRLVHPVMYVL
                     KTDIIKLKRNLEIISGSLKDANYQETFKDKLEIDINTPALSSDFLEVVREFNLSHPLD
                     INGKMSRQNN"
     gene            complement(<844368..>845873)
                     /locus_tag="KLLA0_D09999g"
                     /db_xref="GeneID:2893159"
     mRNA            complement(<844368..>845873)
                     /locus_tag="KLLA0_D09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453506.1"
                     /db_xref="GeneID:2893159"
     CDS             complement(844368..845873)
                     /locus_tag="KLLA0_D09999g"
                     /note="highly similar to uniprot|P47771 Saccharomyces
                     cerevisiae YMR170C ALD2 Cytosolic aldehyde dehydrogenase
                     that uses NAD as the preferred coenzyme expression is
                     induced in response to high osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453506.1"
                     /db_xref="GeneID:2893159"
                     /db_xref="GOA:Q6CRD3"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD3"
                     /translation="MSLYETVNIPQLNITYEQPLGLFINNEFVKSSDGKKIESINPST
                     EESIVSFFAASEKDVNSAVTAARDAFENNWSKTSGEQRGILLSKLFDLIERDKLLLAA
                     IETLDSGKPYHSNSLADLEQILQLTRYYAGGADKFTGGEYIPLNQDKYAYTMKVPYGV
                     VAQIVPWNYPLAMASWKIQSCLAAGNTIVIKPAENTSLSLLYFAQLVKEAGFPPGVLN
                     ILPGYGSVTGTAMASHTDIDKIAFTGSTAVGQKVMSLAAQSNLKAVTLECGGKSPCLI
                     FADANLDEAIPWVAGGIFYNSGQNCTANSRIYVHEDIYEEFLTKFEEYAKSNWKFGAK
                     FDPFDKDCTLGPVISKVQYDRIQSYVEHGKASEKLGFKEFAEYPSKGYFIPPTIFSDV
                     PNSSKLSQEEIFGPVGVVASFSTYEEAIKLANDSSYGLASCVFSENARTTAQFARDIR
                     AGTVWINSSNDEEISVPFGGFKMSGIGRELGRNGVDSYLQTKAVHVNIAKL"
     gene            <847239..>848750
                     /locus_tag="KLLA0_D10021g"
                     /db_xref="GeneID:2893235"
     mRNA            <847239..>848750
                     /locus_tag="KLLA0_D10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453507.1"
                     /db_xref="GeneID:2893235"
     CDS             847239..848750
                     /locus_tag="KLLA0_D10021g"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170c ALD5 and to uniprot|P54114 Saccharomyces
                     cerevisiae YMR169c ALD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453507.1"
                     /db_xref="GeneID:2893235"
                     /db_xref="GOA:Q6CRD2"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD2"
                     /translation="MSFTSIKLADGTEYQQPLGLFINNEYVEAHGSETLTSYNPSSGE
                     EICKVQCADPKIDVDLAVKAARDAFPGWKATPAIEKRDLFYKLAGLLERDIDILSKIE
                     SLDTGKPIANNAKYDILEVVEVLKYYAGWIDKAGGQSFAPSSEKLAYTLHQPLGVVGC
                     IIPFNYPLAMMSWKWTAIATGNTTVFKSADQTPLSILYFAKLVKEAGFPAGVFNVLSG
                     TGASVGSAIVKHTGVDKIAFTGSTAVGQIIQQQSAVNLKPITLECGGKSANMIFEDCD
                     LEQAVKWSAWGIFNNMGQICSGTSRVFVQESIYEEFVAQLADHVKKTYIVGAPSDDAV
                     IVGPQVSKKQQERVLEYIKIGIEEGCKVPLGGLGAPEPIANDPALANGYYVKPTILAD
                     VKASYRIAKEEIFGPVIVVGSFKDYKEALDIANDSDYGLGSAIFSKDIVTCHKFAQDV
                     EAGMVWINSSNDVDINVPFGGVKMSGHGRELGEYGLANFTNVKSVHVNLGRKL"
     gene            <849549..>851015
                     /locus_tag="KLLA0_D10043g"
                     /db_xref="GeneID:2893557"
     mRNA            <849549..>851015
                     /locus_tag="KLLA0_D10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453508.1"
                     /db_xref="GeneID:2893557"
     CDS             849549..851015
                     /locus_tag="KLLA0_D10043g"
                     /note="similar to uniprot|Q755L6 Ashbya gossypii AFL202C
                     AFL202Cp and weakly similar to YDL106C uniprot|P07269
                     Saccharomyces cerevisiae YDL106C PHO2 Homeobox
                     transcription factor regulatory targets include genes
                     involved in phosphate metabolism binds cooperatively with
                     Pho4p to the PHO5 promoter phosphorylation of Pho2p
                     facilitates interaction with Pho4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453508.1"
                     /db_xref="GeneID:2893557"
                     /db_xref="GOA:Q6CRD1"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD1"
                     /translation="MDNFDYNQPDFPHFQPEFDPSNTFLGDQEQLQDKRISSGESGYG
                     NQSGTLMNASDGVEMFQGIPSTLANEHNTQVEHDDDHDSNHETHHSSSSSSKPKSKRT
                     RATGEALEILKREFQLNPSPNAQNRKRISEMTGLPEKNVRIWFQNRRSKYRKSDKRMN
                     GPGATDNTTLVSSFEFDKIPLAINSSYYFIDISSLTVGSWKRLKSGNLRSDSLPQIQK
                     LSNLSPISINTIMANATDLMVLISKKNFEINYFFSAIANNTKILFRIFFPINTVVNCS
                     LSLDNTESLKGDAKNSNSPSSLDGNNDTNSSKLAELRLSLSKSPKFAVYFSETIDDAS
                     SNQWSICEDFSEGRQVNDAFIGGSNIPHVLTGLDESLKFMNSLILDMNSTEHFPPTTQ
                     LQHGIMHSMPPTDTQSTALRFNDDPNLIAHDTSANPSHNSQSSFLTTNDNFTSMTFDN
                     FSSNIPKTPDFLNSTNLQEGQSMSTLLFQDQHPNGSSH"
     gene            complement(<851283..>852683)
                     /locus_tag="KLLA0_D10065g"
                     /db_xref="GeneID:2892717"
     mRNA            complement(<851283..>852683)
                     /locus_tag="KLLA0_D10065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453509.1"
                     /db_xref="GeneID:2892717"
     CDS             complement(851283..852683)
                     /locus_tag="KLLA0_D10065g"
                     /note="similar to uniprot|Q03212 Saccharomyces cerevisiae
                     YMR171C Endosomal protein of unknown function mRNA is
                     targeted to the bud via the mRNA transport system
                     involving She2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453509.1"
                     /db_xref="GeneID:2892717"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:Q6CRD0"
                     /translation="MNLSLVARHGHKSKMAHKHHGDSAHVSEGPSDPDVDMDLIVFTM
                     MFMFLSYLLSILVYFVTRWLVKRLFTARISLHEEGTMNGGQSDLSEDRYLDDESEVKE
                     FLQNLSPKEQFYYKQGEEYVKQNPPLLVPYLPNDPENREEVIPDPIVNEQTLQFIEEE
                     GAAAWEFQADPNLPNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNKVYYYECKIFE
                     LNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQT
                     LFPRFEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPC
                     KIHVNFGTYGFVYIEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLESAFEDDVSDSES
                     ITSDSINEQITDQSGNILPPPPGFEFSTSVASDIPVESITMHSLPAEPPNYSADEDEE
                     HNVEDNTIANQFVATT"
     gene            <854495..>855424
                     /locus_tag="KLLA0_D10109g"
                     /db_xref="GeneID:2892741"
     mRNA            <854495..>855424
                     /locus_tag="KLLA0_D10109g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453511.1"
                     /db_xref="GeneID:2892741"
     CDS             854495..855424
                     /locus_tag="KLLA0_D10109g"
                     /note="similar to uniprot|P14065 Saccharomyces cerevisiae
                     YOR120W GCY1 Putative NADP() coupled glycerol
                     dehydrogenase proposed to be involved in an alternative
                     pathway for glycerol catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453511.1"
                     /db_xref="GeneID:2892741"
                     /db_xref="GOA:Q6CRC8"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC8"
                     /translation="MTSPSGEFPSLKLNTGASIPQLGFGTWPSSHADAYTAVITALKT
                     GYRHIDAAAMYGNEAAVGKGIRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGL
                     DYVDLFLIHWPVPLKPVGGPENLLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKT
                     RAVGVSNFSIKNLEDLLNSSPDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCP
                     LGSSSSAMLSDPTIAEIADKYHVKPANVLINWGISRGYCVLPKSFTPARIASNKTPVH
                     LSREDTERITKLSETLGVKRYVHPDFEPYPLFE"
     gene            complement(<855951..>857342)
                     /locus_tag="KLLA0_D10131g"
                     /db_xref="GeneID:2892920"
     mRNA            complement(<855951..>857342)
                     /locus_tag="KLLA0_D10131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453512.1"
                     /db_xref="GeneID:2892920"
     CDS             complement(855951..857342)
                     /locus_tag="KLLA0_D10131g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453512.1"
                     /db_xref="GeneID:2892920"
                     /db_xref="GOA:Q6CRC7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC7"
                     /translation="MSDLEKKPSVTEKTIQIPDGGYGWVITFAFFLYNFCTWGANAGY
                     AVYLATYLSRDVFPGGGKLDYAAIGGLAFGVGLLFAPVIIYFSRNYGVHVVIGLGIIC
                     QCAALLLAAFSKKLWQIYLTQGLLISFGLALICTPSMGLIPQWFRKRRTLAAGIGAGG
                     SGLGGIIFNLGMQKIIEVKSVKWALIVQCIICTSLSTLALILTRTRNQHIHGSAEQTQ
                     PLGAAFKEHISVFKVVGMWALCSWVSFTMLGYVILLYSLSAFTQSLGYDSEEGSYVSC
                     MISVGSLIGRPLIGHIADRYGPITVGALVNLVVAILCWAMWIPCRSLSVAIVFALLQG
                     GLMGTVWVIFGSATARVVGLKKIDKAFSVMWIFIALFGIPAPVIGLQLRSNVANSKTN
                     YEKTAIFTGFAFLGAALSLLCLRAYILSRDKVASIHAKGEDSMDHDETHYSVTLPSFF
                     NGLISKNTGNRTI"
     gene            <858016..>859983
                     /locus_tag="KLLA0_D10153g"
                     /db_xref="GeneID:2892981"
     mRNA            <858016..>859983
                     /locus_tag="KLLA0_D10153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453513.1"
                     /db_xref="GeneID:2892981"
     CDS             858016..859983
                     /locus_tag="KLLA0_D10153g"
                     /note="some similarities with uniprot|P35995 Saccharomyces
                     cerevisiae YKL222C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453513.1"
                     /db_xref="GeneID:2892981"
                     /db_xref="GOA:Q6CRC6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC6"
                     /translation="MPKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIYNVN
                     LQSQLVDGTKQLSKSQLIAKIGILTSQLREKSDKNTGNPLTKLWYTSSKYGRVLTYGP
                     TSVRCLIKSSRMGWYYSEIWKTIKEKRNEWKKKHVHAIKMEEVYSVGNPILLRSGNSV
                     LDALCGCLPSMDVIKVYLTSFFNSSLFKEFEIVDPNKVFSDVDLCLIAVNGEIKSIEL
                     GNKKNYYRVGLITKILSMTYFHDKNTPAIDVFHKYLASFESAKSAHLERIQFFMLKYI
                     HINAKGFTGGDGGNSLAVVSLAFSTALQIGLFRRETLKLFRDDDRYISNLWQLIVQAD
                     LECSFSIGSALLISDDFLFDFDQSPGMTIETEQNYSPASYLLFLRKIIAEVYSTKNAP
                     DLKVSILQLKFSILTNFGSLTPYLSQGINDEPINFHKLLTILLSLQMISNLSIIESQI
                     NPSGSKQLIQNASLCHIASLVLVLNYIRAVYNRQRTIKGTTNVDSCLDISLGLYLHHT
                     VLPRVTHELVLIFSDAYMNREDDGSAVVSSDVDLQKFIATFDTYLQTDTDVSFNAVLA
                     YRYFKLVHDTFKNERGLELDNLLNQSYLFIVSDEFSTSIIQAFDWSLPPTNQESHILD
                     MNALPYGIRDNDLFLDSALDMFDDEFSTFFA"
     gene            <861073..>861525
                     /locus_tag="KLLA0_D10175g"
                     /db_xref="GeneID:2893069"
     mRNA            <861073..>861525
                     /locus_tag="KLLA0_D10175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453514.1"
                     /db_xref="GeneID:2893069"
     CDS             861073..861525
                     /locus_tag="KLLA0_D10175g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453514.1"
                     /db_xref="GeneID:2893069"
                     /db_xref="InterPro:IPR019587"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC5"
                     /translation="MADIEARTIINAAPSVVRGVFLDFTKYSEWSTFIKEISPSDKQE
                     GPVPGKGLQVLLDFDGGSPQKMAPVVITNSDAEFSWTGVLGVKSVFNGTHKFEFKPLE
                     DGMKTELIQSEAFGGVLKKPLLWYVGKKTQIGFEAFNNALKDRVENSA"
     gene            complement(<861726..>864296)
                     /locus_tag="KLLA0_D10197g"
                     /db_xref="GeneID:2893577"
     mRNA            complement(<861726..>864296)
                     /locus_tag="KLLA0_D10197g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453515.1"
                     /db_xref="GeneID:2893577"
     CDS             complement(861726..864296)
                     /locus_tag="KLLA0_D10197g"
                     /note="similar to uniprot|P05085 Saccharomyces cerevisiae
                     YML099C ARG81 Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type involved in the
                     regulation of arginine-responsive genes acts with Arg80p
                     and Arg82p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453515.1"
                     /db_xref="GeneID:2893577"
                     /db_xref="GOA:Q6CRC4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC4"
                     /translation="MKPAKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGY
                     DVKLRWTRPIQFDTMGNVTATPTGIKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELS
                     ALSSPPLELISEDKTWIIKKFGVFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLA
                     NKKNKVKTADSDSKEGTNLCTPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEW
                     ISNELRDDALLSASAVQGETIPFMGIRQNNTPDTPQTPLTVDNMGKKNGSVNGNCNDG
                     RTSGNDNEDELARVYRLLFHRRGSSDQPPPPTITSETKSGHAKETIGIVPLRNFVELN
                     VPGSTMPRSAIEVIHSQVPDPSIFNRPGNTNPLLDIPTTGVHVHGLARFLLNYYLQNV
                     ADLMTVVVLPTNSWKTIYFPRALKALGDLTGIGYTSNSRNSLLNALLAVSCFNLQSKF
                     PKNSPEMKFFLTLGIEFRTQASSFLKRCLSNTVNQERYKDILTAILSMNSIDVVWGTM
                     ADCQVHLAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVIL
                     DNNSSIDSHISSGISLSNGEFKESLNREDGKIVIEFFSSPSSGKPSPVAFPKGSHDSS
                     GVTTPIFSNIASESYYYPKSNDTDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYR
                     QHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGL
                     IIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMAGCACIDS
                     NLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQNDDWFSVYKDWEMNLMLS
                     "
     gene            <864863..>865342
                     /locus_tag="KLLA0_D10219g"
                     /db_xref="GeneID:2893091"
     mRNA            <864863..>865342
                     /locus_tag="KLLA0_D10219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453516.1"
                     /db_xref="GeneID:2893091"
     CDS             864863..865342
                     /locus_tag="KLLA0_D10219g"
                     /note="similar to uniprot|P11747 Saccharomyces cerevisiae
                     YML098W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453516.1"
                     /db_xref="GeneID:2893091"
                     /db_xref="GOA:Q6CRC3"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC3"
                     /translation="MSRRIRKTSLFSKDVGSLMYAFGDVAQPLPETIQCVDELVVSYL
                     SDICANAYYSAQTVKRNKIKVEDFRFVLRKDEVKLGRAEELIKMNKVITDARKQFDNS
                     EGKSLKRVKDDGDDDHISADEDEETTTVPEPVPTSRPVGRPRKKGNEPPKKKKRETS"
     gene            complement(<865680..>867365)
                     /locus_tag="KLLA0_D10241g"
                     /db_xref="GeneID:2893596"
     mRNA            complement(<865680..>867365)
                     /locus_tag="KLLA0_D10241g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453517.1"
                     /db_xref="GeneID:2893596"
     CDS             complement(865680..867365)
                     /locus_tag="KLLA0_D10241g"
                     /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
                     YML130C ERO1 Glycoprotein required for oxidative protein
                     folding in the endoplasmic reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453517.1"
                     /db_xref="GeneID:2893596"
                     /db_xref="GOA:Q8NIP5"
                     /db_xref="InterPro:IPR007266"
                     /translation="MVKVLQLCFLSAISLVQALNSTVDQKDEAKVDINTVFDNDSTNF
                     CRMDKTEAIGATCDVTFHEINEVNNNIRPQLLSLVQSDFFKYFKLDLYKECPFWSDNN
                     GYCVNRACAVDVVEDWDSLPEYWQPEILGNIENATTDITDDECSFLDELCDKPRFEAE
                     KDIEYCDTNDFNSQHSVLVDLTANPERFTGYGGEQSSQIWSSIYKENCFSLGDENQCL
                     AKDAFYRLISGLHASIGTHLSNEHLNTETGKWEPNLELFMTRVGNFPDRVSNIYFNFA
                     VVAKALWKIRPYMNELGFCNAYNEDVKGMIDGVVSQLNSKVFNEDLLFHDEVSGQLKD
                     DFRIRFKNVTKIMDCVQCDRCRLWGKVQTTGYATSLKILFEMDNDDDVARQHVVDKLT
                     KYELIALFNTFDRLSKSVEAVNRFEEMYNYQLKSPGEKLASFFQLDNFFKVLNDKFNS
                     ANHSSQEKESVSNVEKKVNEFNDLKMPEKKKETHTEVREQASGVFKEAWDVEWKNFKQ
                     ALRFIVTSYTDLPSTVSKYTVLKLNKLWNKFIGVPNYLEEGEELEYPSYNYEE"
     gene            complement(<868131..>869444)
                     /locus_tag="KLLA0_D10263g"
                     /db_xref="GeneID:2893580"
     mRNA            complement(<868131..>869444)
                     /locus_tag="KLLA0_D10263g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453518.1"
                     /db_xref="GeneID:2893580"
     CDS             complement(868131..869444)
                     /locus_tag="KLLA0_D10263g"
                     /note="similar to uniprot|P54787 Saccharomyces cerevisiae
                     YML097C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453518.1"
                     /db_xref="GeneID:2893580"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC1"
                     /translation="MDADDDKGFNASPETISEKPLADVGENLDEKNNYYDFQAFLKIM
                     RDPKADPIVKHTKSFIRNFVSQRENWTTSEQEKLINDFKVFIYDKLLTNEAFRDLSDA
                     QIKNAKEGIEKLVMGKLYYKCFSPCLVNEKRSSDATHEQDLLDDAKLRDKILEFRFLG
                     PEHLDIIPDLINGKLHSFIALSAKELAKINQYRSPRDKMVCVLNSCKVLFGLLKHNNK
                     LNGGADHFVPLLIFTLLKSDVPHLISNVRYIERFRFPSFLMGENAYYLSTLQGAVNFI
                     LDMDIDSISILETDKDFNKKYSQNQEEIKDLKKQELLNPKDSSTKFPHRTVSPSPSEY
                     ILKPLDDAANSVLTKLNDFWNTSTSPTPSSPEYEDRSPRDHQEIDEHTATVLAQQMEH
                     KEQENTLQTLQLMFPDLDPDLIRDVCIASKYRVGVCVDSLLEMAE"
     gene            <869754..>871301
                     /locus_tag="KLLA0_D10285g"
                     /db_xref="GeneID:2893161"
     mRNA            <869754..>871301
                     /locus_tag="KLLA0_D10285g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453519.1"
                     /db_xref="GeneID:2893161"
     CDS             869754..871301
                     /locus_tag="KLLA0_D10285g"
                     /note="similar to uniprot|Q04489 Saccharomyces cerevisiae
                     YML096W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453519.1"
                     /db_xref="GeneID:2893161"
                     /db_xref="GOA:Q6CRC0"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CRC0"
                     /translation="MCGILAYFGKSFGSTLTDEFQELYEKDLTGPIQSCNSNTLFNEL
                     IPYIVRRGPNYASLRSLSEINAMLFSSVLSLRTPFTKQSVMVQDRYLLQYNGELYNDD
                     TVENCEHSDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIGKRSLS
                     YILLDDELYITSVSGRCDGFQNCLAGVIYIFDINTKQLTGSVKIHDEPYIVSDQIDND
                     FQLLEEYKIKLYECLRRSVYQRIVTIHPMHLENGNISILFSGGLDCSVITALLCEQLI
                     KINRNSETIIELLNVGFENPRTGKMPSDSPDRILAIKSAQLLSELYPQVNIKLIEVDV
                     PYTDYLSHKDTVIDLMYPKNTEMDLSIAIAFYFASRGRGKVTENGESKPYNRSGIVMF
                     SGLGADELYGGYHKFSNKSNEELVIELQKQIAQIHDRNLNRDDKVISNHGIEVRYPFL
                     DERVVQFSVDLPLNYKVNKHILRVMAKDILRLDFISEEPKRAIQFGARSAKMTKDSNK
                     RGTDLLK"
     gene            complement(<871349..>872050)
                     /locus_tag="KLLA0_D10307g"
                     /db_xref="GeneID:2893124"
     mRNA            complement(<871349..>872050)
                     /locus_tag="KLLA0_D10307g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453520.1"
                     /db_xref="GeneID:2893124"
     CDS             complement(871349..872050)
                     /locus_tag="KLLA0_D10307g"
                     /note="similar to uniprot|P06838 Saccharomyces cerevisiae
                     YML095C RAD10 Single-stranded DNA endonuclease (with
                     Rad1p) cleaves single-stranded DNA during nucleotide
                     excision repair and double-strand break repair subunit of
                     Nucleotide Excision Repair Factor 1 (NEF1) homolog of
                     human XPF protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453520.1"
                     /db_xref="GeneID:2893124"
                     /db_xref="GOA:Q6CRB9"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB9"
                     /translation="MVDDTTSFESILANVRKRRAEFNQPSPQPQQSPRPSLQQNPAPE
                     LTRKQNEHPNLRDASINSQQRSVTTSKPSGPVINSFNQQHDTSPGNAPVIHNQKKAVQ
                     ESSFADKSSSSKTMFVSSSQTGNPLLKSLVNVNWRYVKSTPTTQVHYDYQIRGRNVIF
                     LSLKYHKLHPEYIGKKLLPFKRTEGNVLLCVVDVENSEDILRELNKVCMFQGFTILLA
                     FTFEQAGKYLTFMNK"
     gene            <872320..>872896
                     /locus_tag="KLLA0_D10329g"
                     /db_xref="GeneID:2893233"
     mRNA            join(<872320..872335,872448..>872896)
                     /locus_tag="KLLA0_D10329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453521.1"
                     /db_xref="GeneID:2893233"
     CDS             join(872320..872335,872448..872896)
                     /locus_tag="KLLA0_D10329g"
                     /note="highly similar to uniprot|Q04493 Saccharomyces
                     cerevisiae YML094W GIM5 Subunit of the heterohexameric
                     cochaperone prefoldin complex which binds specifically to
                     cytosolic chaperonin and transfers target proteins to it"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453521.1"
                     /db_xref="GeneID:2893233"
                     /db_xref="GOA:Q6CRB8"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB8"
                     /translation="MSSQKIDLTQLNPEQLTVVKQQIDQELQHFTQSLHALNMARSKF
                     KECIDDIKTVSRDDNANQNLLVPLSGSLYVSGKIQDNKKFMVDVGTGYYVDKSAEDAI
                     QFYQKKVDKLNKESLQIQEIIKEKNQSSLAIENQLRIAAIKQHEQMAAAQKS"
     gene            <873366..>875945
                     /locus_tag="KLLA0_D10351g"
                     /db_xref="GeneID:2893248"
     mRNA            <873366..>875945
                     /locus_tag="KLLA0_D10351g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453522.1"
                     /db_xref="GeneID:2893248"
     CDS             873366..875945
                     /locus_tag="KLLA0_D10351g"
                     /note="similar to uniprot|Q04500 Saccharomyces cerevisiae
                     YML093W UTP14 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453522.1"
                     /db_xref="GeneID:2893248"
                     /db_xref="GOA:Q6CRB7"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB7"
                     /translation="MAKRPRSTGRTKKQSKRRAFSALEIARRELEGDDSSSDNETGKH
                     GAILNARKKEDADSGEDSFEDEELDSDEALGSDDDYDVLSSKFSQTIRDQKKAKKNVP
                     KYYDSEEDDGGYTSIEEDELVSLSAAWDMDDKESKGDDDADSKLNLNDNLSDQETSAS
                     EESSSEEEEVSEEEDPFADISEDEDETNLSNVVTLLNKDKDKKQMKKLENYTVGEENE
                     FALPTNKSGDKLDISAMLAAVDDPLVSQKASLLKGKQTALATPLPQRIQKRLERKAAY
                     EISKDEVNKWQDAVQHLRQAEHISFPLNPETQHNESNVFIKEQPNVETEVESKVSAVL
                     EKSDLAAPLKESTFEEIETAKMTPAEMKKRTAELRLMRELMFREERKAKRIKKIKSKA
                     YRRIKKKEMLKNQEFIESDESDTDHDIARAKERMTLKHKTQGKWAKDMIKHGMTKDKE
                     TREEMEEMLRQGERLKEKILGRDGDEQSADEDIDTLEADGNDADSEEESSAREKVGKT
                     GVLNMAFMRNAEAREKEANEEQLKALRDMERNGEADIFDAGENSNANKTLNQGRRVYT
                     PGTAESREELTKLNNEIAEEIEIDQSKSLVSRLSKDQKKSNSKSKSTKKDSSSETDVN
                     ANPWLNDSDDESNVKKSSKVHVVDQDSSQLSKAAHKIRKEMVKQSKKKPSSTKDEDVL
                     LDLEDSNTLNIVDAYGGSDDETSTNTMFKQQEVIADAFAGDDVVSKFEEEKRRVAVDE
                     DDKEEDVTLPGWGDWAGAGAETKRKRKFIKKTKGVVEKDKRRDKSLKNVIINERVNKK
                     NLKYQSSSVPFPFESREQYERSLRMPLGQEWTSRTSHQKMIKPRILTKGSTVIDPLKA
                     PFK"
     gene            complement(<876175..>876927)
                     /locus_tag="KLLA0_D10373g"
                     /db_xref="GeneID:2893404"
     mRNA            complement(<876175..>876927)
                     /locus_tag="KLLA0_D10373g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453523.1"
                     /db_xref="GeneID:2893404"
     CDS             complement(876175..876927)
                     /locus_tag="KLLA0_D10373g"
                     /note="highly similar to uniprot|P23639 Saccharomyces
                     cerevisiae YML092C PRE8 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453523.1"
                     /db_xref="GeneID:2893404"
                     /db_xref="GOA:Q6CRB6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB6"
                     /translation="MADRYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIV
                     IATEKKSSSSLALPDTVSKVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYG
                     EYPPTKILVSEVAKIMQEATQSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWK
                     ATAIGKGSSAAKTFLEKRWNEELELEDAIHIALLTLKESVEGEFNGDTIELAIVGDIN
                     QELLGYQGEPRAKGPRFRKLTSQEITDRLDAL"
     gene            <877463..>878282
                     /locus_tag="KLLA0_D10395g"
                     /db_xref="GeneID:2893458"
     mRNA            join(<877463..877468,877605..>878282)
                     /locus_tag="KLLA0_D10395g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453524.2"
                     /db_xref="GeneID:2893458"
     CDS             join(877463..877468,877605..878282)
                     /locus_tag="KLLA0_D10395g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453524.2"
                     /db_xref="GeneID:2893458"
                     /db_xref="InterPro:IPR006735"
                     /db_xref="InterPro:IPR027799"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB5"
                     /translation="MGNDGGSIIKGVRIRVVDDASKNAAKAKKLEYYWNDLWSNCRLL
                     GTPLMPPLFSDCKGNLFNKESILEWLLVKPEYKSEEYTQVVIDAFSHIKLRKDLVELT
                     NLQELGNGTLGVSLSGTGTTTTDLVLGNRRKFGYIDTCGHVNTLSALDNGTGCYVCGT
                     SYTRLNIVVLNPTEQDDVQRLVERQSWLQNQNLLHSRKPRKRKSDGKPLLSSRKKQKL
                     TTTTTKDIK"
     gene            complement(<878575..>878769)
                     /locus_tag="KLLA0_D10417g"
                     /db_xref="GeneID:2893587"
     mRNA            complement(<878575..>878769)
                     /locus_tag="KLLA0_D10417g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453525.1"
                     /db_xref="GeneID:2893587"
     CDS             complement(878575..878769)
                     /locus_tag="KLLA0_D10417g"
                     /note="similar to uniprot|P39103 Saccharomyces cerevisiae
                     YML129C COX14 Mitochondrial membrane protein, required for
                     assembly of cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453525.1"
                     /db_xref="GeneID:2893587"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="UniProtKB/TrEMBL:F2Z611"
                     /translation="MAKYAWYTRITDAAHRLTVLTLLGGTLYMGGGLVYTLYQNGKKY
                     EEEQLLLQEQQQQKQDTSVN"
     gene            complement(<879449..>880906)
                     /locus_tag="KLLA0_D10439g"
                     /db_xref="GeneID:2892982"
     mRNA            complement(<879449..>880906)
                     /locus_tag="KLLA0_D10439g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453526.1"
                     /db_xref="GeneID:2892982"
     CDS             complement(879449..880906)
                     /locus_tag="KLLA0_D10439g"
                     /note="similar to uniprot|Q03104 Saccharomyces cerevisiae
                     YML128C MSC1 Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the endoplasmic
                     reticulum msc1 mutants are defective in directing meiotic
                     recombination events to homologous chromatids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453526.1"
                     /db_xref="GeneID:2892982"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB3"
                     /translation="MKLSSALIFCAAACQVVICNNLFENWSSQDIIQYLKDTGDSAKK
                     DADTSLEELKAYASQKWSEHAQPKPWWKVWPDERDQDNWWNFQSEPSTTESISNWLFD
                     TWSAKDLRKTLRNAGVKFDTDTSYDNLKSLAKENFDKINKKLGSSGYYSTESYFNQWD
                     DYDLKAWLDKHGVTYDKAKANKEELLSLVRKNIYKASQVYSEERLSALESLDLAKKQL
                     YDKSNKLKSDLFDSWSSDDIYDWLQSHSIQVKENAKENRDQLLDVANKNINLLEDDIK
                     WYTEASKSKASALLTKSTDSVNSVWEAFKGKLSGAYHDDNVINDTFLLGVQSWPKKRL
                     QNFLDARGVKYHLLSTKAELLKLVYENRNKPLKSWENAYDEAKHWWNKQNIVGKAKST
                     GSDILNKVSDYESTAVDSFQRSFDSMSNSDLIEYLKSYSVKPSDLNSLSKEQLVERAK
                     ENTQWFFGVPQKPWYSRAADNTLNFAKRAYAVIRP"
     gene            <882149..>883843
                     /locus_tag="KLLA0_D10461g"
                     /db_xref="GeneID:2893052"
     mRNA            <882149..>883843
                     /locus_tag="KLLA0_D10461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453527.1"
                     /db_xref="GeneID:2893052"
     CDS             882149..883843
                     /locus_tag="KLLA0_D10461g"
                     /note="similar to uniprot|Q03124 Saccharomyces cerevisiae
                     YML127W RSC9 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex DNA-binding protein
                     involved in the synthesis of rRNA and in transcriptional
                     repression and activation of genes regulated by the Target
                     of Rapamycin (TOR) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453527.1"
                     /db_xref="GeneID:2893052"
                     /db_xref="GOA:Q6CRB2"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB2"
                     /translation="MSSHSVTPVINAEGETAIPSLKTLPATQLNISRDQTNGITAKPV
                     AGLQQSLGSLPIFNHLPVNSKIGVDDLTRMKMALLSGIDEEVKFALKRYLRYSINASY
                     VIKLNENLDLLPIIMPLITACREYIPQLVGPISNQAFEALQKGSITMLLLRNLAQDSE
                     NTSILATDMELKSFILFVLEWANTFNSKDSAIYQSHTSSFNELLIYTLDLMEAISSYI
                     APAKKDDLYFQNLCLIFRDTKDRYCVISILRSLSRLLVRSKSDQKSAADNLDDSLLNK
                     IVHNLLIDRDEELIIASLDFLYQYILPGHQRIKTLLSHKERYDILVSTLPVLLTYHVS
                     TPDYHALSNTNIKLIQRVKPQPPAHAPELPMPLLKELFELNEPMRATSWLRCCFERSL
                     NGEVTQILLWKTYEQTFSEQVKLTDRKLITAVDFIKNVSNALPGASALVVVDEATSKK
                     KFVIRGIQPRRKALSIVEANKDIDQSSPIQTETPDEFESNNTPSEAVQICLPDIVFPE
                     NLSDVSKASASFLSLVSNDSTEIVAQFIHDMKPLILHQIADVPPLNTVLLDFIHSG"
     gene            complement(<884177..>887839)
                     /locus_tag="KLLA0_D10483g"
                     /db_xref="GeneID:2892768"
     mRNA            complement(<884177..>887839)
                     /locus_tag="KLLA0_D10483g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453528.1"
                     /db_xref="GeneID:2892768"
     CDS             complement(884177..887839)
                     /locus_tag="KLLA0_D10483g"
                     /note="similar to uniprot|Q02773 Saccharomyces cerevisiae
                     YML091C RPM2 Protein component of mitochondrial RNase P
                     along with the mitochondrially-encoded RNA subunit RPM1
                     Rnase P removes 5' extensions from tRNA precursors Rpm2p
                     is also involved in maturation of RPM1 and in translation
                     of mitochondrial mRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453528.1"
                     /db_xref="GeneID:2892768"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB1"
                     /translation="MHFKSLKCKFYCKGYHSSAHKSATSFFDSSYQYLKQNQGLVNLD
                     TAIPQHNILTAVPHPVVVANVNYNNVERALQSRDAELSRLESEELNLFYEKDGEIFYS
                     GEHDVNYSKKSSYGANHNKKKRSNSFTYLSNEKSALINEKLSTRYYSTKVQNSQNNAN
                     NNLRATPITPPTSPPVEKHHSLEKSGAKEQTDKGAVPEALLDRLKDVRLDDSIPAWET
                     DLEPCLNKEAFLETQSKLIEDCMKNKNYNQVNAIYKSLIRNEIVPPLSLFEQVLTSIC
                     RRDLDQNNIDNQMFELLNCYQDIIQNKLKPSAEIYHLVVGSLLSGSIRAFELHNTNGL
                     DFFKIAIDLFFASNLNKNKSFDHEFLDNLLLAINLYPGHIKYGYIKNFIDSNVKYSKN
                     EIYYISLISYAKMLNEHEAVKDLYQDFRSELLKNMQLVEHQYEVYSVVVSAFAETGSL
                     SLATKLLDKLLVDLQAKDGHNKNVSLVISNFLISVGKINSEKAYKLLMEFSKLKWVPE
                     FSYEFYLVMIANCLNTNWPLVKRIYNYIFPMKTSFNTTKNDNKIKNYLLYPSGLESMP
                     STILTYALRQKDDELIMKLVEESNVKKTTFQRGLYPYIFSYFQSIGCPEPYLLRFVNI
                     HGSALSTDSKPLVFEFLNALVENYQSQPILKKVSEMPFFKSACEAFTLENASAVNYAG
                     FIVCFQTLWKTPQLIQDYSYNLELHGIAVSRLYDLDTYYLDIQNEMLLDFKKQMAERF
                     QKLCVNYKRIHLDANKISPVAIQAMKMVDLSEDTVAYFQHPGDWDKSYPLSLGPVLRN
                     SKRTGFKQYERLSEDGYKFDYDTFSELIHQKYITSDVITKTINLCPDKETLKYISNCI
                     VVKCPKNLLEEEVIQHQLFSKILENLTDKSLSKLALNCENIRNFINAVGFPDRFKSIT
                     SQAEYKGATAVIFAALFRAKDYKSVIMFNEICPCLDISLILKSFIRLGDYDNYLSQEA
                     RFKDSMSPAALGVIRSEYLINQKKFEDAMLLLKSFPDVIDHQTYDKYSFALFLSSFSG
                     TPVDVDFQIENTLQLANVLSAQHSFHNMIHCYESMTKGKEFSQDLKLNFGIKMEITQQ
                     ILNNIEDSMQFLDLNDTSIIENYYSKLENYMRFRGYLKTITFTEDQMLQLLNIWQKIN
                     PILVDNLFNNIVESVCLNNAVKVINFNDNGSFNVSKTSLMVLLDSISAIYKSEGLSDH
                     HSKVESFKDIIDSSMH"
     gene            complement(<889601..>891515)
                     /locus_tag="KLLA0_D10505g"
                     /db_xref="GeneID:2893559"
     mRNA            complement(join(<889601..890893,891414..>891515))
                     /locus_tag="KLLA0_D10505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453529.2"
                     /db_xref="GeneID:2893559"
     CDS             complement(join(889601..890893,891414..891515))
                     /locus_tag="KLLA0_D10505g"
                     /note="highly similar to uniprot|P54839 Saccharomyces
                     cerevisiae YML126C ERG13 3-hydroxy-3-methylglutaryl-CoA
                     (HMG-CoA) synthase, catalyzes the formation of HMG-CoA
                     from acetyl-CoA and acetoacetyl-CoA; involved in the
                     second step in mevalonate biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453529.2"
                     /db_xref="GeneID:2893559"
                     /db_xref="GOA:Q6CRB0"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:Q6CRB0"
                     /translation="MTEQDLAKKQKTVDQPPRPQNVGIKGIEIYIPSQCVNQEELEKF
                     DGVSSGKYTIGLGQTNMGFVNDREDIYSMSLTVLSKLLKNYNIDTNNVGRIEVGTETL
                     LDKSKSVKSVLTQLFPGNSDTEGIDTLNACYGGTNALFNSLNWIESSAWDGRDAIVVC
                     GDIAIYEKGAARPTGGAGTVALWIGPDAPIVFDPIRGSFMEHAYDFYKPDFTSEYPYV
                     DGHFSLTCYVKALDKAYEAYSKKAIAKGLAAKPAGNSAINVTEHFDYNVFHVPTCKLV
                     TKSYGRLLYNDFRANPSLYPEIDASLASVEYETSLTDKNLEKTFVNVAKPFHKERVAP
                     SLIVPTNTGNMYTASVYASLSSLLCYVGSDALQNKRIGLFSYGSGLAASLFSCKVVGD
                     IKHIVDVLDVENKLKSRKTESPEDYEKAILLREQAHLQKSFEPTGSIENLYPGTYYLT
                     NVDDRYRRSYAIKE"
     gene            <892955..>894892
                     /locus_tag="KLLA0_D10527g"
                     /db_xref="GeneID:2893554"
     mRNA            <892955..>894892
                     /locus_tag="KLLA0_D10527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453530.1"
                     /db_xref="GeneID:2893554"
     CDS             892955..894892
                     /locus_tag="KLLA0_D10527g"
                     /note="similar to uniprot|P23293 Saccharomyces cerevisiae
                     YPR161C SGV1 CDC28/cdc2 related protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453530.1"
                     /db_xref="GeneID:2893554"
                     /db_xref="GOA:Q6CRA9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MSTVNKKPASLKYKIGKVKQIPTVVKDDKTGLEYIQVQSRENEK
                     VYGVTKFLNNYREEEKLGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQRE
                     ITILKRMNHKNIVKLIEIVYDESPTPKTDSTSPRPVGNYHGNNTANQQKLITGKHFFM
                     ILPYMVSDLTGLLHNPRVEFGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDH
                     KGVVKIADFGLARNYYGSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTA
                     VDIWGIGCVFAEFFEKKPILQGQTDIDQGHVIFKLMGTPSMDEWGLAYHLPGSELTKT
                     NYKSTLQERFSKALNETGLDLLSKLLALDPYKRVTAMKAKKHPFFFEEPLPNAQLTLP
                     NEECHESDIKRYKSEMNESMSQRPPSAPTGHTSTDNSIRAVTGAAFPKEASIPKAPRP
                     EHIKSTIPAQPSASRYNGAATQNIPKEPIPTAPLPKGPKNSIPTGPNKLPPNPRDSYA
                     SKYPAESRFGVNTRITTESYNAGKRYRNRGGWETGRDSLNYNNNYAPPADRSHHPTIQ
                     RPSAPRGGSYPNRYQNQDYNTSRNTGYNQYSQAGDRRSYRPGASENPGTIGHGSSQST
                     QKDSKSSHSNNVKPKDVADYY"
     gene            <896011..>898158
                     /locus_tag="KLLA0_D10549g"
                     /db_xref="GeneID:2893549"
     mRNA            <896011..>898158
                     /locus_tag="KLLA0_D10549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453531.1"
                     /db_xref="GeneID:2893549"
     CDS             896011..898158
                     /locus_tag="KLLA0_D10549g"
                     /note="similar to uniprot|P11972 Saccharomyces cerevisiae
                     YLR452C SST2 Protein involved in desensitization to
                     alpha-factor pheromone member of the RGS (regulator of
                     G-protein signalling) family GTPase-activating protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453531.1"
                     /db_xref="GeneID:2893549"
                     /db_xref="GOA:Q6CRA8"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA8"
                     /translation="MVSESNKKEKTLHELFSNSFDRSPDGSILTHELKTVFSIMIICL
                     PLEEKPRSSSNRLLNFAKKSFPFTFSITEAIDLLQELELNVEMNSTSIYISYSIKPEL
                     GYQLLNTFMKAKLLHTPADKTRSRPKENILLQPTPKGVAVTCDYARKFALKELPPILT
                     SNFNTMNLFKFERNTLDDSVIQSEYFINLLFNKVMGPKPNIWSPKNPTDKIPKLSDLL
                     DQRSSDVFSFENVSPDFAVNELGENPKNNVSGNSQSQHTENNLHSLNSRQLEDEDRES
                     PFAYRFFSNPDSDSHIQYYVSDCGLRLFGNKTFGKGMFIDYCFTTKALWQWLMECTDI
                     MYPKECVAVAALFLKYGLITPILLPPSQNSKKKFLISKTAHYTLTQAGWDVIQWGVDG
                     LPKIPHFMDGVKIGTDTENYGGVNCSVKLSSRSLPGNSQLKSGHDFGTKNVMVSNYDV
                     SSDSSSSSGTGDDNYNPDGLKLLSLKQILADPGMRYLFREHLCKDMCAENLDVYFEIT
                     KFLKRMSVLRKLIESRNQSEHNKMDLREWKTGGSTKLKDTIQSALLKQTSECLSLVYH
                     IYSSYIALGSPYQLNIDHNVRETITGIIFHPQSPTKTAFDTSGKENCSRAISDASVNR
                     PLSLDPAARKKCVEHKVQSHSNTSMPLAPTPLNKGTESYVIIHAISMLKDLYQLLEKI
                     RNTVFIMMKNDSLPKFLATESYRDAISLITANK"
     gene            complement(<898296..>899858)
                     /locus_tag="KLLA0_D10571g"
                     /db_xref="GeneID:2892809"
     mRNA            complement(<898296..>899858)
                     /locus_tag="KLLA0_D10571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453532.1"
                     /db_xref="GeneID:2892809"
     CDS             complement(898296..899858)
                     /locus_tag="KLLA0_D10571g"
                     /note="highly similar to uniprot|P32481 Saccharomyces
                     cerevisiae YER025W GCD11 Gamma subunit of the translation
                     initiation factor eIF2 involved in the identification of
                     the start codon binds GTP when forming the ternary complex
                     with GTP and tRNAi-Met"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453532.1"
                     /db_xref="GeneID:2892809"
                     /db_xref="GOA:Q6CRA7"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA7"
                     /translation="MSDLQNQEPSIVINGDLNDEPIDTFEVEEEEQVFDEVKPKKTVT
                     FSGIDDVEADEERRKREFEEGGGLPEQPTNPDFSKLNPLSPEIINRQATINIGTIGHV
                     AHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKAEDPECPEPDCYKSFRSD
                     KEVAPKVDLPGYSGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCP
                     QPQTSEHLAAIEIMKLKHVIILQNKVDLMREDSALEHQKSILKFIRGTIADGAPIVPI
                     SAQLKYNIDAVNEFIVKSIPVPQRDFLASPRLIVIRSFDVNKPGAEIEDLKGGVAGGS
                     ILTGVFKLGDEIEIRPGIVTKDDHGKIQCKPIFSNIVSLFAEHNDLKFAVPGGLIGVG
                     TKVDPTLCRADRLVGQVVGAKGHLPSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLE
                     PNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEVNEKIALSRRIEKHWRLIGWA
                     TIKKGTTLEPIA"
     gene            complement(<900326..>903103)
                     /locus_tag="KLLA0_D10593g"
                     /db_xref="GeneID:2892795"
     mRNA            complement(<900326..>903103)
                     /locus_tag="KLLA0_D10593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453533.1"
                     /db_xref="GeneID:2892795"
     CDS             complement(900326..903103)
                     /locus_tag="KLLA0_D10593g"
                     /note="similar to uniprot|P08638 Saccharomyces cerevisiae
                     YLR451W LEU3 Zinc-finger transcription factor that
                     regulates genes involved in branched chain amino acid
                     biosynthesis and ammonia assimilation positively regulated
                     by alpha-isopropylmalate an intermediate in leucine
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453533.1"
                     /db_xref="GeneID:2892795"
                     /db_xref="GOA:Q6CRA6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA6"
                     /translation="MSERGYEGIDPPKSLNFGDMSGVSSASSTPVSVKLCNDKKMPQK
                     KKLACVECRQQKSKCDAHERAPEPCSRCLKKGVPCVLQKDFRRTCKRARNEVIAKKFQ
                     ELTQSLSNLGSEELLKKLDAETLRLPEDLGLIKVETSTGAEAPWDQNSIGTGSRSNST
                     GGQEIALRTVLSTNDFVSIAVSSNTTGSGTKLDGPITLTKQQLECQPKTLGDVTLSSS
                     DIANFFSEFTTKYHPFLPVVDVTKGPERIYSLSPCLFWVIILVGLRRKFEAIEMMNKL
                     SNMVKSILAEITISPIIRYTPMESDEPVLNVSSVYSVQAFLIYTYWPPLTSSLSADTS
                     WNTIGSAMFQALRVGLNSAQFSTEYASANSQLIHEQIRTWICCNIVSQTISASFGFPA
                     YVSFDHTVINTCKISTVESSTTDFIPFSIKQMLQIAHFENQIVDTMNSNPSNMSGLVA
                     NEEKLPLLHVLNRQLSELELQLDNVKLDDIRRFLLLVTKVHLLTHYFSNVTDNVDPTS
                     VQKISVKDMETSFATKRGLVIAYNAAVKLLKHAKCMWKRDPLAVKYLPGVYVLNIWQA
                     ASIISKLVHSSLGSIIDVDTGHEVYQDAVSLISNASVLKYDMAYRSAGIMRSIWSMFS
                     NMFEEWKAKKDQSSSSTQSEKDFNLSITIRSRMSVSVFFDCLFILRQKCGMAKLKRER
                     EKTVSSDDENSGDNHNGDAESKELLPNDGYSEEHARRIISTIPLDPEPINAQQSSGSN
                     ITSPNGSHSSDVLSLKSILNKTSPKDEILQKQKNGTMPSSSSPSNNIIVSPTNTHAGA
                     SNVETSGYPRSLNPLNAVTDNKLINHSTTAKKTNSPQFRVSSPSNHSKPTRKINPAAQ
                     SLNELLEPPIPQSFQSVTKSIISEGTENRKEDTPSISPGLTERWDNWESDLVWKDVDI
                     LMNEFAFNPTL"
     gene            <903967..>905322
                     /locus_tag="KLLA0_D10615g"
                     /db_xref="GeneID:2892729"
     mRNA            <903967..>905322
                     /locus_tag="KLLA0_D10615g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453534.1"
                     /db_xref="GeneID:2892729"
     CDS             903967..905322
                     /locus_tag="KLLA0_D10615g"
                     /note="similar to uniprot|P47159 Saccharomyces cerevisiae
                     YJR124C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453534.1"
                     /db_xref="GeneID:2892729"
                     /db_xref="GOA:Q6CRA5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA5"
                     /translation="MQVRKVWREAPRDVKLLWWAVFLRMLAYGMTNQILTLFFSEIGI
                     SDDEMGWFMSLTLVGDVCISYVLTWYADSWGRRLVLTYGSAMMALSGIVFATSENIKV
                     LLAFAIIGVISPSSDEVGPFKSIEESMIAHLTPHNKRPEVYSMHSILGTLGSALGFLI
                     CGIVTDLLITFKVFQTKRACYKAIFGIYAVLAAAKVIISISLSSESEKDGDFDTDRII
                     SGSSAQGDSDTVPEEDTEVVAEDTPLIVKSIKKKPLSKKTLSLVFRLLLIFMTDSLGA
                     GFMTSSWMVYYYKKVFDMSNTSLGFLFFSSKYVMAASAIPSAIVARLYGPVRATLLVQ
                     IPSGIFSILIPFAESHLSLSIILLLLFFFTMAMDVTPRQIILTNTIPSKDLTKVMGMV
                     NIGKTVARCIGPVFTGKLASEGYLWVCYVISGSLVILADMFLALLFCDIDEQILAKTN
                     S"
     gene            complement(<905660..>908257)
                     /locus_tag="KLLA0_D10637g"
                     /db_xref="GeneID:2893564"
     mRNA            complement(<905660..>908257)
                     /locus_tag="KLLA0_D10637g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453535.1"
                     /db_xref="GeneID:2893564"
     CDS             complement(905660..908257)
                     /locus_tag="KLLA0_D10637g"
                     /note="similar to uniprot|P40017 YER024W Saccharomyces
                     cerevisiae YAT2 Carnitine acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453535.1"
                     /db_xref="GeneID:2893564"
                     /db_xref="GOA:Q6CRA4"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA4"
                     /translation="MTMSTFINEKNLPKLPLPDLQKTLEEMEDSLKPLYYADGYYKHP
                     LHPEESSELHENIEKFLHSNAAVKLQEKLKMFDRFNGCYLDKLHLDINNHTSTKEIQD
                     DVLPRNPFLILAEDATSDISQAVRSGVLCSSALRFVSALRQNHLPPDCGSDGKPMSML
                     PYTNLFGTTRCPVFEHGEVESFDLNRPYDESDLEAELNNLSAQRRPSTASSEASNQPS
                     ANSDDDLEFFNVHGITKKQYPDSKHIMIISKGQYYTLEVLDENDNALFTDSQLSRVFQ
                     HIIDDSTTSYSLKRATALGSLTSYSFKNWKYARKRLQKRYPQELNVIDSALFIVVLDE
                     STSTSDINEDCKRLYYGTSIVDDVTGFQVGSCTSRWYDKLQLVVTADSKAAVIWDSFT
                     CDGSVVLRFTSDIYAESILRLAREVHAGDPHFSLWPQVPKASSKDAWTEKFSKITWSF
                     SHILNTHVHLSETKLTDLISKHDIVHTTIPFGRRTAQKLGVRADSLIQIALQIAHYAL
                     YGKMVFSFEPVSTRFFQNSRSTFIPIQTQELLELCQLFISNSLNETGKLEKFITACND
                     HSERIQKAQRGTGFEKHFNAIKYLFKFHDHFDIGLSPEEFEISSKVFNDAMLEPFSAP
                     ELIASNCGNSAMTAFGVTPAVPQGFGIGYIIKNEQCDITLTSQYRQGRRLAFMLKWVL
                     TEINNYWELSSVKSVKISPKVDQLYEIDNAINQLKFNSLSTKPEIAKSPVQFAERPNL
                     GSYQQSSSSSIFNGGHGFLELKGHLESRASSRPISRSGSNLKLSAMNTTNSLQPTLSN
                     GLEDALTSTISITSEVLKQNAGHEILKIDASNIGETQPQVQKKNVVSSKFEINFDRSS
                     VGRKVNTRG"
     gene            complement(<909562..>910245)
                     /locus_tag="KLLA0_D10659g"
                     /db_xref="GeneID:2892700"
     mRNA            complement(<909562..>910245)
                     /locus_tag="KLLA0_D10659g"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_453536.1"
                     /db_xref="GeneID:2892700"
     CDS             complement(909562..910245)
                     /locus_tag="KLLA0_D10659g"
                     /note="highly similar to uniprot|P26783 Saccharomyces
                     cerevisiae YJR123W"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_453536.1"
                     /db_xref="GeneID:2892700"
                     /db_xref="GOA:Q6CRA3"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q6CRA3"
                     /translation="MSEHEAQVEVEVQEDFEVVQEFVPVELATTIPVEIQQAQQEIKL
                     FNKWSFEDVEVKDASLVDYIQISKPIYVAHTAGRYANKRFRKAQCPIVERLTNSLMMN
                     GRNNGKKLKAVRIVKHTLEIINVLTDQNPLQVVVDAIINSGPREDTTRVGGGGAARRQ
                     AVDVSPLRRVNQSIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDE
                     LERVAKSNR"
     gene            complement(<911076..>912464)
                     /locus_tag="KLLA0_D10681g"
                     /db_xref="GeneID:2892929"
     mRNA            complement(<911076..>912464)
                     /locus_tag="KLLA0_D10681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453537.1"
                     /db_xref="GeneID:2892929"
     CDS             complement(911076..912464)
                     /locus_tag="KLLA0_D10681g"
                     /note="similar to uniprot|P47158 Saccharomyces cerevisiae
                     YJR122W CAF17 Mitochondrial protein that interacts with
                     Ccr4p in the two-hybrid system 3'-untranslated region
                     contains a putative mRNA localization element common to
                     genes encoding mitochondrial proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453537.1"
                     /db_xref="GeneID:2892929"
                     /db_xref="GOA:Q6CRA2"
                     /db_xref="InterPro:IPR017703"
                     /translation="MRSFLRYFSSVKEATQFRFESCRVENKSYIRLLGPDSIKFLNGL
                     VTSKLQPNFVKKNLTTISTKEQEKNNTLSSLNFSKYNWGIYKECTRLEDHISRFGTYT
                     GFLNMKGKLLTDSIIYPYPFTLKSIQDKKFPEYLMEFDSHIAQKMERTLDNHKLLSKV
                     KFKHVQNEELRTWDAYITMPEEYQLLENLLNPMQEMKDGEQALHFANFFASMFFQGNE
                     HKLKAVYFDTRLIDDMYEGKIKPMFRIVTDNSVSDINDIFNCTAFGENPFEKANISAT
                     EIQKERFKFGLFDGNHEYIPETLLALEANFDYFEDSINSDKGCYVGQELTARTFATGV
                     LKKRCVGITIDEPQKLADWDHSKYLSIFSKLELQVQNQDTQAAINPFGSLSKPVKKRT
                     RPAGQLINYNGNIGVAVVRKDYIYHALKHHHDIDAYVELPNKETVACSIKLEWLDRFL
                     EETEAEEVEQEQ"
     gene            complement(<913356..>914873)
                     /locus_tag="KLLA0_D10703g"
                     /db_xref="GeneID:2893294"
     mRNA            complement(<913356..>914873)
                     /locus_tag="KLLA0_D10703g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453538.1"
                     /db_xref="GeneID:2893294"
     CDS             complement(913356..914873)
                     /locus_tag="KLLA0_D10703g"
                     /note="highly similar to uniprot|P00830 Saccharomyces
                     cerevisiae YJR121W ATP2 Beta subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453538.1"
                     /db_xref="GeneID:2893294"
                     /db_xref="GOA:P49376"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVLPRFYAASSRAALQAARRAVPFTGVRGYAAAASSQGKVRAVI
                     GAIVDVQFEQGQLPAILNALEIDTPEGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEN
                     VSDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKMRKPIHADPPLFVEQSTAAEV
                     LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERT
                     REGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQ
                     DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSV
                     QAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQ
                     EHYDVATQVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEV
                     FTGIPGRLVRLKDTISSFKAVLDGKYDHLPENAFYMVGGIEDVVAKAEKLAAEAN"
     gene            complement(<915650..>916507)
                     /locus_tag="KLLA0_D10736g"
                     /db_xref="GeneID:2892904"
     mRNA            complement(<915650..>916507)
                     /locus_tag="KLLA0_D10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453540.1"
                     /db_xref="GeneID:2892904"
     CDS             complement(915650..916507)
                     /locus_tag="KLLA0_D10736g"
                     /note="highly similar to uniprot|P32263 Saccharomyces
                     cerevisiae YER023W PRO3 Delta 1-pyrroline-5-carboxylate
                     reductase catalyzes the last step in proline biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453540.1"
                     /db_xref="GeneID:2892904"
                     /db_xref="GOA:Q6CR99"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:Q6CR99"
                     /translation="MSRYTLAIVGCGVMGQALLSAIYNAPKASDEALQYYPSKIIACN
                     DVPASAELVEKLVSGFETSPNGIEVEIATNDNERAVAEAKVIILGLKPHIVEPVLQQI
                     PNEDGSKLLISLAAGVTLNQLSQYYKKVSRVMTNTPAKYGYGTAIVSHSTSVEPQDKA
                     IVSELVSQVGKCLELPEKNMDAATALVGSGPAFVLLMLESMMEAGLKMGIPLKESREC
                     AMKVLEGTAKMVEISGQSPGVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGIEEAAR
                     VSKELGQKK"
     gene            <917125..>919677
                     /locus_tag="KLLA0_D10758g"
                     /db_xref="GeneID:2892974"
     mRNA            <917125..>919677
                     /locus_tag="KLLA0_D10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453541.1"
                     /db_xref="GeneID:2892974"
     CDS             917125..919677
                     /locus_tag="KLLA0_D10758g"
                     /note="similar to uniprot|P47156 Saccharomyces cerevisiae
                     YJR119C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453541.1"
                     /db_xref="GeneID:2892974"
                     /db_xref="GOA:Q6CR98"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6CR98"
                     /translation="MQEIPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPESF
                     KPAFSIDEEQFSFRCRLQVLMELDIENRSRLLFWKQLNNLKRSKGDSKLLSSPQVILG
                     HGQILPVYYYDVYKAVIGYFDPKKGKRTGDDSFSFKLSSTSRKRQRDGSYVSEAQYKL
                     VDPKIVMEHKSCWQEVSLKFPQLDAATTKKIFKLHILPYYRFLYNEMMKTRSTKHSSS
                     LRNSVSGLLYNYDYPKSLLEMYDSTEESNQSRDHSHSGNEHDIFSDDLPESLRYDEEV
                     DDFNIEDEDEDEKCPICVKHVPTKVTSSSVAIVTCNSCDFKFHKKCLGKSTPNLGSNG
                     QEWICNTCIIGNGYYGFKEPSSLYTLKSFKEHCANFDDQQFAGNKPNDIETLEKLFWE
                     HVQEMVPNPITVKYGADIHRNKPGQTTGFPTMGYVPPFITDKESDEFKQFLKVSSHPW
                     NLINLPRARGSLLSIINRKISGMTIPWIYVGSTFSTFCWHLEDQYTLSANYQHIGSQK
                     IWYSIPERSTSAFDEMMKNISPDLFERQPDLLHQLITLVSPYSKRFVEAGIDCYKAIQ
                     NPGEYIVTYPKCYHAGFNSGFNFNEAVNFTLDLWLPYGLQSINDYKETKRTAVVNLFD
                     LMSNVLNAYLIKPETFDDSFVATCVRELKEWFNTDFKNMMKVKNIVGETIFSTGCEDA
                     YTNSSLDQEGGSDSIKDSNQDPGRSVSNKKKFDEDEDDEDEDDDDDDDDIDVFCSKCK
                     TICPVAFIVHNNSKRFRSKRRNLASATPDEWNQLSNDGNISIFCLEEYLKYVDEKDAE
                     NDDDNDDAGQSINSDDPSEDDFKNDVMVYIREPDEVRNLISRVERALDRRLR"
     gene            <920068..>920595
                     /locus_tag="KLLA0_D10780g"
                     /db_xref="GeneID:2892984"
     mRNA            <920068..>920595
                     /locus_tag="KLLA0_D10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453542.1"
                     /db_xref="GeneID:2892984"
     CDS             920068..920595
                     /locus_tag="KLLA0_D10780g"
                     /note="similar to uniprot|P47155 Saccharomyces cerevisiae
                     YJR118C ILM1 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453542.1"
                     /db_xref="GeneID:2892984"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:Q6CR97"
                     /translation="MGLLSSVNVTYFRIVFLLGLAYLSVTDVNAILGNSLVLVLTQAM
                     DLPALQIPQQSAQLGLFSLLLGLSAVHDLLPLLENNKKHFQAVVPFRLMIFFVLTALS
                     VFMNNNLYLHNNAIFVYGFCEVWMNFLIFVALRDERNDDFATGNGFYRPMDVIDEDPF
                     PSTERDIQEMEDDEN"
     gene            complement(<920627..>922642)
                     /locus_tag="KLLA0_D10802g"
                     /db_xref="GeneID:2893583"
     mRNA            complement(<920627..>922642)
                     /locus_tag="KLLA0_D10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453543.1"
                     /db_xref="GeneID:2893583"
     CDS             complement(920627..922642)
                     /locus_tag="KLLA0_D10802g"
                     /note="similar to uniprot|P32569 Saccharomyces cerevisiae
                     YER022W SRB4 subunit of RNA polymerase II
                     holoenzyme/mediator complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453543.1"
                     /db_xref="GeneID:2893583"
                     /db_xref="GOA:Q6CR96"
                     /db_xref="InterPro:IPR019313"
                     /translation="MDGFSEYDPEKGIPLAIDPNLISIPVSTSLTTNGNGDEGVNNED
                     ATVFAADDADNAKSQKSLIQNPYEYFGQMPLEQFIPLMLQQRGTGTKFADIHEETLLE
                     EISRENSSKSNNAIQEEDNDDSAIQNVDEKTTTVVNEGVSDSHEMKDEDGDVNMDVPS
                     VESSPKLAEEREPTADANDAQRAISGNQEESITLEEFKMIKKNVLEHVNMALNESSLS
                     LEFVSLLLSSTRTSAGISSMSPYLKKIAPPASLNADKVPLDILDEHEKLTYDIIHKGW
                     NLRSLEDCKRLLKQHYQILSKSVESEYHYWKQISDNITNKDVLFKMKDKNTGRRTLGI
                     KYGFDDSGSCYSADKGIALLRATSEGSQLELVPIIDSGINVGISRGSSEQFVRVRIFT
                     KIEQEDDYLLSGQSSLNELLLSSRSDIKSQIAKLRFFIFEKELMHQLKKEAGQLLPYG
                     VSVENENKVLLELSNEKIEFELINLDEEVTSNYQQEAAKVNDKRANLILVMLNMLLVV
                     MYKKQLWKRLNPNPHSSKSSKGYGKDLVLLRAILGKIRHKKYTQLIEKIVNNAILEKK
                     EDSIMTTNTDITSNDNEPSKNKELATLQREIALFDKILSMPRTDFTINIPEKGKLELS
                     LRSTNHCNAIIHMKYIDVGQVVKFDTRFSEFTEFEEFLNFVYNEFLI"
     gene            complement(<922978..>924498)
                     /locus_tag="KLLA0_D10824g"
                     /db_xref="GeneID:2893067"
     mRNA            complement(<922978..>924498)
                     /locus_tag="KLLA0_D10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453544.1"
                     /db_xref="GeneID:2893067"
     CDS             complement(922978..924498)
                     /locus_tag="KLLA0_D10824g"
                     /note="similar to uniprot|P40016 Saccharomyces cerevisiae
                     YER021W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453544.1"
                     /db_xref="GeneID:2893067"
                     /db_xref="GOA:Q6CR95"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:Q6CR95"
                     /translation="MSSDAMDIDSVPEAAVDNNSNEDAVVDKLLEILKQVSKSTLSMD
                     SRYVWKSLRDFAALRHDVTVENTSILVNLVYPDDSSYKKYLLKTIHPTSRPKVENAVK
                     FREEYPASLYQLQQDGTSLDVSSEVNSFVHYIVQSLLLDSNRIDELQQFNKTHVIPQV
                     LKQYNNRNLDLINAKIWFYINRANELTSTPNDSSLLAEMMQYLKSATLKHDNETKATL
                     ITSILRQYLRLGEIELAADFVSKVEFPSGDNVSSPLEARYYFYLSKIHAIQLDYSQSH
                     EYVISALRKAPHTKNSLGFLQQANKLQCCIQLLMGDIPELTFFHQKGLEKSLLPYYHI
                     TKAVKLGDLNLFTQSLSKYKKELVQDSNYQLCVRLRSNVIKTGIRMISLTYKKISLKD
                     ICLKLHLDSEQTVEYMISRAIRDGVIEAKINHEEGYIETSELLNVYSTKQPQQVFDER
                     IRFVNHLHSDYVTGMRFPDSREEDNSKKLSDESLETTMDLNSMNLSDFDSDLDDVI"
     gene            complement(<925012..>926382)
                     /locus_tag="KLLA0_D10846g"
                     /db_xref="GeneID:2893119"
     mRNA            complement(<925012..>926382)
                     /locus_tag="KLLA0_D10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453545.1"
                     /db_xref="GeneID:2893119"
     CDS             complement(925012..926382)
                     /locus_tag="KLLA0_D10846g"
                     /note="highly similar to uniprot|P47154 Saccharomyces
                     cerevisiae YJR117W STE24 Highly conserved zinc
                     metalloprotease that functions in two steps of a-factor
                     maturation C-terminal CAAX proteolysis and the first step
                     of N-terminal proteolytic processing contains multiple
                     transmembrane spans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453545.1"
                     /db_xref="GeneID:2893119"
                     /db_xref="GOA:Q6CR94"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:Q6CR94"
                     /translation="MMGIVDILQDILDSSSIPWKTIITGFTVAQFGFETYLTYRQYLA
                     LSNKNLPPVLVGEIDDETFQKSEAYSRAKSKFSIVSNVINLAQNLIFIKFDILPKLWH
                     LGNSFAQYFPSRFFPTSTIAQSLYFLTVMSNLSALMGLPLSYYQHFVLEEKFGFNKLT
                     IKLWISDMIKSSLLGAVIGTPVLYLFLKIFEKFPSNFLWYICLFILVVQILALTIIPV
                     FIMPLFNKFTPLEDGELKTEIENLAKKVGFPLDKIFIVDGSKRSSHSNAYFTGLPFTS
                     KRIVLYDTLVNDSTTDEIVAVLAHEIGHWQKSHLLRMLAFSETHIFLVFSLFTAAYQN
                     KSLYNAFGFFAGSGSSSDISKVITPQYPIIIGFLLFNDLLQPLDCLSTFLTNLVSRAH
                     EYQSDAYAKELGYAPHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYK
                     NEKKDQ"
     gene            complement(<926978..>927829)
                     /locus_tag="KLLA0_D10868g"
                     /db_xref="GeneID:2893171"
     mRNA            complement(<926978..>927829)
                     /locus_tag="KLLA0_D10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453546.1"
                     /db_xref="GeneID:2893171"
     CDS             complement(926978..927829)
                     /locus_tag="KLLA0_D10868g"
                     /note="similar to uniprot|P47153 Saccharomyces cerevisiae
                     YJR116W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453546.1"
                     /db_xref="GeneID:2893171"
                     /db_xref="GOA:Q6CR93"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:Q6CR93"
                     /translation="MLEKLSSYFTGPELSDPLLSWSFDPSSENLYYRHLHEALISFVV
                     YQFILYPFVVPKLNEWFFKEHYTERDEPDKINFDIHTVSMIQSVVSLYLIWPLLWIPF
                     GFNVATYYNSYASMVSAVSIGYFMWDLYICLRYFKLFGIGFLFHAVAAFAVLTITLHP
                     VCQAWIGRFLSFEASTPFVNINWYIIQLSRGSSKQVVPTWFNVLNGFLLISVFFFVRL
                     VWGFVAVAILIYEMWQVWDQIPLYMTAVILGINVSLDFLNIHWFSKMLKIAKKMANGS
                     KRVSKID"
     gene            <928435..>929733
                     /locus_tag="KLLA0_D10890g"
                     /db_xref="GeneID:2893214"
     mRNA            <928435..>929733
                     /locus_tag="KLLA0_D10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453547.1"
                     /db_xref="GeneID:2893214"
     CDS             928435..929733
                     /locus_tag="KLLA0_D10890g"
                     /note="similar to uniprot|P47143 Saccharomyces cerevisiae
                     YJR105W ADO1 adenosine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453547.1"
                     /db_xref="GeneID:2893214"
                     /db_xref="GOA:Q6CR92"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6CR92"
                     /translation="MSALVRHSPLIGLGFLQSTVYPKKVTCYFSTCMWKCHSSIGKVI
                     GIRTTSMRTTVPTRRICSSGRLLLQFGSRARQKQEDLDYQQAILRRNMAQHPKVICLG
                     NPLLDIQVDVTESYLAKYGLKSNDAILVEAGSGDAKLNIFDEIVEMEDVKFVAGGAAQ
                     NTARGIAYVLGKDQVGYFGSVGEDKFSARLLKENDAAGVISLYQVQKDISTGKCAALI
                     TGHDRSLVTDLAAANHFTPDHLDKHWDLVESASLFYIGGFHLTVSPEAIVKLGKHAQE
                     NNKPFILNLSAPFIPAFFKSALEQVLPYTTYVIANESEAAAYAESFGVEADKEDLAAI
                     AKHIVGDSKTRTVIFTHGLEPTVSVSAEGTNTYDVVPLDPSKIVDTNGAGDAFAGGFV
                     AGLAQGKSLETAIAQGQWLAALSIQEVGPSYPAEKKQFQA"
     gene            <930173..>932089
                     /locus_tag="KLLA0_D10912g"
                     /db_xref="GeneID:2893461"
     mRNA            <930173..>932089
                     /locus_tag="KLLA0_D10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453548.1"
                     /db_xref="GeneID:2893461"
     CDS             930173..932089
                     /locus_tag="KLLA0_D10912g"
                     /note="similar to uniprot|Q75D63 Ashbya gossypii ABR160C
                     ABR160Cp and weakly similar to YJR106W uniprot|P47144
                     Saccharomyces cerevisiae YJR106W ECM27 Non-essential
                     protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453548.1"
                     /db_xref="GeneID:2893461"
                     /db_xref="GOA:Q6CR91"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:Q6CR91"
                     /translation="MNSEPGLWLRLTHPLHLYDGVEKLTIPFMAGTITQLTLCFVLLG
                     ICASDHLCPNVAYLTKSGNTSKGVIASILLAWCNSSPDLFSNLISWLNSESPATLSLG
                     EVLGSCGIIICIIQGLLFYCMKEQLDLTIVQRNSLVTDLLFALLAMTCVLWIVVANSV
                     TWYASFIMVAIYVMYVVSKMKLHDSLQGTDDSNKDNIIVGSGRLENGFTMDGSIRPSL
                     LETMDLNIVIQMLENANNNTETISMNTVRPNTFIGLQSGHSKNNNRPITEPNQRLDFI
                     SITGHERAPISTAPSQNPFKPFFDDVESVAEIPDTSPEPPLTYHDTITNSTLRMMNSM
                     LYTLFPNLKNWSLKTLQSKIISVILSPMVMMLRLCVPQYSEETRFNFLIILLQAILAP
                     TVGMLVIESLIDGSVSLWFWFIPGTLVILFLAGLFYLRFKRLLFFGTSLYSDSNSQNE
                     SNELVIKVSNSIGIINSILCISLLANVLIEIIELYQKLTGISKSLLGITLFAWGNSIS
                     DLMSNLAMSQLYHKLPIADSQKSAVATRFLSISLSACVGGMLLNTTIGIGLSSLIAMI
                     FRFRTSAVPVSSSINIQFLLSISIISFTIFASIFALTRHLDLIQQNVKKVGLALCSTW
                     LVATFINIFIEVFQ"
     gene            <932344..>933474
                     /locus_tag="KLLA0_D10934g"
                     /db_xref="GeneID:2893393"
     mRNA            <932344..>933474
                     /locus_tag="KLLA0_D10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453549.1"
                     /db_xref="GeneID:2893393"
     CDS             932344..933474
                     /locus_tag="KLLA0_D10934g"
                     /note="similar to uniprot|P47145 Saccharomyces cerevisiae
                     YJR107W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453549.1"
                     /db_xref="GeneID:2893393"
                     /db_xref="GOA:Q6CR90"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CR90"
                     /translation="MRFFYWFSTVLVTACSLIVDAVADNGHVDASVRVELTNNKIAAE
                     DDNSKLEGVYISKDSYEKMVYFSKICALTYCISTGRLEMDKTFFDGGCPADLDFCSNE
                     ELNPSIRRTRVELILEADEQELGTGYVAVDHEREVVMLAFRGSSTRQDWFSDFEIYPT
                     QYKPISTKEYKKLVERGEISACHNCMIHKGFYRFIETLSKDFLQRVERIFKRYPDYNL
                     VVTGHSLGAALASICGIELKLRGYNPLILTYATPKIFNEEMKQWVNDLFDTKAIHDEC
                     VETGEVNMLHGYFRVIHLQDYIPMVPPGYKAAGLEIFITKPELPHEIHDLEYRAVGSG
                     ATWKKVPMNKDSKYALMSGIGHWLHMDEHRKYFILINSCSGF"
     gene            complement(<934074..>935738)
                     /locus_tag="KLLA0_D10956g"
                     /db_xref="GeneID:2893290"
     mRNA            complement(<934074..>935738)
                     /locus_tag="KLLA0_D10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453550.1"
                     /db_xref="GeneID:2893290"
     CDS             complement(934074..935738)
                     /locus_tag="KLLA0_D10956g"
                     /note="uniprot|P54111 Kluyveromyces lactis GPA2 Guanine
                     nucleotide-binding protein alpha-2 subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453550.1"
                     /db_xref="GeneID:2893290"
                     /db_xref="GOA:P54111"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGLCASKDSRESTHDGGPRVNRPGANDANRRNDVRKGAGDKKQD
                     KKNKKAKGSIVNAASNINNSSSGKTKISTVSEDGTVSNGVGNTAEYDNANNKNNGNNN
                     NSNNNDNNNNNNNNIGNNINGNNNNDSENIHDSNNSNIENKRYFNNINTGVLNGVNGN
                     STNSDKALSNQFDQSNNSETHSGTMTGISQALALNDSGVNGFDTDLAKRNGTVNASGG
                     QSPGGSETVNALKVLLLGSGESGKSTVLQQLKILHQNGFSREELLEYKPFIFDNIIET
                     GKDLAKARRTFNVQLEEDAEISESDLDELLSQQYQPTKLPCLPADLAKTLKILWNLQS
                     TQDLLVSEHRSSFYLMDSASYFYENLDRISEPKYIPTITDVIRTRKKTSGIFDTMIDL
                     DKNLKLHFFDVGGQRSERKKWIHCFDNVTLIIFCVSLSEYDQTLLEDNSQNRLEESLI
                     LFDSVVNSRWFARSSVVLFLNKIDIFAEKLRHVPLEKYFPDYTGGKDINKAAKYILWR
                     FVQLNRANLNIYPHVTQATDTSNIKLVFAAIKETILENSLKDSGVL"
     gene            <936863..>937675
                     /locus_tag="KLLA0_D10978g"
                     /db_xref="GeneID:2893047"
     mRNA            <936863..>937675
                     /locus_tag="KLLA0_D10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453551.1"
                     /db_xref="GeneID:2893047"
     CDS             936863..937675
                     /locus_tag="KLLA0_D10978g"
                     /note="similar to uniprot|P53899 Saccharomyces cerevisiae
                     YNL155W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453551.1"
                     /db_xref="GeneID:2893047"
                     /db_xref="GOA:Q6CR88"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q6CR88"
                     /translation="MTKEVGMLDVGTHCSFCRQTDFLPFHCSACNGDFCANHRLKEDH
                     HCESLKIGKNSRSSVTVSIPAAAAAAVTPKKDNGGSFFQSLLPARAPDRIKTMMQEDN
                     SKPPVDNLKSKLFNSKTSSSRVAIDKLRHFFAKNGKLFESKKSTTKFSSANKLIQVTK
                     MKRTAKGDDSIPVANRIYAWCYVVADSSDKKPIANEVFINKMWPIGRALDSLASVLNV
                     KNSNIDHSISTDEKLFLYKGDASTQHLLPSSARVNATIQEGDTLYLVRGLGR"
     gene            <938541..>939620
                     /locus_tag="KLLA0_D11000g"
                     /db_xref="GeneID:2892949"
     mRNA            <938541..>939620
                     /locus_tag="KLLA0_D11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453552.1"
                     /db_xref="GeneID:2892949"
     CDS             938541..939620
                     /locus_tag="KLLA0_D11000g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|P53111 Saccharomyces
                     cerevisiae YGL157W and similar to uniprot|Q12068
                     Saccharomyces cerevisiae YOL151W and similar to
                     uniprot|Q03049 Saccharomyces cerevisiae YDR541C
                     NADPH-dependent Oxidoreductases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453552.1"
                     /db_xref="GeneID:2892949"
                     /db_xref="GOA:Q6CR87"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CR87"
                     /translation="MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKK
                     ELAKEHPNGKYQFEVVVDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYL
                     IPATHGTKSVLESIQKYGKNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEE
                     ARENSVTAYIASKKYAEKLAWDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLAKSSLNT
                     SADIVNQALKTTPEYEGPFNQPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGY
                     GIEEYEKGKFNFEKILRILNEKLPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTK
                     LTFYKFEDTVYDATKQILDYEASQK"
     gene            <940600..>941679
                     /locus_tag="KLLA0_D11022g"
                     /db_xref="GeneID:2893315"
     mRNA            <940600..>941679
                     /locus_tag="KLLA0_D11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453553.1"
                     /db_xref="GeneID:2893315"
     CDS             940600..941679
                     /locus_tag="KLLA0_D11022g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|P53111 Saccharomyces
                     cerevisiae YGL157W and similar to uniprot|Q12068
                     Saccharomyces cerevisiae YOL151W and similar to
                     uniprot|Q03049 Saccharomyces cerevisiae YDR541C
                     NADPH-dependent Oxidoreductases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453553.1"
                     /db_xref="GeneID:2893315"
                     /db_xref="GOA:Q6CR86"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CR86"
                     /translation="MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKK
                     ELAKEHPNGKYQFEVVVDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYL
                     IPATHGTKSVLESIQKYGKNVEHVVVTSSFAAIVHRHRSGDPTFINDETTWNPVIWED
                     AREDAATSYVASKKYAEKLAWDFVKDNNSTFNLTTVNPPYVFGPQKFTFGLARASLNT
                     SADFVNKALKTTPEYEGPFNQPAGVACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGY
                     GIEEYEKGKFNFEKILRILNEKLPELKGKISPGGIKDNEAELSKLTYYRNKITTDSTK
                     LTFYKLEDTIYDAAKQILDYEASQK"
     gene            complement(<942458..>944068)
                     /locus_tag="KLLA0_D11044g"
                     /db_xref="GeneID:2892738"
     mRNA            complement(<942458..>944068)
                     /locus_tag="KLLA0_D11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453554.1"
                     /db_xref="GeneID:2892738"
     CDS             complement(942458..944068)
                     /locus_tag="KLLA0_D11044g"
                     /note="some similarities with uniprot|P23292 Saccharomyces
                     cerevisiae YNL154C YCK2 membrane-bound casein kinase I
                     homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453554.1"
                     /db_xref="GeneID:2892738"
                     /db_xref="GOA:P40230"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MSITAGPKVTTTAALVNTDRKMNNHHSTQVLHGSGQHGMQPSGN
                     NVLNGLANGATGLQSSASSTSTRDDSTIVGLHYKIGKKIGEGSFGVLFEGVNMINNVP
                     VAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLLGPSLEDL
                     FDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDANMVHLI
                     DFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF
                     LRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETP
                     DYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKS
                     KRHRNKFNQVPLAVNNLNGSNVPLQSHSPLPGGTDLTQGVSNAPQQPQQIMSQQQYQQ
                     HTQQRLDPMSYEAYKQQVQQRYAQQPQPTQQKAQKSPNNDTSQQQFSQNRQQQPQYQF
                     QQNQPQNGKVQVADSNSEKGFFSKLGCC"
     gene            complement(<945075..>945875)
                     /locus_tag="KLLA0_D11066g"
                     /db_xref="GeneID:2892903"
     mRNA            complement(<945075..>945875)
                     /locus_tag="KLLA0_D11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453555.1"
                     /db_xref="GeneID:2892903"
     CDS             complement(945075..945875)
                     /locus_tag="KLLA0_D11066g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453555.1"
                     /db_xref="GeneID:2892903"
                     /db_xref="UniProtKB/TrEMBL:Q6CR84"
                     /translation="MASHEDLMFQFDSGSAAEEDPLQRMPDLESQQGDNYTTPRGFDD
                     DELLSINTNGDDETLFSRSTATTLLDQTPDVSAAVRNNSTQWSRDYTSASNTGSSTVA
                     SSRRPTIDRSIVTGHITTTLDDNERRAASISSASDHHHKASSHRFSLPNLFHSIRRIN
                     PSTNHPSVSVVSEGQDPRRHSLNQAMVFSNYNNYLNDCIFDDSVKTVDQERKLRLEQL
                     ADKFWLRDGSIDEDMFDESSDEEHEEQEEISHHNHRRSSLTRKSKSVL"
     gene            <947523..>947894
                     /locus_tag="KLLA0_D11088g"
                     /db_xref="GeneID:2892898"
     mRNA            <947523..>947894
                     /locus_tag="KLLA0_D11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453556.1"
                     /db_xref="GeneID:2892898"
     CDS             947523..947894
                     /locus_tag="KLLA0_D11088g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453556.1"
                     /db_xref="GeneID:2892898"
                     /db_xref="UniProtKB/TrEMBL:Q6CR83"
                     /translation="MDATEKTDMPELTASITDLEKQELQYEVELDEADETSDNTKLIF
                     SQDKKKKQPRKRPWTPITWHITMALLVIYIISLLVFIKFVYPTMFLGPVKETVSAGHV
                     TLFENLGMATLDDTSMSGSLI"
     gene            <948248..>949840
                     /locus_tag="KLLA0_D11110g"
                     /db_xref="GeneID:2892967"
     mRNA            <948248..>949840
                     /locus_tag="KLLA0_D11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453557.1"
                     /db_xref="GeneID:2892967"
     CDS             948248..949840
                     /locus_tag="KLLA0_D11110g"
                     /note="similar to uniprot|P38840 Saccharomyces cerevisiae
                     YHR137W ARO9 Aromatic aminotransferase catalyzes the first
                     step of tryptophan phenylalanine and tyrosine catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453557.1"
                     /db_xref="GeneID:2892967"
                     /db_xref="GOA:Q6CR82"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CR82"
                     /translation="MTVTIDDKTLEEHYSKFLNRHVDRRVILQFWDDYLPKDVKPHPN
                     PYVLAAGMPNEGLFPVESVHVNVVERPFQHLEYPFKSEKIHVGAAGEIGVNEAEYVKS
                     RVDDGSMVDIWRYDPSHGDNIPIAQALQYSDTKGFPQLIDFSKKLVSYLNKPAYDNWD
                     VMLANGSSDSLSKVFTTLTDEDVTVLMEEFTFTPTISNVTANGGIPIPLKVDITDDAS
                     QQGINVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEK
                     HDIIIVEDDPYGYLKFLPFDKSDPLKNQYNDGTITFDKYCKEILAPSYLTIDTSGRVI
                     RLETFSKVFAPGMRLSFIVANKFILDKLLKYADISVRSPCGLAQAMTINIIDKWAENF
                     NGDKVRAWLSWVMKVAGEYTHRRNVLFQALEATPAYKEELFELIEPSAGMFISIKINF
                     DKFGEISDKLKAMNFLNYKLLEEGCIVILGYRMAVDKKFSYDRSNFLRITFAMAPDEE
                     HLQTAAERLGKGVERFFKEYHN"
     gene            <950190..>950579
                     /locus_tag="KLLA0_D11132g"
                     /db_xref="GeneID:2893099"
     mRNA            <950190..>950579
                     /locus_tag="KLLA0_D11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453558.1"
                     /db_xref="GeneID:2893099"
     CDS             950190..950579
                     /locus_tag="KLLA0_D11132g"
                     /note="highly similar to uniprot|P53900 Saccharomyces
                     cerevisiae YNL153C GIM3 Subunit of the heterohexameric
                     cochaperone prefoldin complex which binds specifically to
                     cytosolic chaperonin and transfers target proteins to it"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453558.1"
                     /db_xref="GeneID:2893099"
                     /db_xref="GOA:Q6CR81"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:Q6CR81"
                     /translation="MELLPEGQKNTVTVAYEDQQRINEFSKLIMRKDAIEQDLTQQRT
                     EKEYLDDVSLEIELIDEDEKVQYKIGDVFVFLKQKEVVEKLESDAENIDSNIEKLESD
                     EAELDSRIKELKSILYAKFGDNINLER"
     gene            complement(<950719..>951097)
                     /locus_tag="KLLA0_D11143g"
                     /db_xref="GeneID:9487521"
     mRNA            complement(join(<950719..950963,951052..>951097))
                     /locus_tag="KLLA0_D11143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999326.1"
                     /db_xref="GeneID:9487521"
     CDS             complement(join(950719..950963,951052..951097))
                     /locus_tag="KLLA0_D11143g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999372.1"
                     /db_xref="GeneID:9487521"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:B5FV75"
                     /translation="MRFAPIFIGTALASSLSSLMVIYPDSFQYYNDLVNVAHELDGTI
                     THEYTLFNGFSLDLPEEFVAKFKEMNQHFNWGLEIEEDQEVHALGGLKEHAV"
     gene            <952049..>953530
                     /locus_tag="KLLA0_D11154g"
                     /db_xref="GeneID:2893576"
     mRNA            <952049..>953530
                     /locus_tag="KLLA0_D11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453559.1"
                     /db_xref="GeneID:2893576"
     CDS             952049..953530
                     /locus_tag="KLLA0_D11154g"
                     /note="highly similar to uniprot|P09624 Saccharomyces
                     cerevisiae YFL018C LPD1 Dihydrolipoamide dehydrogenase the
                     lipoamide dehydrogenase component (E3) of the pyruvate
                     dehydrogenase and 2-oxoglutarate dehydrogenase
                     multi-enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453559.1"
                     /db_xref="GeneID:2893576"
                     /db_xref="GOA:Q6CR80"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6CR80"
                     /translation="MLRFNSTRSFSSSALLKTVTKKHDLVVIGGGPGGYVAAIKAAQL
                     GYDVACVEKRGRLGGTCLNVGCIPSKALLNNSHLYHQMKTDAKQRGIDINGEININVA
                     QFQKAKDTVVKQLTGGIEMLFKKNGVTYYKGLGAFETDKSVKVLPVEGLEGSVTEDHL
                     LESDRIIVATGSEVTPFPGITIDEERIVSSTGALSLKEIPKKLAIIGGGIIGLEMGSV
                     YSRLGSKVTVIEFQPQIGATMDGEVAQTTQKILKKQGLDFKLSTKVLSASRNGDVVDI
                     EVEGAKNGKKESLQADVLLVAVGRRPYVAGLNAEKIGLEVDKRGRLVIDEQLSTKFPH
                     VKVIGDVTFGPMLAHKAEEEGIAAAEYFKVGHGHVNYGNIPAVMYSHPEVAWVGKTEE
                     QLKEAGIQYKIGKFPFIANSRAKTNMDTEGFVKILIDAESERLLGAHIIGPNAGEMIA
                     EAGLALEYGASAEDIARVCHAHPTLSEAFKEANLAAYAKPINF"
     gene            complement(953908..953980)
                     /locus_tag="KLLA0_D11176r"
                     /db_xref="GeneID:2893151"
     tRNA            complement(953908..953980)
                     /locus_tag="KLLA0_D11176r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2893151"
     gene            complement(<954239..>955786)
                     /locus_tag="KLLA0_D11198g"
                     /db_xref="GeneID:2893152"
     mRNA            complement(<954239..>955786)
                     /locus_tag="KLLA0_D11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453560.1"
                     /db_xref="GeneID:2893152"
     CDS             complement(954239..955786)
                     /locus_tag="KLLA0_D11198g"
                     /note="similar to uniprot|Q75DH5 Ashbya gossypii ABR051C
                     ABR051Cp and weakly similar to YMR013C uniprot|P20048
                     Saccharomyces cerevisiae YMR013C SEC59 Membrane protein
                     that catalyzes the CTP-mediated phosphorylation of
                     dolichol the terminal step in dolichyl monophosphate (Dol-
                     P) biosynthesis required for viability normal rates of
                     lipid intermediate synthesis and protein N-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453560.1"
                     /db_xref="GeneID:2893152"
                     /db_xref="GOA:Q6CR79"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:Q6CR79"
                     /translation="MPTSTLAKGATSDLGVGNVYSKENSNVNSGSKGNLSRDSIISEV
                     LDKVFEADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMVTSVLMAYVVNLWMSATRT
                     NLGVNTLPTFNTIYLFYMQLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLL
                     MGDDGSANIANDVKALVLNYFFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESDS
                     IYFQVFQVCFTSFIVLVTVTSAVSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLI
                     INNVPPFTWLIDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAI
                     LPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEK
                     GPIIISYLYFIIGISLPFLINGSIIGIISLGVGDSLASIIGKKFGRNRWPNTCKTFEG
                     TFAFIAATGITTVIMKVYFNFFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFMLI
                     LLESMKE"
     gene            956328..956411
                     /gene="SNR78"
                     /locus_tag="KLLA0_D11200r"
                     /db_xref="GeneID:9487358"
     ncRNA           956328..956411
                     /ncRNA_class="snoRNA"
                     /gene="SNR78"
                     /locus_tag="KLLA0_D11200r"
                     /product="snR78"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR78"
                     /transcript_id="XR_002633577.1"
                     /db_xref="GeneID:9487358"
     gene            956620..956705
                     /gene="SNR77"
                     /locus_tag="KLLA0_D11203r"
                     /db_xref="GeneID:9487489"
     ncRNA           956620..956705
                     /ncRNA_class="snoRNA"
                     /gene="SNR77"
                     /locus_tag="KLLA0_D11203r"
                     /product="snR77"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR77"
                     /transcript_id="XR_002633578.1"
                     /db_xref="GeneID:9487489"
     gene            956899..957006
                     /gene="SNR76"
                     /locus_tag="KLLA0_D11206r"
                     /db_xref="GeneID:9487430"
     ncRNA           956899..957006
                     /ncRNA_class="snoRNA"
                     /gene="SNR76"
                     /locus_tag="KLLA0_D11206r"
                     /product="snR76"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR76"
                     /transcript_id="XR_002633579.1"
                     /db_xref="GeneID:9487430"
     gene            957134..957217
                     /gene="SNR75"
                     /locus_tag="KLLA0_D11209r"
                     /db_xref="GeneID:9487301"
     ncRNA           957134..957217
                     /ncRNA_class="snoRNA"
                     /gene="SNR75"
                     /locus_tag="KLLA0_D11209r"
                     /product="snR75"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR75"
                     /transcript_id="XR_002633580.1"
                     /db_xref="GeneID:9487301"
     gene            957387..957469
                     /gene="SNR74"
                     /locus_tag="KLLA0_D11211r"
                     /db_xref="GeneID:9487482"
     ncRNA           957387..957469
                     /ncRNA_class="snoRNA"
                     /gene="SNR74"
                     /locus_tag="KLLA0_D11211r"
                     /product="snR74"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR74"
                     /transcript_id="XR_002633581.1"
                     /db_xref="GeneID:9487482"
     gene            957592..957696
                     /gene="SNR73"
                     /locus_tag="KLLA0_D11214r"
                     /db_xref="GeneID:9487386"
     ncRNA           957592..957696
                     /ncRNA_class="snoRNA"
                     /gene="SNR73"
                     /locus_tag="KLLA0_D11214r"
                     /product="snR73"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR73"
                     /transcript_id="XR_002633582.1"
                     /db_xref="GeneID:9487386"
     gene            957837..957925
                     /gene="SNR72"
                     /locus_tag="KLLA0_D11217r"
                     /db_xref="GeneID:9487295"
     ncRNA           957837..957925
                     /ncRNA_class="snoRNA"
                     /gene="SNR72"
                     /locus_tag="KLLA0_D11217r"
                     /product="snR72"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR72"
                     /transcript_id="XR_002633583.1"
                     /db_xref="GeneID:9487295"
     gene            <958249..>959682
                     /locus_tag="KLLA0_D11220g"
                     /db_xref="GeneID:2893134"
     mRNA            <958249..>959682
                     /locus_tag="KLLA0_D11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453561.1"
                     /db_xref="GeneID:2893134"
     CDS             958249..959682
                     /locus_tag="KLLA0_D11220g"
                     /note="similar to gnl|GLV|CAGL0M07678g Candida glabrata
                     CAGL0M07678g and weakly similar to YMR014W uniprot|Q04347
                     Saccharomyces cerevisiae YMR014W BUD22 Protein involved in
                     bud-site selection diploid mutants display a random
                     budding pattern instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453561.1"
                     /db_xref="GeneID:2893134"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:Q6CR78"
                     /translation="MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRK
                     TNKKVTKLLEAADKQKINGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAK
                     IGAEQFIKYMSYSKLVKLTMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYNGV
                     FSKNKLNSLVSKLLNNKNVKDLIQTYENGIHVILNEKDKIQKDTTTASTKQSKTKSED
                     TSTDKNIDGVSKTEKGATESESESDLLEENSEREAPELDSETEELLSKQYDGLLVGSD
                     EESEPEFQLDPTIDYNQVTDEEDKEEYSADEDDEENSDSDSGEPSNKKPKYNLPELMN
                     GYISGDEEEDLDDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQRQLEKEH
                     KERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTSNIPPPPQPVITADKPI
                     HPSWEAKRIAEEKQKNVKFQGKKITFG"
     gene            complement(<959973..>961577)
                     /locus_tag="KLLA0_D11242g"
                     /db_xref="GeneID:2893180"
     mRNA            complement(<959973..>961577)
                     /locus_tag="KLLA0_D11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453562.1"
                     /db_xref="GeneID:2893180"
     CDS             complement(959973..961577)
                     /locus_tag="KLLA0_D11242g"
                     /note="highly similar to uniprot|P54781 Saccharomyces
                     cerevisiae YMR015C ERG5 C-22 sterol desaturase a
                     cytochrome P450 enzyme that catalyzes the formation of the
                     C-22(23) double bond in the sterol side chain in
                     ergosterol biosynthesis may be a target of azole
                     antifungal drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453562.1"
                     /db_xref="GeneID:2893180"
                     /db_xref="GOA:Q6CR77"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6CR77"
                     /translation="MDNIVVSQTSNATQVASEASVKLFSLANAQQLVETVQQMSYFKL
                     FCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEEYLAKWNSGPLS
                     CVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRK
                     SLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMREIMCALSLKA
                     FCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIFEQCAQ
                     MAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLFASQ
                     DASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKET
                     LRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERWV
                     EGSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKV
                     FATIFPKDDLLLSFKKRDPLTGEVEL"
     gene            complement(<962069..>964108)
                     /locus_tag="KLLA0_D11264g"
                     /db_xref="GeneID:2893219"
     mRNA            complement(<962069..>964108)
                     /locus_tag="KLLA0_D11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453563.1"
                     /db_xref="GeneID:2893219"
     CDS             complement(962069..964108)
                     /locus_tag="KLLA0_D11264g"
                     /note="some similarities with uniprot|Q03213 Saccharomyces
                     cerevisiae YMR172W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453563.1"
                     /db_xref="GeneID:2893219"
                     /db_xref="GOA:Q6CR76"
                     /db_xref="InterPro:IPR022210"
                     /translation="MSAMENRKNSLHGSPNGLSGLNMVLPREGDSNNGIMTTEDARNG
                     KLKGDKDLNMKMHVGMGTTPINTRLGNTMNSDVANSMSYLLEQPQSGTLIGDRLILET
                     SEEPVGVNLVDGQNARNNQQMLNNASHMDPAFTLPADDTMNNSAAAAAAAAAAAAAST
                     GPSQPTMQSTPSISTGGSTNFQVQIAQRLADIDQRILRMEMLMDNVCNKIDSHSQQQS
                     LWKNDMHQMENKVIDVLDEIKSNIFSLKRQVSNQGDGAFAAELINAISNVSNKHIRKN
                     TYGFPAGNPQGNDMGQTMNGYNNAMQLSSMAAPMSYVPGEQVNLNQLGNSKDQIDRFL
                     TKSANEFMLDPSGLKKRRKNPSSSNESPITLSHTKTHSTSQPINYSASLPNLNLDALS
                     KVMLPQHQQLTHNGGSQHPLSDKSIKFGISSTSHSSSNSSDSDDEEDDIDDEEDEAED
                     EEDENDDSRDVNDHDNVEGRETLTKKSMKPGNSIEGRDPSGTNGTVNSTTNNHMNTID
                     TATNTSSQLQGTVIRSTADTENPKQESNASAAATSGAATGVATGTTTANIATSASDKL
                     KLHGDSKKEPKFTMIKAPSSVKEIWREYTQGIDGRPSIKSLDQKFGNKWRANKNKKTY
                     SRRKRMYKFILNGIKKGKSEEEMVQMLENKRIYKDSDGNQKKRTIGWLQQSLSGI"
     gene            complement(<964642..>966678)
                     /locus_tag="KLLA0_D11286g"
                     /db_xref="GeneID:2893228"
     mRNA            complement(<964642..>966678)
                     /locus_tag="KLLA0_D11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453564.1"
                     /db_xref="GeneID:2893228"
     CDS             complement(964642..966678)
                     /locus_tag="KLLA0_D11286g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453564.1"
                     /db_xref="GeneID:2893228"
                     /db_xref="GOA:Q6CR75"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CR75"
                     /translation="MTNNLAGKSAKEIKEQIVRKRTPKSCIRCYSIKRKCDHKKPSCT
                     RCFKKSLPCEYFTEEHVLERCLQRQSNLRSVIHQKAPASRSSTNETISENDTLPTTEL
                     NPSSSETEARNFKLIVNSTGEYSKYISLSLFPFSDPSQIVSYIVDRVPQDQDKYVIFD
                     FSFVSGRLNTAADILKMLPSKVQCDRLVAYFFNNIAPFIPILDQEEFEIKYKDLWKNF
                     KTYDDLNNLMVLFAILFSCCVSIQVTNIYLTGKHFSEDDPIDYDKLKYSCFQCVQNIR
                     YLNRTDISPSMSAITALTLMYYVGSFHCSVAVGEVAALLRFSQIVGLHRSLSSDTKSS
                     SVRAFLYSYVVHLDSLVAYYNGLTSYINPDLFEIVRNFPKREKDLKTLHSLTKFHSSI
                     VWTDLLHQLNKIKPSVEEDYVRLNNEYLRSVEKVNSLNAEILTLFPDEDQDYIHLLVS
                     EARLGLRKSAILVHILRLSVANINIKNVHQGESFNYDLVVQALLLINESLMKIHLGVK
                     CNINMMWWVRNSYPLQALSIVLTHILKKPTTRMNFENLPVGYEYTKHPDINYSAFDIR
                     EEMVVKTMDAIQTIKRTWPKVVQRRFEKICELKEYVFSQRRKQSTTQQTSTLNLGIPS
                     STTVPIYSSDFADTNAHPSGSTVPKMTFDELLSSLFDGDTDFQSLLFETLPNNL"
     gene            complement(<967169..>968806)
                     /locus_tag="KLLA0_D11308g"
                     /db_xref="GeneID:2893265"
     mRNA            complement(<967169..>968806)
                     /locus_tag="KLLA0_D11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453565.1"
                     /db_xref="GeneID:2893265"
     CDS             complement(967169..968806)
                     /locus_tag="KLLA0_D11308g"
                     /note="similar to uniprot|O94493 Schizosaccharomyces pombe
                     SPCC417 SPCC417.12 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453565.1"
                     /db_xref="GeneID:2893265"
                     /db_xref="GOA:Q6CR74"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="InterPro:IPR019826"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CR74"
                     /translation="MGQVVSTEGTTPFPISIPGQGTLTGYTFKSPRTNNVTTHRFAQI
                     PYAEPFTKENRFKRPVPLADDFDYTGDYKEFGLKCPQPSVPNPAFRYTKSPSDENINK
                     LNIWVPSSDKYKESDGWPVLVYIHGGWLQYSSPYSEFFNTNEMFDDEEFTQKYILVTP
                     GYRLNMFGFLSGKELLEEDEASSNFGFWDQRLAIEWTYKYIKYFGGNPDKISVGGISA
                     GAYSTFFQLAYELYHPEDNQIIKQALFFSNLVYVQPKTIEECQEQFDEIVEKLDIDPK
                     ASGQEKLAVLRELDAPFIEDFIPTLTHHTFRAVTDDKFISSTLIKDLDSGEYARRLLS
                     IKGDKFRILCGEVDNEPLKYSLLNTPQTLGELPVQVGNYYPKNIVDSLLDLYKVDKLN
                     PASPTLKEDLRVAYGDIIGDGQVYASGRGYLHKLVEHGFPSKNIFRYRVSYRAKWLDN
                     HIEPDDRVPHAGDFSLWFYCLREGYTDEERIHINEWLQPYLQFLNFKSLDSWDSDDVK
                     KYRIFKEDGSFDYVDDIHWDWGVKVATTAYKAQLTGQ"
     gene            <970243..>971808
                     /locus_tag="KLLA0_D11330g"
                     /db_xref="GeneID:2893231"
     mRNA            <970243..>971808
                     /locus_tag="KLLA0_D11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453566.1"
                     /db_xref="GeneID:2893231"
     CDS             970243..971808
                     /locus_tag="KLLA0_D11330g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease ureidosuccinate permease
                     expression is constitutive but sensitive to nitrogen
                     catabolite repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453566.1"
                     /db_xref="GeneID:2893231"
                     /db_xref="GOA:Q6CR73"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CR73"
                     /translation="MSPTDMKDQTIEKCESVQDATTEDVPLQTILSPSGKVLVLGEAA
                     DEAMEFAKHHEHIELSAEEDRKVKRKIDMIVMPLFSFLYMIQFMDKTCISFAAVMGIQ
                     TDYKMVDTMYSWTTSCFYLGYLFASPFAAVALQKLPSMRTSAICIVIWGVIQCLHVTA
                     KSYATFTLLRTLLGVLEAFVSPIFVIMMNQYYKKSEHFGYIGVLYGCNGLGTVILACI
                     SYGLYHNLGSYTMEAYKVLFIIVGCLTIFNGLLILFIMPNTPADARFLNDREKLAVLE
                     RIRGNNQGFGSKTFKWHQMKECFMDMRTWLYFLIGISVAIPNGGISSFGSIILKGFGY
                     STEKSLLMKAPIGACELVGLVILPLISYFISKRMIIAVFYLLVCVMSTCLLAFSKNKN
                     VALAGYYITGIAPVGIITITSCVASNTAGHTKKLTANAISLIGYSAGNIVGPQTFRSS
                     DAPNYPKAKAAVVGCYCASIALMGLMSFLNVRENRRRDKMQEELGDKYVVVENQEFAD
                     LTDFENPAFRYSL"
     gene            <973371..>974828
                     /locus_tag="KLLA0_D11352g"
                     /db_xref="GeneID:2893280"
     mRNA            <973371..>974828
                     /locus_tag="KLLA0_D11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453567.1"
                     /db_xref="GeneID:2893280"
     CDS             973371..974828
                     /locus_tag="KLLA0_D11352g"
                     /note="highly similar to uniprot|P04807 Saccharomyces
                     cerevisiae YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
                     phosphorylation of glucose in the cytosol predominate
                     hexokinase during growth on glucose functions in the
                     nucleus to repress expression of HXK1 and GLK1 and to
                     induce expression of its own gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453567.1"
                     /db_xref="GeneID:2893280"
                     /db_xref="GOA:P33284"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="PDB:3O08"
                     /db_xref="PDB:3O1B"
                     /db_xref="PDB:3O1W"
                     /db_xref="PDB:3O4W"
                     /db_xref="PDB:3O5B"
                     /db_xref="PDB:3O6W"
                     /db_xref="PDB:3O80"
                     /db_xref="PDB:3O8M"
                     /db_xref="PDB:4JAX"
                     /translation="MVRLGPKKPPARKGSMADVPANLMEQIHGLETLFTVSSEKMRSI
                     VKHFISELDKGLSKKGGNIPMIPGWVVEYPTGKETGDFLALDLGGTNLRVVLVKLGGN
                     HDFDTTQNKYRLPDHLRTGTSEQLWSFIAKCLKEFVDEWYPDGVSEPLPLGFTFSYPA
                     SQKKINSGVLQRWTKGFDIEGVEGHDVVPMLQEQIEKLNIPINVVALINDTTGTLVAS
                     LYTDPQTKMGIIIGTGVNGAYYDVVSGIEKLEGLLPEDIGPDSPMAINCEYGSFDNEH
                     LVLPRTKYDVIIDEESPRPGQQAFEKMTSGYYLGEIMRLVLLDLYDSGFIFKDQDISK
                     LKEAYVMDTSYPSKIEDDPFENLEDTDDLFKTNLNIETTVVERKLIRKLAELVGTRAA
                     RLTVCGVSAICDKRGYKTAHIAADGSVFNRYPGYKEKAAQALKDIYNWDVEKMEDHPI
                     QLVAAEDGSGVGAAIIACLTQKRLAAGKSVGIKGE"
     gene            complement(<975206..>976003)
                     /locus_tag="KLLA0_D11374g"
                     /db_xref="GeneID:2893275"
     mRNA            complement(<975206..>976003)
                     /locus_tag="KLLA0_D11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453568.1"
                     /db_xref="GeneID:2893275"
     CDS             complement(975206..976003)
                     /locus_tag="KLLA0_D11374g"
                     /note="similar to uniprot|P32496 Saccharomyces cerevisiae
                     YFR052W RPN12 Subunit of the 19S regulatory particle of
                     the 26S proteasome lid synthetically lethal with RPT1
                     which is an ATPase component of the 19S regulatory
                     particle physically interacts with Nob1p and Rpn3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453568.1"
                     /db_xref="GeneID:2893275"
                     /db_xref="GOA:Q6CR71"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="UniProtKB/TrEMBL:Q6CR71"
                     /translation="MPSLPELTKGLKTAFEGKQYETCLRLLLPIKIELIKAKLLIPDI
                     KSAKENQSYLQDLNIAKKILEIGALSSIYCEDFETFMNYYSQLSAFYFSDVKELSDSD
                     SKFKLISLYLLILLAQNDYTKLHSEFEFLSRYVTNLEESSYLSYPVKLERLLMEGSYQ
                     KAWDLLQTGSKVEEFNVFTKTLKEAIREEIALNSEQAYSSLPLFNAKTLLFFENEKEM
                     EAFAKERDWSVNHGVITFGNDSTPDRIESGDTVDMAIDYAVHLESIV"
     gene            complement(<976408..>978018)
                     /locus_tag="KLLA0_D11396g"
                     /db_xref="GeneID:2893503"
     mRNA            complement(<976408..>978018)
                     /locus_tag="KLLA0_D11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453569.1"
                     /db_xref="GeneID:2893503"
     CDS             complement(976408..978018)
                     /locus_tag="KLLA0_D11396g"
                     /note="similar to uniprot|P43621 Saccharomyces cerevisiae
                     YFR051C RET2 Delta subunit of the coatomer complex (COPI)
                     which coats Golgi-derived transport vesicles involved in
                     retrograde transport between Golgi and ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453569.1"
                     /db_xref="GeneID:2893503"
                     /db_xref="GOA:Q6CR70"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6CR70"
                     /translation="MVVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSS
                     KQHTFVEDEHVRYVYKPFDDYYIILITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEED
                     VFDSAFDILNSFDEIITMGYKENLSLTQIKTFLAMESHEERIQEIIERNKEFEAAEER
                     KRRAKEISRKEQARKLGIPDTQEFTGIHGGVMNKAYDSYYSHASSAAQQSHMHTQSNQ
                     GIQQQNLAPQQQQQQQYANREPLGGKGLQVNGPRRGVERPIKNVERQSLSVQTATLPE
                     EEKPINNGILISVKETINAEISRDGAIMGSELKGVLELRVNNPDLAHAKLCLGTDVNV
                     KDKTYQFKTHPNVDKAGFLTNKTIGLRDPNKPFPSNDQSLGVLRWRKVKGADEHDLIP
                     LEISTWLSPSSETDNAIDVTFEYEVNSDYEGTIDELRFLIPVFTDTVFIKDDLNEANA
                     IVEAIDESQGIIIKVDPIESGQSSVFSVTVQAAYEDALFPIEVALKNSNAKPLSNLNI
                     ASVVSAADDTELPFDTVSTLKSEQYVVV"
     gene            complement(<978322..>980349)
                     /locus_tag="KLLA0_D11418g"
                     /db_xref="GeneID:2893561"
     mRNA            complement(<978322..>980349)
                     /locus_tag="KLLA0_D11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453570.1"
                     /db_xref="GeneID:2893561"
     CDS             complement(978322..980349)
                     /locus_tag="KLLA0_D11418g"
                     /note="weakly similar to uniprot|P53061 Saccharomyces
                     cerevisiae YGL249W ZIP2 Required for 'ZIPpering' up
                     meiotic chromosomes during chromosome synapsis involved in
                     meiotic recombination and disjunction"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453570.1"
                     /db_xref="GeneID:2893561"
                     /db_xref="GOA:Q6CR69"
                     /translation="MVSAMWDTSALKLRNIFEEEFGGYLEKRLRESIQLNRPTKRYLK
                     LATRSDIDLKFHKVGKKESNGSSLVKYIIEFDTTAILVKGYIRPWNNPEWKCKAPYNS
                     NQNVDTRSLYKEKIIVRDNVKDLFSAALTKLDLSVRLNKFDQNVHAKYRLNEDFLQPL
                     GRTLRHSCEFPVMHSRLVQRESELYEEFLSYDLPKRQMTTMDIQFKTVKVQSFQQYKI
                     QYIQTLTREKTSQEYTSSARLPHWQSNQIQNSSIKFLKLCCEDEDFHPLELYKLENPK
                     ADQFQRKAVYRSKPIKPKWRISDEIIKRLNWNPFKELNLPKNSELLESLRDVQVRCTS
                     YALVFKRIPSSKIDLMVSKIPVSFRSVNAISYDQFDPKSKENVQESSQCIDSLANEET
                     TDVDEVTNKRIMTSGKRSFINADLVSIIAAKRSKLKRLSISNGDVNPVATLNETVEQS
                     TMSNVTFQLSDKSFHNAEEKVIIFNAEYIAKNYKLINFLHQNNFCVLEMDLGDHSDIL
                     LDASTCLILRNITSVYQKQVDSFPLLRAIQELKCKYKRVVIFLSYSERSLALDSNLAY
                     KTQLLLNCLGGTTTHLVEETQLKLTATWISLYCGTNTPNEQQIYRMSLSKEVLQHFDI
                     NPIAIESILSLTSLEEFLSISYGKRALLYGKFLTEYQLAHIDDFVTMSWSE"
     gene            complement(<980535..>981428)
                     /locus_tag="KLLA0_D11440g"
                     /db_xref="GeneID:2892850"
     mRNA            complement(<980535..>981428)
                     /locus_tag="KLLA0_D11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453571.1"
                     /db_xref="GeneID:2892850"
     CDS             complement(980535..981428)
                     /locus_tag="KLLA0_D11440g"
                     /note="similar to uniprot|P53060 Saccharomyces cerevisiae
                     YGL250W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453571.1"
                     /db_xref="GeneID:2892850"
                     /db_xref="InterPro:IPR018822"
                     /db_xref="UniProtKB/TrEMBL:Q6CR68"
                     /translation="MSLEDQEVPRLEELSSVSVAEHVPEANEAGSSVENDENDGIETI
                     NRDEQSSSGSMSVHSDSIVSDYEDEQMIDSDEDLRNQLKGLGESVKESLPSADIPDTT
                     LEYAGEVYPMFSKDNDNGTDNNEQQSVVIEDRSLIHMELNYLIAAIRLFLQNKHGALS
                     LASKEILLHFPNLDLLCNEDNLYIKKMTMDDIISIFKVLRTNSLRNGEENVPSTLRIV
                     ASLQPRFVSRYNDLVEVMDNNGSFAVVHGFSNDESHPVFVDEGNQDGSNFTGGRSSEV
                     IVMDSDEASLKDSDSDIEIIN"
     gene            <982040..>985303
                     /locus_tag="KLLA0_D11462g"
                     /db_xref="GeneID:2893420"
     mRNA            <982040..>985303
                     /locus_tag="KLLA0_D11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453572.1"
                     /db_xref="GeneID:2893420"
     CDS             982040..985303
                     /locus_tag="KLLA0_D11462g"
                     /note="similar to uniprot|P51979 Saccharomyces cerevisiae
                     YGL251C HFM1 Meiosis specific DNA helicase involved in the
                     conversion of double-stranded breaks to later
                     recombination intermediates and in crossover control
                     catalyzes the unwinding of Holliday junctions has ssDNA
                     and dsDNA stimulated ATPase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453572.1"
                     /db_xref="GeneID:2893420"
                     /db_xref="GOA:Q6CR67"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CR67"
                     /translation="MSKEYEISSSNTSNDTTFQLNFSNSLTRPLRKKPKIATLQKDPV
                     NEIRLLPVSVLPDSAQCIFPFENFNRMQTESFENIYRSNENCIVTSPTGSGKTVLFEL
                     AILNAMNRLDRPSSVKVLYIAPTKSLCNEKYQQWKSKFIMLSVGMLTSDTSFTELEKV
                     KAANIIICTPEKWDVITRKWTDYPQFFAILSLVLVDEIHILQEHRGSTLEVILTRMNS
                     MCQNLRIVAVSATIPNIHDIADWLKTGGPTGVPAKVLAFDDSYRQVVLRHHVYSFYNK
                     FNNEFQMDALFNTRLVELINKHSKGKPVLIFCPTRQSTIVTARHIALHDHEMNNTSSK
                     RSNIKLQDKQLSEIAQKGIAFHHAGLSMTDRSVIEDKFTNGDIKVLCSTSTLAVGVNL
                     PAYLVIIKGTRMWSINGSQEYSTLDILQMIGRAGRPQFETEGTALILTDEGSQEKYEN
                     LLKGTSTLESCLHLNLAENIVAEIALNSITSIKSAMNWLKNTFFYRRYLKNPAHYSVI
                     RSSILTSDAECQLTHFCERTLKDLLSYKIILDNNGNLCASGYGQAMTRHYILGDTVKN
                     IIRSNTSLKSLEVLKILANASEFDSIRLKHNEKKLYREINANPLLRYPFTDKKKQLMS
                     ITSKEQKISLLIQYELSGLEYPSYKDAQKHHQTLVQDKMLVFRHAPRVLKCMIDCFIE
                     KYDGDSLKSTLFLLRSVAGKGWEDTPMILRQLNTIGLVSLRKLVSHGVCTFADMEKLT
                     EQQIEYYLSLRPGNGYKIKSDLQMIPLLSLEYSVEEKTVTQNAIHVSFKVEVQANFKS
                     ASWHGQQLCMLIMLKTDTGILIDFRRTFLSKLKTPKAFRITIQVDRNTNFIEFVYSCE
                     QIGGSNREIRYYLSNGCYDDMPKYSNVLEQIDSNQTGSFQTSINYSDARETINNETDD
                     DEELLNLLAEKNNSNANNERQEDCDRSLLDNGNMKCHHTCKDKSTCRHLCCREGIPRN
                     TRRKASKQSMIKHTESVQQEEPSSSKDARNDLQKGLSSSKSMLPNLDECQQMEPEPVL
                     ENPINSLPKVSSAQQTQKITYIIPSSSPKQSSPFDTSLSDTQDADLLNFLGSDIELG"
     gene            <985655..>987418
                     /locus_tag="KLLA0_D11484g"
                     /db_xref="GeneID:2893456"
     mRNA            <985655..>987418
                     /locus_tag="KLLA0_D11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453573.1"
                     /db_xref="GeneID:2893456"
     CDS             985655..987418
                     /locus_tag="KLLA0_D11484g"
                     /note="highly similar to uniprot|P32608 Saccharomyces
                     cerevisiae YGL252C RTG2 Sensor of mitochondrial
                     dysfunction regulates the subcellular location of Rtg1p
                     and Rtg3p transcriptional activators of the retrograde
                     (RTG) and TOR pathways Rtg2p is inhibited by the
                     phosphorylated form of Mks1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453573.1"
                     /db_xref="GeneID:2893456"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="UniProtKB/TrEMBL:Q6CR66"
                     /translation="MSMISDSDNETEVVSRNLCGVVDIGSNGIRFSISSKASHHARIM
                     PCVFKDRVGISLYEVQYAANSLIKAPIPTAVIHEVCSAMKRFKLICEDFGVPETGVRV
                     VATEATREALNSQEFIDAIYDSTGWDVEILTKEEEGRIGAYGVISSFNTVSGLYIDLG
                     GGSTQLSWIKCVNGEITQSSTPVSLPFGAGALTRRMKFESKHVLLQEIVDAYKSAVTK
                     IGIPKEMYDEAQLNGGFDLYTCGGGLRGMGHLLLSQIKEYPIQTIINGFSCSFSEFSN
                     MCDYLFLKERVPGESASKIFKVSDRRAKQLPAVGLLMAAASESLPKIKNVHFSEGGVR
                     EGTLYSILPREIRAQDPLVIATRPYAPLLVHKYLELLRTAIPTKEIPKIVYERIAPAL
                     CNLAFVHASYPKELQPTAALRVGTSGIIAGCHGLSHRSRALVGIALCNRWGGDIPEPE
                     EVYKKLLEDIALRDGDKLERERTIWWTKYIGTIMYVICGVHPGGNIGDGVFHFSTSEK
                     DESAIDLQMLSIDENLSGNGKPTPTGNPNKRIFEVVVKINRNDLKTIASVRQRIITLQ
                     KKIRKLSRGSSDKVKINVEFY"
     gene            <987844..>988641
                     /locus_tag="KLLA0_D11506g"
                     /db_xref="GeneID:2892765"
     mRNA            <987844..>988641
                     /locus_tag="KLLA0_D11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453574.1"
                     /db_xref="GeneID:2892765"
     CDS             987844..988641
                     /locus_tag="KLLA0_D11506g"
                     /note="highly similar to uniprot|P30657 Saccharomyces
                     cerevisiae YFR050C PRE4 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453574.1"
                     /db_xref="GeneID:2892765"
                     /db_xref="GOA:Q6CR65"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR016295"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CR65"
                     /translation="MNHDPFAWGRPSDEHYGAYNHAIAQASNNPKMNTQNPIITGTSV
                     ISIKYNNGVIVAADNLGAYGSLLRFTNEERLIKVGPNTVVGVSGDISDMQYIQHLLDE
                     MEIENNYDSAYADNEEQLKPSFVFEYLSSVMYQRRSKLDPLWNAIIVGGTEDGKPFLR
                     YVNLLGVTYSSPTLATGFGAHLALPLLRKLVDTEKDVEKVNLDVAKKAILEAMKILYY
                     RDARSSRKFSLAIIDNELGLNIEKDLQVENMSWEFAKDIRGYGTQKV"
     gene            <989252..>990358
                     /locus_tag="KLLA0_D11528g"
                     /db_xref="GeneID:2893547"
     mRNA            <989252..>990358
                     /locus_tag="KLLA0_D11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453575.1"
                     /db_xref="GeneID:2893547"
     CDS             989252..990358
                     /locus_tag="KLLA0_D11528g"
                     /note="similar to uniprot|P22434 Saccharomyces cerevisiae
                     YGL248W PDE1 Low-affinity cyclic AMP phosphodiesterase
                     controls glucose and intracellular acidification-induced
                     cAMP signaling target of the cAMP-protein kinase A (PKA)
                     pathway glucose induces transcription and inhibits
                     translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453575.1"
                     /db_xref="GeneID:2893547"
                     /db_xref="GOA:Q6CR64"
                     /db_xref="InterPro:IPR000396"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q6CR64"
                     /translation="MSTYPGCSFELTILGSCGGPLNNHTQSFLMKRAGSSESGYICID
                     AGSGLAEIADMIYAQEYGNTFLVKSLYKSSAEDVSRFLAQGVRCTIGFGTPSEVFLKK
                     SAEAHSSIMRTACEIFSEVREYYITHPHLDHMMGLILNAPLIYTKLGSYKNVYGTEHT
                     IQAIKEHIFNDKIWPDFTTDNTIRLEALEPSIRRNTYSIQGIDCIPFTLNHGQTIDTK
                     EPVLSTAFLFHEHQTDGHVLICGDTESDLVSKTDSLLNIWTYLAENVPINNLKAIVLE
                     CSNTDEVDTSKLYGHLCPQHIIWELKRLIEVYDVKPENFSLHVILTHVKDIDSEEDPK
                     ITVLKQVNKRCKQQGLDKYNISFSMAIQGFTMIL"
     gene            complement(<990698..>991099)
                     /locus_tag="KLLA0_D11550g"
                     /db_xref="GeneID:2892877"
     mRNA            complement(<990698..>991099)
                     /locus_tag="KLLA0_D11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453576.1"
                     /db_xref="GeneID:2892877"
     CDS             complement(990698..991099)
                     /locus_tag="KLLA0_D11550g"
                     /note="similar to uniprot|P19955 Saccharomyces cerevisiae
                     YFR049W YMR31 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453576.1"
                     /db_xref="GeneID:2892877"
                     /db_xref="InterPro:IPR020373"
                     /db_xref="UniProtKB/TrEMBL:Q6CR63"
                     /translation="MRASTLNLAKAVKYVPSIKFVGGPHPVVTHSAADAGLHPCTVDS
                     LRPGAPGCSTVEEVAKKWLPFKVVPYVNSNKSASGKGSSTKAAGNSPKYVFKNRPLEE
                     NEVGSISQLPPRFKLRPMDEQEIEIINGGGI"
     gene            complement(<991747..>992865)
                     /locus_tag="KLLA0_D11572g"
                     /db_xref="GeneID:2893236"
     mRNA            complement(<991747..>992865)
                     /locus_tag="KLLA0_D11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453577.1"
                     /db_xref="GeneID:2893236"
     CDS             complement(991747..992865)
                     /locus_tag="KLLA0_D11572g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453577.1"
                     /db_xref="GeneID:2893236"
                     /db_xref="UniProtKB/TrEMBL:Q6CR62"
                     /translation="MPMTDQMPSPPSIEISDSQYQKLGLQCISPGIATANLDDERLQT
                     FNKSKYIAMQQKRQIRRMNLDSVTINEDEHEHEHEQENEQDEEQDDEKEHEKEHEQDE
                     DQEQEQDDENTKLAEKAGTSIKNNNNITASDLETDKSSSSNSIDGTTTPGTETSINTS
                     KSQSKSLKRNNIPKPLTLKSKQNTPNGSLPNIRSAPPMVTRHPIPSSHTFSQRTSRVS
                     KPRVIYKGRSLTRNLAGQIPMFQTSSPIVPRPLMRHQYAPMTAYPTTTAPPHTQRSFE
                     QFVSNPIRATNSVTRDVFKDETTRIAPLSVQPKSTKREFFDAIEIEDHSNNVVIEGDI
                     QLMMENFQFHFDSTDPQMDKKLFLSICSKIWDDVVSRE"
     gene            <993485..>994144
                     /locus_tag="KLLA0_D11594g"
                     /db_xref="GeneID:2893534"
     mRNA            <993485..>994144
                     /locus_tag="KLLA0_D11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453578.1"
                     /db_xref="GeneID:2893534"
     CDS             993485..994144
                     /locus_tag="KLLA0_D11594g"
                     /note="similar to uniprot|P29547 Saccharomyces cerevisiae
                     YPL048W CAM1 Translational cofactor elongation factor-1
                     gamma participates in the regulation of GTP-binding
                     protein EF-1 alpha may play a redundant role in the
                     regulation of protein synthesis or another GTP-dependent
                     process"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453578.1"
                     /db_xref="GeneID:2893534"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CR61"
                     /translation="MSQGTLFANFRIRTWLPRAIVKSLSLDVKILEPESNVEYWSKLF
                     PLKKVPCYVGSDGFKLTQQLAILVYLVNLSDNNAEIQRLLGKGNKEKAEVLQWLSLAN
                     TDLCLAFTRGAFPLNGRSPYNKKQVDDAYAELDRLVQRYEQRLNDHKYLVGDRASLAD
                     YLSAIIFTRIFETLYGKKWREEHAKLTQWFTNITEDPFVSFLWEGITLCDEPLPNPPT
                     K"
     gene            <995087..>996262
                     /locus_tag="KLLA0_D11638g"
                     /db_xref="GeneID:2892778"
     mRNA            <995087..>996262
                     /locus_tag="KLLA0_D11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453580.1"
                     /db_xref="GeneID:2892778"
     CDS             995087..996262
                     /locus_tag="KLLA0_D11638g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453580.1"
                     /db_xref="GeneID:2892778"
                     /db_xref="GOA:Q6CR59"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6CR59"
                     /translation="MNVYSLFLALALDVVSGFEYGPQYSTNFITDLDHTREGKAHRNE
                     LFLGFQESSSMWFYTTLAPMLWDTVARWYGIGEKSAKSQQWIWDKFQEALKPLQQGII
                     GSSTNDNTIVSPVGNVLSTMYDEKIGKGPISQTQFREIASEIADHVIAGHETTGITLT
                     YICWELSRPCNRHWQDKLFEECKTVPSDLQRLDQMPILHSIVQEACRLHSAIPGSEPR
                     YVPQEGPKFEATLRDKHGTRVEIPPGTIVSCQPWSLHLLETPFGANPRQFNPARWLRD
                     ETTGETEQEYEKRLTKMNNSMFTFGQGNRMCLGMNLALMEMKYCIAQLYSRYTTDISP
                     EWCNKVYQQQTDSLMGTSGRGRATSIKGTDVDMMRMADTYTTRPLMNECWLEFSSRD"
     gene            <996785..>998320
                     /locus_tag="KLLA0_D11660g"
                     /db_xref="GeneID:2893117"
     mRNA            <996785..>998320
                     /locus_tag="KLLA0_D11660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453581.1"
                     /db_xref="GeneID:2893117"
     CDS             996785..998320
                     /locus_tag="KLLA0_D11660g"
                     /note="highly similar to uniprot|P15202 Saccharomyces
                     cerevisiae YDR256C CTA1 Catalase A breaks down hydrogen
                     peroxide in the peroxisomal matrix formed by acyl-CoA
                     oxidase (Pox1p) during fatty acid beta-oxidation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453581.1"
                     /db_xref="GeneID:2893117"
                     /db_xref="GOA:Q6CR58"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:Q6CR58"
                     /translation="MGHPTNTADVRKDRVVTNSQGAPINEPFATQRVGQHGPLLLQDF
                     NLLDSLAHFNRERIPERNPHAHGSGAFGYLEITDDITDVCGSAMFDTVGKRTRCLVRF
                     STVGGEKGSADTARDPRGFAIKFYSEEGNVDWVNNNTPVFFIRDPSKFPHFIHTQKRN
                     PETNMKDADMFWDFLTTEENQVAIHQVMILFSDRGTPASYRNMNSYSGHTYKWSNKQG
                     EWRYVQVHLKTDQGIKNLNNEEATKLAGENPDYCQKDLFENIAKGNYPSWTLYIQTMT
                     EEEAEKLPFSVFDLTKVWPHKQFPLRRVGKMVLNENPENYFAQVEQAAFSPSHTVPYQ
                     EASADPVLQARLFSYPDAHRYRLGPNYSQIPVNCPYASKVFNPAIRDGPMNVNGNLGK
                     EPNYLSTSKKYQFIQQSKPIQQHQEVWSGPAMPVHWATSPGDIDFVQARDLYNKVLSK
                     QPGQQKALAHNVAVHVASACPEIQDRVFAMFARVDRGLSENIKKEALSLSPRKAAALN
                     AKL"
     gene            <998670..>998963
                     /locus_tag="KLLA0_D11682g"
                     /db_xref="GeneID:2893004"
     mRNA            <998670..>998963
                     /locus_tag="KLLA0_D11682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453582.1"
                     /db_xref="GeneID:2893004"
     CDS             998670..998963
                     /locus_tag="KLLA0_D11682g"
                     /note="similar to uniprot|Q03067 Saccharomyces cerevisiae
                     YPL047W SGF11 11kDa subunit of the SAGA histone
                     acetyltransferase complex involved in regulation of
                     transcription of a subset of SAGA-regulated genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453582.1"
                     /db_xref="GeneID:2893004"
                     /db_xref="GOA:Q6CR57"
                     /db_xref="InterPro:IPR013246"
                     /translation="MTASLTTDSVADSIYQNILTSIIQDIISRQTVKRKLLKLQFPDA
                     KPYYADPSGTLDIHGKAKQADSAVYIECNVCGREVSGNRFAAHLVRCLSRGRR"
     gene            <999198..>1000388
                     /locus_tag="KLLA0_D11704g"
                     /db_xref="GeneID:2893589"
     mRNA            <999198..>1000388
                     /locus_tag="KLLA0_D11704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453583.1"
                     /db_xref="GeneID:2893589"
     CDS             999198..1000388
                     /locus_tag="KLLA0_D11704g"
                     /note="similar to uniprot|Q12508 Saccharomyces cerevisiae
                     YDR255C RMD5 Cytosolic protein required for sporulation
                     also required for the ubiquitination of the
                     gluconeogenetic enzyme fructose-1 6-bisphosphatase which
                     is degraded rapidly after the switch from gluconeogenesis
                     to glycolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453583.1"
                     /db_xref="GeneID:2893589"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR027711"
                     /db_xref="UniProtKB/TrEMBL:Q6CR56"
                     /translation="MSTLLETLDQQWVNSRLYVDKDERRTQLGKCVEEVHDFKIQLKK
                     LKAHLLKHGSSPQKRLVIREKLAKSHKNWDSSMKKSLNSSISTYRKFSKACVKPLNEF
                     QLDSVYVNKINPQKLYYLDTAIFSHIARYYTNMAVGTTSDEMLKYLHSTYRIPRSIAM
                     DYIEMANIVKEMRSGNLNTCIRWCQDNNLEVLHFQLHYLNAMSLLSENKPMECYLYIQ
                     TNLASTVSKSSQLRMARPVSALLAKIVIGDTIPASKVDAYLETCVECFTKQYCLQNKL
                     PLHSALFLVVLSGVIGFQVFTKYEAIRKVSHVDWSTADELPFHVKLPPFLSNYHPIFI
                     CPVLKEETTKENPPYSLPCHHVLSKKSLDKLSKNGTCNFKCPYCPVMSTKVKTKRVSF
                     MKLP"
     gene            complement(<1000442..>1000732)
                     /locus_tag="KLLA0_D11726g"
                     /db_xref="GeneID:2893279"
     mRNA            complement(<1000442..>1000732)
                     /locus_tag="KLLA0_D11726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453584.1"
                     /db_xref="GeneID:2893279"
     CDS             complement(1000442..1000732)
                     /locus_tag="KLLA0_D11726g"
                     /note="similar to uniprot|O13292 Saccharomyces cerevisiae
                     YPL046C ELC1 Elongin C forms heterodimer with Ela1p that
                     participates in transcription elongation expression
                     dramatically upregulated during sporulation widely
                     conserved among eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453584.1"
                     /db_xref="GeneID:2893279"
                     /db_xref="GOA:Q6CR55"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="UniProtKB/TrEMBL:Q6CR55"
                     /translation="MEEISLVSSTGDSRTVNRDVAMQSPTLKRMLESSFIESQGTIKL
                     EEFDTRILDKVIEYMEYSYKYKDADDDVEVPEFNVSPDISLDLLLAADYLGI"
     gene            <1000988..>1003369
                     /locus_tag="KLLA0_D11748g"
                     /db_xref="GeneID:2893232"
     mRNA            <1000988..>1003369
                     /locus_tag="KLLA0_D11748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453585.1"
                     /db_xref="GeneID:2893232"
     CDS             1000988..1003369
                     /locus_tag="KLLA0_D11748g"
                     /note="similar to uniprot|Q03308 Saccharomyces cerevisiae
                     YPL045W VPS16 Vacuolar sorting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453585.1"
                     /db_xref="GeneID:2893232"
                     /db_xref="GOA:Q6CR54"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="UniProtKB/TrEMBL:Q6CR54"
                     /translation="MDLNPSLNWERLQSLFYRSQTLQSIGRKPSATGLSVYLVAEPEK
                     TFVYNYTDELQLTLNHEALPSAHLKSVIEDDQLVVIMKDRVRVYLSLITEEFKEHNIL
                     DKERQPLSIWDYKDGIVITTDFRIYRIYHQEQLFPNLAFSLLLKDHWFTNKSQIVLLD
                     SSGTVIIGNILSKELRQFEGWTGWYKGSISENGFVCLVNAKLNNLIVFDDDLNKPLIE
                     VKLDELPKNIAWCANDLICCNFGDDEVRLIGSEKDYVSFWLPSHIVGLQSVSDGLKVI
                     TEDHIEFVSKVATYTSDIFSIGSTAPGAILLDSLNLLQNDENSPKAIENLKIINLKKA
                     VDECVSAAGDEINSIWQKRLLSAASFGKDSLSSTEFNASQFVITCNYLRVLNFLKTVG
                     IFLTLRQFISIGVEAIVLKLVNIRKIYESYQIIDHLKCPELIPVVFNEWSKGKILTSP
                     DSGNEALYQVVHDRALALNVQLQLSKVANIAFLDGRHSLARKLALDDQNLLPKVDILL
                     KMDEVNIATDEANKSMDIPVVLFLLLYSKRVMSTAQFTKNLIVTMKDNNVYQFFQRND
                     FPFLYDYFRQTDDYLSLARLIWKHGKEEGQESNSLLSQVSDLYGKFMTNADVKRDRTT
                     IERAKKLFLYQTDLSNKYGINFHNQTCDETLSTLIKVGQRNEVKRMINEFKISERKFY
                     FLKCSCLAKEHKLKELYSFSQEKKSPIGYLPFFKAVSKYANKKDAAIYVNMLSSLTYA
                     EKLDMYLDCKAYHEAISLASHERDAIGLKQVLNRIPQNETQLRSLAMQQLHSL"
     gene            complement(<1003388..>1004617)
                     /locus_tag="KLLA0_D11770g"
                     /db_xref="GeneID:2892980"
     mRNA            complement(<1003388..>1004617)
                     /locus_tag="KLLA0_D11770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453586.1"
                     /db_xref="GeneID:2892980"
     CDS             complement(1003388..1004617)
                     /locus_tag="KLLA0_D11770g"
                     /note="weakly similar to uniprot|P38907 Saccharomyces
                     cerevisiae YDR254W CHL4 Outer kinetochore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453586.1"
                     /db_xref="GeneID:2892980"
                     /db_xref="GOA:Q6CR53"
                     /db_xref="InterPro:IPR007902"
                     /db_xref="InterPro:IPR027716"
                     /db_xref="UniProtKB/TrEMBL:Q6CR53"
                     /translation="MDGEQHIIGTAKMERTLRNDNNNVDITVTKNKLARLGAQAIVKL
                     ITTWLDTHAINDSQLVSDNLVELVKKHGVRNIANMAVTSWWPSLSREQLSQLDIWSVL
                     CDTSTNQWVASRCLDRDGKQFIVNVEPNELINGMREQFKRLYELDVNIEENDDLSMYI
                     CRVQLFESTGDLIINTHKPFYFAIMPGHSIIFHSLQSDTHSQLILLAFSKLHSKTIRL
                     ERISRKPTTSLHELNLSLGLPSVNTTGYGIWSVYSGKDALEPSPLIEPKDHPINHTLS
                     DSLIKDQTRRRSDIAMLKFKGSISGVRRQRIYAMKRMNDRVYGNSDTNLKEITKYDSL
                     LPVRRVKFTYEDTKMKGKIQINLSGKDIFGGLHELSDKGLLDPVVMPDWLCGDYGDTS
                     GNVEDGVFTPNPVGGLI"
     gene            <1005079..>1007136
                     /locus_tag="KLLA0_D11792g"
                     /db_xref="GeneID:2893068"
     mRNA            <1005079..>1007136
                     /locus_tag="KLLA0_D11792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453587.1"
                     /db_xref="GeneID:2893068"
     CDS             1005079..1007136
                     /locus_tag="KLLA0_D11792g"
                     /note="similar to uniprot|P37838 Saccharomyces cerevisiae
                     YPL043W NOP4 Nucleolar protein essential for processing
                     and maturation of 27S pre-rRNA and large ribosomal subunit
                     biogenesis contains four RNA recognition motifs (RRMs)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453587.1"
                     /db_xref="GeneID:2893068"
                     /db_xref="GOA:Q6CR52"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CR52"
                     /translation="MSDKKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHA
                     VIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGKKDA
                     DEVSSAPSVDNVKDEEESKPEDDNDLMKGKPKLIIRNMPWSCRDPTKLKKIFGLYGTV
                     VEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAVDFAIQKNRWEDY
                     KNEHKELEASDEDEEEEEEDDDDDEDDGSDSGEEDADNQDDKEKEEKSDIVLDSDEEI
                     SEEEETPEQDTVKKNRKEDFSIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETG
                     LAKGTAFVAFRSEDAYNDCLNNAPATGSTSLLISDDVSPEYVYEGRVLAISPTLDRES
                     AGRMFERNAEKRKEVLGKAPGEKDRRNLYLLNEGRIVAGSKLSQLLTPADMEVREKSY
                     KLRVEQLKKNPTLHLSMTRLAIRNIPRAMTEKGLKALARKAVVEFAKEVNENKRHALN
                     KEEIVRSTKEKYKFMSEEEIEAQKKKDKKQGIVRQSKIIMEIKGSSGGRSRGYGFVEF
                     RDHKAALMCLRWLNAHEVSRDEILEGLTDDEKKQLDADSFKKRRLVVEFAIENANVVK
                     RRREKVKESRLISFKRKRDDEENKEEEKVAQPVEEETKSGLSNNIKQIIGSKRRRKNK
                     GRS"
     gene            complement(<1007240..>1009021)
                     /locus_tag="KLLA0_D11814g"
                     /db_xref="GeneID:2892704"
     mRNA            complement(<1007240..>1009021)
                     /locus_tag="KLLA0_D11814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453588.1"
                     /db_xref="GeneID:2892704"
     CDS             complement(1007240..1009021)
                     /locus_tag="KLLA0_D11814g"
                     /note="uniprot|Q70W23 Kluyveromyces lactis srb10
                     Cyclin-dependent protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453588.1"
                     /db_xref="GeneID:2892704"
                     /db_xref="GOA:Q6CR51"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /translation="MYGNQQNNSNPYQMSYYRMNNGQGQGTNRWPQQLSHQEMLAGHS
                     QQILNNNKPAGNQSKPPIVMASNNVFSIGPYRQRKDSSRISVLQKYEIIGYIAAGTYG
                     KVYKAKARDYQNGMNRDNVIILDSPDSVSADSNLDINSINRSTRQQEANDNLTTMDFR
                     KPSHKRFTPPNNSNSTQIRSNSGSETNVRINSSSITNNSRKPSQIQFYAIKKFKTERE
                     GVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHDLLQIIHFH
                     SHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLA
                     RKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLRPIFK
                     GEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEYLQLAKMPKYRDNLTA
                     WYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFTNGDPPVCENVFEGLNYKY
                     PPRRIHTNDNDITNVGNDNNQANHSQKQPMHGNNNNKNGNMNGLGVNKRILAAAAAAA
                     AAAAVSGNGNNPTSNTATGGSARKKRK"
     gene            complement(<1009428..>1010030)
                     /locus_tag="KLLA0_D11836g"
                     /db_xref="GeneID:2892928"
     mRNA            complement(<1009428..>1010030)
                     /locus_tag="KLLA0_D11836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453589.1"
                     /db_xref="GeneID:2892928"
     CDS             complement(1009428..1010030)
                     /locus_tag="KLLA0_D11836g"
                     /note="some similarities with uniprot|Q6LE92 Saccharomyces
                     cerevisiae YPL041C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453589.1"
                     /db_xref="GeneID:2892928"
                     /db_xref="InterPro:IPR018811"
                     /db_xref="UniProtKB/TrEMBL:Q6CR50"
                     /translation="MKLLQSLPGLGTSCSKMVIGNRYSIIQKRGPAKLFINGIRYNSS
                     KVEPSKIDDRLHRLIKKSKFLTRLNGNPRYKHYFDKLSEAGAVSTMTSFLILHEITAI
                     VPLFALWGLLYNLDLSDQYEMPVYFKDLLNKCGESIGKLIGDYDNGWDRDRLVVSGAL
                     AYAIVKVLYPARILFSLWAAPYVGTFVIMPFTKLRALIRR"
     gene            complement(<1010259..>1013231)
                     /locus_tag="KLLA0_D11858g"
                     /db_xref="GeneID:2892914"
     mRNA            complement(<1010259..>1013231)
                     /locus_tag="KLLA0_D11858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453590.1"
                     /db_xref="GeneID:2892914"
     CDS             complement(1010259..1013231)
                     /locus_tag="KLLA0_D11858g"
                     /note="similar to uniprot|P48526 Saccharomyces cerevisiae
                     YPL040C ISM1 Mitochondrial isoleucyl-tRNA synthetase null
                     mutant is deficient in respiratory growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453590.1"
                     /db_xref="GeneID:2892914"
                     /db_xref="GOA:Q6CR49"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR010663"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="UniProtKB/TrEMBL:Q6CR49"
                     /translation="MLRAFTTVRNASSHSYQKTLRLPKTKFPNRSNLQKTLDQLLPQS
                     SQQTYSQQYSKLLTKLSKIEQCPDDMKLQFLRENVFILHDGPPYANGDLHLGHALNKI
                     LKDIINRFQLLNGKHVVYIPGWDCHGLPIELKALNKLNDQLDRISPTKIRSIARAHAQ
                     KTIKSQRQQFEQFGILTNWDTNYVTMDPKFEINQLSVFQELFRKKLIKRQRKPVYWGT
                     ETKTALAEGELEYKEDHISIAAYVKFPLTEESKSVLGFPEAPVSFLIWTSTPWTLLSN
                     RAICFNQSLDYVLIKHNGEYMIVEKNLADKLDFLSGFELVKDLDGNFLSHLKYTNPIL
                     KDNVTRPLFHGDHVTSVTGTGLVHTAPGHGHEDYIIGIQNFLEIFSPVDHEGRYNVEE
                     LPAHLRDLLKEESGKGRKVLDRTTTEKILSVLKGENMLMHHHEYVHSYPYDWRSKKPI
                     IIRATPQWFADLHDVKTLALRALETVKFVPERGINRLSSFIKTRNEWCISRQRYWGVP
                     IPSLHKRDDPDSVLMNEETISHIIKTIESKGVNSWFAESTVDSMYQWLPKKYHDIAHE
                     YYRGTDTVDVWFDSGSSWNVIADWYKNVAGLQSQLPVPLADIYLEGSDQHRGWFQSSL
                     LTKVASSGMPDAPYKNVITHGFTLDENGIKMSKSIGNTISPGAIIKGDPKANLPALGV
                     DGLRLLVAQSNFTSDVVAGPTVMKHVADALKKFRLTFKFILGNLQETQSHGLIPFSEL
                     RRVDQYTLLNLKALSQETKKLYQQYNFSNVLTQVQYHMNNDLSALYFSVTKDSLYSDS
                     LNNKKRLSIQTTLFHILDTYRSIMSPIIPIMVQEVWNYTPKEWINENSSEGVAEIETP
                     FTRQWDSLQDVPSSNDERLESFASNELKILNIFTEKFNRMEDITKTLQVKATIYCSDP
                     SLLPFTAEEMEDLLQVGKLNIEHGNRSDLESISLPSVDIQLLLEESTSDKCPRCWKHN
                     SPSEDTLCNRCEEVINAL"
     gene            <1013755..>1014711
                     /locus_tag="KLLA0_D11880g"
                     /db_xref="GeneID:2892941"
     mRNA            <1013755..>1014711
                     /locus_tag="KLLA0_D11880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453591.1"
                     /db_xref="GeneID:2892941"
     CDS             1013755..1014711
                     /locus_tag="KLLA0_D11880g"
                     /note="some similarities with uniprot|Q03080 Saccharomyces
                     cerevisiae YPL039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453591.1"
                     /db_xref="GeneID:2892941"
                     /db_xref="UniProtKB/TrEMBL:Q6CR48"
                     /translation="MLELNGASPQHITQEEVVKIQQTQFQKPGLSASPMSGNFCSSTS
                     GRGGSMSPDPSMSNNTGQQTIMDLKKRYRYKVEMDKLSGFMLKNFCAGALIKYSRLFV
                     PVEFDSKQGKKQTCKAPAINLADLMKFVKILLTRVKATRHQFKKMCILSIKFFEACVK
                     SRENYMKYLKYDVRKVVVACLALTYPQGHTMANTEKSMLLVSSAAGVSNEQLRHCCEI
                     VGPILKSEFLKKQRQQYQTAHAQAQTGANESNHASQNNTASMRGSIATRTTVNIRSTD
                     FGTFTNCYTNQDDQETYLTPSDYESFNEMGKQMVNRTFLVKL"
     gene            <1015273..>1016142
                     /locus_tag="KLLA0_D11902g"
                     /db_xref="GeneID:2892770"
     mRNA            <1015273..>1016142
                     /locus_tag="KLLA0_D11902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453592.1"
                     /db_xref="GeneID:2892770"
     CDS             1015273..1016142
                     /locus_tag="KLLA0_D11902g"
                     /note="some similarities with uniprot|Q12041 Saccharomyces
                     cerevisiae YDR253C MET32 and some similarities with
                     uniprot|Q03081 Saccharomyces cerevisiae YPL038W MET31
                     Zinc-finger DNA-binding proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453592.1"
                     /db_xref="GeneID:2892770"
                     /db_xref="GOA:Q6CR47"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CR47"
                     /translation="MNEDSIFFQKAAEAIMVTSLNSEKVDPTIRELLNRVKYVSTPAP
                     PSQHQTNNLPFSALGSASSQYASLNKNHRNDIPYNNHPQGHNNIDGVGPAGVIAPENK
                     TILNYFDKLLSNPVNFANQNNDGTSHSTGHTPVNHNGMTPSLSHSNDTYHQRRASTEL
                     ENRSKKRKLPSKKILSGSSDTAIVPYDRDSTDGSNNADLDDKRFPCEKCHMVFRRSSD
                     LRRHERQHLPILPNICTLCGKGFARKDALKRHFDTQTCKRNRQKLLSIGGDINEILER
                     ARQSGATIYSGSK"
     gene            complement(<1016451..>1016927)
                     /locus_tag="KLLA0_D11924g"
                     /db_xref="GeneID:2893166"
     mRNA            complement(<1016451..>1016927)
                     /locus_tag="KLLA0_D11924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453593.1"
                     /db_xref="GeneID:2893166"
     CDS             complement(1016451..1016927)
                     /locus_tag="KLLA0_D11924g"
                     /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
                     YPL037C EGD1 Subunit beta1 of the nascent
                     polypeptide-associated complex (NAC) involved in protein
                     targeting associated with cytoplasmic ribosomes enhances
                     DNA binding of the Gal4p activator homolog of human BTF3b"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453593.1"
                     /db_xref="GeneID:2893166"
                     /db_xref="GOA:Q6CR46"
                     /db_xref="InterPro:IPR002715"
                     /translation="MPIDQEKLAKLQKLSANNKVGGTRRKFAKKSGSSSKDDSKLQDQ
                     LQKLRAVTVDNVQQANFFKDDGTVLHFNKVGVQVAPQHNTSVFYGIPQEKSLQELFPD
                     IIPQMGADAINALTQMASQLQSAQGANQQAAAPEAEGKDIDIPELVEGQTFEADVE"
     gene            complement(<1017503..>1020235)
                     /locus_tag="KLLA0_D11946g"
                     /db_xref="GeneID:2893147"
     mRNA            complement(<1017503..>1020235)
                     /locus_tag="KLLA0_D11946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453594.1"
                     /db_xref="GeneID:2893147"
     CDS             complement(1017503..1020235)
                     /locus_tag="KLLA0_D11946g"
                     /note="some similarities with Saccharomyces cerevisiae
                     YPL032C SVL3 Protein of unknown function mutant phenotype
                     suggests a potential role in vacuolar function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery cytoplasm bud and bud neck and with YDR251W
                     uniprot|P37304 Saccharomyces cerevisiae YDR251W PAM1
                     Essential protein of unknown function; exhibits variable
                     expression during colony morphogenesis; overexpression
                     permits survival without protein phosphatase 2A, inhibits
                     growth, and induces a filamentous phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453594.1"
                     /db_xref="GeneID:2893147"
                     /db_xref="GOA:Q6CR45"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:Q6CR45"
                     /translation="MSQLKVLIYGNHPNLALYAWRFQFAKSVDLYHVSDSKSNEFSIE
                     TQSYGTDTFRLQKHFNGFNELKLSLETDSEKFDLVILSASSLQEISSITTQLNSVIMN
                     NTKIFVESSGFVQLEPFIRMSVSSPQVKVFSLISDYDIRAVASNRYVQFNGGNKSKKQ
                     TIFIGETGSLKTQSASNSYPKQISSLLTTFHSLFLKLFPDDAIDTCNFSPLDFLTQQW
                     KLAIPRVCFDPLLVLFEEFVPKRLHQQILAKPLISGLVTEIITLTRTMGARLPSGYDT
                     ESDLLERWVADNGENNYPSLLYHFEHRSAPLDIDLLLLQPILLADDFTIKTPYLEFLY
                     SMMCQFKKLNNDESKLFTRSDKVSKLRDELGQLSLLKGTLKDKETEFNLKLNESKEAY
                     QNEINSRDSQISMLGDQLQREQSQNSSLRRELIAIQSELSTLRQLQSQNQSQTQSQSQ
                     PLSEPRTPVEPTSQVPEQQYTETGTPVLRDIEDMAVYAIPYAESPVQDSLGINGENPA
                     STNAAVAGASAAASAATPPSSAPLSADEHALRERELKLRRRELELQERELQLQKKQSK
                     TMLNQKYAHAQSKNGMSPNENPSQYSNQMQNRKLHGQSYMGKPPQGIPGQYMAPHVQQ
                     QPLQQVPQQHRQHSSVGLPGMPGVGGYSGSVVGINGGGQRPMNGFGISQNMLDGAAPM
                     GSNGFGPKTFQKTSRKNRRSNMPMLRNPSNTMLSDFNMPQAPTGQQRFNSLSGNLPPL
                     SMNYHNGSMPRLNGNPNPMRTGSQGQLSNLPTQPQQQYQPVPNGMRQISTSTMLDEGE
                     STASVIQRPPNAFQQQQQEQQFGSNSNSNPNSNVNLTSTSNSNSFSNSNSHSTSPPPL
                     ESDISSTNPPSSSKTNLSPVEPQDKLPSDSNNEQNQKSNELKKSKFSFFHSKKK"
     gene            <1021670..>1022782
                     /locus_tag="KLLA0_D11968g"
                     /db_xref="GeneID:2893162"
     mRNA            <1021670..>1022782
                     /locus_tag="KLLA0_D11968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453595.1"
                     /db_xref="GeneID:2893162"
     CDS             1021670..1022782
                     /locus_tag="KLLA0_D11968g"
                     /note="weakly similar to uniprot|Q03787 Saccharomyces
                     cerevisiae YDR249C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453595.1"
                     /db_xref="GeneID:2893162"
                     /db_xref="UniProtKB/TrEMBL:Q6CR44"
                     /translation="MGFIAAGYRTKDFQSVYSDREDWAICRRAKVRRSSNLLSRSSRR
                     KKCKVQDKPLTIRDLPSELIQKIFVFSGNHELYEVNKFFYTCLKPTSFLLHRFILENF
                     YHDLNRDLTSSKGNENGPVPAFHGLNGKVFENSVYVSFLNDNPHLIQEIGHIGHHEEL
                     TALQEERLALFQEGDLTGLDARHKELQKQDYPSIFYSEVEFFFQNDIQLKKPVYNQLI
                     LELSVHYEVKQPYFLIETLMHWFFHTNQGQYNINHLFHAIILVTHISSVLPSKSLDNN
                     GPLIELINNIYLTPAGQQLHELLLVDDYTDEEAFSRRRIRVLNKFINKFYKLEETRPL
                     LLSQDVLWETLVDVKDKHVMKLIMEYGGQPSINVIQ"
     gene            complement(<1022895..>1023944)
                     /locus_tag="KLLA0_D11990g"
                     /db_xref="GeneID:2893430"
     mRNA            complement(join(<1022895..1023792,1023928..>1023944))
                     /locus_tag="KLLA0_D11990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453596.1"
                     /db_xref="GeneID:2893430"
     CDS             complement(join(1022895..1023792,1023928..1023944))
                     /locus_tag="KLLA0_D11990g"
                     /note="highly similar to uniprot|P17157 Saccharomyces
                     cerevisiae YPL031C PHO85 Cyclin-dependent kinase with ten
                     cyclin partners involved in environmental stress response
                     in phosphate-rich conditions Pho85p-Pho80p complex
                     phosphorylates Pho4p which in turn represses PHO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453596.1"
                     /db_xref="GeneID:2893430"
                     /db_xref="GOA:Q92241"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MVAPSQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEE
                     GTPSTAIREISLMKELKHDNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSH
                     KGLEMDLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGI
                     PVNTFSSEVVTLWYRAPDVLMGSRNYCTSIDIWSCGCILAEMIMGKPLFPGSNDEEQL
                     KLIFDTMGTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHG
                     LLQLNPDARLSAKDALNHPWFAEYNHAN"
     gene            <1024590..>1026203
                     /locus_tag="KLLA0_D12012g"
                     /db_xref="GeneID:2893502"
     mRNA            <1024590..>1026203
                     /locus_tag="KLLA0_D12012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453597.1"
                     /db_xref="GeneID:2893502"
     CDS             1024590..1026203
                     /locus_tag="KLLA0_D12012g"
                     /note="similar to uniprot|Q2XN15 Saccharomyces cerevisiae
                     YPL030W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453597.1"
                     /db_xref="GeneID:2893502"
                     /db_xref="GOA:Q6CR42"
                     /db_xref="InterPro:IPR011671"
                     /translation="MTSNTLHYTVEKSSILGPEWQSLYSTAEPVDFDKSHFEQAMLNV
                     IRQPNVNSTVILRADMLIDNEYDLESGSCVKSEKKDIALGSDEGILKVNIDDLAPRSV
                     PIALADVTTKFQFVRRIVPRNPFKDAIINQTCLVMNSNSDASTSLVIYIPHFDNAELC
                     PFYIPQVAAVGILLHDHQLSVHYIPFAGQKELLFDPKQRVVRTAFRLLQTAYKHSKGV
                     KDGYAKRVMHDVVVDKVLFQDQYIHLKKKYSKFLVDNWAESTDPKKHVFEDIAIAAFL
                     IELWKKIYGAENTTNKMQFRDLGCGNGVLCYILIQEGFKGLGIDARQRKSWSIYPAEV
                     KRCLKEQVIIPSVLLRPHPTMKLHAPHLQHNGRFFPMQLVSPQLIAPATVMYSSADLL
                     QSPQVNIAEFPPDTFIIGNHSDELTCWIPLLGYPFMVIPCCSHNLSGNRIRYAVRDVE
                     RAKKLGNSTYQGLVDRVEYLADRVGWKTEKEMLRIPSTRNAAIIGYKNDKLNEFPTDE
                     IYSILMEEGGADGWVANTMNLMKSNPRGH"
     gene            <1026586..>1028841
                     /locus_tag="KLLA0_D12034g"
                     /db_xref="GeneID:2893528"
     mRNA            <1026586..>1028841
                     /locus_tag="KLLA0_D12034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453598.1"
                     /db_xref="GeneID:2893528"
     CDS             1026586..1028841
                     /locus_tag="KLLA0_D12034g"
                     /note="similar to uniprot|P32580 Saccharomyces cerevisiae
                     YPL029W SUV3 ATP-dependent RNA helicase component of the
                     mitochondrial degradosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453598.1"
                     /db_xref="GeneID:2893528"
                     /db_xref="GOA:Q6CR41"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CR41"
                     /translation="MLKLYPSLIRSIPLRIFRDVSPVIWTRFQSSYVDKSLPFTSPKW
                     LVNKPKFMHLPEEEQRGVSVIPLKFDPKDSKLVENNAYLNDDEFRKNLNNALTLVHSN
                     LLTGYTEFDVSNSNATWLRLREFLYQELSRYSHKSFSSSSTLTISSLLKPTNPKELVQ
                     HLLSVDQISADTWKSILQRQEFSTVDQYYFILKNYFSFIKEQEIIPQMTPSWSLVDRG
                     LDISNPSEWFPEARKLKRTIIMHVGPTNSGKTYNALQKLKNCPRGYYAGPLRLLAREV
                     YDRFQNEGIRCNLLTGEEVIEDLDAMGNPAGLTSGTVEMIPLNRDFDICVLDEVQMLS
                     EKDRGWAWTNAILGVRAKEIHLCGEESVLPLMDKIVKLTGDTLVVNRYERLGKLEVEH
                     QPLANGLKGLKSGDCVIAFSKKSILDLKLRIEKETNLKVAVVYGSLPPETRVKQAKLF
                     NSGEYDILVASDAIGMGLNLSINRVVFTASYKFNGVEVVPLTFSNIKQIGGRAGRFKG
                     KKADGSSKESIGHVTAIDEDILRDVRKGINAPIQYLEKAVVWPTDELVNDLLSYYPPG
                     MKLTVLLNKFKTDILKSSTKSFELSYIDDKSKVVSTFEDMRGLTLKDKLRLSNAPVRI
                     NPMVMNIFKKFCETIAERRTMSLLNYPLPFLMLHSRHIKDENVSLEFYEEFHQLINLY
                     CWLHIRYPNLFVDYESAIDIKNHCEMMIFKKLEFLKKNPYKKFNKRSQSKNSSPKNRY
                     ATKKSYRSNSY"
     gene            <1029222..>1030418
                     /locus_tag="KLLA0_D12056g"
                     /db_xref="GeneID:2893283"
     mRNA            <1029222..>1030418
                     /locus_tag="KLLA0_D12056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453599.1"
                     /db_xref="GeneID:2893283"
     CDS             1029222..1030418
                     /locus_tag="KLLA0_D12056g"
                     /note="highly similar to uniprot|P41338 Saccharomyces
                     cerevisiae YPL028W ERG10 Acetyl-CoA C-acetyltransferase
                     (acetoacetyl-CoA thiolase) cytosolic enzyme that transfers
                     an acetyl group from one acetyl-CoA molecule to another
                     forming acetoacetyl-CoA involved in the first step in
                     mevalonate biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453599.1"
                     /db_xref="GeneID:2893283"
                     /db_xref="GOA:Q6CR40"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q6CR40"
                     /translation="MSDNVYIVAAARTPIGSFQGSLSSKNCVDLGSAAVKGALAQVPE
                     IDPSTVEEIIFGNVISANVGQAPARQVALAAGLGKHIVASTVNKVCASGMKAIILGAQ
                     AIKTGSADIIVAGGAESMSNAPYYLSSHRSGARFGESKVIDGIQRDGLNDAYDGQAMG
                     VHAEKCASDYDFSREEQDDFAIQSYQKAQLAQSQGKFDKEIVPITIKGFRGKPDTQVT
                     KDEEPSKLNVEKLRSARAVFAANGKGTVTAPNASPINDGGAAVILVSEKKLKELNLKP
                     LALIKGWGEAAHEPADFTWAPSLAVPKALKHAGVPDISSVDFVELNEAFSVVGLVNTK
                     KLGIDAAKVNVYGGAVALGHPLGCSGARVVVTLANILNQENGKIGVAGICNGGGGASS
                     IVLERV"
     gene            <1030847..>1031392
                     /locus_tag="KLLA0_D12078g"
                     /db_xref="GeneID:2893284"
     mRNA            <1030847..>1031392
                     /locus_tag="KLLA0_D12078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453600.1"
                     /db_xref="GeneID:2893284"
     CDS             1030847..1031392
                     /locus_tag="KLLA0_D12078g"
                     /note="similar to uniprot|Q03786 Saccharomyces cerevisiae
                     YDR248C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453600.1"
                     /db_xref="GeneID:2893284"
                     /db_xref="GOA:Q6CR39"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR006001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CR39"
                     /translation="MNDRPTIYVIGGTCGTGKSTIAERVHQRLHENNPKIEFIEGDLL
                     HPAENIRKMSHGIPLHDDDRWGWLEKVSDDSYKKSEECDTCIVTCSSLKKSYRDYIRS
                     KHPEGRFVFFMLYGAKSEILKRMLQRESHFMKADMVDSQFNDLQLPAEDEQDSFVINV
                     TSLSVEEVVDEIMKKINASLS"
     gene            complement(<1031728..>1033161)
                     /locus_tag="KLLA0_D12100g"
                     /db_xref="GeneID:2893508"
     mRNA            complement(<1031728..>1033161)
                     /locus_tag="KLLA0_D12100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453601.1"
                     /db_xref="GeneID:2893508"
     CDS             complement(1031728..1033161)
                     /locus_tag="KLLA0_D12100g"
                     /note="similar to uniprot|Q12505 Saccharomyces cerevisiae
                     YPL026C SKS1 multicopy suppressor of snf3 and grr1 mutants
                     serine/threonine protein kinase homologous to Ran1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453601.1"
                     /db_xref="GeneID:2893508"
                     /db_xref="GOA:Q6CR38"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CR38"
                     /translation="MLNNCQINNFQITRQIGSGAYGVVFHAIDLITENEYAIKAIMKS
                     NDDPLVPHSETSLKKSAVLQTQLYHYFKSFQNKLFLPTIDLDSVLALSDDQLRQAPHY
                     RELQLQLKCHSHQNVVTIHQILESSLATFVVMDYYPIDLFTSIVENQHFCNDGMLVKK
                     AFLQVCSVLHHCHSVGVYHCDIKPENILLDDNDNVKLCDFGLATTAPFINANVCIGSS
                     YYMAPERVSCPSSVLHSAENQNNLGIHVFPTASGDIWSLGIILINLTCTRNPWLKAHQ
                     KDDNTFKYFINDSRVLTKILPLSEELFGILNSILQVDPSKRTDLISLIDSVSKCQHFT
                     SSGPLAEVAPLTQHQLNCFICGDDTMMIKNMLSRFDTRNRELKEDEELSESSDEVCKE
                     YDIDGNSNLPSYSSEEDFELIQDGNLINAPFPNTGITPNGFLNQDDSKFWLKMQYSQF
                     NLSNTPTTGSQGANALNSTLDSWLPHY"
     gene            complement(<1033231..>1033581)
                     /locus_tag="KLLA0_D12122g"
                     /db_xref="GeneID:2893285"
     mRNA            complement(<1033231..>1033581)
                     /locus_tag="KLLA0_D12122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453602.1"
                     /db_xref="GeneID:2893285"
     CDS             complement(1033231..1033581)
                     /locus_tag="KLLA0_D12122g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453602.1"
                     /db_xref="GeneID:2893285"
                     /db_xref="UniProtKB/TrEMBL:Q6CR37"
                     /translation="MGNLAMSSDTRRSPTENGYSSKCLWSYHHAIRRIAESCLFCTDG
                     ALHGYILVCMVSGTEKLKVEPGPDSIGRMIV