GenomeNet

Database: RefSeq
Entry: NC_006041
LinkDB: NC_006041
Original site: NC_006041 
LOCUS       NC_006041            2234072 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Kluyveromyces lactis strain NRRL Y-1140 chromosome E complete
            sequence.
ACCESSION   NC_006041
VERSION     NC_006041.1
DBLINK      BioProject: PRJNA12377
            BioSample: SAMEA3138170
            Assembly: GCF_000002515.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Kluyveromyces lactis
  ORGANISM  Kluyveromyces lactis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1  (bases 1 to 2234072)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 2234072)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2234072)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382125.
            This is an updated version of the complete genome sequence. The
            Kluyveromyces lactis sequence is made of 6 chromosomes (A to F).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2234072
                     /organism="Kluyveromyces lactis"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-1140"
                     /db_xref="taxon:28985"
                     /chromosome="E"
     gene            <2681..>3727
                     /locus_tag="KLLA0_E00111g"
                     /db_xref="GeneID:2894259"
     mRNA            <2681..>3727
                     /locus_tag="KLLA0_E00111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453953.1"
                     /db_xref="GeneID:2894259"
     CDS             2681..3727
                     /locus_tag="KLLA0_E00111g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453953.1"
                     /db_xref="GeneID:2894259"
                     /db_xref="GOA:Q6CQ36"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ36"
                     /translation="MSSHPFQVIDLCAPAEETSRLLLEAANTQGFLFIDGHSFSQQQV
                     DALFRLSMEYFTNTPHHEKLQYAFDVAKNYGYTDYTREQGDPSKAKDFKECYNFGSIN
                     FSNGTYNGQSRSTSENCMQHGEVPPLFTYHNDLIVDSIKKFHELARNIMGLFTVALGI
                     IQEDFFVSRFSDDKKNGCVMRLLHYPLFRDDGVDGSSGIDPTLRIGPHSDYGALTLLL
                     QKEGEQGLEVQLDPGCDQWTKVPFLTSRYEGSAPPIVVNFGDMLSFWTKGVIRSTKHR
                     VKIDPGETRSSDRYSIVFFTHPDADTTLDPVPSRVIESNSNGIGAPPVTAYEYLSAHL
                     SRVINSIPSHDGMV"
     gene            <4528..>6051
                     /locus_tag="KLLA0_E00133g"
                     /db_xref="GeneID:2894148"
     mRNA            <4528..>6051
                     /locus_tag="KLLA0_E00133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453954.1"
                     /db_xref="GeneID:2894148"
     CDS             4528..6051
                     /locus_tag="KLLA0_E00133g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453954.1"
                     /db_xref="GeneID:2894148"
                     /db_xref="GOA:Q6CQ35"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ35"
                     /translation="MSATLQSIMSENNTTFREKGEAATSLETSNISSAGELKDPGRLE
                     KEQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYY
                     MDSGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALL
                     AAFSTKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIV
                     FNLSTQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDM
                     FKYPVIWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPL
                     VGLAADKFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTS
                     IITRLVGLPKLEAVYSVVWMFLGVCAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTA
                     YLLAALALWCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
     gene            complement(<6738..>6956)
                     /locus_tag="KLLA0_E00155g"
                     /db_xref="GeneID:9487526"
     mRNA            complement(<6738..>6956)
                     /locus_tag="KLLA0_E00155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999339.1"
                     /db_xref="GeneID:9487526"
     CDS             complement(6738..6956)
                     /locus_tag="KLLA0_E00155g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999385.1"
                     /db_xref="GeneID:9487526"
                     /db_xref="UniProtKB/TrEMBL:Q6CLV2"
                     /translation="MVSWECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNV
                     SAYFENGSFYRWESFATVAATSDFFASH"
     gene            <8041..>8481
                     /locus_tag="KLLA0_E00177g"
                     /db_xref="GeneID:2894039"
     mRNA            <8041..>8481
                     /locus_tag="KLLA0_E00177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453955.1"
                     /db_xref="GeneID:2894039"
     CDS             8041..8481
                     /locus_tag="KLLA0_E00177g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453955.1"
                     /db_xref="GeneID:2894039"
                     /db_xref="UniProtKB/TrEMBL:Q6CLV0"
                     /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLEFDMVSNS
                     TSVCFNSTNYAIDVSELPLPEWLDDWDSLLLAMPCGDEIFVSVPKDLDSNTTAKILAY
                     SLASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVQN"
     repeat_region   8493..8906
                     /rpt_type=long_terminal_repeat
     gene            <9200..>10468
                     /locus_tag="KLLA0_E00221g"
                     /db_xref="GeneID:2893994"
     mRNA            <9200..>10468
                     /locus_tag="KLLA0_E00221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453956.1"
                     /db_xref="GeneID:2893994"
     CDS             9200..10468
                     /locus_tag="KLLA0_E00221g"
                     /note="similar to uniprot|Q06598 Saccharomyces cerevisiae
                     YPR201W ARR3 Arsenite transporter of the plasma membrane
                     required for resistance to arsenic compounds transcription
                     is activated by Arr1p in the presence of arsenite"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453956.1"
                     /db_xref="GeneID:2893994"
                     /db_xref="GOA:Q6CQ33"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ33"
                     /translation="MKEFFVTGENTLKGGEDAQNSEVLDGQKKARSMVYSTIKSVSYL
                     DLLLPFTILLCMIVSILISVYVPSSRHTFDAENHASLVNVSIPLAIGMIVMMIPPICK
                     VSWESIHKYLKEKYVWRQLLLSLILNWIFGPLLMTALAWLALFEHKEYREGIIMIGIA
                     RCIAMVLIWNQIAGGDNDLCVVLVVCNSVLQMVLYAPLQLLYCYVISNDHFQGSYNAM
                     FSEVAKSVSAFLGIPLCCGILIRLIFVYSIGKHNYEKHILKYISPWAMIGFHYTICIL
                     FVSRGYQFIHEIGSAFLCFIPLVLYFILAWSFTFVLMRYLTNTKPSDDEKCECDQEQL
                     LLKKSWGKKTCSSNYPITMTQCFTTASNNFELSLAVAISIYGNDSQQAIAATFGPLLE
                     VPILMILAIFARYLRIRFIWRDDVIPKVER"
     gene            <11467..>11862
                     /locus_tag="KLLA0_E00243g"
                     /db_xref="GeneID:2893758"
     mRNA            <11467..>11862
                     /locus_tag="KLLA0_E00243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453957.1"
                     /db_xref="GeneID:2893758"
     CDS             11467..11862
                     /locus_tag="KLLA0_E00243g"
                     /note="similar to uniprot|Q06597 YPR200C Saccharomyces
                     cerevisiae ARR2 Arsenate reductase required for arsenate
                     resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453957.1"
                     /db_xref="GeneID:2893758"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ32"
                     /translation="MDCEELSRIISDNSEQVQVIDLRIEDFLAGHIKGAWQVPVRKDI
                     TDEQLGSLLTKLQNAFPNEIPVTVVFHCTASKNRGPRTKQRFEQYCEALGVSRKFRAF
                     VLTGGYYAWEEYCKLSETPNCLMPNISTS"
     gene            <12033..>12899
                     /locus_tag="KLLA0_E00265g"
                     /db_xref="GeneID:2894732"
     mRNA            <12033..>12899
                     /locus_tag="KLLA0_E00265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453958.1"
                     /db_xref="GeneID:2894732"
     CDS             12033..12899
                     /locus_tag="KLLA0_E00265g"
                     /note="weakly similar to uniprot|Q06596 Saccharomyces
                     cerevisiae YPR199C ARR1 Transcriptional activator of the
                     bZIP family required for transcription of genes involved
                     in resistance to arsenic compounds"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453958.1"
                     /db_xref="GeneID:2894732"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ31"
                     /translation="MSKPRGRNGGRKPSSSPPKDKRTAQLRKSQKTYRERRINRLREL
                     EYKEKLLEQTLSDLSEVTKRNNVLNAMLQSSLSKTPACHISSFGVERPNIPGYTLTKE
                     LCNLQHSQVKHYTSQDYRQLYNTITEDLYSLCEGKDCGPFCRTSSITPSTTTLDIMND
                     TNTFYSTECSPSYGFDNNLIESFDLFDFIENLQNPVSPQSRNCPASSPKLATNHYVAK
                     SEDSYISGLLSTSVLLPGADICYFVLSFRQTHFFDLSEMLLKLKKEAVCINHDVVISL
                     DALVRLITSCFV"
     gene            <15302..>16837
                     /locus_tag="KLLA0_E00287g"
                     /db_xref="GeneID:2894260"
     mRNA            <15302..>16837
                     /locus_tag="KLLA0_E00287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453960.1"
                     /db_xref="GeneID:2894260"
     CDS             15302..16837
                     /locus_tag="KLLA0_E00287g"
                     /note="weakly similar to uniprot|P23585 Saccharomyces
                     cerevisiae YMR011W HXT2 High-affinity glucose transporter
                     of the major facilitator superfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453960.1"
                     /db_xref="GeneID:2894260"
                     /db_xref="GOA:Q6CQ29"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ29"
                     /translation="MTSEKTVEYTEAVTKIDSSSRQYEKSTKNFFINLKESFNLTMTL
                     SSLLLICSSFSHGFDNQGFATIQAMDSFIEKFGQYDAQTGAYAIPPVFLSFLNSFQYI
                     GFAFGLVCGSIVSSRFGRKICVLSMSLYALITATIGITSNSKEQILSARVLNYVFIGM
                     EMAVIPVFQAEIVPPNTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGL
                     YYIFPSVIASLVMFIPESPRWLILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISS
                     VEAEKQEKSKYTELFTGTNKRRTLIVILANIFQQVTGQAFASQYGTIFIKSLNTVDPF
                     QMSIVSSVVAIVAVIIVLLFTDEFGRKKFLVIGSVIQAIALLVMGGLGTGDVTTAKKN
                     GIVATMMINSFAYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPY
                     LLSKPYANLQSKVGFIYGAFTVLSVVFSYYLPECRGLSLEEIESNFVNKVPLNRFSKN
                     SIS"
     gene            <17100..>18608
                     /locus_tag="KLLA0_E00309g"
                     /db_xref="GeneID:2894062"
     mRNA            <17100..>18608
                     /locus_tag="KLLA0_E00309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453961.1"
                     /db_xref="GeneID:2894062"
     CDS             17100..18608
                     /locus_tag="KLLA0_E00309g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453961.1"
                     /db_xref="GeneID:2894062"
                     /db_xref="GOA:Q6CQ28"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ28"
                     /translation="MSPKPNLILFMPDQLRYDCIGANGNQKIQTPNIDRLTKLGARFS
                     NCYLQHSVCSQSRASMFTGKYPHVTGHRGLTTLIKPYEDNLFKSLKNDGYFVVNVGTR
                     GDLFSAGGYEESFDEYGFTVKTNYDIFKKNRSLEKPSFQDIQVDWPRLYYSGNRGDDL
                     KIDYDEAVISSAEKWLKAFKKDSSLTDGKPWVLFLPLFFPHCPFEVEEKWYNMYSRED
                     VPARVKIETKTGGEPLYMRRLREKHGLIDLPERVWNEAIATYYGMISRLDWQFGRILN
                     LVEDELKNNLFLFFFTDHGEYLGDHNLIEKWPSGVSEQLTHGPLFIAGPEVEKGRTIN
                     HLVEMLDLVPTIFDLGKVETRYPNNGKSLVPLLSAQSTNDIIHKEYVVTEGGFLKSEE
                     PIIEIAPFPYDIKANLQHDEIDTVGRVISMRTKEFTFVYRLYEPNELYNRIDDLDERH
                     NLIAEPSYTSTVDAFEKKILKFFIESSDHAPFVSDVRIPEVNLPLPGSKEFK"
     repeat_region   18831..19164
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(20686..20764)
                     /rpt_type=long_terminal_repeat
     repeat_region   20860..21231
                     /rpt_type=long_terminal_repeat
     gene            <23256..>25637
                     /locus_tag="KLLA0_E00397g"
                     /db_xref="GeneID:2894061"
     mRNA            <23256..>25637
                     /locus_tag="KLLA0_E00397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453962.1"
                     /db_xref="GeneID:2894061"
     CDS             23256..25637
                     /locus_tag="KLLA0_E00397g"
                     /note="highly similar to uniprot|P40897 Saccharomyces
                     cerevisiae YJL212C OPT1 Plasma membrane transporter that
                     transports tetra- and pentapeptides and glutathione member
                     of the OPT family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453962.1"
                     /db_xref="GeneID:2894061"
                     /db_xref="GOA:Q6CQ27"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ27"
                     /translation="MSVIYRGTHSEESDGRASDSSSLSQIQLQITVKNENTISLEKDI
                     KEEELVNESEFHDSESIDEDDGLVWKGDPTYLPNSPYPDVRFAVSIEDDPTIRLNHWR
                     TWFLTTIFVVVFAGVNQFFSLRYPSLSIDFIVAQVICYPIGKVLAKLPDWKCRRVPFF
                     DLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMI
                     GYGAAGLTRRWVVNPASAIWPQTLISVSLFDSLHSRKIERAVVNGWSMPRYKFFVIVF
                     IASFVWYWVPGFLFTGLSYFNVILWGPKTRDNFVANTIFGVESGLGAFPISFDYTQIS
                     QAMSGSVFATPFYVSANTYASVLLFFVIILPCLYFSNTWYAKYMPVISGSTYDNTQSK
                     YNVTKILNEDYSINLEKYKNYSPIFVPFSYLLSYALNFAAVIAVFVHCILYHGKDILA
                     KLKDRRNGGTDIHARIYSKNYADCPDWWYLVLQVVMIGLGFVTVCAFDSKFPAWAFVI
                     AILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMRQG
                     LNLSRDLKLAMYMKVPPRLIFFIQIYATILSGMVNVGVQEWMTHNIEGICSTDQSNGF
                     TCANGRTVFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLVVPLIVYAIQRKFPKIQFA
                     KYIHTPVFFTGPGNIPPSTPYNYSLFFSASFCLHIIRKRWGPWFKKYNYVMGAAVESG
                     VAIAVVIIFLCVQFPGAELNWWGNNVWKNTYDHNYKKFYTLEEGQTFGHTKWW"
     gene            <28957..>31341
                     /locus_tag="KLLA0_E00419g"
                     /db_xref="GeneID:2893724"
     mRNA            <28957..>31341
                     /locus_tag="KLLA0_E00419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453963.1"
                     /db_xref="GeneID:2893724"
     CDS             28957..31341
                     /locus_tag="KLLA0_E00419g"
                     /note="similar to uniprot|P40897 Saccharomyces cerevisiae
                     YJL212C OPT1 Plasma membrane transporter that transports
                     tetra- and pentapeptides and glutathione member of the OPT
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453963.1"
                     /db_xref="GeneID:2893724"
                     /db_xref="GOA:Q6CQ26"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ26"
                     /translation="MNHIKSVLSADAPVTEKVLLDVGQERSFINSSDDNLNLEDKKRG
                     LEVNVFAARSDYLLGSQLSHEVIEDEYAGIVVEDDSAYPEVRAAVPSSDDPTLPQNTV
                     RMWVIGMLMATVGSGLNLLFSLHSPSIVLSAFVTSILAWPIGKAWDKVMPDVKLFGRF
                     GGPSLNPSPFNLKEHCLIQIMANVSFGGGEAYATDIFLAMNNYFEADFGWGFDIVTIL
                     ATQCIGFALAGLVKDILITPASMIWPSNLVTCTFLTNLHINENHMANGWKISRLKFFF
                     MVFIIGFVYYWFPGFIFQALSYFAWVTWIRPDNVIINQIFGASTGLGIIPLTFDWNQI
                     AGYVGSPLVPPVSTIFSILLSMIMIFWVTVPAIHYSNVWFGKYLPISDSGSYDRFQQS
                     YNVSKIVTPNLSFDIDAYKSYSPLYLPATFVISYGMSFASNTATLVHAGLFHGKEITG
                     AFRNVKKEQEDIHNRLMKNYRDVPHWWYGIVFLVFFGLAIAGIRAWNTEMPVWALIFA
                     LVIAGVFLVPIGIICAVTSISVGLNVLTEFIIGYILPGKPIAMMFFKTFGYITNHQAV
                     TYAQDMKLGHYMKIAPRLMFSAQFIATVWSSVVQVCVLKWAQGNITDVCDAHQKSHFT
                     CPNARVFFNAAIIWGVIGPQRMFSSGQLYSKVLWFFLIGASLPLINWLVLKKWPKSPI
                     KYLNWPVFFSGTGLIPPATPYNYGSYCMVGITFGYFIKRKWFHWWTKYNYSLSAALDI
                     SLAWSSLMIFFCLTLTNTNAPNWWGNTVIDTIDYEGTAIQSILNDGESFGLTKW"
     gene            <32524..>34200
                     /locus_tag="KLLA0_E00441g"
                     /db_xref="GeneID:2894596"
     mRNA            <32524..>34200
                     /locus_tag="KLLA0_E00441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453965.1"
                     /db_xref="GeneID:2894596"
     CDS             32524..34200
                     /locus_tag="KLLA0_E00441g"
                     /note="similar to uniprot|P38732 Saccharomyces cerevisiae
                     YHL039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453965.1"
                     /db_xref="GeneID:2894596"
                     /db_xref="InterPro:IPR017119"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ24"
                     /translation="MVKEAALERLLVHAKKNNCEISDDLEFRIDPVTGVGAYLKHKLH
                     NKEALIKISQDFILTKAEALQYFEIDSCSSSNPNAITQLYLIALQSNQSAKWQPYLDV
                     LPSLDDISSPLVWQPHELEIIRGSDLYIKTKRKLASLLDEWYEILTELNLCSEKAKKY
                     YELQDRDNIAVEKCYSVDSFAAYLWAHLIFSSRAFPSIIYDNSAGLEEGFLLPIVDLL
                     NHKSDTKVHWKSEGSFITFSSEEIIEAKGELYNNYGDKSNEELLLGYGFAIDSNPHDA
                     TSISLKLDEKTLSEASNYGTEINPNNVSGDSVRFDISLKDPLPVPLIKLFGFISKLKS
                     EKNITVRAVLEGLDQLYALLHQKIAIFKAKTKFESHNIRNESIIKNAKIYLTGQRRLF
                     HSSQEELQREMKAIMKIYKPVSFKSIYKLDPEFSSSLSSCLNVSSYEELVKKGLAQHA
                     LLLWIVKAHNAKFYKSPHSPSFVSDTFNDVERNITIEKDDVLEYMQFYQAFFPNLSQM
                     FPKVYSVGSWSIKDFIIAGVVMDRIVWLRMASNEYFLFEKQTFDFKRSYS"
     gene            complement(<34713..>35664)
                     /locus_tag="KLLA0_E00463g"
                     /db_xref="GeneID:2894462"
     mRNA            complement(join(<34713..35130,35651..>35664))
                     /locus_tag="KLLA0_E00463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453967.1"
                     /db_xref="GeneID:2894462"
     CDS             complement(join(34713..35130,35651..35664))
                     /locus_tag="KLLA0_E00463g"
                     /note="highly similar to uniprot|Q03048 Saccharomyces
                     cerevisiae YLL050C COF1 yeast cortical cytoskeleton
                     component mammalian cofilin homolog Cofilin actin binding
                     and severing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453967.1"
                     /db_xref="GeneID:2894462"
                     /db_xref="GOA:Q6CQ22"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /translation="MSRSGVAVADESLNAFNDLKLGKKYKFILYALNDSKTEIIVKET
                     SAEQDYDKFLEQLPENDCLYAVYDFEYELGNNEGKRSKIVFFTWSPDTAPVRSKMVYA
                     SSKDALRRALNGVSSDIQGTDFSEVAYESVLEKVSRAAGSH"
     gene            <36083..>36628
                     /locus_tag="KLLA0_E00485g"
                     /db_xref="GeneID:2894057"
     mRNA            <36083..>36628
                     /locus_tag="KLLA0_E00485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453968.1"
                     /db_xref="GeneID:2894057"
     CDS             36083..36628
                     /locus_tag="KLLA0_E00485g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453968.1"
                     /db_xref="GeneID:2894057"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ21"
                     /translation="MIPDTVVLINRLVDRVNTLELTLGEYSINDMRIRGALAELQKNS
                     QLILKNGDKNLKEMHRYLIAFGNNSHLGANEAQVWFEAHHSELLKMLDMLMNLDTKLT
                     ESLDLTLGSFGSRIPDCVLELTQLHNVTRTVIQLVLKSFLVINRFICLSTQQEEMILD
                     VESRLNRLHGILRCSESEVSI"
     gene            <37469..>39076
                     /locus_tag="KLLA0_E00507g"
                     /db_xref="GeneID:2894463"
     mRNA            <37469..>39076
                     /locus_tag="KLLA0_E00507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453969.1"
                     /db_xref="GeneID:2894463"
     CDS             37469..39076
                     /locus_tag="KLLA0_E00507g"
                     /note="similar to uniprot|P38734 Saccharomyces cerevisiae
                     YHL036W MUP3 Low affinity methionine permease, similar to
                     Mup1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453969.1"
                     /db_xref="GeneID:2894463"
                     /db_xref="GOA:Q6CQ20"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ20"
                     /translation="MEDTHLIEGSKAPLYIIESERDSTEDLSKNVSSLISDNEVPQGR
                     HLGIFSTVILFVSRIVGGGIYSVPSSVFVNCGGNVSLFLFVWLCAAVMAFIGMSMFLE
                     LGTILPKSGGRKNFLEFLYDKPPMMTTVILCTYCLMTCFAMSPAMILGKYILYALGYG
                     EDFVNKESYASNYIGIAAIMVIVFVHGLSLNHGLIIQNILGIIKLVIVLLMSLAGMYV
                     TLFYHNASYDITQPSLLFSAAVQSSEAISSASLTSAFIQCFYCFAGWDTVHTVTSEIK
                     DPNRTLKLAGPLSLLMALICYLSLNIAYIKVLTYEEIKNAGPLLGSVLFSKIFGKAVG
                     AQFINISIILSAISNLFVTVYGISRMNQEIFREGLFPFSAQLARNWPCNSPLPSLLIC
                     GIVSSFWLYLLPGTGAAFDYLINFEGYGNQIMLLLVAAGLLVRRERLKRYQFPSRTPI
                     VGVVAFLLLSVYLSVGPFFGNGTGNSVGKFPSYQYAAIFLFALSVGFWFMKFVLLPRL
                     FKYTLRSTVVVQNDGLTVVDWRRHPVE"
     gene            complement(<39173..>44125)
                     /locus_tag="KLLA0_E00529g"
                     /db_xref="GeneID:2894005"
     mRNA            complement(<39173..>44125)
                     /locus_tag="KLLA0_E00529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453970.1"
                     /db_xref="GeneID:2894005"
     CDS             complement(39173..44125)
                     /locus_tag="KLLA0_E00529g"
                     /note="similar to uniprot|P32386 Saccharomyces cerevisiae
                     YLL048C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453970.1"
                     /db_xref="GeneID:2894005"
                     /db_xref="GOA:Q6CQ19"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ19"
                     /translation="MSGSNSNSNLDAISDSCPFWRYDDITECGRVQYINYYLPITLVG
                     VSLLYLFKNAIQHYYRKPQEIKPSVASELLGSNLTDLPNENKPLLSESTQALYTNPDS
                     NKTGFSLKEEHFSINKVTLTEIHSNKHDAVKIVRRNWLEKLRVFLEWVLCALQLCIYI
                     SVWSKYTNTQEDFPMHASISGLMLWSLLLLVVSLRLANINQNISWINSGPGNLWALSF
                     ACYLSLFCGSVLPLRSIYIGHITDEIASTFYKLQFYLSLTLFLLLFTSQAGNRFAIIY
                     KSTPDITPSPEPIVSIASYITWAWVDKFLWKAHQNYIEMKDVWGLMVEDYSILVIKRF
                     NHFVQNKTKSRTFSFNLIHFFMKFIAIQGAWATISSVISFVPTMLLRRILEYVEDQST
                     APLNLAWMYIFLMFLARILTAICAAQALFLGRRVCIRMKAIIISEIYSKALRRKISPN
                     STKEPTDVVDPQELNDKQHVDGDEESATTANLGAIINLMAVDAFKVSEICAYLHSFIE
                     AIIMTIVALFLLYRLIGWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQK
                     LNEAFQAIRIIKFFSWEENFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTS
                     ASFAVYIYVQGQTLTTPVAFTALSLFALLRNPLDMLSDMLSFVIQSKVSLDRVQEFLN
                     EEETKKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGK
                     TSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNI
                     LFNAPYNENRYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYS
                     SSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVSHNVALTLKNADWVIIME
                     NGRVKEQGEPVELLQKGSLGDDSMVKSSILSRTASSVNISETNSKISSGPKAPAESDN
                     ANEESTTCGDRSKSSGKLIAEETKSNGVVSLDVYKWYAVFFGGWKMISFLCFIFLFAQ
                     MISISQAWWLRAWASNNTLKVFSNLGLQTMRPFALSLQGKEASPVTLSAVFPNGSLTT
                     ATEPNHSNAYYLSIYLGIGVFQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLR
                     FFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQFLIVAA
                     IVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDERRFLVDN
                     MKKIDDNNRPFFYLWVCNRWLSYRIELIGALIVLAAGSFILLNIKSIDSGLAGISLGF
                     AIQFTDGALWVVRLYSNVEMNMNSVERLKEYTTIEQEPSNVGALVPPCEWPQNGKIEV
                     KDLSLRYAAGLPKVIKNVTFTVDSKCKVGIVGRTGAGKSTIITALFRFLDPETGYIKI
                     DDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEYSEAEIFEALKRVNLVSS
                     EELGNPSTSDSTSVHSANMNKFLDLENEVSEGGSNLSQGQRQLICLARSLLRCPKVIL
                     LDEATASIDYNSDSKIQATIREEFSNSTILTIAHRLRSIIDYDKILVMDAGEVKEYDH
                     PYSLLLNRDSIFYHMCEDSGELEVLIQLAKESFVKKLNAN"
     gene            complement(<45755..>46483)
                     /locus_tag="KLLA0_E00551g"
                     /db_xref="GeneID:2893905"
     mRNA            complement(<45755..>46483)
                     /locus_tag="KLLA0_E00551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453971.1"
                     /db_xref="GeneID:2893905"
     CDS             complement(45755..46483)
                     /locus_tag="KLLA0_E00551g"
                     /note="similar to uniprot|P10080 Saccharomyces cerevisiae
                     YHL034C SBP1 Single-strand nucleic acid binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453971.1"
                     /db_xref="GeneID:2893905"
                     /db_xref="GOA:Q6CQ18"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ18"
                     /translation="MSEIIETSTKIVVDPETSIFVGNLSPETSPEDLQKVFGESVKVE
                     IPTLQSDRTYPRIFAFVTFDDKVDVEDLRSKFDKTVIKDKSIYVTKVLTPEEQQLKKQ
                     KRRANQRGKAVPAPPKKNKEAQVPLEQMERSKDTLYVNNIPYHTTKAEIASFFGTTEE
                     SVILPMRRMKDTTTKRVFFSRKFNRGIAFVSFPEGTDIEAKAAEFNGKNFEDRELTVD
                     VAANKPAHTEPVQTEAEHGNSTSE"
     gene            complement(<47961..>48728)
                     /locus_tag="KLLA0_E00573g"
                     /db_xref="GeneID:9487429"
     mRNA            complement(<47961..>48728)
                     /locus_tag="KLLA0_E00573g"
                     /product="60S ribosomal protein L8"
                     /transcript_id="XM_002999340.1"
                     /db_xref="GeneID:9487429"
     CDS             complement(47961..48728)
                     /locus_tag="KLLA0_E00573g"
                     /note="highly similar to uniprot|P29453 Saccharomyces
                     cerevisiae RPL8B and to YHL033C uniprot|P17076
                     Saccharomyces cerevisiae RPL8A Ribosomal protein L4 of the
                     large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L8"
                     /protein_id="XP_002999386.1"
                     /db_xref="GeneID:9487429"
                     /db_xref="GOA:B4UN96"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:B4UN96"
                     /translation="MAPSKKVAPAPLASKAASAKKSNPLTKSSPRNFGIGQAIQPKRN
                     LSRYVKWPEYVRLQRQKKILSIRLKVPPSIAQFQNTLDRNTAAETFKLLKKYSPETAA
                     EKKERLTKEAAAIAEGKTKQEASPKPYVVKYGLNHVVSLIENKKAKLVLIANDVDPIE
                     LVIFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDEAALAKLVSTIN
                     ANYLEKYEDSKKHWGGGIMGQKAQKKIEKRAKAAESA"
     gene            complement(<49243..>51228)
                     /locus_tag="KLLA0_E00595g"
                     /db_xref="GeneID:2893659"
     mRNA            complement(<49243..>51228)
                     /locus_tag="KLLA0_E00595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453973.1"
                     /db_xref="GeneID:2893659"
     CDS             complement(49243..51228)
                     /locus_tag="KLLA0_E00595g"
                     /note="similar to uniprot|P32190 Saccharomyces cerevisiae
                     YHL032C GUT1 Glycerol kinase converts glycerol to
                     glycerol-3-phosphate glucose repression of expression is
                     mediated by Adr1p and Ino2p-Ino4p derepression of
                     expression on non-fermentable carbon sources is mediated
                     by Opi1p and Rsf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453973.1"
                     /db_xref="GeneID:2893659"
                     /db_xref="GOA:Q6CQ16"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ16"
                     /translation="MTEKELVIKSDTEKEVVPLVAAIDVGTTSSRVILFNRLGQEISK
                     HQIEYSTSASHSAYSASGERRLEENKTNGSSNEQTIFSAEGIAIEATEYLEIEDLEKD
                     VEPTLRFPKPGWVECKPMNILENVVQCFAANLITMDRVNGDRVSNGLPPYRIKCIGIA
                     NMRETTLVWSKKTGKPLIDYGIVWNDVRTTEIVQKKKDETPEEYQEHLRELTGLPLFS
                     TYFSCSKLRWLLDNIPEVTKAYEENDLVFGTVDTWLIANLTHNNVLVTDVTNACRTGF
                     MNLNTKDYDDELLDYWNIDKAKIHLPKIVSSSEYYGNFVVPECTKKSLTSTAWDLLSA
                     FSQRVPPVPIQGCLGDQSASLVGQLAFKPGSAKCTYGTGCFLLYNTGTTKLISKHGAL
                     TTFAYWFPQLENEENDYGKPHYALEGSVAVAGAVVQWLRDNLRLIPRAEDVGPLASAV
                     PNSGGVVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIARAAVEGVCFQARAILKA
                     MSSDAFGSEDKDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRR
                     SPTSECTALGAAIAAAMAFKTDEERILWKNLKDVKKWVFYGGVEKGEKAPPSTTNDTD
                     LKVFISKSSDKSRRKGWKMWETAIEKSKGWMNEIQLS"
     gene            <53103..>54794
                     /locus_tag="KLLA0_E00617g"
                     /db_xref="GeneID:2894219"
     mRNA            <53103..>54794
                     /locus_tag="KLLA0_E00617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453974.1"
                     /db_xref="GeneID:2894219"
     CDS             53103..54794
                     /locus_tag="KLLA0_E00617g"
                     /note="weakly similar to uniprot|P23900 Saccharomyces
                     cerevisiae YLL043W FPS1 Plasma membrane glycerol channel
                     member of the major intrinsic protein (MIP) family of
                     channel proteins involved in efflux of glycerol and in
                     uptake of the trivalent metalloids arsenite and
                     antimonite"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453974.1"
                     /db_xref="GeneID:2894219"
                     /db_xref="GOA:Q6CQ15"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ15"
                     /translation="MSQTAQYEPVKDAGISNGDWQNDDFANVNHRYPTGSVDGNESRI
                     SGEGGYDDDNDSADDGATVPVTAYVQQYLDEGSYFPVQEVVPNTSLNMNNYRRIRSNT
                     VTSNVMPPRPTEGPGSVMSRSTTGPNQNSQTAADPNDPSNVNGAVTMMVKPKTLYQNP
                     QTPTVLPSTYYPINKWSSFKYQHMKEFFGEFLGTMIMMMFGTAVNCQRKLSQQNQINK
                     FNQIIQLNNMESDQIAMLQYLATPDVAGNFATVAFGWAAAVVMGYFAAGGSAISGAHL
                     NPAITVSNFVYRGFPWRKLGVYFMGQYLGSYIGTLLILWYYREVIEHVYPNWHLEESV
                     LAMFSVVPLDYLSTSRQIIAEFLIGAMLQCGIFSLTDPYTCLSTDLFPMMLFILMFIL
                     NAAGAYQTGAVLNPARDMGPRLALLTIGMDKDVIFNTHHHFFWVPMVVPFVGSFTGGL
                     VYDFCIYQGHESPLNLPLSAYTDWFRRHWELLKVKTSSGFVGSDLETIGTNNTTSNVE
                     SHRSQTSENKQVHFKSVLRNSKTRNPSTGIPTIFESEETTYSRPNFIQKHSDRSA"
     gene            complement(<54895..>55542)
                     /locus_tag="KLLA0_E00639g"
                     /db_xref="GeneID:2894015"
     mRNA            complement(<54895..>55542)
                     /locus_tag="KLLA0_E00639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453975.1"
                     /db_xref="GeneID:2894015"
     CDS             complement(54895..55542)
                     /locus_tag="KLLA0_E00639g"
                     /note="similar to uniprot|P38736 Saccharomyces cerevisiae
                     YHL031C GOS1 v-SNARE protein involved in Golgi transport
                     homolog of the mammalian protein GOS-28/GS28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453975.1"
                     /db_xref="GeneID:2894015"
                     /db_xref="GOA:Q6CQ14"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ14"
                     /translation="MSASFVTVRSKAISLESQTDSLLTKYSSFAQTTSSEPSGQETQL
                     QEKLEKILNQRQETVESLQRIADSESNISTSKLSQLQRHRETLQDNWQTFRDIRSSIQ
                     QERNRLNLLFSVKKDLQNSASDNQNEYIQDEARRVENSHTVVDSLIDQAYETREQFMS
                     QRVFLQRSSDRILQTLQHIPLINNVISKINTRRKKNAVILASLISICILVLFFTA"
     gene            complement(<55858..>56325)
                     /locus_tag="KLLA0_E00661g"
                     /db_xref="GeneID:2894715"
     mRNA            complement(<55858..>56325)
                     /locus_tag="KLLA0_E00661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453976.1"
                     /db_xref="GeneID:2894715"
     CDS             complement(55858..56325)
                     /locus_tag="KLLA0_E00661g"
                     /note="weakly similar to uniprot|Q07879 Saccharomyces
                     cerevisiae YLL042C ATG10 Enzyme that mediates formation of
                     the Atg12p-Atg5p conjugate, which is a critical step in
                     autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453976.1"
                     /db_xref="GeneID:2894715"
                     /db_xref="GOA:Q6CQ13"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR016524"
                     /translation="MLSLQQYNKQLPEIAKLVSRWDKASRVQLIKEISDHILVVNMRQ
                     KQFLTIELQINYDKVYQVPSIRFRLWEHALDDEDVSSSKLLFLSDVELRSIIALNSFS
                     VSLSSDPTTKEVWYHVNNCDTDANVGTEPERYLLRWISLYLQIFDPTLNIMLI"
     gene            complement(<57323..>58087)
                     /locus_tag="KLLA0_E00683g"
                     /db_xref="GeneID:2893808"
     mRNA            complement(<57323..>58087)
                     /locus_tag="KLLA0_E00683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453977.1"
                     /db_xref="GeneID:2893808"
     CDS             complement(57323..58087)
                     /locus_tag="KLLA0_E00683g"
                     /note="highly similar to uniprot|P21801 Saccharomyces
                     cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of
                     succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which
                     couples the oxidation of succinate to the transfer of
                     electrons to ubiquinone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453977.1"
                     /db_xref="GeneID:2893808"
                     /db_xref="GOA:Q6CQ12"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ12"
                     /translation="MFNAIIKRGLATEAKAVAPRLKTFKIYRWSPDRPAEKPRLQEYQ
                     VDLNQCGPMVLDALIKIKNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQN
                     ENKQTKIYPLPHMYIVRDLVPDLTHFYKQYKSIQPYLQRSEVPADGKENLQSIADRKK
                     LDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLVDSRDEAAGIRKQMLQNS
                     MSLYRCHTIMNCTRTCPKGLNPGRAIAEIKKALAVD"
     gene            complement(<59404..>68778)
                     /locus_tag="KLLA0_E00705g"
                     /db_xref="GeneID:2893787"
     mRNA            complement(<59404..>68778)
                     /locus_tag="KLLA0_E00705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453978.1"
                     /db_xref="GeneID:2893787"
     CDS             complement(59404..68778)
                     /locus_tag="KLLA0_E00705g"
                     /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
                     YLL040C VPS13 homologous to human COH1 component of
                     peripheral vacuolar membrane protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453978.1"
                     /db_xref="GeneID:2893787"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR017148"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ11"
                     /translation="MLESLVSALLNRFLGAYVENFDPTQLNVGIWNGDVKLRNLRLRK
                     DSLDALDLPIDVKFGYLGELTLLIPWSSLKNKPVKIIIEDVYMLCAPRTPESYNVEEQ
                     IERELKVKLQRLADFELANSSKPDINLDSNRNESFTQSLLTKIVDNLQVTVKNIHMRY
                     EDMNSVFSEGPCAFGISLSELSAVSTDESWNPSFISIKQQITHKLATLDSISIYCNTG
                     TESIETDDSEELLIRLRESIADNRGAPEYQYLLKPVRGSARLKMNKAGATEDAPHIDV
                     QLMFDEFALVLDDCQYKEVLHNLSKYHWFHKTLKYRQHRPTVKPAADPALWFKYAANC
                     VLSEIHEKNYKSSWEYIKERRNKRDEYVSLFKKKLTLPDINDPLPNVEEEKRLHALDV
                     ELSFDDIKFFRAFTRREFCQESKFTQLSETISTNANPQGWFSSWWAPSNAKSDDSLTM
                     TDEQRKELYDAIEYDDSNDPLKSVDIPKDRTTLRVTNLLQKGSLTVMDRTKGHRMCDF
                     IFEESATEFLNRPDSFLFKFELSSFLVEDGSPHTLYRHIVSPRTKHEKGGDPLLHLYF
                     DSCPMDESADTFLDIKFGSVFVYYHIHFINELIRFFNPPTKHWETVSALMNAAEATVE
                     GWTSQTRMGLEALLNEHKTIDLKLNAASPTIIIPLDAHSWESPCAIIDAGSIKMSSDL
                     VPKQEIKKIKELSVDEYAKIDSDELKRLMFDRFKIKLTDTQLLIGPDMKSSITSINVK
                     QRDNNFTILEKMELDFILDILIFPKALNLPRVAASVTLPSLNIFLNDFQYKIIMQLVE
                     SCVPYVEDDQEEASTSSGSQSYSQLIPLDNIGGSDEALLKHKETLVLKQTKRMMETLS
                     KAELDQTSFQLSLDVSKIEISLLKCLEGPTMNSSKLVKLVGEHLSLRLLKSFVKMDFD
                     LSLTELRFEDHISKQTSKGCEEYMIFSNGHTKKEKLFDIRGSRVQQIIEYESNLYEVF
                     DISVDLRMSELTLSLIPKSILTLMNFVLNTFTDPETPAIPSNVLRQSQQQDSTPGNTN
                     VKIFLDGVNIILNDESSKLATFSIHNSELCMDILPQNMKLKGKLGDMKLVDETSVDLP
                     KDSVFREIISREDNDLAEVIYETFDPETNTNNYDSYLYYRTGAMRINFIEHSINKIIS
                     FFAKFQKMKVLFDTAHNNAYSKAPDIDTVNNMKLDIVIRTPSISFPKLIDPRNNVYDE
                     LIWNMGDLYISNTFTGELGKLVNNVSAGIKNAHISSIFNFEGRKVQKLSAVSNLDLRF
                     DVSYNQFHTESDALVTVKGYFAPFYVDLTDLQLQYIYLLSQRIANSFIVSTDDDNMEE
                     VEIAALNTNAIIDPQKELHSNQNIFKSEEASSSDNQKNIEIEFEFNAPEFCLSLFNNT
                     SEKITVKDLGIARFTLENFGLSGSAFNTSSANYEMHIKSFTVEDIRYSKTNKHTQLIP
                     KIEGDHHQFMASVDYKEDKGSSTTTLEVTIDSPKVVLAVEFLLALQSFANSSLNVKQA
                     ANFQELSYSKEELPNEALPDDLAVASKVENSNKTFNYSVNVVDSAVILLADPSDKQSE
                     AIVFTIGQFLVTDHNILSIAANNVGLFLSRMGDLNQNRIRILDDFSSTVMIDGRDSTP
                     DILKTQIHSSVGPLLLRLSLRDIRLAMEIFNSSLSLAKDEGLMIVDTTNEEDEDITTK
                     YGKFSREFKNKIKKYAPSMVSSLSEISNVMHRNSISDSTKVITKAEKLHSDFAGLRVV
                     LIGDMHELPIADFNINAFSVDAKDWSTNIDVISTIEPFASAFNYSRSSWEPLIEVFPM
                     TFHLSKDDENDNALIFDIITRKSVEITLSSRTIALLSQIPASLTKSHNLKPRGAEKPY
                     RIHNDTGHTLNIWIKNSDDDAVNKRANLTKLQSGEIIDWEFEDWRVVRETLDTEKCML
                     RASFADDDYSNIIDVDASKEGDVIHKLYPPVAGVHNRLLISSNLLENNVKLITFGSTL
                     LLRNLTSTEVEYGLSDAGKIKSIGVINPNGTRSIPIDSAYQSSFHIRPLTDNASYKWS
                     GIPIFWKMLSESPLALSCESDLETAGFHFEVEGSVDKDDPLSKIYPRMTVTLSAPLVL
                     ENSLPQDISFCLKGRKEEARSEIFLQAGATIPLHNVSLDSYLLLSIKPDDENFNWSNE
                     TLVNSPDVSALEEEHRIFITTLDGQKLYLSLKYHANGKRAKTISIYAPYVIMNKTTHD
                     LSVFSDRQWGVVKSDVFMKDGQKLARPKMFSFQYEDYNRNRAKIKFTETNPSVPVSFD
                     AIGQSVDISLELLNHNQECNLGINVKEGEGKYRFTKIVEISPRYIFRNSTSEVIEIME
                     YGTSSPTILAPKELTPLYFLKRTLSKKFVARFAKIPSTWSNPFRLKDVGESFVKMNIT
                     DAAQRLIKMDISLEGATVFINAVDSDDNWPFSIRNFSDHEFLFWQRNPRFVDDESDEL
                     DYYYQEDEEEVDFEPIYYRIPPRSIMPYSWDYPSAKQKKLYIHTKNRRREIDLNEIGN
                     LRPIRIPSDNPKQPPSIVDINILMDNGVQVLVLSNYNQEQSLYKLRSQRRFQSETSIT
                     SSITSSSDKFEVDESLDSKLNARVVISFSGIGISFINDRLQELCYINILGLEFRFNDS
                     EMYQNLSFKMKWIQIDNQLFGGVYETVLYPTKIPKDSKEIDIHPSLSGAISKVKDESS
                     SLLNFKMATLLLQEMTIQIDEDFLLALLDFAKIPGASWNQAVDDSSSEQLFLHPCTVP
                     DFPTTVRSSKVYFEMLHLQPTLLHLSFVRTDRVNVEEEKSSGNSAINYFINVLTMALG
                     NIEGAQIKLNSLLLEHVRVSLPTLVGAIESHYAQQFFYQLHKVLGSADFLGNPVGFFN
                     NISSGVMDIFYEPYQGYIMNDRPQELGIGIAKGGLSFLKKSIFGFSDSFSKMTGSMAK
                     GLSVAIQDTSFQERRRLQQRQRGKFGSVGVGASSFFNNVTSGLTGVALDPYSGGAKEG
                     AFGFIKGVGKGIIGLPAKTAIGVLDLASNVSEGIRNSTTLMDIGQIERVRLPRFVSSD
                     KLIKPYNLRDSQGQYWLKTCNGGEYAKDMYVGHVICETPAGYQIVIVSLQRILRMQLS
                     TLTVMEHIPFRMIRNVRVIKTGITIYTAEREYFFSVPKDEERRYLYKLVHTAVIEFNS
                     KWQITL"
     gene            <69141..>74684
                     /locus_tag="KLLA0_E00727g"
                     /db_xref="GeneID:2893881"
     mRNA            <69141..>74684
                     /locus_tag="KLLA0_E00727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453979.1"
                     /db_xref="GeneID:2893881"
     CDS             69141..74684
                     /locus_tag="KLLA0_E00727g"
                     /note="similar to uniprot|P38737 Saccharomyces cerevisiae
                     YHL030W ECM29 Major component of the proteasome tethers
                     the proteasome core particle to the regulatory particle
                     and enhances the stability of the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453979.1"
                     /db_xref="GeneID:2893881"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024372"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ10"
                     /translation="MSKFQQLSEGQERSLVEKVDLRLVLAKDDAKFEQTLNTFLPPLL
                     LKLASPYSSVRELVYESIKHITSRVNSHFRCKLPVRQLLQQVKKPNLNEGQDATNVIV
                     YSSFFLSKGVERISRQESRELLPDIIEDISNLSSPAQTRIFHILCKVLLTWKAPLQGS
                     SEERETIDFLNVNDSDLRFLVEKFLKFFLLVPKRTEGSSVSYFCPGLSSTDVSFFIYS
                     PAIYFTKDLLNQYRRAIFDFTVSGLTSNDQILIPFLLVVSAQPIDISDSASTLLKRIK
                     IPYDDETFVKYLSDLFCGNIAEHLPPVNPQIQEKILGLLTRSILITRLPNLPLRISMD
                     GIASRNLRVKLAALVFIRHVAKNNHLALRETTGNDMTSIITAIKNDIQLAGWPRYNSQ
                     EENKLSGITLRTSQYETLGQLLRQDFDSVKNFEMVKFLLESLNGDLNEFRITIKDALG
                     SLVHHFPLLPSESKKQLKQFLSSTLKDNYALLHGTSDEKEAIMTLRFVGMKFNNAAFP
                     FEDNEARVFSILGTSRLNRFDVVQEAFKGLSPYQFRMNRASLETGFVSTDTLLAKKIS
                     ETRFVDFSSFISLFLSEAQNKSEHCSIKDCIVTGVRFLRHTLISNSIYGKRTVVLQDE
                     NWSMRIEKSLEVDENVRKHVHENIEHLSESTVSSVLLFLFNEIIHENNVSSKDDPVFS
                     KLFLVLVTYAKNDVIMKSENILASTLKRINTKQSPPDIYTDSLVNSFGIIGARIGLSS
                     HSVSQILATDFDQESNNPSAIIPVLVYLLASLIPRLQLLHSVEFGTVVSRILQKITKQ
                     YLSGSCRELSLKAYCELLKYRTLDSLDAVNRKSITISIKDAIKDKLFNDELAIMTWGY
                     LYMNSNETEFDDYLGVYETIHSSKHIDYLFVSGESLTIILGGWNSKLLERQLDINYDV
                     KHLQELTTTTKLQDGLNRVLSFCSSTKPSLQKASCIWLLCIVQYLGHLRDVSAKFNEI
                     HAAFTKFLAHREEFVQESASRGLSIVYDMSDADMRETMVKGLFKTLTNSSSALSLQAG
                     SVSGETELFDAGVLSTNDGSVSTYKDILNLANEVNDPGLVYKFMALAKNSSLWNSRKG
                     VAFGIGAIFSNVSLQDQLINDSTLSKRLVPKLFRYRFDPSTDVANSMDNIWDTLFPEG
                     SQAVEKYFDIVLEEVLTNSGNREWRVREASSAALLHLVQTYPLENFENKFEEIWTVAF
                     RLLDDIKDSVRKSGTSLARTLSKILIRSINGHKNTARMQQSKVLDIILPFLLGTKGLN
                     SDAEEVRIFALNMLLDLIKESKESLKYYVPTLVYELTMLLSVLEPQVINYLTLNADKF
                     NVKASAIDEHRLQGVTNSPIMQAIEALIDISDSNDEKIQKLVDSCILASRKSVGLPSN
                     IGASRVLQLLCIRHSIILKPYCGKLLKACSNGMNNKNVVVASSYASSFGRLFKVSTLD
                     KQIKYSEKVVQKFFETEDFEKQKVTGVAIESILKYSAEDFDNVANILMPLVYIAKHSL
                     NGSIADQFDGIWIESSKSGSSSLDICFSEIVDLVSIHIKSNIFSIRQTCTSALCKACQ
                     NYNGPLKPDIVNNIFEVLLEACQGRSWDGKASVVSGVLESFKKLSARVTLDKFCQRID
                     TMIIAELSRRNKSYVKGLIQPFAEYVFFRNDQKLYEKLIDVTQEVFLDLELEDNNETH
                     ESNDNMKSKKPRLLNDLNRASSKKNIEMENYRIEIIKTVAKGYKDILHEEKGINTNNV
                     IKLVFEFMKGMFESSKILYSWRSELAYFDVAILLITPWTKTEVSSNDVSHIFIDIWKY
                     GHALCNKKEVIESVKIKLIRYGGLLKEKFPHTNTMVDFGILEILRVDDSSVLKAEALN
                     IGISQ"
     gene            complement(<74948..>76093)
                     /locus_tag="KLLA0_E00749g"
                     /db_xref="GeneID:2893864"
     mRNA            complement(<74948..>76093)
                     /locus_tag="KLLA0_E00749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453980.1"
                     /db_xref="GeneID:2893864"
     CDS             complement(74948..76093)
                     /locus_tag="KLLA0_E00749g"
                     /note="highly similar to uniprot|P04838 Saccharomyces
                     cerevisiae YLL039c UBI4 ubiquitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453980.1"
                     /db_xref="GeneID:2893864"
                     /db_xref="GOA:P0CG75"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI"
     gene            <78021..>79361
                     /locus_tag="KLLA0_E00771g"
                     /db_xref="GeneID:2894762"
     mRNA            <78021..>79361
                     /locus_tag="KLLA0_E00771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453981.1"
                     /db_xref="GeneID:2894762"
     CDS             78021..79361
                     /locus_tag="KLLA0_E00771g"
                     /note="some similarities with uniprot|P38739 Saccharomyces
                     cerevisiae YHL028W WSC4 cell wall integrity and stress
                     response component 4 Putative integral membrane protein
                     containing novel cysteine motif. Similarity to SLG1 (WSC1)
                     WSC2 and WSC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453981.1"
                     /db_xref="GeneID:2894762"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:F2Z6I6"
                     /translation="MKWVNWLATVSLVRLAYGLEQDYCSSENTGTDLITYGYQSNGYC
                     SDTCRGKSFDFAIVQGYSCWCSNDLPSSQVSVSSCSETCPGYGVEDCGDTSAGLYGYL
                     YLGSGSLPSISSSSSPSGTTSESSADPSSTSTDDDGTTVTNDGSSTSDTGSATSSSSS
                     SSSSSSSSSSSSSSSSSSSSSTSSSTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPT
                     AQTTTTLEPSISVLYSVETITAEPSTDSNSNGSNSRTNEIVTTRVITTVYSSPSQTIA
                     ASTSTESNSNRGNSSFWDSSGKVGGTFAVVGVVVAAILAILLILFLKYRKNKEQQDFE
                     KTYDEVKRSATGAYSTSSSSQIHSSGGGGGAAPFVYTDEKGIVNTTTTSPKSPTSNTQ
                     QPVNTPESEVSEPVVLDQRLDPQHLMSQWETNGSRVSLADDVDYSRKVLRVINE"
     gene            <80516..>82069
                     /locus_tag="KLLA0_E00793g"
                     /db_xref="GeneID:2894720"
     mRNA            <80516..>82069
                     /locus_tag="KLLA0_E00793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453982.1"
                     /db_xref="GeneID:2894720"
     CDS             80516..82069
                     /locus_tag="KLLA0_E00793g"
                     /note="weakly similar to uniprot|P33400 Saccharomyces
                     cerevisiae YHL027W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453982.1"
                     /db_xref="GeneID:2894720"
                     /db_xref="GOA:Q6CQ07"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /translation="MSPIAHLLNASTGTDSGSHLRDIHGHHDSHDHGSEEQAVSPLSP
                     RSYPSPRSNSSSSCEESQSSAGVLANIHTGPASPHGKACVASSPLSTTGMRSASTPSS
                     SDEDTVHLHRCQWKGCSLEFTSPELLYHHLCQDHVGRKSQKNLQLNCQWGDCQTKTVK
                     RDHITSHLRVHVQLKPFACSTCNKKFKRPQDLKKHLKVHNEELSLLKKKRGPKPSNKL
                     GKISNDRSRAHQRFTLPSISLDKFIHEEVKTQQPVYSQQLAEKMAIVLLLPVNNNNAT
                     SPPSASSASSTAVSPNLVSHHMVLPYQTQQRPLVGHGAELRSAVGFFNNLSMDMSRNY
                     ANNNLPTANLGPNPVPAPQSYPLIPKLPSISARPNVGAPPPVLSVFNRFDTHQTSPSS
                     SSSAFYPQHYSNNYSLHQRTALLDAEANEDIPEKDNVSLEESFTSLNLSSEEQDLELF
                     YETYSTVKLVKDYLLCELMEELDEFKEEEEEQGFTSFDEFSDSKECVIEGRIPSNKIS
                     LSKYPQVVI"
     gene            <82495..>84390
                     /locus_tag="KLLA0_E00815g"
                     /db_xref="GeneID:2894158"
     mRNA            <82495..>84390
                     /locus_tag="KLLA0_E00815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453983.1"
                     /db_xref="GeneID:2894158"
     CDS             82495..84390
                     /locus_tag="KLLA0_E00815g"
                     /note="similar to uniprot|Q9P4W6 Saccharomyces cerevisiae
                     YLL035W GRC3 Protein of unknown function required for cell
                     growth and possibly involved in rRNA processing mRNA is
                     cell cycle regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453983.1"
                     /db_xref="GeneID:2894158"
                     /db_xref="GOA:Q6CQ06"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029007"
                     /translation="MSEDILTYTANTDSDDSDVEQREIEKKYKTSSETPVVQLYDGDD
                     YDNDDIRETNGNDFPNEEDESNQLYSPVVDMNFFTLSDECTEVIICLEKNQHLLICGQ
                     FNLQIIKGGITYNNVHYNSGYKNWEFWHPACNAISPIVSSFYAGWESKLFLNREYQHF
                     TTQIESYDCVLKISNGCNITELSSLLPELRDMWGPLNISLLPGIARKQLTFNIISKIS
                     DSVRILDISTEWSTVIDEMRIFHANSSQDMRVMVIGGKNSGKSTLMRLLVQKFLHSNN
                     DLSYEAIHYLDIDPGQPEYSPPESISWNKVDPKSMSLGQHLCQGRFTTIKQHFIGSSS
                     PQDWPETYSNAVESLLKEWQTENFMGTSFLNIPGWIKGFGVKIINHALDHFKPTHIIF
                     LSYNGLPFSSEIKVPDAFSTTQRSTYKPIILQLHSPAVGKHISHALQRFNAAKIRQFK
                     ITAYLHKKYDRNFVINPLVMQKPQLTSIGNRGIVGFEFLQYSNSSLYHDDIKLSLDGT
                     VVALHRADSTPDVLFKGIFPVMKNYSKINTEFVGLALIHSIDLEQSLIYMYIPENLFR
                     ALRETENKWVLVRGKTETPICELYPNNGIFKSEVDIPYVSLYQKKRHEHVWKVRKNVM
                     RRGHHMK"
     gene            complement(<84426..>86870)
                     /locus_tag="KLLA0_E00837g"
                     /db_xref="GeneID:2894721"
     mRNA            complement(<84426..>86870)
                     /locus_tag="KLLA0_E00837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453984.1"
                     /db_xref="GeneID:2894721"
     CDS             complement(84426..86870)
                     /locus_tag="KLLA0_E00837g"
                     /note="highly similar to uniprot|Q07844 Saccharomyces
                     cerevisiae YLL034C RIX7 Putative ATPase of the AAA family
                     required for export of pre-ribosomal large subunits from
                     the nucleus distributed between the nucleolus nucleoplasm
                     and nuclear periphery depending on growth conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453984.1"
                     /db_xref="GeneID:2894721"
                     /db_xref="GOA:Q6CQ05"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ05"
                     /translation="MVKPRPRKNGLSQSLETKISDLIYRMLDEKSLEKQRENAKKREL
                     LERSDVQSDDSSLEELNTELADIFLAKDLRFPEVLAFCQSKDLSLQRVKKVLLEKTIQ
                     KALLQVIDDELEEMGPLMDQEKPESNEEVLSDKNLMFTPNSNDLNKDITSQWQVSKLE
                     KEETTEGKKLIKKRAKDEPKDKIKRQKKDDRSPPSSNLSTLGGMDDVIAQLMELIGLP
                     ILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGE
                     SEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELSFE
                     KMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNVPNETSRYFILKKMASSLKIDG
                     EIDFIKLAKLTPGFVGADLKALITAAGTCAIKRIFQNYAGSNDVDMDIDIDAETQLKN
                     TANMIDPLPLSIIQRFIDNFPDALTAEQLQGLFIKYEDFLKALPTIQPTAKREGFATV
                     PDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAK
                     AVANESRANFISIKGPELLNKYVGESERAIRQVFNRARASVPCIIFFDELDALVPRRD
                     ASLSESSSRVVNTLLTELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELP
                     NFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFSGADIAALVRESSVLALKRN
                     FFKTDEIMSVGENNLDKEFEDLTTNSPTEDVIVYMKDFENALKKVKPSVSDKDRTRYD
                     RLNKRMGWNDSSDGSE"
     gene            <87256..>87822
                     /locus_tag="KLLA0_E00859g"
                     /db_xref="GeneID:2894001"
     mRNA            <87256..>87822
                     /locus_tag="KLLA0_E00859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453987.1"
                     /db_xref="GeneID:2894001"
     CDS             87256..87822
                     /locus_tag="KLLA0_E00859g"
                     /note="weakly similar to uniprot|Q07843 Saccharomyces
                     cerevisiae YLL033W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453987.1"
                     /db_xref="GeneID:2894001"
                     /db_xref="GOA:Q6CQ02"
                     /db_xref="InterPro:IPR016613"
                     /translation="MVLIKSRKSIVTATNVCINSSSKFYLTEEQVQSLGDKEFLTASY
                     RRFLRMRQFISKRQMVKESYTTYLRYKFKIEDFELKRSKLLSVSGMSAMDFRSSVQKS
                     LCFLIKAFSISDAYSKDMIDDSHKCKKIIKNLLTVDYHRNRIINRSSNMYQYYRKDFT
                     FFTDGQNIGLKQFEENLMRLNECLGTRL"
     gene            complement(<87991..>90132)
                     /locus_tag="KLLA0_E00881g"
                     /db_xref="GeneID:2893990"
     mRNA            complement(<87991..>90132)
                     /locus_tag="KLLA0_E00881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453988.1"
                     /db_xref="GeneID:2893990"
     CDS             complement(87991..90132)
                     /locus_tag="KLLA0_E00881g"
                     /note="weakly similar to uniprot|Q07834 Saccharomyces
                     cerevisiae YLL032C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453988.1"
                     /db_xref="GeneID:2893990"
                     /db_xref="GOA:Q6CQ01"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ01"
                     /translation="MDSLDNIIPFTAHAFLRPESKQCLFNSISEWSLLQGKQCLFRVP
                     PGFEIVRTEENSSDSISVSCILRTNNLEDITKWDPLAFSELALHLESDNSEWYSLFQC
                     LLHDWNKKHYNANIVLLGRNDVKESTVSNDERLILFGLKSKLAIMEIELKCAIAVKQH
                     KYVDVIDFKAVSMMPLLAGQNGGNWKHLSECFHTEVIDSQLGILGHDYPSKLFLQSEQ
                     KCDALLAKQCLEKKLNDILDGSLHATAIPNVSPLKIAYLKTVFPSETIMKLMQKYPSY
                     INYTTGSVQLQSNSAALLDIVRKRFVRNILAVISEVRFWFTESNDATELINRTSTFKR
                     IASKNNVIFSTDKFKNFFNFVGCHASIQQTYLDILAEDFQCVQNVRFTLELDTIYKDF
                     ISGKKNGKLMKIMDRKKCAISLENDSSGHMLVILQGEDWQQIQDSFSLLLQELPCEKS
                     FFIPEAYHRPVIGTGGSVIQTIMRKYNVFIQFSNSFQLPQGDWTFTRYDNVIIRCPSK
                     NTINIEAAKEQLLSLSEQYSQVQKTVYVKMSPSQYLYLIHMNSDLSFISEIEKAHSCY
                     ISFPQSLPVEGYHINVKGNDTGPERAANDIISRFGREMEIHIKNPASENEFSKGLLLP
                     LSYSNVQFTQNRNFIRLTFSPLMKPSQLEEIIFLIDSFLKLSNNKIISKREVAHYTSV
                     TPLYRVGKQLNTTIENSPQTSILKSFSQVRI"
     gene            <92292..>98297
                     /locus_tag="KLLA0_E00903g"
                     /db_xref="GeneID:2894690"
     mRNA            <92292..>98297
                     /locus_tag="KLLA0_E00903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453989.1"
                     /db_xref="GeneID:2894690"
     CDS             92292..98297
                     /locus_tag="KLLA0_E00903g"
                     /note="similar to uniprot|P39960 Saccharomyces cerevisiae
                     YER155C BEM2 Rho GTPase activating protein (RhoGAP)
                     involved in the control of cytoskeleton organization and
                     cellular morphogenesis required for bud emergence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453989.1"
                     /db_xref="GeneID:2894690"
                     /db_xref="GOA:Q6CQ00"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ00"
                     /translation="MKGLRWSTRTRKNEDKHKGSGHSIGTSSNSAPSSHRGSTTSTNS
                     GLSISRHGSLPKSASNLYLSESQSRSQRSLSSSSSRHDLQTVTDEESIDSIPGHSNSL
                     TPVISSNKDSMTINGGSGSTYAINNLTYDNKHASSVSNNDQSNADIRSESLDRSHTPA
                     LQLNSDNFDSMVFKTGWMNKSHGTVHTPSSNSSFGSSRNHRESRIYGSDLSSSSSVRS
                     SSNYSQEYRLYKAQLKGCVLNLYKSGISNAKFLDPTLDPPDTKHEHEEDPQLPTPPLM
                     TDIPVSTSKEQNSSKEAGPISSPSSKQSTVSAIQTKDNETNVSKDITEIKYLSEIYPH
                     PNLKIDKHDQIVFGTVESICHAVLFSVTLETKKIVDLILMLPLIEDFSLFFQCFCLYG
                     KTFSKNSEKLTNDSKQFHKVSPATDELMTQRLALVVKTVLDVFPGFLLDDTTFNHIIN
                     LLDIISLHDDEISNSLKLAIAESHNKLNKLVSFSKKPVDQNAISKFVDVKEFLKLDNA
                     ILADQIHAINLTYNKIWSPQKDYSLLYDSAFNKNYIDLNPLVFNNRSNIHYVSRLLIE
                     HLFKQIDGTPLHPKERALVLTKWVQLGCTFEKIGDMVSWLAIATIICSTPILRLSLTW
                     QYISDQTLKIIFKDWVPTIVQLERRQLSFRTTNSVFILAPPNLNEKSIRENVIPYFGD
                     LTIHTNDLTQDTMFRYLEKKIYRTKNAFQKWQQRLPPIEMANIQSTPQNPDVDFHHYL
                     NYHVSRSRLNVENIMEMSLKLEPPKLDKLDAFANLSKRSSLLNGSYLPILFNQLFLDY
                     SLFSQTALIGAAGAQNNRQSFVQTNTLSRSGKTLSVSGPLGISPEDKSLITGIDRIDE
                     PVVRELSTKQSNKQMLLKSIRDVFSINMDLFHVLDDLTFKSVDDWDKKSRPASVVIET
                     PKRFSVQSSRDSQEVINRLSVGVENMDFFKNISKTTDSWDEAVINVVLKSASLEKLFD
                     VLVLTSSVFSKLVSINDISAFFKNHQGKYNEGNGAGLLDYAIVKLCMDNDLYTKTFFS
                     TYKSFTTTASLLENLAKRFIGAKSCAVSIERLVKDDSRKKATDLSGTTNNKFLCWDSA
                     SSEFGKEHYLHAAKIQIGTAEALFYLINEHYSDFNDDMHNNKLLLDIIKIMDQEIIDE
                     WDLRITALSDSVEKSEAEKSLVIDLNSYHDKLKELLQKIKSSYQRQLYRPVGVSRHNR
                     NTMKILNSFNTITMEELNKFALDNSLDDPMVSSFQKLKTDSYGEILNWMYQLDDLILS
                     HLKLATVKEWMVVSQLLEGFSYESLSSLFKYSQLDHSYSQITSGNAHPDDLEIVNVFT
                     WLASLVNGREESLFKKLPYSIQLITNLHISLTNFFVVQIAQLEKTYESRLETCCIILQ
                     MLGFSRYKNSSIDLFQATTDSGSTISPHLPSFIESALINSILSPESRKFEISWKNASE
                     KLGNTTSLKSVYNILDCVDASIKKFIEFDGIAPRHKNFCPCPGWFIGRLLEISQLVPN
                     MSIENSKLINFDKRRFTFNLVLNYQQLLQTNDVDLNIQSPTFGLILNHYEIDPNHSFR
                     NRAKDVATSETKLMKYQLRGIFNEVLIAEMYKIKREQKKREHLISQEKELKRSQSLQQ
                     VMKQKSIDMQNSVLAQVQQQSGFSSSPRSKRSSIVNNSRNSVIYTATNSGNGVGRKIG
                     GFFKRPFSISGFSSSVSSNGINSMLVNSIQQNGAVAPIDLPKISKEELQEQKPVLSIK
                     TFDIKKCINVNNFSSDASMIYCFKILMENGNEHLIQTIDSHDLSQWLKTIALSKRYSF
                     HSKKYKGKTSNKVFGVPIEDICEREGTLTPTIVHKLLEEIELRGLDEVGLYRVPGSVG
                     SINLLKNAFDDEGAVHNVFTLEDDRWFEINTIAGCFKLYLRELPESLFTNEKLPDFIQ
                     LVEQFQTDQITEEAFDELVRQKLRTLPIYNYHMIKRIFQHLHRVHNHMDTNRMDASNL
                     AIVFSMSFINQDDLANSMGPSLGLLQSLLQKFIRYPDTYFVYE"
     gene            complement(<98423..>99586)
                     /locus_tag="KLLA0_E00925g"
                     /db_xref="GeneID:2894207"
     mRNA            complement(<98423..>99586)
                     /locus_tag="KLLA0_E00925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453990.1"
                     /db_xref="GeneID:2894207"
     CDS             complement(98423..99586)
                     /locus_tag="KLLA0_E00925g"
                     /note="similar to uniprot|P39952 Saccharomyces cerevisiae
                     YER154W OXA1 Translocase of the mitochondrial inner
                     membrane mediates the insertion of both mitochondrial- and
                     nuclear-encoded proteins from the matrix into the inner
                     membrane interacts with mitochondrial ribosomes null is
                     respiratory deficient"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453990.1"
                     /db_xref="GeneID:2894207"
                     /db_xref="GOA:Q6CPZ9"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ9"
                     /translation="MFRSAILRAGKVSPRTIVQPQLFGTQRVAWTGFSSIRFNSSDSS
                     AVSDAAAGAASKVSEIQTQLPSFDENTIETVSQVGQVIGDASNQIGYLSSIGMAKSWL
                     WPPDLIQNVMEQIHFYAGLPWWATICVTTVLARVLLFPLYVKYSDTLGRTSKIKPEMD
                     KVNADLMACSDTTKAQQIAMKRRKLLSENGIKNRYLIVPVVQIPIAISFFTSIREMCL
                     YPVDGLATQGIAWFQNLTLADPYLGLQCLTAAMFVALARKGGESGAQQFSPQMKKVFT
                     YLPILTIPVTMNLSAGVVLYLAVNGVCSMIQTLLLRNQTARKFLNIAEVVNHPAPENQ
                     GPQKGVFESFRENIQKAKDQAEKRAMMKEQDDKMKDLAKKEKENQRIKIVRKK"
     gene            <100123..>100968
                     /locus_tag="KLLA0_E00947g"
                     /db_xref="GeneID:2894180"
     mRNA            <100123..>100968
                     /locus_tag="KLLA0_E00947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453991.1"
                     /db_xref="GeneID:2894180"
     CDS             100123..100968
                     /locus_tag="KLLA0_E00947g"
                     /note="similar to uniprot|P10355 Saccharomyces cerevisiae
                     YER153C translational activator of cytochrome C oxidase
                     subunit III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453991.1"
                     /db_xref="GeneID:2894180"
                     /db_xref="GOA:Q6CPZ8"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ8"
                     /translation="MIRKAVPDFSAMIKSCVRGEFSDVLKELRSTPRDCMNRTFLQFY
                     LGQSTKYAHWPSISFIWNRFVVRRDLLVVKPSVLADIAKISMHNGKYGFTETLLKHYN
                     RYYASHTGVRWDGYRYMLLNAHIEMYAKKPNREVNFKKKWHAYISEIDNTLIRYPISV
                     FDFPNMTASLNGINIDRLKKWLLVDCKEGSLNQHSMPMFLNMILLQSHVTPTEKIELF
                     RDFLARSSVDPSQYLQESLQILAHDCSNDAIQDLVRDIQPYRMKLNAKTTRRIAQNKV
                     RELEK"
     gene            <101430..>102767
                     /locus_tag="KLLA0_E00969g"
                     /db_xref="GeneID:2894538"
     mRNA            <101430..>102767
                     /locus_tag="KLLA0_E00969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453992.1"
                     /db_xref="GeneID:2894538"
     CDS             101430..102767
                     /locus_tag="KLLA0_E00969g"
                     /note="similar to uniprot|P10356 Saccharomyces cerevisiae
                     YER152C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453992.1"
                     /db_xref="GeneID:2894538"
                     /db_xref="GOA:Q6CPZ7"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ7"
                     /translation="MGENQRPINFFKGHPSFRLLPREAIVEATSQLLLPECRDYDDID
                     EDRHPLTYGPDEGSKWVRTAIAAFSNDCFQLPSEEMKTKPEHINLTAGASYGVMNILE
                     QTTLPHTGYTRQAFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEY
                     FDSISNDNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKH
                     DMLIVSDDVYDLLRYDDSLDELPHPLPRLTHVDRMSYKHGDSGYGNTISNATFSKIIA
                     PGLRFGYQETVNENLAYQLSQGGANVSGGTPSQLNSMIVGTLIQNGKAKEIICSLRKE
                     YQLRAACLYQSVKSYLPRATQYHLQLGGYFSWCTLPEGYDAKKIGQELKERFNVTLAN
                     GSSFEVIGDERNWGERSVRLSNSFLEIADIEQGIKLWGTVCEDYAKRHNLPFR"
     gene            <103562..>104317
                     /locus_tag="KLLA0_E00991g"
                     /db_xref="GeneID:9487321"
     mRNA            <103562..>104317
                     /locus_tag="KLLA0_E00991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999341.1"
                     /db_xref="GeneID:9487321"
     CDS             103562..104317
                     /locus_tag="KLLA0_E00991g"
                     /note="similar to uniprot|P38957 Saccharomyces cerevisiae
                     YDR078C SHU2 Suppressor of hydroxy-urea sensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999387.1"
                     /db_xref="GeneID:9487321"
                     /db_xref="GOA:B4UNA2"
                     /translation="MSQGQERFLNYSQLLSELVDGRGRTLNDTTVAFLYQLFPNDLFV
                     KAFSLLETHNLFLYVWDSIDDVALNDGVQCSDAEIDETSNSVAGSRLPTEGHQCHSKR
                     NSNDNDISRLANMLYDLETRSKTLHRIIVQSVDEEVSKKPIYVDVTAWFCSCNEYTKC
                     FSGMLHNNGDEGYQGMFETYGNETDDNFAKVNSHTHVNSSKVICQHLLAAAILLQTSL
                     KVLKYFTSVKQSVSLFSINNKDDWLKLHLNIVD"
     gene            <104991..>107315
                     /locus_tag="KLLA0_E01013g"
                     /db_xref="GeneID:2894763"
     mRNA            <104991..>107315
                     /locus_tag="KLLA0_E01013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453994.1"
                     /db_xref="GeneID:2894763"
     CDS             104991..107315
                     /locus_tag="KLLA0_E01013g"
                     /note="some similarities with uniprot|Q01477 Saccharomyces
                     cerevisiae YER151C UBP3 Ubiquitin-specific protease that
                     interacts with Bre5p to co-regulate anterograde and
                     retrograde transport between endoplasmic reticulum and
                     Golgi compartments inhibitor of gene silencing cleaves
                     ubiquitin fusions but not polyubiquitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453994.1"
                     /db_xref="GeneID:2894763"
                     /db_xref="GOA:Q6CPZ5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ5"
                     /translation="MDARDYSGSMYPPQEPGQDMGNMAYMVPPSQFGFANMYMDMNGY
                     SAPAGHYPPYPMAIYAPTMDAMAHQQPHPPQPKKKMTFNKNANFKPNAFNNYIPMNAN
                     VPNISPGSSKSSEKGLEYRFEVGNATYFNSEALKESYPIYINTNFAEFSRAKSTMEEL
                     RKSYSNFKTATVANEPNSVTEETRESEPQREANGEPIPKTEVNSSKEVESISASEEKV
                     EEKVLKSTEYQTSSDPTAPPRSNTASPTPTKSSVSPKPAQTLPVKSWSKLAAGSLGKP
                     KQQLAVTNLASKKGKKYVPPSVKSPEPLGSVALRVCFDKNFTNHTLQSTKAKKLITEL
                     VPRGIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKR
                     FDRETIVNELNETRENSKTKSKSSNLNENIISIDPEPFYKSISTLPKFKDLTWGRQED
                     AEEFLTHMLDQLHEEFIGSINTLNSNDILNIFQSLQEDDQKVFFLKYISKYKSASFAE
                     KPEQSLKALFEKYKQTNDLSDEEDKEWKEVSKKGKKSKNASKRITEVESSPISTIFGG
                     QFRSVLDTPQNKESQSITYDPFQTIQLDISSPDVIDLESAFKKFSEQESIELKSSSGN
                     DVEAKKHTCIDKLPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHEL
                     TIPKESISPNLVSTSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLDKWYRIDD
                     VNVDEIKNKEDILRSGDSASDSRTAYILLYEKSS"
     gene            <109821..>115457
                     /locus_tag="KLLA0_E01035g"
                     /db_xref="GeneID:2894208"
     mRNA            <109821..>115457
                     /locus_tag="KLLA0_E01035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453995.1"
                     /db_xref="GeneID:2894208"
     CDS             109821..115457
                     /locus_tag="KLLA0_E01035g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019C MUC1 GPI-anchored cell surface
                     glycoprotein required for diploid pseudohyphal formation
                     and haploid invasive growth transcriptionally regulated by
                     the MAPK pathway (via Ste12p and Tec1p) and the cAMP
                     pathway (via Flo8p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453995.1"
                     /db_xref="GeneID:2894208"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ4"
                     /translation="MHFTIVGLICWLVLAVGPAAASNNNCDFVKGNHGSGSFEPINGC
                     PCLDFSFRSQNTRTMPYNIELENVKWVESNIYTVTLHVTGQKQIPLKSLWSLKIIGVN
                     SPDGSTFQLFGYNEKTYLIDNPTDWTATFRVYGQADSNDPSIVWMPTFQIQYEYCQGS
                     ADCSDWSYGTTTFDLITGCNNYDNYKRSQTDAGSYFWPAQLSGETKYPQSYPCEKPTS
                     TLASSSSTSTSSTSSSASSTSTISVSSTSSLRSTSSASTSSISSTSSTSSSSVSTTSS
                     MPSASSAVPVDFTGGDHGSGSVEPINGCPCLDFSFHSQNTGTMQYSIVPEEVNWVQDN
                     IYTVTLHVTGQKQIPLKSLWSLKIIGVNSPDGSTFQLFGYNEKTYLIDNPTDWTATFR
                     VYGQADSNDPSIVWMPTFQIQYEYCQGSADCSDWSYGTTTFDLITGCNNYDNYKRSQT
                     DAGSYFWPAQLSGETKYPQSYPCEKPTSTLASSSSTSTSSTSIISSGVSTITTAEPQE
                     QTSTASSTEAITSSDVISTESSTEATSTDVTSTEAITSDVTSAEVPFDGSLSFSRTSV
                     PEEQTPTESSTEAITSSDVTSTESSTEATTSEATSTESSTEATTSDVTSTESPTEATS
                     TESSTSSTTTADPQEQTSTESSTEATTSDVISTESSTSSTTTANPQEQTSTESSTEAT
                     TSEATSTESSTEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEAITSE
                     ATSTESSTEATTSEATSTESSTEATSTESSTSSTTTADPQEQTSTESSTEATTSEATT
                     SDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEATTSDVISTESSTEATTSEA
                     TSTESSTEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEAITSEATST
                     ESSTEAITSEATSTEATSTESSTEATTSEATSTESSTEATTSDVISTESSTEATSTES
                     STESSTEATSTESSTEATTSDVISTESSTEATSTESFTSSTTTADPQEQTSTESSTEA
                     TTSEATSTESSTEATTSEATSTESSTEATSTESSTSSTTTADPQEQTSTESSTEATTS
                     EATSTESSTEAITSSDVTSTESSTEATSTEATSTESSTEAITSEATTSEATSTESSTE
                     ATTSTESSTEATTSDVISTESSTESSTEATSTESSTEATTSDVISTESSTEATTSEAT
                     STESSTEATTSDVISTESSTESSTEATSTESSTEATTSDVISTESSTEATSTESSTES
                     STEATSTESSTEATTSDVISTESSTEAITSSDVTSTESSTEATSTESFTSSTTTADPQ
                     EQTSTESSSEVTSTGSSTVITVSSTTILEPEERTSTESSSEVTSTGSSTVLTASSTTI
                     LEPEERTSTESSSEVTSTGSSTVIIASSTTILEPEERTSTESSTEATSTESPIEATKS
                     SDIISTQSSNTSTEEDNYYTSALPPTVPESTTEMSSTSASFTPLIPSALYPNSTITSA
                     TATTTEETSDINSQSSTVPTDSQTSITSDLTTDYSISESSQTVTSFETESNDDISAVV
                     TPTQSSTTTLAVPPDRLTTLSESSSTISSATTSTTTADPEEAASLSTPATISSSEFIS
                     SEIPTAVSETTIFSGSSDSITTLLNTVTEETTKTSVTGPETESKTTGTITETNPPNVI
                     VSSSITSDEVTVFSGTDTLTTNPSSSTSTVTSTSYETDSKGHVTKTNVYTETLVVPCE
                     TTDNTIYQTNPKGETTGTTVVHTSTVPTGVTNEIATDSETQTSTEIATETKSQVAAET
                     KNPEAKNPDAATETASKSNSNTQPVPSYISSVTTTAQQPAISSESSVPAASSATGTSS
                     KTTPTAAVYTGGASASIIFNRFTLIVLPFLLTMAIM"
     gene            complement(<116315..>116800)
                     /locus_tag="KLLA0_E01057g"
                     /db_xref="GeneID:2893936"
     mRNA            complement(<116315..>116800)
                     /locus_tag="KLLA0_E01057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453996.1"
                     /db_xref="GeneID:2893936"
     CDS             complement(116315..116800)
                     /locus_tag="KLLA0_E01057g"
                     /note="some similarities with uniprot|Q01589 Saccharomyces
                     cerevisiae YDR077w SED1 abundant cell surface
                     glycoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453996.1"
                     /db_xref="GeneID:2893936"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ3"
                     /translation="MRFLTALTLFSATALAAFENVTSSDIPVPTNGTTSEDLSTAWVT
                     DVETVTEFTTYCPEPTTIITNSKTIIVTEPTTLTITDCPCVITKTTPEAPEKPTETVV
                     PPPAEETTEAEHTKETTVSTEVTSASSSSSHTVQTFDENIGNKVSGGFAGALACLALL
                     L"
     gene            complement(<117963..>119204)
                     /locus_tag="KLLA0_E01079g"
                     /db_xref="GeneID:2893655"
     mRNA            complement(<117963..>119204)
                     /locus_tag="KLLA0_E01079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_453997.1"
                     /db_xref="GeneID:2893655"
     CDS             complement(117963..119204)
                     /locus_tag="KLLA0_E01079g"
                     /note="some similarities with uniprot|P38953 Saccharomyces
                     cerevisiae YDR076W RAD55 Protein that stimulates strand
                     exchange by stabilizing the binding of Rad51p to
                     single-stranded DNA involved in the recombinational repair
                     of double-strand breaks in DNA during vegetative growth
                     and meiosis forms heterodimer with Rad57p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_453997.1"
                     /db_xref="GeneID:2893655"
                     /db_xref="GOA:Q6CPZ2"
                     /db_xref="InterPro:IPR014774"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ2"
                     /translation="MSFGVPLSQLIQARADHVRSGIESLDDSLNDGFQPQSIYEVYGP
                     PGIGKTKFAVQLVNNNQNRMKCLWIDTFQQVPLKLIEQGDEDEVHFKGCQFARVKKFA
                     QLWYMFQNLKETYGLIIIDGLSQLLVEYLHMYEKNSGYSNHRQTLHDFKVKSLIQLLV
                     TITKYATSNNTVVVLLNDAMNTGYQDYSDDAVVSYNDPSNGTHSDGSFSNFLVKSQRK
                     RHVQVLKSGLVANAAVGSKDARWEVFLRCRIGVFWNWDAEQKQNPNSQKRIIPEVSRQ
                     FVVQHQQPVGSKNKLVWVKTNESGNFYSCHTTIVAENPTTAVTDNLLPTNTSSSATAA
                     AAAVAAAPVLPPNKRRRVLYTEPSPSRMLLDVQSHSQPVTPNSSQSIQFTPRIVHSDN
                     IVATHGTEGTDNDAIIYDSEG"
     gene            <119812..>120573
                     /locus_tag="KLLA0_E01101g"
                     /db_xref="GeneID:2893756"
     mRNA            <119812..>120573
                     /locus_tag="KLLA0_E01101g"
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /transcript_id="XM_453998.1"
                     /db_xref="GeneID:2893756"
     CDS             119812..120573
                     /locus_tag="KLLA0_E01101g"
                     /note="similar to uniprot|P47141 Saccharomyces cerevisiae
                     YJR101W RSM26 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /protein_id="XP_453998.1"
                     /db_xref="GeneID:2893756"
                     /db_xref="GOA:Q6CPZ1"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:Q6CPZ1"
                     /translation="MSMFGRQLFRGIHTVPKIPGISQLLDSGIPHVMSANTFKTCWVD
                     QQQLLCDKLTLASAGTAAESYLPFHLVLHTAKKSYQTNIFNLASALHNNHLFIENILP
                     MEQVTHPSREFLQKLESQYSMTWDAFKDEMVRHAEEDVLGQGWLFLVENDAKELHILT
                     VQNNGTPYYFARNQSFDLNSALSLEEMEQFVTMRDLLAANADVKDWTMPLIAISLWDH
                     SYLNDYGIKGRSTYVRKCLDNLNWSAVNNRLFSTQ"
     gene            120819..120908
                     /locus_tag="KLLA0_E01123r"
                     /db_xref="GeneID:9487363"
     tRNA            join(120819..120856,120872..120908)
                     /locus_tag="KLLA0_E01123r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:9487363"
     gene            complement(<121191..>122633)
                     /locus_tag="KLLA0_E01145g"
                     /db_xref="GeneID:2894202"
     mRNA            complement(<121191..>122633)
                     /locus_tag="KLLA0_E01145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454000.1"
                     /db_xref="GeneID:2894202"
     CDS             complement(121191..122633)
                     /locus_tag="KLLA0_E01145g"
                     /note="highly similar to uniprot|P32915 Saccharomyces
                     cerevisiae YLR378C SEC61 Essential subunit of Sec61
                     complex (Sec61p Sbh1p and Sss1p) forms a channel for SRP-
                     dependent protein import and retrograde transport of
                     misfolded proteins out of the ER with Sec63 complex allows
                     SRP-independent protein import into ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454000.1"
                     /db_xref="GeneID:2894202"
                     /db_xref="GOA:Q6CPY9"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /translation="MSGRVLDLFKPFEAYLPEVIAPERPVPYKQKLIWTGVSLLVFLV
                     LGQIPLYGIVSSETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQV
                     NMENKQDRELYQIAQKVFAILLTFGQAIVVVLTGNYGKPSDLGLAISLLLIFQLIFAS
                     FTVLLLDELLSKGYGLGSGISLFTATNIAEQITWKAFAPTTVNVGRGQEFEGAVIALF
                     HLLAIRKDKKRALVEAFYRENLPNMFQVFSTIGVFLSVLYLQGFRYELPIKSTRTRGQ
                     YGSYPIKLFYTSNTPIMLQSALTSNIFLISQILYQRFSTNPLVKLLGVWGTRAGAPAG
                     QQVALSGLSYYIQPPFSVTDALLDPIKTVVYVGFVLGACALFSKTWIEISGTSPRDVA
                     KQFKDQGLTINGKRETNVYKELKKIIPTAAAFGGAVIGALSVGSDLLGTLGSGTSILM
                     ATTTIYGYYEVAAKEGGFTKNLVSGFSEMM"
     gene            complement(<123073..>124512)
                     /locus_tag="KLLA0_E01167g"
                     /db_xref="GeneID:2894187"
     mRNA            complement(<123073..>124512)
                     /locus_tag="KLLA0_E01167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454001.1"
                     /db_xref="GeneID:2894187"
     CDS             complement(123073..124512)
                     /locus_tag="KLLA0_E01167g"
                     /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
                     YDL054C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454001.1"
                     /db_xref="GeneID:2894187"
                     /db_xref="GOA:Q6CPY8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /translation="MRLSNIEHWLTYHIRTWLSNSFEWSTIHNSTFIISLFSSISAGL
                     FSMISVYAVPWELRLGYSSLDVNLLYAAGNLGAYLTPPLLGILSDSHGPVILSWLSFI
                     GFVPSYLYLSCVFQLGSDPCFALSVVAFAIVGIATSSLYFCALITCAKLYPDTKLLSI
                     SFPTTCFGLSSVIGLQVIKLPWFHSKEDGYLDLAVVFKSFAVFYTFVFLLTWISTSTI
                     SIIKLRGSQSPSASHASARADAIVLEDETTLLLASGNKGEFYKRIRNFFQDYIAYAFL
                     IVMLLSMGVMEMFNTNMVNLTSLILGPGSSFNVLTQFALFSTSSRLLSGLFIDLFTKW
                     NWPRIPLIILMLLSAILAQVIIIHAMNVVNISYIAIASAISGFTYGGLFTIFPALTLN
                     LWGDEVFGTAYGTFMLGPAFGSSFFGVMYAQVHDSNCKSVIPAATADPVTSSPNCIVP
                     AFTASTIALVVALTITIIATVKSKRLRSA"
     gene            complement(<124802..>125227)
                     /locus_tag="KLLA0_E01189g"
                     /db_xref="GeneID:2894027"
     mRNA            complement(<124802..>125227)
                     /locus_tag="KLLA0_E01189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454002.1"
                     /db_xref="GeneID:2894027"
     CDS             complement(124802..125227)
                     /locus_tag="KLLA0_E01189g"
                     /note="some similarities with uniprot|Q07362 Saccharomyces
                     cerevisiae YDL053C PBP4 Pbp1p binding protein, interacts
                     strongly with Pab1p-binding protein 1 (Pbp1p) in the yeast
                     two-hybrid system"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454002.1"
                     /db_xref="GeneID:2894027"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY7"
                     /translation="MANAWQSKKLGAWGSESSALKKKSMAYTTASPTSASAIPTPVTS
                     ENTSRSSISSQDSRSNKKKNNNSNGQNSQTNQASYVHSKPPFNHDEVKQFLISQFEQY
                     SRSSVTLTTDDSTDWNTSQSKTWKSKKYGCLSELERVLR"
     gene            <126280..>127347
                     /locus_tag="KLLA0_E01211g"
                     /db_xref="GeneID:2894286"
     mRNA            <126280..>127347
                     /locus_tag="KLLA0_E01211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454003.1"
                     /db_xref="GeneID:2894286"
     CDS             126280..127347
                     /locus_tag="KLLA0_E01211g"
                     /note="highly similar to uniprot|P09201 Saccharomyces
                     cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
                     regulatory enzyme in the gluconeogenesis pathway required
                     for glucose metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454003.1"
                     /db_xref="GeneID:2894286"
                     /db_xref="GOA:Q05079"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /translation="MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLL
                     NSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVK
                     VLVSEEQEDLIVFRNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGE
                     EDSEGTINDVARCGREMVAACYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPEL
                     RLPEQKSIYSINEGNTCYWEPTIADFIAKLKENSEENNGKPYSARYIGSMVADVHRTL
                     LYGGLFSYPGDKKNPNGKLRLLYEAFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDK
                     SSIWLGSSGDVDKYLKHIGKL"
     gene            complement(<127544..>128491)
                     /locus_tag="KLLA0_E01233g"
                     /db_xref="GeneID:2894496"
     mRNA            complement(<127544..>128491)
                     /locus_tag="KLLA0_E01233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454004.1"
                     /db_xref="GeneID:2894496"
     CDS             complement(127544..128491)
                     /locus_tag="KLLA0_E01233g"
                     /note="similar to uniprot|P33333 Saccharomyces cerevisiae
                     YDL052C SLC1 fatty acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454004.1"
                     /db_xref="GeneID:2894496"
                     /db_xref="GOA:Q6CPY5"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY5"
                     /translation="MGFFSKIVFWGKSVIAVTLLSSCALYGVLASIVFSLIGKKHLAQ
                     WSTARCFYGVMGFIMGIKINLINGERLNDLPAIFISNHQSELDILMLGRTFPPGCTVT
                     AKKQIKWVPLLGWFMSLSGTLFLDRSSREKAIKVLNDSLANLKKDKRALWIFPEGTRS
                     YSTKLELSAFKKGAFHLAQQGKIQIIPVVVSNTSSIYHPRSGVFNRGTITVKVLEPIS
                     TENLKKEDVGDLCNRVHKLMNDELKNIGYSEAIVDTVLPADVIAYNSARRFEDQHRLT
                     ADDYEEEIVDLDRSSIHSNGTVVTNPEPTERSSLLKEVI"
     gene            <128932..>129558
                     /locus_tag="KLLA0_E01255g"
                     /db_xref="GeneID:2894731"
     mRNA            <128932..>129558
                     /locus_tag="KLLA0_E01255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454005.1"
                     /db_xref="GeneID:2894731"
     CDS             128932..129558
                     /locus_tag="KLLA0_E01255g"
                     /note="weakly similar to uniprot|Q12318 Saccharomyces
                     cerevisiae YLR376C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454005.1"
                     /db_xref="GeneID:2894731"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY4"
                     /translation="MNVVSRCKVYSLDQFTSPYQYTCEVNGKKCTRIHVVQESLRGNG
                     KTRTIVNTVREQCEGNGLILNISSMPRNDHNDNDLLETYPEFQQTNLSMLQFDSFIQF
                     MSQLCTDPVTALSRCQPQNSETSTSKQLAWVLIDNLSHLSMDPKFDAKLLNRSIRLVQ
                     QTFGSVVISTSLPLSFHGGIESTFKHQSTKCASGDRLLPYFNESDIIL"
     gene            <129929..>130729
                     /locus_tag="KLLA0_E01277g"
                     /db_xref="GeneID:2894520"
     mRNA            <129929..>130729
                     /locus_tag="KLLA0_E01277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454006.1"
                     /db_xref="GeneID:2894520"
     CDS             129929..130729
                     /locus_tag="KLLA0_E01277g"
                     /note="similar to uniprot|P33399 Saccharomyces cerevisiae
                     YDL051W LHP1 RNA binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454006.1"
                     /db_xref="GeneID:2894520"
                     /db_xref="GOA:Q6CPY3"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY3"
                     /translation="MSFSQEIRRRGSYAPIDFTPEVSQACRKQVEFYFSEYNLPYDKF
                     LRSLCEQNDGWIPITTLASFNRMKKYRPVDKVVDCLKDSTILEVSADGENVRRKSPLE
                     TVDFKDRNERVLVFMNFKKIENEDKDKFLELQEELEKFFNGFTTVNQVRLKKDHKKYF
                     NGVVEVEFKTKEECVKFFEEHKTDFSYQGQPLEVVTKKQYSLAKNATRSKNFGGSGQK
                     TRSLTGYRKNIPKTNDETPEASSESKLSEGDANAPTEKKSEESATETA"
     gene            complement(<130994..>131779)
                     /locus_tag="KLLA0_E01299g"
                     /db_xref="GeneID:2894461"
     mRNA            complement(<130994..>131779)
                     /locus_tag="KLLA0_E01299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454007.1"
                     /db_xref="GeneID:2894461"
     CDS             complement(130994..131779)
                     /locus_tag="KLLA0_E01299g"
                     /note="similar to uniprot|P39005 Saccharomyces cerevisiae
                     YJL174W KRE9 Glycoprotein involved in cell wall
                     beta-glucan assembly null mutation leads to severe growth
                     defects aberrant multibudded morphology and mating
                     defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454007.1"
                     /db_xref="GeneID:2894461"
                     /db_xref="GOA:Q6CPY2"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY2"
                     /translation="MRLLVLLLLYVCKVLADVSVTVPKPGSSYAASGGEVEIEIQWTD
                     DETTPLLDEIIEYKFVLCTGSDSNIVPVDTLGPFKPSEVSDYKYQASFPATTAPDGTY
                     FIQIYAAYKEGYTIHYSGRMKLSGMDGTLSVSAESVTDTDGPPKQISLDAASVDTRSF
                     TIPYTKQTGISRFAPMQQQPGSTVTLETWSRRYATSAVSYFPSLINSLQQKTTITPGW
                     SYTRPSDYNYATPAPFPTENGGWYDPKDRQTMSVRKLNVKRAI"
     gene            <132673..>134538
                     /locus_tag="KLLA0_E01321g"
                     /db_xref="GeneID:2893766"
     mRNA            <132673..>134538
                     /locus_tag="KLLA0_E01321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454008.1"
                     /db_xref="GeneID:2893766"
     CDS             132673..134538
                     /locus_tag="KLLA0_E01321g"
                     /note="some similarities with uniprot|Q03795 Saccharomyces
                     cerevisiae YMR155W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454008.1"
                     /db_xref="GeneID:2893766"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY1"
                     /translation="MTPASKYQLASIFIGANVVALGSGTPYMYSFYAPQLLKKCHLDI
                     ERSSDFSFAMSLGMSAMGVFAGMIIDHSPSLATGIGAFLTFFAYSTLYFCYTYEYSSV
                     FLIFVALVMIGFGSICSFYAAMKCCTANFPNHRGAAGAFPISQYALSGLVFSLLCSSL
                     FKDDIQSVFLFLIIVCTSTALIGCMTFRIIEEDHVHKVESSEDALLALDDSGAENESP
                     SLLDETYHSKPINVINAKRGSMSSVTYNAFATGSADSSSPTAAAMKQSSSTTLFSLRR
                     SDSVSSWTKDLVGSLQFWGIGRARPSDSALFPYHPKRNARTSFTIDVNPTQRRQSLSQ
                     DQSQNSTVLASNNFPEPNIDNVSHEINIQTSKIETISTENKQSWWNEHPVLKNLSKPR
                     FFAYLFTLATLQGIGQMYIFAVGFVVTTQIQSSDDPSSWNQEEYLSLQVSLISVMSFG
                     ARFLSGIVSDLLVKKFHSQRLWIITFSAVLSIIASRKLISLDPDTSTTSSNLHNISLS
                     SVLFGFAFGMAFGTFPAIIADSFGTKGFSTLWGLSTAGGIFTVKILSGILANDLSVHM
                     APNETTCTKGIKCYSHTFHITQYWGLFAVFLSLLTIFISYRQKIERHRAIFTLDA"
     gene            complement(<134691..>137207)
                     /locus_tag="KLLA0_E01343g"
                     /db_xref="GeneID:2893863"
     mRNA            complement(<134691..>137207)
                     /locus_tag="KLLA0_E01343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454009.1"
                     /db_xref="GeneID:2893863"
     CDS             complement(134691..137207)
                     /locus_tag="KLLA0_E01343g"
                     /note="similar to uniprot|P33775 Saccharomyces cerevisiae
                     YDL095W PMT1 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway acts in complex with
                     Pmt2p dolichyl phosphate-D-mannose:protein
                     O-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454009.1"
                     /db_xref="GeneID:2893863"
                     /db_xref="GOA:Q6CPY0"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6CPY0"
                     /translation="MGKTKTSTKVQDCVLDVDSVGDIQVEKGPLRPFLVTEPPKNLKS
                     IRTMTSSKERLVVIALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVH
                     PPLAKMLFAGIGSLAGFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTL
                     RASGIRIWIAFVASLMFALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESF
                     NSYKALLATGLSLGLAVSSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVV
                     KATLLLAAPAALYLFFFYIHFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVG
                     SSVSIRHTGTMGGYLHSHKHIYETGSKQQQVTLYSHLDANNDWVIELYDQPEVIPETF
                     EGLKDGTKIRLRHRLTDRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIE
                     IDHEASAPGEAQEYVKALDTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCASSGVP
                     SLTLWYVEHNSNPLLPEDAAKISYQTPTFLEKFIESHQRMWHINKNLKEHHVYQSDPA
                     TWPLLLRGISYWSQDHKQIYLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQD
                     KHVLNFHIQTFQYLLGWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYV
                     FKNKKTVGYGVVITFLAAATAFFYVYKPLIYGLPWTRDVCYKSQKLGSNWDYGCNGFF
                     EKLEDYDNYVTEVSTQAVAPSKTAVADADADPTNDPLEGPPPEHVKYEANDIDQILND
                     DKPKRFVDENGVELSEEEFRAVLEQGGKIQSVEKQVIQDN"
     gene            <138197..>139474
                     /locus_tag="KLLA0_E01365g"
                     /db_xref="GeneID:2893803"
     mRNA            <138197..>139474
                     /locus_tag="KLLA0_E01365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454010.1"
                     /db_xref="GeneID:2893803"
     CDS             138197..139474
                     /locus_tag="KLLA0_E01365g"
                     /note="highly similar to uniprot|Q12377 Saccharomyces
                     cerevisiae YDL097C RPN6 Essential non-ATPase regulatory
                     subunit of the 26S proteasome lid required for the
                     assembly and activity of the 26S proteasome the human
                     homolog (S9 protein) partially rescues Rpn6p depletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454010.1"
                     /db_xref="GeneID:2893803"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX9"
                     /translation="MSLEEARNLVGKEDYEKAEAQFLAVLNHQDAAQPQSISNKDAQE
                     KEQCILELGQLYGTTHQLKKLAEFVPRSREYMMKVAKSKIAKVLKTLLNDFELIPDSL
                     DTQIEICEDSIDFATKEKRIFLKHSLSIRLATLYYQKTHYNESLQLINDLLRQFKKLD
                     DKSSLLEVHLLECKVYHKLRNLTKSKAALTSARTSANSIYCPTLTMAELDLMSGILHC
                     EDKDYKTAFSYFYESFEAFHSQTGSNTFGKACQVLKYMLLSKIMLNLIDEVKTILNAK
                     YTKETYQSRGIDAMKAVAEAYNNRSLLEFNTAMQNYKTELMGDELIRSHFNALYDTLL
                     ESNLSKIIEPFECVEVSHISKIIGLDAQQVEGKLSQMILDKVFFGVLDQGNGWLYIYE
                     TPQQDATYDSSLELINQLNGVVEQLFEKAAVLY"
     gene            complement(<139568..>140275)
                     /locus_tag="KLLA0_E01387g"
                     /db_xref="GeneID:2893693"
     mRNA            complement(<139568..>140275)
                     /locus_tag="KLLA0_E01387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454011.1"
                     /db_xref="GeneID:2893693"
     CDS             complement(139568..140275)
                     /locus_tag="KLLA0_E01387g"
                     /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
                     YMR156C TPP1 DNA 3'-phosphatase that functions in the
                     repair of endogenous DNA damage; functionally redundant
                     with Apn1p and Apn2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454011.1"
                     /db_xref="GeneID:2893693"
                     /db_xref="InterPro:IPR006551"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX8"
                     /translation="MSQSTHKLTILPHIIKWVPKDPAPVRKVISFDLDHTVIKPVKGR
                     FSRTSDDWIFMKYGKTEVLAKLSAQMKETPDFHIVFFSNQGGVVSEPRTSKSCVKHVD
                     KICKVLKYISENDSQLCDRIWIYCATKKPASLFGGSKAASTAHANKVVKNIISGQKKR
                     INGTMVTPEMFDNVRKPNRGLFDEFLKDSDEQSDSIELLFYCGDAAGRPNDFSDSDKE
                     FAKILGVPFKVPEEYFI"
     gene            <140505..>141065
                     /locus_tag="KLLA0_E01409g"
                     /db_xref="GeneID:2894221"
     mRNA            <140505..>141065
                     /locus_tag="KLLA0_E01409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454012.1"
                     /db_xref="GeneID:2894221"
     CDS             140505..141065
                     /locus_tag="KLLA0_E01409g"
                     /note="similar to uniprot|Q12368 Saccharomyces cerevisiae
                     YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
                     Putative RNA binding zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454012.1"
                     /db_xref="GeneID:2894221"
                     /db_xref="GOA:Q6CPX7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX7"
                     /translation="MSFGRRTWNREEYAAKAATSPGGQSHLSSLDQEQLKALKDRYTD
                     YNALLEYNLRDINKKTLSANLSQQKKGKQFGFYCDICDLTFKDTLQFINHLNHKSHVV
                     RFENIFNEPLIKDTRDNDLVPLNEVRSQFHKSVSAFIGDTELRSNKRKAAKRVKCEKS
                     DAEIKYQPQSEIGRLMGFTEFGSSKK"
     gene            complement(<141256..>141909)
                     /locus_tag="KLLA0_E01431g"
                     /db_xref="GeneID:2894223"
     mRNA            complement(<141256..>141909)
                     /locus_tag="KLLA0_E01431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454013.1"
                     /db_xref="GeneID:2894223"
     CDS             complement(141256..141909)
                     /locus_tag="KLLA0_E01431g"
                     /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
                     YMR157C FMP39 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454013.1"
                     /db_xref="GeneID:2894223"
                     /db_xref="GOA:Q6CPX6"
                     /translation="MFVRAAPRLLKSPVMRRMLSGKMDKAEEPPSFKTILLVGLVGTA
                     IFVKAVDSLEQNKPKNTYTFSEFDTVMSGLRRRVSIFEQDDLNLRCVQTGVATKKLKF
                     PEDAKVIKPSEAIEFFRNKSDDKYYVLLNDLYEKEGKSYMEKLPTGLSVVLIGKYMKE
                     KCQKGDTVYLLDFPDNIKDAIKFENEVSVIDKVIVPNSEGDGQVSKYFKTVDKVETI"
     gene            <142457..>142924
                     /locus_tag="KLLA0_E01453g"
                     /db_xref="GeneID:2894531"
     mRNA            <142457..>142924
                     /locus_tag="KLLA0_E01453g"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_454014.1"
                     /db_xref="GeneID:2894531"
     CDS             142457..142924
                     /locus_tag="KLLA0_E01453g"
                     /note="highly similar to uniprot|Q03799 Saccharomyces
                     cerevisiae YMR158W MRPS8 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_454014.1"
                     /db_xref="GeneID:2894531"
                     /db_xref="GOA:Q6CPX5"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX5"
                     /translation="MSLVNLGNVCAHLQNCSRARIGLTSIPYTKLHLNFAYNLYKHGF
                     LSSLQRGSTKGPDVTPVDVTPDNIATRKLWLGLKYRENKPVISSCRLISKPNLRISLD
                     AHDLKKLCSGTSVRLIKPLAPGELILVKSGNEIMDIDDAIAKKVGGEVLCRIR"
     gene            complement(<143257..>144213)
                     /locus_tag="KLLA0_E01475g"
                     /db_xref="GeneID:2894513"
     mRNA            complement(<143257..>144213)
                     /locus_tag="KLLA0_E01475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454015.1"
                     /db_xref="GeneID:2894513"
     CDS             complement(143257..144213)
                     /locus_tag="KLLA0_E01475g"
                     /note="weakly similar to uniprot|Q12191 Saccharomyces
                     cerevisiae YDL099W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454015.1"
                     /db_xref="GeneID:2894513"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX4"
                     /translation="MSELSPEEERARKLEEAKIRVEELKKKNKNKKNKKKKDKEDLEA
                     AEVKTETETELEPTDTNVSESPVHSDEQPIVEETKAEEKAEINADAKGNDNNEEKFEK
                     ESVEKSEKESAENKKDSEEEVLEKEATDIPNPTEEVSKEAFAVQQKEEEPIEAKSTDE
                     VEELFGGNDDKEKDFLSTIQEQKSQDEVINLKEEVSKLKDQVKQLKFVNIDQESSIEE
                     LEEQINIMKSQLNDKTVQLLSAQQELSTSRQEVEQLRATQSPQLTPVEFSSFDRHSPS
                     KFEPSRQIQHPTTDPVMLAKWKNWNVDMTNWRSVGVGPVVEF"
     gene            <144767..>145816
                     /locus_tag="KLLA0_E01497g"
                     /db_xref="GeneID:2894749"
     mRNA            <144767..>145816
                     /locus_tag="KLLA0_E01497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454016.1"
                     /db_xref="GeneID:2894749"
     CDS             144767..145816
                     /locus_tag="KLLA0_E01497g"
                     /note="highly similar to uniprot|Q12154 Saccharomyces
                     cerevisiae YDL100C ARR4 ATPase involved in resistance to
                     heat and metal stress active as a dimer normally localized
                     to the cytosol but appears to localize to late endosomes
                     under stress conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454016.1"
                     /db_xref="GeneID:2894749"
                     /db_xref="GOA:Q6CPX3"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDLTVEPDLNSLITSSTHRWIFVGGKGGVGKTTSSCSIAIQMAL
                     AQPEKQYLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAV
                     ANNATGSGEFSDLLQGGALSELTGSIPGIDEALSFMEVMKHIKNQEQGEGDRYDTVIF
                     DTAPTGHTLRFLQLPSTLSKLLEKFGEITARLGPMLNSLAGANNVDLVGKMSELKSNV
                     EKIKEQFTNPDMTTFVCVCISEFLSLYETERLVQELISYDMDVNSIIVNQLLFAEYDE
                     GDSCKRCQSRWKMQKKYLDQIDELYEDFHIVKMPLCAGEIRGLNNLKKFSQFLRKPYD
                     PVADSKVIYELEQQD"
     gene            complement(146055..146127)
                     /locus_tag="KLLA0_E01519r"
                     /db_xref="GeneID:9487438"
     tRNA            complement(146055..146127)
                     /locus_tag="KLLA0_E01519r"
                     /product="tRNA-Met"
                     /db_xref="GeneID:9487438"
     gene            complement(<146269..>146649)
                     /locus_tag="KLLA0_E01541g"
                     /db_xref="GeneID:2894240"
     mRNA            complement(<146269..>146649)
                     /locus_tag="KLLA0_E01541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454017.1"
                     /db_xref="GeneID:2894240"
     CDS             complement(146269..146649)
                     /locus_tag="KLLA0_E01541g"
                     /note="some similarities with uniprot|Q03818 Saccharomyces
                     cerevisiae YMR159C ATG16 Protein that interacts with the
                     Atg12p-Atg5p conjugate during formation of the
                     pre-autophagosomal structure essential for autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454017.1"
                     /db_xref="GeneID:2894240"
                     /db_xref="GOA:Q6CPX2"
                     /db_xref="InterPro:IPR013923"
                     /translation="MELPLLDKLKVRDLVDKRFSHLFETVSLLSGDNEEDNEDQLRLK
                     NSIKNLREHLTEKEEEIRQLHDVISVKNRDAERLNDELISINIENNLLQERLTHIQAE
                     YDTLIERWLLKAQREADIMNTRLK"
     gene            <146955..>149105
                     /locus_tag="KLLA0_E01563g"
                     /db_xref="GeneID:2894231"
     mRNA            <146955..>149105
                     /locus_tag="KLLA0_E01563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454018.1"
                     /db_xref="GeneID:2894231"
     CDS             146955..149105
                     /locus_tag="KLLA0_E01563g"
                     /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
                     YMR160W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454018.1"
                     /db_xref="GeneID:2894231"
                     /db_xref="UniProtKB/TrEMBL:Q6CPX1"
                     /translation="MSEPINSTGEDNNPFWRRWIPGTNASEENSQDTPTNSSSEHQDE
                     GWLKRYIPAWFSNQESLEISDSTSYHQLTKKQIKILENEAEQGILKGHDTCCWFNETL
                     NNKLLDSDGVLSVYNTGSATCPLPLSKYPLLPQRKSTIINAKNSTIIPGVSPTEYMHE
                     LPLKTKLAHAIKNHYNFISEKHLYLKQHSTLNFNEDTIIVISLHGSLPEKYERVSTGK
                     LPTALELNDQMLKKLLNFDPHRALTFSFECPLDVKPTPMVLQETISLLKNWMHLFQDA
                     TRIFVIGTYHSVPLSILLTDAILDNFTITKLKSIGILGFESCLQGYQFWNHTAEITPQ
                     SMENPTFQVNKEKALFEGSSKLQQEVLSTYRNYRNPDGPERKELMNVLDKLLFHHPNL
                     RISLVGKLYDNFLTVSQKLAMDYIHPMIQRRLWCDGNNMNLNYINVAKAIPDETMINL
                     EQSFKIPIPEEREFEVSIMNNMLLAINLGHRQFIPFLNELSPFYISRSFNSSTCPALL
                     KKQLQTESKAWQQEKDASFKEMVTDSEKILPKDITTYRVAFDYLHYKSHRSPDDIELK
                     TSIFNDISILEGFIYDNIFTANLQAPVHLMMHHSSDNSKVLNSVNEYNLVWNFHEVMS
                     SFIRIRNFPTLPGPPVITACMETPNSQSQRIEITKAIFDNTNLESCKRMEQLWRTYQT
                     WNPNTTGLKKLHNILSVLRLYDSGEQLQKDVSIV"
     gene            <149305..>150960
                     /locus_tag="KLLA0_E01585g"
                     /db_xref="GeneID:9487424"
     mRNA            join(<149305..149370,149488..>150960)
                     /locus_tag="KLLA0_E01585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999342.1"
                     /db_xref="GeneID:9487424"
     CDS             join(149305..149370,149488..150960)
                     /locus_tag="KLLA0_E01585g"
                     /note="similar to uniprot|P39009 Saccharomyces cerevisiae
                     YDL101C DUN1 Cell-cycle checkpoint serine-threonine kinase
                     required for DNA damage-induced transcription of certain
                     target genes phosphorylation of Rad55p and Sml1p and
                     transient G2/M arrest after DNA damage also regulates
                     postreplicative DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999388.1"
                     /db_xref="GeneID:9487424"
                     /db_xref="GOA:B4UNA3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B4UNA3"
                     /translation="MSPSEVFSCKYQSLSMNPAVKRRAQQDTQSSNNNQRIIATLLSL
                     IPDREQKIQLVDIPTISVGRSRSCNIVLSEPDISTIHAELYTIEVQINGFKRKMINIT
                     DKSRNGTFVNGDRLIRKDYVLKNGDKIVFGKSCSYLFKYATLTENGLSQTTATQISQT
                     TQNSDYDGVFRKPLFSSQNTTKKLSRTREQPRSFFDKYLAGKELGTGHYAIVKEARNK
                     ETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQIQT
                     YLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILL
                     SISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLV
                     KTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILQGKFAFYSPYWDNIDDS
                     VLHLISNLLVVNPASRFSVNDALTHPWFTSNNAEVTMGNERRSQLEPGRLPKTFSELS
                     NLQK"
     gene            complement(<151015..>154320)
                     /locus_tag="KLLA0_E01607g"
                     /db_xref="GeneID:2894580"
     mRNA            complement(<151015..>154320)
                     /locus_tag="KLLA0_E01607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454020.1"
                     /db_xref="GeneID:2894580"
     CDS             complement(151015..154320)
                     /locus_tag="KLLA0_E01607g"
                     /note="highly similar to uniprot|P15436 Saccharomyces
                     cerevisiae YDL102W CDC2 Catalytic subunit of DNA
                     polymerase delta required for chromosomal DNA replication
                     during mitosis and meiosis intragenic recombination repair
                     of double strand DNA breaks and DNA replication during
                     nucleotide excision repair (NER)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454020.1"
                     /db_xref="GeneID:2894580"
                     /db_xref="GOA:Q6CPW9"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW9"
                     /translation="MTVGITRAREVETLEDAFQDIKKQRTQSFDRSALSEPVSTIEII
                     PTDKFKKQNVLGYKSSKVNDTVGKGNPTAFEEELSLMDHELVEKTECGQSKVWSRVPI
                     PADFNAKTSDISFQQLDAEQAMLPGQYDSNTNIVIRFFGVTDKGNSILCNVTGFKHYL
                     YVPAPLGFHQENILTLQQYLNEHYENNVDSIKIVPKQSIWGFSGDAKIPFLQIFVKNP
                     NLLNKIRTGFEKGYIQPNDKWFVGGCTTYDNIAFPLRLMIDCGIVGMSWITLPASKYQ
                     LVPVNQRISTCQFEVNINYKDLIAHPAEGEWSHNAPLRIMSFDIECAGRPGVFPEPEH
                     DSVIQIANVVSISGAAKPFIRNVFTVNSCSPITGSQIFEHDKESDMLEHWRDFIVEVD
                     PDVVIGYNTTNFDFPYLIDRAAALGVQSFPYFGRLSNVKQEVKSSTFSSKAYGTRESK
                     NINIDGRLQLDLLQFVQREYKLRSYTLNAVSAHFLGEQKEDVHHSIITTLQNGDSETR
                     RRLAVYCLKDAYLPLRLMEKLMALVNYTEMSRVTGVPFMYLLARGQQIKVISQLFRKC
                     LQIQTVIPNMSSQGSDEQYEGATVIEPKRGYYDVPIATLDFSSLYPSIMMAHNLCYTT
                     LCDRATVQRLNLKLDEDYIVTPNNDIFVTSKVRRGVLPEILEELIGARKKAKFDLKNE
                     TDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGRTMIETTKNAV
                     ENKYCIKNGASHDAVVVYGDTDSVMVKFGTTDLEESMKLGAEAAAYVSSLFKDPIKLE
                     FEKVYFPYLLINKKRYAGLYWTNPKKYDKLDQKGLASVRRDSCPLVSIVMNKVLKKIL
                     IGRNVDGAMQFIRETIDDILQNRCDISKLIISKTLAPNYTNPQPHAVLAERMKKRDGV
                     GPNVGDRVDYVIIGGGDKLFNRAEDPLYVLEQNLQLDSIYYLSNQLQNPIISIIAPII
                     GEKQANSMFIVKSIKRQSGPVGAASKQKGGLMSFVKKVDTCKSCKRVLRKNEGPLCND
                     CLSRSGELYMEALYDVRTLEERFSRLWTQCQRCSGSLHNEVLCSNKNCDIFYMRVKAK
                     KELQEKVIELSKW"
     gene            <155088..>155783
                     /locus_tag="KLLA0_E01629g"
                     /db_xref="GeneID:2894497"
     mRNA            <155088..>155783
                     /locus_tag="KLLA0_E01629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454021.1"
                     /db_xref="GeneID:2894497"
     CDS             155088..155783
                     /locus_tag="KLLA0_E01629g"
                     /note="similar to uniprot|P48353 Saccharomyces cerevisiae
                     YMR161W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454021.1"
                     /db_xref="GeneID:2894497"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW8"
                     /translation="MSEYTEEQERITLDILSKDKHEFYEMLKVGKSASESDIKKAYRK
                     LAIKLHPDKNRHPRASEAFKKINRAFEVLSDDSKRRIFDQLGHDPDDRAAAQESYRGG
                     SSAAAAGGPRFRGNAGFGEPFGGSPEDIFEFLFRGGGPGGQFGGHPFGGPFGGPFGNA
                     GGATYSFGGPGGFKVYTNYDSPFGRRARRTQPRHNDNSAERKEEPNTQLMMLIAPFIV
                     IILLNLLERLLLG"
     gene            complement(<155975..>160627)
                     /locus_tag="KLLA0_E01651g"
                     /db_xref="GeneID:2894443"
     mRNA            complement(<155975..>160627)
                     /locus_tag="KLLA0_E01651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454022.1"
                     /db_xref="GeneID:2894443"
     CDS             complement(155975..160627)
                     /locus_tag="KLLA0_E01651g"
                     /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
                     YMR162C DNF3 Non-essential P-type ATPase that is a
                     potential aminophospholipid translocase localizes to the
                     trans-Golgi likely involved in protein transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454022.1"
                     /db_xref="GeneID:2894443"
                     /db_xref="GOA:Q6CPW7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW7"
                     /translation="MTGRSRGYSLRTQLFNKKLSDKLRSESEEIEMEIANDGDSLPAS
                     SYSTENLPSNQTKKRKKLSLRTKIMDLILNRTTHLSSESGRVIPICLDKNSVLYQQYA
                     RSNLLIDERTDRPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSW
                     STTGTYTTIVPLSIFLSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDS
                     IYSLSNVSARSTDAILSDFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKD
                     LKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT
                     SATGLSMHSATTTLEDPNNDLYNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGI
                     VIFTGEETKIRMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNY
                     VDNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYH
                     IESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHEIDEDLI
                     DPIDDDIDVISIEDRSFLNEFDLRSTHSKNPRTSIEYKGNSGAVYSGRPSMALQIQRQ
                     ELAEDLNTTRTNSSRSSEEKNGLKTTVDLLLYIQKHPNTEFSIRAKFFILSLALCHTC
                     LPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYPNGFDDQPIV
                     EDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERLRNSELAQNKVLE
                     QQNLIEQRKLEEAEMILHQRKSLELTNMRDGITGLARNSQLQNRSSISTLKLDAARKS
                     ISRKASIRSEQELQINSIDDFLSNIQHDESQIENIMLNARKSVQFQQREKYGEAEDNS
                     ESMDSIEKYIGDEKLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEA
                     KYHEAKTSLTNRSTQIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMW
                     MLTGDKRETAINIGYACKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKIAHCVLV
                     IDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAI
                     GDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSK
                     FVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDL
                     KPMTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIWGFTAQSDNSI
                     YPIGVINFTSICFLINVKCQFIETRNRNWLAFASLLISCIGWILWCCLLPGIYGENAI
                     YDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKDD
                     IRKKLEFAAHRELHQSWSFQKDPSSVKKYAMKAVNFKKNGAEDSNYNTNDRYDIKDFD
                     TEEYEMLPSGKLIHKKQVTKKSVKSKLGKKLRFKLNSKPDDFEIKQIIENRMRDLE"
     gene            <161221..>162633
                     /locus_tag="KLLA0_E01673g"
                     /db_xref="GeneID:2893723"
     mRNA            <161221..>162633
                     /locus_tag="KLLA0_E01673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454023.1"
                     /db_xref="GeneID:2893723"
     CDS             161221..162633
                     /locus_tag="KLLA0_E01673g"
                     /note="similar to uniprot|P43123 Saccharomyces cerevisiae
                     YDL103C QRI1 UDP-N-acetylglucosamine pyrophosphorylase
                     catalyzes the formation of UDP-N-acetylglucosamine
                     (UDP-GlcNAc) which is important in cell wall biosynthesis
                     protein N-glycosylation and GPI anchor biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454023.1"
                     /db_xref="GeneID:2893723"
                     /db_xref="GOA:Q6CPW6"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW6"
                     /translation="MTDLKQQYESKGQSHLFAHWDTLAQNEREHFLNQLSKFDSKKLS
                     EDCQKAIALADENSSSENVIRPLPASSYESVIGDDDLRNTYQQLGLNAIKNGEVAVIL
                     MAGGQGTRLGSSAPKGCYNIGLPSGKSLFQIQAERLKRLQTLAGCTKPIQWYIMTSGP
                     TRAATESFFKEHNFFGLSESQIHFFNQGTLPALDISGEKLFLSDKDELVESPDGNGGL
                     YRAIKTNNLLNDFNSRGIKHIHMYCVDNVLVKIADPVFIGYAIKNDFQLATKAVRKRD
                     AHESVGIIATKNDKPCVIEYSEISKPLAEAVDEDTGLLTLRAANIVNHYYSVDLLNTK
                     LDNWVESMPYHIAKKKISYYDNVNDKYVKPSEPNGIKLEQFIFDVFPSIPMSRFGCLE
                     VERAEEFSPLKNAPGTANDNPETARDAYLHLTTSWLKDVGALVNDEILVEVSSLLSYG
                     GENLDSYKGTVFDKQGEILN"
     gene            complement(<162748..>164748)
                     /locus_tag="KLLA0_E01695g"
                     /db_xref="GeneID:2893907"
     mRNA            complement(<162748..>164748)
                     /locus_tag="KLLA0_E01695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454024.1"
                     /db_xref="GeneID:2893907"
     CDS             complement(162748..164748)
                     /locus_tag="KLLA0_E01695g"
                     /note="weakly similar to uniprot|Q03824 Saccharomyces
                     cerevisiae YMR163C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454024.1"
                     /db_xref="GeneID:2893907"
                     /db_xref="GOA:Q6CPW5"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /translation="MDIFQAVPLHLQIPRIEIPKMASAASTPSTMSSSQTWSSSRPQV
                     PISYQQLRKLSEWGIEALKDTSPTVVGQDRFESQEILIDNDYRTDFLNSHEEDSRWSK
                     QVDLIMKQLPYGDLDAFVDEFHYEIISSQLLTSSIASHHQLFTVQKSILNFNKENTLS
                     IHNAEGKTIPTKYGQLLISGKKFYLQRTIPYMFTILTARKAFRKMLYKRHLPRSSLMS
                     LLMIAVYLALQQEYFHAKYSKYTALLNLRQMNAALQSVDKLIYRYHLTYKELTIYKPI
                     ALTENRGLRSDEARTLTLLTDVLTCTVDQLFHKLNIASSNILPVVNAVQLTDYISIYN
                     VDLQSLYQMIRTVESLDITQKLERLQYMRKFFLCCLLSINYTDPLKKCEIALVLKRIF
                     PGYHVEKTSDIERFQIISKQLYTLTQGISSLLPVLHHYKHLLLSVYGSTIEKEDPESK
                     EAVITQSIYRLSELQRYLMKQDKTSTELSSHLIDELNGIIQIWNIDYKHNSHEQLKPP
                     KCSPRPSSQRVFSGGLNLDIVKTTSDIPVVVDSFPKLTSLVDVLEVDETGSDIEKEHE
                     ELVYGTENDQETASSNDSKFSRFTDDQLRHELNQRILNLSIENKKSRENLRKQKSFEL
                     MNRKIENQKKGRPQIDCKGLFNSEESIPVLFELKQFLNRRSD"
     gene            complement(<165223..>166842)
                     /locus_tag="KLLA0_E01717g"
                     /db_xref="GeneID:2893689"
     mRNA            complement(<165223..>166842)
                     /locus_tag="KLLA0_E01717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454025.1"
                     /db_xref="GeneID:2893689"
     CDS             complement(165223..166842)
                     /locus_tag="KLLA0_E01717g"
                     /note="some similarities with uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164C MSS11 Transcription factor involved in
                     regulation of invasive growth and starch degradation
                     controls the activation of MUC1 and STA2 in response to
                     nutritional signals"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454025.1"
                     /db_xref="GeneID:2893689"
                     /db_xref="GOA:Q6CPW4"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /translation="MAGPGARKSNASNTPQDKKMKGDSIQDQKNKQYNSGDVVEPFVS
                     DAMAKNSKQLLYAHIYNYLVHNQHHDTAKKFLQEANVPLSKAVPQHSLNGDKLLNSKM
                     LMNSPDTFLFEWWQSLWALNQYVETTPIENLTSLKPFNDRIVPILPQVPPQEMLSRVV
                     RTGPIAPAMGFAGNIVPQQQQQQQQQQQQQLQQQQQQQQHFRTMTSPGSGNTPYATNA
                     NSFPAGVRVPQPQGSFQPVLGTTPNAGTNAGLGVNPYHAATLGSSKSTPKPQNTSVGS
                     KNKQTKKSSATNKDSGANTKPRANGESKQFKGVNSSSKVKKPSPSGSQQVQANWTKLQ
                     QKQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQHQQQQQHQQQQQHQQQQQQIRMQYQK
                     MMTLMQHQQNQQNQQHHQLGNQNILPGQGDPSDNSSPSQQYLQQQRAYENMVKSQQQD
                     QPMNKDHFAMSLQTQQPQSFDSYAMPATMGPQASSQPLDNNKKSEPLSKIDVTNNQDF
                     NTFSGGSNNKLNFGQFDMSGLGNEFMGGRKQ"
     gene            complement(<167644..>168996)
                     /locus_tag="KLLA0_E01739g"
                     /db_xref="GeneID:2893886"
     mRNA            complement(<167644..>168996)
                     /locus_tag="KLLA0_E01739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454026.1"
                     /db_xref="GeneID:2893886"
     CDS             complement(167644..168996)
                     /locus_tag="KLLA0_E01739g"
                     /note="weakly similar to uniprot|P07390 Saccharomyces
                     cerevisiae YNR045W PET494 Specific translational activator
                     for the COX3 mRNA that acts together with Pet54p and
                     Pet122p located in the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454026.1"
                     /db_xref="GeneID:2893886"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW3"
                     /translation="MHLRCCFRSMARRFHTSRRITLQWKNKMFQSTPRLQKGQQRYSE
                     TLWKYFNAPGNAFFVTTNVVTLTGMVIYSTVSTMSRQATIIDSLENGFGVENSLDAVY
                     DDKQNFAVPKRPRSEVSWRESSQLKKQAMEQRRSEVIGESNNAAADIETISDPFLDSN
                     PEGKGLQSANSYMVKMGIFYLFYSFHIYKKSLETGVEVNDKMLQKLLDNVPQNEHDLH
                     DIQNAAFYKSWRHEFGALLKNLSKAQHFSVPKPESFPEELQDVFKRLSDSKMAFQSDF
                     YEFYQSINDISQRRLLQLWYYDNSRNLLKQNNFSNERIYEQMVFESSQWNNDLFEKYI
                     SVLYQPSSRRFQSMFNNYFKGMTSVSLDTVLGVLKGLIASNVQRKNDHIVKVVSLLRK
                     NSVLAGKKKLRVIIPTEDKIPLLEQMMTADVRKNTYSVMAKNPVALKLLSTLGGVKSN
                     "
     gene            <169765..>170334
                     /locus_tag="KLLA0_E01761g"
                     /db_xref="GeneID:2893902"
     mRNA            <169765..>170334
                     /locus_tag="KLLA0_E01761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454027.1"
                     /db_xref="GeneID:2893902"
     CDS             169765..170334
                     /locus_tag="KLLA0_E01761g"
                     /note="weakly similar to uniprot|P26188 Saccharomyces
                     cerevisiae YDL200c, DNA repair methyltransferase
                     (6-O-methylguanine-DNA methylase) involved in protection
                     against DNA alkylation damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454027.1"
                     /db_xref="GeneID:2893902"
                     /db_xref="GOA:Q6CPW2"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /translation="MSHLLVYDFMEHDLANVLIVVKPSTKSLVFVSLSGTKPKLLGDA
                     KKFVSKVNSLSKNKGSIYTLKNKSILKSDDVAWLEQLSFDFLQILAGGIDSQTNIKCE
                     YLLGTEFQKKVWETTKTIKAGATISYQQLAVLLGNPKAVRAIGSALAKNNIAVVIPCH
                     RIIGSKGKLTGFRWGIELKESLLRQEQAI"
     gene            <171319..>173037
                     /locus_tag="KLLA0_E01783g"
                     /db_xref="GeneID:2894019"
     mRNA            <171319..>173037
                     /locus_tag="KLLA0_E01783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454028.1"
                     /db_xref="GeneID:2894019"
     CDS             171319..173037
                     /locus_tag="KLLA0_E01783g"
                     /note="similar to uniprot|Q12300 Saccharomyces cerevisiae
                     YDL138w, glucose receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454028.1"
                     /db_xref="GeneID:2894019"
                     /db_xref="GOA:Q6CPW1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW1"
                     /translation="MSEEKKVVNVPSNSEKESALVEVESRSTIDEIENVFNGNKPTEE
                     VLKEVDELVLKYDLQEYQELLSRGALLANDPDVLLTDNYSEKERKKIGRELTHPFLSL
                     SRGMIWAALCTSLAAVNFGMDESAVGGAVLGYQKAFNITNPNIQGLTLAAPYLAAGVL
                     TLPLTVLLNKKFGRRFIVLISCFIGVSGSLIQGFSNGLGLILFARLYLGIGMGLCSST
                     VPIYTAECAPAVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIGSSCVA
                     PFITALVVYIPPESPRWLIGNGFVRESLESLIRLRNTEVSGSRDFYILYESLKYEHKL
                     AAKLSWHQEIKSLFSNIRNRFALWVSFLGILGQQYGGVNILVSYTATILTNAGIDPVT
                     AIAGSIGIGGGCFLATFLSSQLIDRFGRRTMLLLTLPVEGACLFWLGGILNIKEDQAR
                     LAAGLAAMYVFVLFYGIGIGPISFTLVAETPSITVRMAHSAFAMSINWLLDFCLTMTW
                     PKMADSMGTSGGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLDEVFKHGVTHYAKQNT
                     RKLFGK"
     gene            complement(<173125..>174093)
                     /locus_tag="KLLA0_E01805g"
                     /db_xref="GeneID:2894157"
     mRNA            complement(<173125..>174093)
                     /locus_tag="KLLA0_E01805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454029.1"
                     /db_xref="GeneID:2894157"
     CDS             complement(173125..174093)
                     /locus_tag="KLLA0_E01805g"
                     /note="similar to uniprot|P25379 Saccharomyces cerevisiae
                     YCL064C CHA1 catabolism of hydroxy amino acids catabolic
                     serine (threonine) dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454029.1"
                     /db_xref="GeneID:2894157"
                     /db_xref="GOA:Q6CPW0"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q6CPW0"
                     /translation="MDQLTIKTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHL
                     IKTTMDSISDPENELAVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIES
                     AGAKVVIFGDHWKEADTYLREYVMRQSSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQL
                     AESHTDINDVKGIVCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIA
                     GEPVVLDRISSIATSLGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSIL
                     VEPACGASLHTCYRPELLGPLGPDDIVVVILCGGSCNTYDDLKSFH"
     gene            <174481..>175047
                     /locus_tag="KLLA0_E01827g"
                     /db_xref="GeneID:2894256"
     mRNA            <174481..>175047
                     /locus_tag="KLLA0_E01827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454030.1"
                     /db_xref="GeneID:2894256"
     CDS             174481..175047
                     /locus_tag="KLLA0_E01827g"
                     /note="similar to uniprot|Q12517 Saccharomyces cerevisiae
                     YOL149W DCP1 Decapping enzyme essential phosphoprotein
                     component of mRNA decapping complex plays key role in mRNA
                     decay by cleaving off the 5' cap to leave the end
                     susceptible to exonucleolytic degradation regulated by
                     DEAD box protein Dhh1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454030.1"
                     /db_xref="GeneID:2894256"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV9"
                     /translation="MSTETLEIYRKALNFNVIARYDPKIKQLLFHTPHATVYKWGDDN
                     WNKLEYQGVLAIYLRDVGDKEAILPEVSSYDDTITGQQSEANTPHVLTGHDIYNYGLI
                     IMNRINPDNFSLAIAPNSVLNKRKLFAPNREEELEPMKVEVRDDLVMIKTLKKEVYGI
                     WVHTPEDRQNIYELIKYLLENEPTDSFT"
     gene            complement(<175162..>176991)
                     /locus_tag="KLLA0_E01849g"
                     /db_xref="GeneID:2894229"
     mRNA            complement(<175162..>176991)
                     /locus_tag="KLLA0_E01849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454031.1"
                     /db_xref="GeneID:2894229"
     CDS             complement(175162..176991)
                     /locus_tag="KLLA0_E01849g"
                     /note="weakly similar to uniprot|P50875 Saccharomyces
                     cerevisiae YOL148C SPT20 Subunit of the SAGA
                     transcriptional regulatory complex involved in maintaining
                     the integrity of the complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454031.1"
                     /db_xref="GeneID:2894229"
                     /db_xref="GOA:Q6CPV8"
                     /db_xref="InterPro:IPR021950"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV8"
                     /translation="MSTGTGYPPSHAKTGDSRSIPSQQQMQVPVSGNMLQQQQRLMYQ
                     QRLKQQQQQQLHFEQQIYQLLTTLNRKPKRLYQFKEDPDDLLKKYEQFKPSFEFHIYE
                     NNFKICAPANSRLQQHQKTPQNSNDGLILNKNNEVLREFLEYVARGVIPEAIMEVLRD
                     CNIQFYEGCLILQVYDHTNTVDVKQETPNPNQMPKKVPTQTDLQKRNSSSSSSGPGAA
                     ANSSVPATRVPVDGSSSVPAPVGVTPKPENVAANSLSNNGNTNTTNASTVPNSTNNAK
                     KDKENSGKSFTTLKRPRMYRTLLRPNDLTHYYDMLSYADHTRFPDSMYQQLESEILTL
                     TKRNLNLDTPLNPYTHKEYVSDEEFLEPVYEEEKQKWEFPYRELCIEPFTKGAIEHIE
                     LHEELPQHSSTYEQLMLILSEKTTTTTAATLAASLLKKAEANAARKAATNGKTSGSSV
                     GVTSNSVAAAAAVGTGTNTDAQQFSRLKIIEHWRVEKERRKHQSVNSNIVPSAYDTRI
                     SMGNPMTQRRASQQHTDGQSMNQTSTAVANKRTGTEPEEKPKAKRGRKATKKAADGTA
                     APPKKRAMTKKKAAAAAAAAAAAAAAAAAAAAAAAAAGPPSAT"
     gene            complement(<177514..>178218)
                     /locus_tag="KLLA0_E01871g"
                     /db_xref="GeneID:2894204"
     mRNA            complement(<177514..>178218)
                     /locus_tag="KLLA0_E01871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454032.1"
                     /db_xref="GeneID:2894204"
     CDS             complement(177514..178218)
                     /locus_tag="KLLA0_E01871g"
                     /note="similar to uniprot|Q12462 Saccharomyces cerevisiae
                     YOL147C PEX11 Peroxisomal membrane protein required for
                     peroxisome proliferation and medium-chain fatty acid
                     oxidation most abundant protein in the peroxisomal
                     membrane regulated by Adr1p and Pip2p-Oaf1p promoter
                     contains ORE and UAS1-like elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454032.1"
                     /db_xref="GeneID:2894204"
                     /db_xref="GOA:Q6CPV7"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV7"
                     /translation="MVLDTVIYHPTLTKFISLLNKTAGREKILRLLQYLVRFLAVQYR
                     SGLNRQLQSEFTSVRKILRFFKPLNHIQDAAKLYDNKIAPDQWVRWLSIIKNVGYVGY
                     LTLDQINLLRILKLIPATPITAKKVPRYTNWFWFVALIAGLITDVRKLYTSQRKIEAS
                     LSSKGNAPTEKASSEKLTAYYNERFAAFRRLIWDSIDTFIVLNNLQFLRNDESSVALA
                     GVATSVFGLQDVWKTA"
     gene            <179231..>179797
                     /locus_tag="KLLA0_E01893g"
                     /db_xref="GeneID:2894483"
     mRNA            <179231..>179797
                     /locus_tag="KLLA0_E01893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454033.1"
                     /db_xref="GeneID:2894483"
     CDS             179231..179797
                     /locus_tag="KLLA0_E01893g"
                     /note="similar to uniprot|Q12146 Saccharomyces cerevisiae
                     YOL146W PSF3 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454033.1"
                     /db_xref="GeneID:2894483"
                     /db_xref="GOA:Q6CPV6"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /translation="MGYYDIDDILADGTRFPCRFNYDVPGLGYLEGNPGRPISKNAKL
                     ELPLWMVHLLAVVGAQSNEDSRVEEPLPFVELLPPDLFAPRVLNAIKSGATSLDLHSI
                     SPHFYTLAEKWATLFSDKELSQVLKDMLLERGQEINNHAISVSMFSNCNQTNDSAVFL
                     QTLDEFEKTIYRDTNVNCKEMKKWLVLK"
     gene            complement(<180022..>183243)
                     /locus_tag="KLLA0_E01915g"
                     /db_xref="GeneID:2893707"
     mRNA            complement(<180022..>183243)
                     /locus_tag="KLLA0_E01915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454034.1"
                     /db_xref="GeneID:2893707"
     CDS             complement(180022..183243)
                     /locus_tag="KLLA0_E01915g"
                     /note="similar to uniprot|P89105 Saccharomyces cerevisiae
                     YOL145C CTR9 Component of the Paf1p complex which is a
                     large complex that binds to and modulates the activity of
                     RNA polymerase II and is required for expression of a
                     subset of genes including cyclin genes contains TPR
                     repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454034.1"
                     /db_xref="GeneID:2893707"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV5"
                     /translation="MDASTDYPLAQWPNSLDIPLRESEEVVSIDLKNDLPEDPQDLTT
                     LLVEEQSDKEHWLTIAASYCNNGSVKEGVKLAEQALSHFSDKQTASIHTFLTWAYLRL
                     ARSSTGIVEERNKYLSLAETHVIEASKQDPTWIGNRLATVELYFQRGMYDRALEYTDI
                     FIKSVQDEDKRSGSVNKPNIMFIIMRAKLMYIKKNYHGALRLFQELLLLNPTLVPDPR
                     IGIGMCFWHLKDRSMAIAAWERSAAVSGKDSVAAILVLLGKFHNSLTSSTNDEMFKTS
                     FTNAVLDLDTLYQERGPHPVLLALLQVYFYMNQKYDKVITIYEQKIMSRSAMISDQIL
                     SESSFWVGRAYYAQGDSRKAFHYFQEALKKNEGNLLAKIGLGQSQVKNNLVEESILTF
                     ENIYQSNESLQEINYILGLLYASKCFNTTVKVSSAELRKITDKAIQFLEKYVHLTKAK
                     GNQIVINKAYLLLSELYEIKNNYKQSIDYLQKGIDQLHIQGEETPLEVLNNLGCFYFV
                     TGEYEKAQNLFQEASAKVIVHDSKKVTLDYNTARALEHTDKAKSHDIYTAILTDHPKY
                     ISARIRDIHLKFINHPESNLKDEIKSVLTENESNGEVRAFYAWYLKKLGKPAEHEMSE
                     HSKETLVKYDSHDLYALISLANLYVAIARDQKKSARNSKDANKSIESYLKATQLYQKV
                     LQVDPMNIFAAQGLAIIFAENKRYGQSLEVLRKIRDSLDNQSVHINLGHCLSEMREYA
                     KAIENYEIALNRFDNPKSKPLLLNLLGRCWYLRALKERSLEAVQKALGYVKRAYDLES
                     AKVNGKMTSSYKFNLALLEFQVAEQMRRSSPKERTMADLEASIEGLQYGISLLKELLE
                     TKSIVIPSEQLEQRIQLGETTMKTALERSIEDQKAYELEISAKMENARKVLEEQRELE
                     AQRDAQQKEEEKIKSEKLAEEYRKLQEEAQRLIQERTAQEEIVDDDNDNDDLPQEEDG
                     SYKAPSKKGKKAKRKADSDSKSSKKKRRTAKKIVDEDDEDDDQLNGVQNGDSKRGKSR
                     PLSKEFIEDSDEEADFTDDGEPADEAEAELALEPENSGSDNED"
     gene            <183638..>185092
                     /locus_tag="KLLA0_E01937g"
                     /db_xref="GeneID:2893644"
     mRNA            <183638..>185092
                     /locus_tag="KLLA0_E01937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454035.1"
                     /db_xref="GeneID:2893644"
     CDS             183638..185092
                     /locus_tag="KLLA0_E01937g"
                     /note="similar to uniprot|Q08287 Saccharomyces cerevisiae
                     YOL144W NOP8 Nucleolar protein required for 60S ribosomal
                     subunit biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454035.1"
                     /db_xref="GeneID:2893644"
                     /db_xref="GOA:Q6CPV4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV4"
                     /translation="MITKRVYVGSVTSNQDDCFAELYARFLKFGKVVDESKSFEQHDA
                     FGYLNMEFEDASQFEKMKSSFNRVKFKGNTLRVAEAKPDWKTRWEIDHKDEEREHKKR
                     KQMAKQEWEHYKKLENINKSWIDRKEVISGRERTSRRSAFKLRNITFRVNVNGKLKVY
                     KCYKTKLWGYEKNKNVRDLVYRFSNNYWRNGPDHIVDKLDYSRCKSVSFRNISGDSLT
                     LSRETSNEKVDTDDLTETEKEKNNLVLSSLLDNFDFDKPLAVEEVTAEEEEENAGADY
                     EYEGLYRESDSKPLFSSSISKEIPRVKEGEFSKTENTTATSYVEDEEADKEQDMDSEE
                     DEFIPTFGATPQVPDNSTENTTNPTEVLRDLLNPLEPTSFKLIEESDEDIDHQRDVQE
                     EQVALPIPEVIIPQKSNNPLFFLHKDSPFLVGQTKIAKIKPPIALDEKFKTWEETFWN
                     SRSSWTKEMKQRKRDVVRQIKKRRDKYHGNTVLI"
     gene            complement(<185188..>185691)
                     /locus_tag="KLLA0_E01959g"
                     /db_xref="GeneID:2894130"
     mRNA            complement(<185188..>185691)
                     /locus_tag="KLLA0_E01959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454036.1"
                     /db_xref="GeneID:2894130"
     CDS             complement(185188..185691)
                     /locus_tag="KLLA0_E01959g"
                     /note="highly similar to uniprot|P50861 Saccharomyces
                     cerevisiae YOL143C RIB4 Lumazine synthase (6
                     7-dimethyl-8-ribityllumazine synthase also known as DMRL
                     synthase) catalyzes synthesis of immediate precursor to
                     riboflavin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454036.1"
                     /db_xref="GeneID:2894130"
                     /db_xref="GOA:Q6CPV3"
                     /db_xref="InterPro:IPR002180"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV3"
                     /translation="MAVKGLGQLDQVYDGSNLRIGIVYARWNRTIIDALVEGAIKRLQ
                     SLGVKEENIILESVPGSFELPWGVERFVQKEFEKGHRLDAVIPIGVLIKGSTMHFEYI
                     SDSTTNAIMSLSSKLNTPVIFGLLTCLTEEQALARAGIDEGKTMHNHGEDWGAAAVEM
                     AVKFGYN"
     gene            complement(<186177..>187475)
                     /locus_tag="KLLA0_E01981g"
                     /db_xref="GeneID:2894684"
     mRNA            complement(<186177..>187475)
                     /locus_tag="KLLA0_E01981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454037.1"
                     /db_xref="GeneID:2894684"
     CDS             complement(186177..187475)
                     /locus_tag="KLLA0_E01981g"
                     /note="highly similar to uniprot|P32561 Saccharomyces
                     cerevisiae YNL330C RPD3 Histone deacetylase regulates
                     transcription and silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454037.1"
                     /db_xref="GeneID:2894684"
                     /db_xref="GOA:Q6CPV2"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV2"
                     /translation="MVYEAKPFDPITVKANEKKRVAYFYDADVGNYAYGAGHPMKPHR
                     IRMTHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV
                     KFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGF
                     CYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGT
                     GELRDTGVGKGKYYAVNVPLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSL
                     SGDRLGCFNLSMKGHANCVNYMKSFGVPLMIVGGGGYTMRNVARTWAFETGILNNVIL
                     DEELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKVLLNIFSNLEHTKYAPSVQLN
                     HVPRDAEDKGDAEEDTAAAKDTRGGSQYARDITIENATEF"
     gene            complement(<187814..>190816)
                     /locus_tag="KLLA0_E02003g"
                     /db_xref="GeneID:2893978"
     mRNA            complement(<187814..>190816)
                     /locus_tag="KLLA0_E02003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454038.1"
                     /db_xref="GeneID:2893978"
     CDS             complement(187814..190816)
                     /locus_tag="KLLA0_E02003g"
                     /note="similar to uniprot|P33760 Saccharomyces cerevisiae
                     YNL329C PEX6 Required for peroxisome assembly Member of
                     the AAA-protein family that includes NSFp and PEX1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454038.1"
                     /db_xref="GeneID:2893978"
                     /db_xref="GOA:Q6CPV1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVIASLESTHAISTSIVLSSDLWTEFYGTESVSSASPNYVKLTL
                     PSYNKWHHQALISHCDNDDSLPFGSAGLPTNFIKQSQVRPMFSSIEIEPYVQQLPNLD
                     NLVLSLNPDLFNELNQLSKEEQRKFLTLRFNLLFGITVLNVNQVVYPAFCKVTSSSND
                     FGILTDQTQIVLVPDSNVVEQSRSNDEFTEFDHLFSLHVKIQSLLDPVPVEFLSPPQP
                     DTTDNDLFAFVQPNILLQLGVPSGTFVRVIAEEQEMLVQLFVLFAPNEYECDSLYVSP
                     RVRYVFMNHARVIIQRPNLALNRFSVSNAVTLSRIGCQINAQRRYQDIISHHLALYFS
                     EKQRIVKVGDLIPITFDSNYASMFTDDIRSGQHDTLVWFKVEEIESDSNEEYHIIDSS
                     ITRLSTVKITSRELMPKSICDYDRFYNLSPLFHYDEDAFPFAKRLKDILNTAIKCSAR
                     NVNVGTSIMLHSSSPNVGKTMLTRSVCAELGFHLIHVDCLSLTSNSNTSDATNKTIGY
                     IRAKIETIISYVEKVVIFLSHLETILEDEQNQQDNTSSKMARQMNVEMADLIEEYTTK
                     YKGTVFVGSTNDIDNIPAIVRSRIKFEIDVPVPTEKQRLQMFRWYFDPYVLNSQTPKL
                     RSLISHNVPLQTVSVQSAGLTPMDIRSIVKAVKYKCYQRLKQNDLLIDMTDITAVINI
                     ARDRFSDSIGAPKIPNVTWDDIGGMDVVKGEIMDTIDMPLKHPELFSSGMKKRSGILF
                     YGPPGTGKTLLAKAIASNFSLNFFSVKGPELLNMYIGESEANVRRVFQKARDAKPCVI
                     FFDELDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSSGGDGVFVIGATNRPDLLDEA
                     LLRPGRFDKMLYLGISDTDKKQANIIKALTRKFTLESGIDILDIAKKCPFNYTGADFY
                     ALCSDALLNAMTRVAGEVDEKWEKYNMENKKNISLRYWFDNVANENDLKVVVKLQDFE
                     LAQQNLIPSVSEDELRHYLRLKSSFESQ"
     gene            complement(<191062..>191502)
                     /locus_tag="KLLA0_E02025g"
                     /db_xref="GeneID:2894013"
     mRNA            complement(<191062..>191502)
                     /locus_tag="KLLA0_E02025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454039.1"
                     /db_xref="GeneID:2894013"
     CDS             complement(191062..191502)
                     /locus_tag="KLLA0_E02025g"
                     /note="similar to uniprot|P42834 Saccharomyces cerevisiae
                     YNL328C MDJ2 Protein of the mitochondrial inner membrane
                     function partially overlaps that of Mdj1p which is a
                     chaperone involved in folding of mitochondrially
                     synthesized proteins in the mitochondrial matrix member of
                     the DnaJ family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454039.1"
                     /db_xref="GeneID:2894013"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q6CPV0"
                     /translation="MVLPIIVGIGITTIAVVARSGLRAWDKYCRLTPLMIAQFNNIHI
                     PFKDLDQFGSKYRTRLSPELLTKLDRYPGGFYDKMSETEALLILGISAREIEALDERL
                     LRQKHRRAMIMNHPDKGGSPFIASKINQARDLLANSVILKGPRD"
     gene            <192747..>194939
                     /locus_tag="KLLA0_E02047g"
                     /db_xref="GeneID:2894131"
     mRNA            <192747..>194939
                     /locus_tag="KLLA0_E02047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454040.1"
                     /db_xref="GeneID:2894131"
     CDS             192747..194939
                     /locus_tag="KLLA0_E02047g"
                     /note="weakly similar to uniprot|P42835 Saccharomyces
                     cerevisiae YNL327W EGT2 Glycosylphosphatidylinositol
                     (GPI)-anchored cell wall endoglucanase required for proper
                     cell separation after cytokinesis expression is activated
                     by Swi5p and tightly regulated in a cell cycle-dependent
                     manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454040.1"
                     /db_xref="GeneID:2894131"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU9"
                     /translation="MVALRYLITGVLFTAVSARYSNDTSVVSSSIASTISSSSSLWSE
                     SSSLSQVSSSDIPVLPSSSSIDYSSVTDNSTTSDVSPVTSSEIPSHTTSSNSSSVTFT
                     STSTSDISISTPSAAIETVQVFDTLSQSQISSNPNNWFVINVDISVTAGFTGDLFLTV
                     PDQFSNFPEGIYEVLADEDVIGSVSHNSSGVFKVSFEDVAEDYYGSFNFLTKLADKPS
                     EPTTVDYSFEVYSGPTFSSTLTFETKSYTVSTVDTGIDEFGRPYFAVDIPYNEYSGEL
                     EFTSVAESDYEFVASYFQIVTAVDSFKNPTAASNVTAAKSNSDESTISYSFSSSVSGG
                     QALRIIYFLSADAGTTTLKNVAQLTYPNLSVYKRDISIIFETTAYLEPVSNIELSGIN
                     SITVLTSNVDNNNSTSTSTSTSIPTSTITSTNITSSMPTVTSVSTYSNESLTYTVITR
                     TQDGEVTEITQLVPVSTLSSSSTSSASFENTTSTARTSSASSDNSHSKSLTSSSASSE
                     ETSATLSKDSDSKFETSSTSTEEPTSSRSKDSQSTSLTSSFAPVEETSSSKSRETSSK
                     LTSNSSEDVPSSYATVVTETVHGRTSTYTSWVSSCTACQKTDTLETTSHTETAIRTNT
                     PSTEITNFQTFTSLESRTLSGEETEIGSFVPVTTLATDVGDAAEKTQTSLRTSTRGEE
                     VSTLLQFLGASTSSAEQTQAVVSQYSGFANRVEYGFGSLFIAILAIII"
     gene            complement(<195185..>196162)
                     /locus_tag="KLLA0_E02069g"
                     /db_xref="GeneID:2894120"
     mRNA            complement(<195185..>196162)
                     /locus_tag="KLLA0_E02069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454041.1"
                     /db_xref="GeneID:2894120"
     CDS             complement(195185..196162)
                     /locus_tag="KLLA0_E02069g"
                     /note="weakly similar to uniprot|P42836 Saccharomyces
                     cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p one
                     of three yeast DHHC-cysteine rich domain proteins (Pfa3p
                     Erf2p Akr1p) with palmitoyltransferase activity required
                     for vacuolar integrity under stress conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454041.1"
                     /db_xref="GeneID:2894120"
                     /db_xref="GOA:Q6CPU8"
                     /db_xref="InterPro:IPR001594"
                     /translation="MLLDRIGFYFPKALSNFLILYTCCICFSRIDILPRIVNVVLLIT
                     LSSFALYTYWKIIRVGAGSPLEYSFLKIQSIDNVLNRTEQPPDIIKDNCIFVKRDGSF
                     RFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSL
                     YVLLMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNET
                     TIEQYEWGNIRHDLEIYGDSINCNMGSVDNVFDLGSRSANFNCVMGASWAELLLPIQV
                     RADDPFDPYANQGLFFPVQSDTYRIYRESVNLQQRLITRLTLRPSIEHI"
     gene            <196450..>197172
                     /locus_tag="KLLA0_E02091g"
                     /db_xref="GeneID:2894663"
     mRNA            <196450..>197172
                     /locus_tag="KLLA0_E02091g"
                     /product="exosome complex component RRP40"
                     /transcript_id="XM_454042.1"
                     /db_xref="GeneID:2894663"
     CDS             196450..197172
                     /locus_tag="KLLA0_E02091g"
                     /note="similar to uniprot|Q08285 Saccharomyces cerevisiae
                     YOL142W RRP40 Ribosomal RNA Processing Rrp40p"
                     /codon_start=1
                     /product="exosome complex component RRP40"
                     /protein_id="XP_454042.1"
                     /db_xref="GeneID:2894663"
                     /db_xref="GOA:Q6CPU7"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU7"
                     /translation="MSKLLLPGDVISADETQSQSISAGPGIYSDPLSQEIKATHAGLE
                     VVTPNKKGASVYVDYNSKRYIPAVGDFVVGVIVASFGDSYRVSLCNFSNPVTLSYMAF
                     PNASKKNKPTLKVGDLCYARVCSAYKELEAEIECMDSSKGQDAGFGLLDGGMTIEVSL
                     AYARELLFNDSYPLLNILGNLVEFEVAIGVNGIIWLKTDDVRTTLACYRSILTCQGVS
                     PAQFDKTIKSIFNDTLKSTDEK"
     gene            complement(<197197..>199797)
                     /locus_tag="KLLA0_E02113g"
                     /db_xref="GeneID:2894446"
     mRNA            complement(<197197..>199797)
                     /locus_tag="KLLA0_E02113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454043.1"
                     /db_xref="GeneID:2894446"
     CDS             complement(197197..199797)
                     /locus_tag="KLLA0_E02113g"
                     /note="similar to uniprot|P42837 Saccharomyces cerevisiae
                     YNL325C FIG4 Protein required for efficient mating member
                     of a family of eukaryotic proteins that contain a domain
                     homologous to Sac1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454043.1"
                     /db_xref="GeneID:2894446"
                     /db_xref="GOA:Q6CPU6"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU6"
                     /translation="MNIDSGPIEPLPKQKATKQRKTMKFTLSKYTIYETKKSIYIVAS
                     NKRETMFRILEIDLNGEEDNLNIAEDNVFFMRNEVMEVLRKIEEADDDALTKKLTGYG
                     LLGVIRFTACYYLVVITEMSQVAVLGGHSIYHIDDTELVPITKSTKKRDSTELRFIQS
                     FQNLKLSKTFYFSYTFDITNTLQTNILRQKFLSVGRSDIEVPPGIPDYNEMFMWNSYL
                     LDPIFSCIDTVYDWFQPIIHGFIDQVNVSLFGKSIYITLIGRRSHYFAGARFLKRGVN
                     NKGYVANEVETEQIVADMSLTSFHSPARGFFDSDKYTSFVQHRGSIPLFWSQEASNLT
                     AKPPISINITDPFYSAAAKHFDKLFQRYGGGTIQILNLIKTKEKNPRETKLGEEFERC
                     IKYLNQFLPDIKKLEYKAWDMSKASKSHGQMVIEFLEKYAKETVETTGIFHNGKDFQS
                     TSVQEGVCRTNCIDCLDRTNAAQFVIGKRALGEQLHAMGIIEEKFLEYDSDIVNILTE
                     LFHDHGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMVESIKRFYSNSFVDAQRQEA
                     INLFLGHYIWSKDQPMLWDMSTDFYLHNLYEISGLRRSYRHWWLDSNIKGLHKTIQEE
                     IIDKNNDVTVAKIFKNVRGYPNSYDNYWNEHYTPRIFVSLKDAFTFNMNSTRRYHHGK
                     QAISPFDSRKQTSINQKLRLLTSDKKDKHVSETSRKKVEASVSPKDELNLYTAQLKEI
                     LHQSEKSLKQLDNFPIGFPVFSSDQPLSYHEFAIDDDDEIPEYGHTTFECNEYDRISN
                     LQKNTRYAYAEPSEETLYENVINFENYKLLYDYSEYINYQSLTVSQAGISEYEKVINK
                     ADSYGNPTFI"
     gene            complement(<200436..>202055)
                     /locus_tag="KLLA0_E02135g"
                     /db_xref="GeneID:2893682"
     mRNA            complement(<200436..>202055)
                     /locus_tag="KLLA0_E02135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454044.1"
                     /db_xref="GeneID:2893682"
     CDS             complement(200436..202055)
                     /locus_tag="KLLA0_E02135g"
                     /note="similar to uniprot|P46950 Saccharomyces cerevisiae
                     YGR197C SNG1 Protein involved in nitrosoguanidine
                     resistance and weakly similar to YJR015W uniprot|P47090
                     Saccharomyces cerevisiae YJR015W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454044.1"
                     /db_xref="GeneID:2893682"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU5"
                     /translation="MGFNDFDKMSGDDIRLVNETARERFLEGVAFDAAKDGQYMNAES
                     SADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNE
                     EQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWG
                     ALYNHSSDYHNVKFIAVVEDDGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNIS
                     EKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMR
                     ASIVPLLTSIETTYKKTFFYNDYFPSVIANITNISGPNLSAAGDMNWKQIDNRPFTDY
                     TLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLF
                     FCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWL
                     ISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAA
                     WCVLNTLLFPFVMKIVGQKFMNDAKKRAMQK"
     gene            complement(<202891..>203262)
                     /locus_tag="KLLA0_E02157g"
                     /db_xref="GeneID:2893709"
     mRNA            complement(<202891..>203262)
                     /locus_tag="KLLA0_E02157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454045.1"
                     /db_xref="GeneID:2893709"
     CDS             complement(202891..203262)
                     /locus_tag="KLLA0_E02157g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454045.1"
                     /db_xref="GeneID:2893709"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU4"
                     /translation="MTSIFLQITWTTTTTSFFFSSSISQISCTPQECQLTERRCREKL
                     SAKASTNLLYTELVSDTTARHFPSTANPKSGYRWNLFETSHPLTSFTTIDRPERLYQD
                     VHDPAEIGPSLPTQRLTQFQP"
     gene            <203854..>205143
                     /locus_tag="KLLA0_E02179g"
                     /db_xref="GeneID:2894053"
     mRNA            <203854..>205143
                     /locus_tag="KLLA0_E02179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454046.1"
                     /db_xref="GeneID:2894053"
     CDS             203854..205143
                     /locus_tag="KLLA0_E02179g"
                     /note="similar to uniprot|P42838 YNL323W Saccharomyces
                     cerevisiae YNL323W LEM3 Membrane protein of the plasma
                     membrane and ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454046.1"
                     /db_xref="GeneID:2894053"
                     /db_xref="GOA:Q6CPU3"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU3"
                     /translation="MTALKNIGKSVTGVFHRRGKDGKSTEDENGLNTMVELEDDVDAS
                     EFEDDENEVVKKPKSRRPKETKFTQQKIASFNPVLTPKKVLPIYFFLGALFLIFGGVM
                     LNNARHVDEIFVFYQDCDTNAPTDDFADVPDDHYKYIFHKAYNKDDLPVPQWKYVPDS
                     DPDPEELQTGTCQLRYSTPYSLEGPLYIYYYIENFFGNHRRYVLSFSEFQIIGDKATL
                     GQVKDNIGINCKPLVRDSAGKIYYPCGLIANAMFNDTFPDTMQVISEDSGDQVDTIEL
                     SNKNINWSTDKDRYKKTKYSPSEVVPPPYWKKQFPDGYNDTNMPDIHEWEEFQNWMRT
                     PAFSKFSRLIRRSANSLPQGQYQLDIDLHWPVTIYNGKKAAYITHGSTLGGRNTAPGI
                     IYLVGGSICFILALISLASHLFWGRSTADTHLLSWNK"
     gene            complement(<205466..>207973)
                     /locus_tag="KLLA0_E02201g"
                     /db_xref="GeneID:2893993"
     mRNA            complement(<205466..>207973)
                     /locus_tag="KLLA0_E02201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454047.1"
                     /db_xref="GeneID:2893993"
     CDS             complement(205466..207973)
                     /locus_tag="KLLA0_E02201g"
                     /note="weakly similar to uniprot|P33301 Saccharomyces
                     cerevisiae YDR369C XRS2 classified as an early
                     recombination function required for DNA repair but
                     dispensable for mitotic recombination (xrs2 is hyper-Rec
                     during vegatative growth) required for double strand
                     breaks meiotic recombination and spore viability DNA
                     repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454047.1"
                     /db_xref="GeneID:2893993"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU2"
                     /translation="MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDK
                     SISRVHLLIKFDGSDLIITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNV
                     RYFYEEWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKG
                     VPVVSIEFLNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQ
                     KMYDTLRYTIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEE
                     FDKSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKA
                     SVNGKKTKSKPNIQSLDSLNFFGGGNLEVTQNEEKHEPVISHTSESKVKVKEESKAFV
                     PYNDNQDLDTSANGNTKTLPSYITNKSSLGGMSTEPANQPHTSTKKDDRTELQKVRRK
                     RPRVQQLDNLMMRSSSQQATQIEPDDRNDKLKLRRIGDTASNVNAEGVLPSNSPSNAE
                     NMIKNIKTPDISNKNPTLSAISLLEPGGAEHVSAKKNLISDGGKSIDAQSSNRIEQNM
                     GNMTELDSRPHSVARLETDLQVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTES
                     ALIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLC
                     SDNTSNQIGREYITMRKYDSRKAKKHIAEEMDEIDIFPCRSHSNSVGVMDIAIANTEH
                     DSGFRFSNREYSIPTRSLFVADDDDDEENETSNNSALAIYGQNNEQHYEGVGPAAAVS
                     IRSPATVSTASSVAKLGDTDDEEDDTPRFNFRSRREI"
     gene            complement(<208267..>209709)
                     /locus_tag="KLLA0_E02223g"
                     /db_xref="GeneID:2893988"
     mRNA            complement(<208267..>209709)
                     /locus_tag="KLLA0_E02223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454048.1"
                     /db_xref="GeneID:2893988"
     CDS             complement(208267..209709)
                     /locus_tag="KLLA0_E02223g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454048.1"
                     /db_xref="GeneID:2893988"
                     /db_xref="GOA:Q6CPU1"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:Q6CPU1"
                     /translation="MSSTTLSNQLPDGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIF
                     NRILADPLQKVDSAFKSCEDIQKKLLFTGLFQSAEITLDHDVDVRSSRLLTENVPKTL
                     DIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSSAGARLFWINKFGNAETISLQGDVN
                     YTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFG
                     LSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFIS
                     ELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRPFF
                     NTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNRGGLYFYK
                     LGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYSASFAN
                     LDLSYSLPLRVRDYDIAKPGLTFGLDLSFF"
     gene            complement(<210001..>211212)
                     /locus_tag="KLLA0_E02245g"
                     /db_xref="GeneID:2894233"
     mRNA            complement(<210001..>211212)
                     /locus_tag="KLLA0_E02245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454049.1"
                     /db_xref="GeneID:2894233"
     CDS             complement(210001..211212)
                     /locus_tag="KLLA0_E02245g"
                     /note="weakly similar to uniprot|Q06349 Saccharomyces
                     cerevisiae YDR370C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454049.1"
                     /db_xref="GeneID:2894233"
                     /db_xref="GOA:Q6CPU0"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="PDB:4GPS"
                     /db_xref="PDB:4GPU"
                     /translation="MTTVSCDKDENKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSC
                     KKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKD
                     SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTFVS
                     LRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICYT
                     GFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKS
                     SVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKIN
                     NSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQESTSTTFKVQIDTNLTLSI
                     SPASQFVTALG"
     gene            <212406..>212717
                     /locus_tag="KLLA0_E02267g"
                     /db_xref="GeneID:2894212"
     mRNA            <212406..>212717
                     /locus_tag="KLLA0_E02267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454050.1"
                     /db_xref="GeneID:2894212"
     CDS             212406..212717
                     /locus_tag="KLLA0_E02267g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454050.1"
                     /db_xref="GeneID:2894212"
                     /db_xref="InterPro:IPR005545"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT9"
                     /translation="MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYK
                     DVVDGKPANFAGSHLTIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK
                     Q"
     gene            complement(<212983..>213583)
                     /locus_tag="KLLA0_E02289g"
                     /db_xref="GeneID:2894534"
     mRNA            complement(join(<212983..213350,213571..>213583))
                     /locus_tag="KLLA0_E02289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454051.1"
                     /db_xref="GeneID:2894534"
     CDS             complement(join(212983..213350,213571..213583))
                     /locus_tag="KLLA0_E02289g"
                     /note="highly similar to uniprot|P07274 Saccharomyces
                     cerevisiae YOR122C PFY1 Profilin actin- and
                     phosphatidylinositol 4 5-bisphosphate-binding protein
                     plays a role in cytoskeleton organization required for
                     normal timing of actin polymerization in response to
                     thermal stress localizes to plasma membrane and cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454051.1"
                     /db_xref="GeneID:2894534"
                     /db_xref="GOA:Q6CPT8"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT8"
                     /translation="MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEIS
                     EIARGFDNPSGLQSNGLHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYP
                     PGVQAGEATKIVEQLGDYLISVQY"
     gene            complement(<214032..>215285)
                     /locus_tag="KLLA0_E02311g"
                     /db_xref="GeneID:2894218"
     mRNA            complement(<214032..>215285)
                     /locus_tag="KLLA0_E02311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454052.1"
                     /db_xref="GeneID:2894218"
     CDS             complement(214032..215285)
                     /locus_tag="KLLA0_E02311g"
                     /note="similar to uniprot|P38439 Saccharomyces cerevisiae
                     YOR123C LEO1 Component of the Paf1 complex which
                     associates with RNA polymerase II and is involved in
                     histone methylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454052.1"
                     /db_xref="GeneID:2894218"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT7"
                     /translation="MSDRVEEEPERVNNEQIEEKVSDALDDLFGDESEEENQQQSLDE
                     QQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKYKEVDVEIV
                     KHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGD
                     RLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLT
                     VSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRT
                     DPELEKRELEKKHDQILRERRKKQLKEKLELENAGDSPEPQFNIQKNLSKRHNLDEYE
                     YDDGFVAQDDEEEDDEEEEEDEDFSGEDNDVGDEEESDGGDSEKEYENAKRLREVKQT
                     GAQEYQEDAQAKKRKIAVLDDEDDE"
     gene            <215594..>217036
                     /locus_tag="KLLA0_E02333g"
                     /db_xref="GeneID:2893883"
     mRNA            <215594..>217036
                     /locus_tag="KLLA0_E02333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454053.1"
                     /db_xref="GeneID:2893883"
     CDS             215594..217036
                     /locus_tag="KLLA0_E02333g"
                     /note="similar to uniprot|Q06350 Saccharomyces cerevisiae
                     YDR371W CTS2 Sporulation-specific chitinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454053.1"
                     /db_xref="GeneID:2893883"
                     /db_xref="GOA:Q6CPT6"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT6"
                     /translation="MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSA
                     GRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFV
                     VDAKSGAVKSSDSWSDFELPLSVGVKGCIKELQKIKLESKHEFKTILCLGGWSNREAY
                     KKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMD
                     QLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEW
                     SDVTGYHSNLYLQGHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYG
                     RGFTNVETNDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDP
                     KSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSKDPRKSLVNAFSKEIGLSEG
                     FVSLFKSDKVKQFHLQKYPKDYISSLFQKL"
     gene            complement(<217222..>218196)
                     /locus_tag="KLLA0_E02355g"
                     /db_xref="GeneID:2893901"
     mRNA            complement(<217222..>218196)
                     /locus_tag="KLLA0_E02355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454054.1"
                     /db_xref="GeneID:2893901"
     CDS             complement(217222..218196)
                     /locus_tag="KLLA0_E02355g"
                     /note="highly similar to uniprot|Q06385 Saccharomyces
                     cerevisiae YDR372C VPS74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454054.1"
                     /db_xref="GeneID:2893901"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT5"
                     /translation="MSLQRRRVNKGDTTESIPQIDNEHDHKIVYDEQEAKLRDNTSVP
                     KLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDV
                     SERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR
                     ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNT
                     YFPQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFP
                     LDKQTSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL"
     gene            complement(<218647..>222309)
                     /locus_tag="KLLA0_E02377g"
                     /db_xref="GeneID:2894270"
     mRNA            complement(<218647..>222309)
                     /locus_tag="KLLA0_E02377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454055.1"
                     /db_xref="GeneID:2894270"
     CDS             complement(218647..222309)
                     /locus_tag="KLLA0_E02377g"
                     /note="uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
                     carboxyl-terminal hydrolase 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454055.1"
                     /db_xref="GeneID:2894270"
                     /db_xref="GOA:O42726"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /translation="MMASQEPALELNGEQRDSVSETAEVLRSKSLESFSDLVDDGKTL
                     LYGDISKSFPFKTCDRILDDIRISPWFLKKFGSSVMKQPMLQYSRERQQLQPWNLVHL
                     IDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTPNDFDDIDKFPEYFFHLKITVK
                     RRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKLI
                     LVEIIKPEFNSENLAEYRTAKIEERYKNACQEFDLLNPDDIPSQAECLKTLFMIFKNP
                     LQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGEEYKPPDLV
                     DYITDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTEKKTVAKCFSNQHFSASHTW
                     WFNILNHQHIEPFPYDINYHFINLSVAFKYIDKDIIKNYETQIALDQENISHYFDALQ
                     YVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASLLDANTMIEYYNSHL
                     LRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVDETVDDDIIQ
                     TAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCTDISYDEA
                     LNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLINHFLD
                     TGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDAS
                     EYHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAFAPSN
                     VEVEFGDDTVAQKELIDLTTDVVEDPTDTTRHLASCDDDIIMCQSPVALPEHKTSSEA
                     GTQQYSVQVAKISADQLENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDL
                     VKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNL
                     EEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATED
                     PKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLIETKKFLQSGTLKAHDI
                     DADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEFKHIGYSLFAVFIHR
                     GEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATPYFLVYVREGQ
                     EQETIEPLKRILQQQE"
     gene            <223247..>223819
                     /locus_tag="KLLA0_E02399g"
                     /db_xref="GeneID:2893663"
     mRNA            <223247..>223819
                     /locus_tag="KLLA0_E02399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454056.1"
                     /db_xref="GeneID:2893663"
     CDS             223247..223819
                     /locus_tag="KLLA0_E02399g"
                     /note="highly similar to uniprot|Q06389 Saccharomyces
                     cerevisiae YDR373W FRQ1 N-myristoylated calcium-binding
                     protein that may have a role in intracellular signaling
                     through its regulation of the phosphatidylinositol
                     4-kinase Pik1p member of the recoverin/frequenin branch of
                     the EF-hand superfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454056.1"
                     /db_xref="GeneID:2893663"
                     /db_xref="GOA:Q6CPT3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT3"
                     /translation="MGNKTSTLSKNDLTSLKQSTYFDRREIQQWHKGFLRDCPNGQLT
                     REEFIKIYKQFFPFGSPDEFATYVFSVFDKDNNGSIDFKEFITALSTTSRGSLEEKLV
                     WAFQLYDLNHDGVISYEEMLTIVSSIYKMIGNMVKLSDDEATPELRVEKIFRLMDKDK
                     DGCITLDEFRDGSKVDPSIVGALNLYDGLV"
     gene            complement(<224180..>224890)
                     /locus_tag="KLLA0_E02421g"
                     /db_xref="GeneID:2893919"
     mRNA            complement(<224180..>224890)
                     /locus_tag="KLLA0_E02421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454057.1"
                     /db_xref="GeneID:2893919"
     CDS             complement(224180..224890)
                     /locus_tag="KLLA0_E02421g"
                     /note="highly similar to uniprot|P41735 Saccharomyces
                     cerevisiae YOR125C CAT5 Mitochondrial inner membrane
                     protein directly involved in ubiquinone biosynthesis
                     essential for several other metabolic pathways including
                     respiration and gluconeogenic gene activation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454057.1"
                     /db_xref="GeneID:2893919"
                     /db_xref="GOA:Q6CPT2"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT2"
                     /translation="MLRTCCRRAVPLRQFSVLSTLGNSSNAGEHRAEPNESAELTKFK
                     PMSDAQLAYLDRVVRVDQAGELGANYIYAGQFFVLANRYPHLRPVLQHMWDQEIHHHD
                     TFNNLQLKRRVRPSLLTPLWKIGAFAMGSGTAFLSPEAAMACTEAVETVIGGHYNDQL
                     RCLNNQYELESEDGTKVGQTVELKNLQATIKQFRDEELEHLQTAIDYDSHKAVPYILL
                     TEGIKTVCRVAIWAAERV"
     gene            complement(<225413..>226207)
                     /locus_tag="KLLA0_E02443g"
                     /db_xref="GeneID:2894262"
     mRNA            complement(<225413..>226207)
                     /locus_tag="KLLA0_E02443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454058.1"
                     /db_xref="GeneID:2894262"
     CDS             complement(225413..226207)
                     /locus_tag="KLLA0_E02443g"
                     /note="some similarities with uniprot|Q06390 Saccharomyces
                     cerevisiae YDR374C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454058.1"
                     /db_xref="GeneID:2894262"
                     /db_xref="InterPro:IPR002740"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT1"
                     /translation="MCNIQMDLWTELFLLNASSKFDFDDKNNASNGNAWYKDRSDTQE
                     KIVPKGFNDEESFDTSGGSSFIESLMSNMDGFFSTASTIMESLSPLKEYTTDYSKIEN
                     RESVYGIPHGSKFFVIKSFNERNVKLALQNSVWSSTRKGNRRLEREYHSLAPGAKLFL
                     LFSVNKSGKFCGIAEMCSDLIENDPRANIWETHTDSYTFPHLFQIKWWYVNDVKVRRF
                     NHLVWETDGEQKSLGHGRDTEIVPFNIGHEIVAIFHNSYTKSSLLF"
     gene            <226664..>226921
                     /locus_tag="KLLA0_E02465g"
                     /db_xref="GeneID:9487433"
     mRNA            <226664..>226921
                     /locus_tag="KLLA0_E02465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999343.1"
                     /db_xref="GeneID:9487433"
     CDS             226664..226921
                     /locus_tag="KLLA0_E02465g"
                     /note="similar to uniprot|Q2V2P8 Saccharomyces cerevisiae
                     YDR374W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999389.1"
                     /db_xref="GeneID:9487433"
                     /db_xref="UniProtKB/TrEMBL:B4UN97"
                     /translation="MSEHLRRIVVDGLLGRIRDNTLGTLDEPSEAEETLIGCLFADLI
                     RKLMDEAKLQAEKDGTRTISVGHLRDAKDLILESSPDNNED"
     gene            complement(<227048..>228388)
                     /locus_tag="KLLA0_E02487g"
                     /db_xref="GeneID:2894265"
     mRNA            complement(<227048..>228388)
                     /locus_tag="KLLA0_E02487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454059.1"
                     /db_xref="GeneID:2894265"
     CDS             complement(227048..228388)
                     /locus_tag="KLLA0_E02487g"
                     /note="highly similar to uniprot|P32839 Saccharomyces
                     cerevisiae YDR375C BCS1 Protein of the mitochondrial inner
                     membrane that functions as an ATP-dependent chaperone
                     required for the assembly of the cytochrome bc(1) complex
                     from the Rip1p and Qcr10p proteins member of the
                     CDC48/PAS1/SEC18 ATPase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454059.1"
                     /db_xref="GeneID:2894265"
                     /db_xref="GOA:Q6CPT0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPT0"
                     /translation="MASNGTGGLPPIDFEKVRNDSDGSVTGMAKGLFNQFIEGNPYFA
                     AGGGLMVLGTSLALLRRGVISTSRLAYHQLIVDLEIPSKDKSYLWFLQWMSRYPHRSS
                     RHLSVETNYLQHNNGSVSTEVNFVPGVGNHLIRYKGAFMLIKRERSGQIANITNGTPF
                     ETVKLTTLYRDRHLFQELLMEAKDLAVKAQTGKTVIYTSWANEWRPFGQPKAKRNLKS
                     VILDNGLKESILNDVNDFLQNGKWYYDRGIPYRRGYLLYGPPGSGKTSFIQALAGELD
                     YNICIMNLADPNLTDDRLNYLMNNLPERSLMLLEDIDAAFVKRSKNDEGFVNGVTFSG
                     LLNALDGVASSEEIITFMTTNHPEKLDPAVMRPGRIDYKTYVGNATEYQIKQMFLRFY
                     PEEKELCEQFVQKAVELDTPISTAQLQGLFVFNKQNPKNAVLMVESLRYPNHVF"
     gene            complement(<228652..>229377)
                     /locus_tag="KLLA0_E02509g"
                     /db_xref="GeneID:2894266"
     mRNA            complement(<228652..>229377)
                     /locus_tag="KLLA0_E02509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454060.1"
                     /db_xref="GeneID:2894266"
     CDS             complement(228652..229377)
                     /locus_tag="KLLA0_E02509g"
                     /note="similar to uniprot|P41734 Saccharomyces cerevisiae
                     YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase required
                     in balance with alcohol acetyltransferase to maintain
                     optimal amounts of isoamyl acetate which is particularly
                     important in sake brewing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454060.1"
                     /db_xref="GeneID:2894266"
                     /db_xref="GOA:Q6CPS9"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS9"
                     /translation="MALTYQKFLLFGDSITEFSFNTRMNGDQTDQFSLGAALVNAYTR
                     KLDIVQRGFSGYNSRWALKLLPKILEQEQDVAISTLFFGSNDSCQHEQQNVPLPEFKE
                     NTIKLIQMMKNKGIKVVVVGPALHDQDHWYSLKKPEVDKGYVRSNELYKQYSDAAEEA
                     AREEDVAFVNLYEAFKDQGDTWPELLCDGLHFTGKGYEVMFNEVLKAVNKRYPEYSPE
                     NVEYKLPNWRLVESNGSTLDALI"
     gene            <229894..>231330
                     /locus_tag="KLLA0_E02531g"
                     /db_xref="GeneID:2894268"
     mRNA            <229894..>231330
                     /locus_tag="KLLA0_E02531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454061.1"
                     /db_xref="GeneID:2894268"
     CDS             229894..231330
                     /locus_tag="KLLA0_E02531g"
                     /note="similar to uniprot|P48360 Saccharomyces cerevisiae
                     YDR376W ARH1 Oxidoreductase of the mitochondrial inner
                     membrane involved in cytoplasmic and mitochondrial iron
                     homeostasis and required for activity of Fe-S
                     cluster-containing enzymes one of the few mitochondrial
                     proteins essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454061.1"
                     /db_xref="GeneID:2894268"
                     /db_xref="GOA:Q6CPS8"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS8"
                     /translation="MVRKYVSIIGSGPSGFYTAHHLLQNVKVPLEVTIWERLPVPFGL
                     SRYGVAPDHPNVKNCEDTFTDTVKDVMGKDSIHKFNFIGNCEVGKDIELSKLLSKQDA
                     VVLSYGCATDRKLGIPGENDTTGVFTSRQFVNWYNGHPDFALHPKFMDFDWKSVKNVG
                     IIGNGNVALDLARLLLSNNVDSIWGRTDISPIALNKLREAPIENVKLIARRDFPNSKF
                     TNKELREMWLLEEYGVRGHIDSKFFTPEEWEMKEQVRSFRRCVDLCSEYVKPFELRSA
                     KYKKLPQPTNGIFTKNWELDYLKTPLEILKDETTGYIKSLKLCNNTLTKANKVIPHEE
                     ETMSYEVDLLITSLGYKGSAMAGFEELGVQFDNAKVTNKQGRVLNTEGNEIPRLYTSG
                     WIGRGASGVILATMTNAFKVADNILKDLNVLPTREGTSLPSLQNIRYTTWDDAQKILK
                     FEQEKGEQVSKPREKLLTIEEMLQVVNK"
     gene            <231758..>232467
                     /locus_tag="KLLA0_E02553g"
                     /db_xref="GeneID:9487531"
     mRNA            join(<231758..231814,232222..>232467)
                     /locus_tag="KLLA0_E02553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999344.1"
                     /db_xref="GeneID:9487531"
     CDS             join(231758..231814,232222..232467)
                     /locus_tag="KLLA0_E02553g"
                     /note="highly similar to uniprot|Q06405 Saccharomyces
                     cerevisae YDR377w, ATP synthase subunit f, ATP17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999390.1"
                     /db_xref="GeneID:9487531"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:B4UN98"
                     /translation="MIAKRALSTLIPPKIVSANNLGSAPNAKRIANVVSFYKSLPQGE
                     AAAVKPSGLIGRYKAKFFDGENASGKPLLHLAIGILTLGYSMEYYFHLRHHKGGEH"
     gene            complement(<233160..>233402)
                     /locus_tag="KLLA0_E02575g"
                     /db_xref="GeneID:2894269"
     mRNA            complement(<233160..>233402)
                     /locus_tag="KLLA0_E02575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454062.1"
                     /db_xref="GeneID:2894269"
     CDS             complement(233160..233402)
                     /locus_tag="KLLA0_E02575g"
                     /note="similar to uniprot|Q06406 Saccharomyces cerevisiae
                     YDR378C LSM6 Component of small nuclear ribonucleoprotein
                     complexes involved in RNA processing splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454062.1"
                     /db_xref="GeneID:2894269"
                     /db_xref="GOA:Q6CPS7"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /translation="MESKATASGSFLENIIGKPVYVKLFSGILYQGKLESIDGFMNVT
                     MSQVSEHYEAEENGTLHKYPSEVFLRGSQVLYISEK"
     gene            <234517..>237654
                     /locus_tag="KLLA0_E02597g"
                     /db_xref="GeneID:2894297"
     mRNA            <234517..>237654
                     /locus_tag="KLLA0_E02597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454063.1"
                     /db_xref="GeneID:2894297"
     CDS             234517..237654
                     /locus_tag="KLLA0_E02597g"
                     /note="weakly similar to uniprot|P39083 Saccharomyces
                     cerevisiae YOR127W RGA1 GTPase-activating protein for the
                     polarity-establishment protein Cdc42p implicated in
                     control of septin organization pheromone response and
                     haploid invasive growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454063.1"
                     /db_xref="GeneID:2894297"
                     /db_xref="GOA:Q6CPS6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS6"
                     /translation="MSASPKGAAETSVCVRCTNHITMGHAYELGGNRWHTHCFSCYKC
                     DKPLSCDSDFLVLGTSDLICFECSDSCKNCGKKIDDLAIILASSNEAYCSECFKCCKC
                     GEKINDLRYAKTKKGLFCITCHERLLARKKYHEEKKRRLKKQLPIVPSPKLPDSSSSL
                     DPQKMEFSSVETANNSNLNSSLDPGLELTPESNPYSVVSSIAPDRSSSRPATAELLQH
                     NHQHADNNYSEDVINQLNQSPSPPPQKSITAPIDFSKKDAIVKSSSNSVIAQFLDDEY
                     HDDDGNVSISTQHKDSQLDKILQNTLDNSEEDTLQISSTFNSSDNLPSSLRQNSDSSV
                     MITRADLEQQLNDGPDSSINKTPLHSSVKSPSHGLKSPRSPELHRHAIVYATESQEDI
                     ISEQYSTSITAALNTPKARNNSIEEDSHFRTPKSDTESKPTGLGISTPKSKQKFKLSS
                     SLAIISPRTEAVKHSNTIGIPYDSTEERPPSSTNTENASTINHSAPDHHRRTSSGAKN
                     ITRSLSFRSKNLISNLRNKTRSANSPGRSSEKDFDTHSGWGVVSTHPAIDESSSSQTT
                     QVPRRRVSGRGQSDSTIYSHIPTDSAQQPNHIRSQSGSNKVAMFRTPPLGSANTTVHS
                     HNKSLSIDPNNQSTIREDEKSDDDRVFTPVAKDFFEKDVKSISLQLRKLNMEVKELQL
                     TKAQLTADIEKLKITKETLTSETEALRIEKRDLKLTTTSQESLTDDAYEVDFNGSNNA
                     LSPTRNQLPSTSNSSIAKPRFWKLFGSGNTNVRQVNPNSSKSIEISAPMLQNPNEFDD
                     LKLFPIPYSASNDSVPRNSLSSSSSDGQTLYGSSLVARCAYERRDVPLIITTCINYIE
                     SDPEYMMAEGIYRKSGSQVIIEQYEKMFAEEEKVDFGKQNTDVHAVTSIFKRYLRKLP
                     NPVFGYQCYESLINLIRENNLLIELPLNNSLKQPDLFTNILVKLSDILKTLPIQHLVV
                     LKLLCNHLELIMRYQEDNLMNLHNLALVFAPGLIKDYSGEKDIVDMKERNYLIGLVLQ
                     NYREIFKVLQQKIDA"
     gene            complement(<237959..>238198)
                     /locus_tag="KLLA0_E02619g"
                     /db_xref="GeneID:2894401"
     mRNA            complement(<237959..>238198)
                     /locus_tag="KLLA0_E02619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454064.1"
                     /db_xref="GeneID:2894401"
     CDS             complement(237959..238198)
                     /locus_tag="KLLA0_E02619g"
                     /note="similar to uniprot|Q3E785 Saccharomyces cerevisiae
                     YDR379C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454064.1"
                     /db_xref="GeneID:2894401"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS5"
                     /translation="MAKRLSGLQKEVIHLYRQCVRTAHKKPIENRPHFITYIRTEFGK
                     FKGLSRKDFSTIEHLLRVGNRRLEMYATPELKDIH"
     gene            <239180..>240838
                     /locus_tag="KLLA0_E02641g"
                     /db_xref="GeneID:2893774"
     mRNA            <239180..>240838
                     /locus_tag="KLLA0_E02641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454065.1"
                     /db_xref="GeneID:2893774"
     CDS             239180..240838
                     /locus_tag="KLLA0_E02641g"
                     /note="uniprot|Q8TGC8 Kluyveromyces lactis Putative
                     ceramide glucosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454065.1"
                     /db_xref="GeneID:2893774"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS4"
                     /translation="MRYAMLVPSRWFLLLISLICLNCNGLVNAKEFQNALDQTGVKVA
                     SPVSERAFLDTVFGVILIIWYIVVILLGYSGWVEIERKFSQVKELPEEDLAKLEPVSI
                     LRPCKGVDSEMVACLESCINQDYPKHLFEVIFCVESSTDSSIAIIQKILAKHPDHNLS
                     LLIGDKDYFGPNPKINNLSKGYRMAKYDIVWVLDSNVWCSPGTLARSVSSLTKSLDNG
                     IRTSKPVVLTHHVPLGISINSESVSGRLDEMFLFSSHAKFYVAFNYVSIAPCVNGKSN
                     LYRRSNLEKAVQMIGDSTRHSGMFDNGNIQKFARETMHKRNDSSFFPNKITRVMFNQS
                     NSHLITEEISGAEQNKFHAIEFFSTYIGEDNMIGTALWDMLQGRTGMTRDVVIQPLKF
                     GSSDDSWHSYITRRVRWLRVRKYMVLAATLLEPTTESILIGTMGLFGLTRLLPGSVSF
                     WKAFIIHMFLWCLSDWIQYRTLCQNTVNDNVMNRSSIFSDPGYTYPFFTPGLHPRSFT
                     DWIGTWILRECLALPVWINAMCGSVIQWRNRPFRIKPDLTAEEL"
     gene            <244696..>248025
                     /locus_tag="KLLA0_E02663g"
                     /db_xref="GeneID:2894756"
     mRNA            <244696..>248025
                     /locus_tag="KLLA0_E02663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454066.1"
                     /db_xref="GeneID:2894756"
     CDS             244696..248025
                     /locus_tag="KLLA0_E02663g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454066.1"
                     /db_xref="GeneID:2894756"
                     /db_xref="GOA:Q6CPS3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS3"
                     /translation="MKISNEESARDSRHPDSRKRKVAKRACLACRERKIKCDGEANPD
                     PSGGPGKCTNCVRSTLECVFVASNRGGRRVFDKSKRYISPPSSDVCPVLAESAVKSQK
                     VDICDPPNPLCSSNSSVLGSSHNLPVRPYLRAITSSAKFPTRLSGTPASIHDSIPNNN
                     NGLMTHPLSNHSKPQQRSKTQHQHQSSYPNSPHNFVLPQLTLENHHQLLVESRPLTAG
                     TSGAHTDNVGKHRIVSNSLRGITHNSHFMVNVGQNPAMHISQFMSEINNSGACNKIYP
                     GTTGLSQNQEKWQTQPSYSLYSPVNSLISFQHSGNMNIMGHGGVDQPQARPSINYGND
                     FNTIPAAINNTDVPVGSNSNLSGNRTEALGHYGHVLSTISQDPKSNWQNRSSRGTKDC
                     LNNLKSSQTTPSSSSKPNTQFDVKKEFTPMELNASKRLQSDINQGTYKLPKYGSVPAF
                     VFPTLMFGQEHTNENSAATPAATFEKAFPVLNQSQPQIQEFVPEQIFVDLHRCEIEQL
                     AQLKLGSTGKMPSFHLTMELLDLYYEYVHPKVKVLPPKEVMKRISLSQTNTSLTYAIF
                     LCAIPLTSLKNKTKLSESGFLPTMSDCLREISTHWEELDFIGTLQTLNILVYHSIFIQ
                     MNSRLTAMHLEKLLKTIAYSNIVGQYRNGPNLEEFFTFSTNTSFAHDRTLLMNLWIAF
                     SQVCCARNIFRDHPLLHEVLSSLCSTQERLEDVILPHDQLVFITYTKNIPQNFSGRIS
                     IKECPEKNKKSLDLFHLRDLEKKHRVDIASSVIYQFYIWNIFHDWKNQKIDNITALAK
                     LNVFDLSIQNRLYELKDEKRLLVVDWDVLNCLALSQTLKINLRENINKLDILICDVFD
                     SELRLVDVAELSEAVDSEISSFEAFSIMLCFQSMFRLLDVITLIELASGNIPAHSSSL
                     NKTPIVSFRSCNDYIEQKSAEDYSRIHPAVQSEDNPEELEESYGKVQENDSFLNDTKK
                     CVWMRYPPIFINLLRFALPKIVQDIIWFKFIKFVTFDGKCALIYANKSIPLDESQFNA
                     KSLISYARGSLYFGNSNLSDEELLAKLVLVAEPTFLKQKFILLSEFTKVVSASLSDRD
                     LVHQKVDQLTQYVNVIIGLTF"
     gene            complement(<248162..>249871)
                     /locus_tag="KLLA0_E02685g"
                     /db_xref="GeneID:2894665"
     mRNA            complement(<248162..>249871)
                     /locus_tag="KLLA0_E02685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454067.1"
                     /db_xref="GeneID:2894665"
     CDS             complement(248162..249871)
                     /locus_tag="KLLA0_E02685g"
                     /note="similar to uniprot|P21264 Saccharomyces cerevisiae
                     YOR128C ADE2 Phosphoribosylaminoimidazole carboxylase
                     catalyzes a step in the 'de novo' purine nucleotide
                     biosynthetic pathway red pigment accumulates in mutant
                     cells deprived of adenine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454067.1"
                     /db_xref="GeneID:2894665"
                     /db_xref="GOA:F2Z607"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /db_xref="UniProtKB/TrEMBL:F2Z607"
                     /translation="MDQRTVGILGGGQLGRMIVEAAHRLNVKTIILDAENSPAKQINA
                     LSEHVNGSFAKPEDIKKIASLCDVLTVEIEHVDVPTLKRVQQDHPNLKIYPDPETIAL
                     IQDKFVQKQYLIQNKISVAKSVAVNSDEESLAKVGFEFGYPFMLKSRTLAYDGRGNFV
                     VKSKESLSEALEVLKDRPLYAEKWAPFVKELAVMVVRSPEGKVFSYTTVETIHQDNIC
                     HLCYAPARVPDSVQLKAKLLAEHAIAAFPGAGIFGVEMFYLEDGELLINEIAPRPHNS
                     GHYTIDACVTSQFEAHIRSILNLPLPEGFSALSTTNTNAIMLNVLGDHAEKNKELQIC
                     ERALSTPGASVYLYGKESRPQRKMGHINIIGSSMSECERKLKYIMYADAAYEHIATRE
                     FTLPGASMRPLISIIMGSDSDLPVMSKACDILNDFNIQYEVTIVSAHRTPHRMSKFAI
                     EAANRGIKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGV
                     PVATVAINNSTNAALLAIRILGAYDPVYFSKMQQFLQKQEEEVLTKAAKLETIGYQEY
                     LKK"
     gene            <251220..>253115
                     /locus_tag="KLLA0_E02707g"
                     /db_xref="GeneID:2893706"
     mRNA            <251220..>253115
                     /locus_tag="KLLA0_E02707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454068.1"
                     /db_xref="GeneID:2893706"
     CDS             251220..253115
                     /locus_tag="KLLA0_E02707g"
                     /note="similar to uniprot|Q06408 Saccharomyces cerevisiae
                     YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde
                     which is the first specific step in the Ehrlich pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454068.1"
                     /db_xref="GeneID:2893706"
                     /db_xref="GOA:Q6CPS1"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS1"
                     /translation="MSPVQLDEKSLRTKSPRSDSPVHGQSTVVKNIPFGHYVFERLLN
                     SGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAYAADGYSRYTNKLGC
                     VITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSHNVHHLVPAIDSQ
                     QPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGYVFIPVDFADK
                     LVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSDLLVDRFNL
                     RKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSSDLILHF
                     GPAKNEINCGYYSFHFNENARIIELSNNIIQFIDIKDKNASTVEEANFVSVLKYVNDN
                     LDKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVETGSFQFGV
                     PNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYIPRLIL
                     CEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKWTAL
                     LNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQELNAM
                     LVNGKPN"
     gene            complement(<253382..>256117)
                     /locus_tag="KLLA0_E02729g"
                     /db_xref="GeneID:2894041"
     mRNA            complement(<253382..>256117)
                     /locus_tag="KLLA0_E02729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454069.1"
                     /db_xref="GeneID:2894041"
     CDS             complement(253382..256117)
                     /locus_tag="KLLA0_E02729g"
                     /note="weakly similar to uniprot|Q92274 Saccharomyces
                     cerevisiae YOR129C Putative component of the outer plaque
                     of the spindle pole body may be involved in cation
                     homeostasis or multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454069.1"
                     /db_xref="GeneID:2894041"
                     /db_xref="InterPro:IPR012860"
                     /db_xref="UniProtKB/TrEMBL:Q6CPS0"
                     /translation="MKHSSKVKTGLNFHLRQSQNEHTHSNPNVQFIIAAEFDNKSGPI
                     IKHQYPKTIPGFKTIGSDSTCSHLASLMIPNSVENHPGKPDFTVFVLYKNQNVYQLFP
                     VSKNKTKGTDLDSSLIIEEEDFEEEQENGLRSGKIGSIRDDRHLEETEPPLFFLSVVN
                     TFLDNSNDRGAYIKAIALGTTMTNFYTFKPLLTMVLDHYMTSNNNDIKILIDCFDMIN
                     SLDLSLVIRFHSNVVLQNILNSINDEEITSKIFDANENSLPNILRVNELPKKDKFGNE
                     IQFKNRILEYKFSTFRPKVLPAYFTRIPLQIDLIKYDAIKIDTNYNNSILKLLARLIP
                     LLTEIPDSTYSWRLIINSTERSKDELCQFVLALSNLINGFSSEYFDNSSICIFPYMEI
                     SIIDMFRENFTEEFTKGNFFSVVGVSNPIFQYQVDAWDFYYDLDSDSLLNSKALPSEE
                     ENAEKNLGIRSMFNKYTTSQVHPLPATKQPTPKSGLMLKVINLLVKGQHDNETVLNTF
                     KRASILQLLHLIDGDGDKANGVEMVLKDQYILNYKDLILFPDIFEYNSLKVLNLIHNL
                     ETDMSRLFWPTSNYTYQTRKRLLQDLYKHLKELHKFISMNKKNLGKFLNIAMNYPLVS
                     AFDGLDIMGANLRDVDLEKLLSHERSNMKSIDSLCDVHLPGNTIDHFNTYKSFNLILF
                     PLFLNPHREEDDTNYITEIGPPLVSTRPSTGKYYNYQSDSSLSMISSIYETNDLMSHE
                     YNYEGTLHDDTMTIFTAKSGVADLSSLINKCRQMSIKVLYRIQRHHIGRLLFNLKLNP
                     LFKVTYQTTKLELFNNSDIKLPSSPALAHMSSSSMSEPVKPKCKFKKPSTISHGEKSS
                     LKLSVSRRELLKDLNLLNVNNDTSSPKIHDEKSTPQHLLESLAKFDISSKQFSNI"
     gene            <256959..>258863
                     /locus_tag="KLLA0_E02751g"
                     /db_xref="GeneID:2894049"
     mRNA            join(<256959..257213,258450..>258863)
                     /locus_tag="KLLA0_E02751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454070.1"
                     /db_xref="GeneID:2894049"
     CDS             join(256959..257213,258450..258863)
                     /locus_tag="KLLA0_E02751g"
                     /note="similar to uniprot|Q12159 Saccharomyces cerevisiae
                     YDR381W YRA1 Nuclear protein that binds to RNA and to
                     Mex67p required for export of poly(A) mRNA from the
                     nucleus member of the REF (RNA and export factor binding
                     proteins) family another family member Yra2p can
                     substitute for Yra1p function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454070.1"
                     /db_xref="GeneID:2894049"
                     /db_xref="GOA:Q6CPR9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR9"
                     /translation="MSALDQSLDEIIGSAKHARRNNKAGPKKVSKQVNKSRTRTGAGP
                     SRVPKKAASAAALVPALLRAPISTRVNVEGLPRDINQDAVKEFFNHQVGGVQKALLSY
                     NERGNSTGMATITFKNAEQANLAVKKFHNAPIDGGKSKLRLTLIVDPSRKTLLDRIRP
                     VQNAQAAAPNKKAAPTKPQPKKKPAGPNKKAIAAKQKKRAKPEKKSLEDLDKEMADYF
                     EESK"
     gene            complement(<259296..>259619)
                     /locus_tag="KLLA0_E02773g"
                     /db_xref="GeneID:2894603"
     mRNA            complement(<259296..>259619)
                     /locus_tag="KLLA0_E02773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454071.1"
                     /db_xref="GeneID:2894603"
     CDS             complement(259296..259619)
                     /locus_tag="KLLA0_E02773g"
                     /note="similar to uniprot|Q3E6R5 Saccharomyces cerevisiae
                     YDR381C-A Hypothetical ORF identified by homology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454071.1"
                     /db_xref="GeneID:2894603"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR8"
                     /translation="MSNPFQNIGRNFAYLCIGLTASIVIVKTVVRDAKVSKFDPQNLS
                     GDEKKDADSYYANPALVKPGFPMKKEEETTEIKRKSEFEGAGLSYNTRKRGDRLGFLD
                     RRSNE"
     gene            <260349..>260516
                     /locus_tag="KLLA0_E02795g"
                     /db_xref="GeneID:9487493"
     mRNA            <260349..>260516
                     /locus_tag="KLLA0_E02795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999345.1"
                     /db_xref="GeneID:9487493"
     CDS             260349..260516
                     /locus_tag="KLLA0_E02795g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999391.1"
                     /db_xref="GeneID:9487493"
                     /db_xref="UniProtKB/TrEMBL:B4UN99"
                     /translation="MALMTAIGMGSLYVAKGQMDERKAGHAKGSAKSWEEIAEEHGIE
                     TKKSGSAVETK"
     gene            <260854..>261768
                     /locus_tag="KLLA0_E02817g"
                     /db_xref="GeneID:2893942"
     mRNA            <260854..>261768
                     /locus_tag="KLLA0_E02817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454072.1"
                     /db_xref="GeneID:2893942"
     CDS             260854..261768
                     /locus_tag="KLLA0_E02817g"
                     /note="weakly similar to uniprot|P39953 Saccharomyces
                     cerevisiae YEL006W Hypothetical ORF9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454072.1"
                     /db_xref="GeneID:2893942"
                     /db_xref="GOA:Q6CPR7"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR7"
                     /translation="MSEINPNDVDELAHAIAGSLGGAASIAVTYPLVTITTNLQTKEN
                     EARPKLETIKEIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQY
                     LSTWESILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRTVIDIVKTDGPLTLLN
                     GLKPALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPY
                     ITLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMTAAFLFFFK
                     EGFIQWSLKFIKLLRSVTKSNKKNTLSI"
     gene            complement(<261895..>262749)
                     /locus_tag="KLLA0_E02839g"
                     /db_xref="GeneID:2893943"
     mRNA            complement(<261895..>262749)
                     /locus_tag="KLLA0_E02839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454073.1"
                     /db_xref="GeneID:2893943"
     CDS             complement(261895..262749)
                     /locus_tag="KLLA0_E02839g"
                     /note="similar to uniprot|Q12375 Saccharomyces cerevisiae
                     YOR130C ORT1 Ornithine transporter of the mitochondrial
                     inner membrane exports ornithine from mitochondria as part
                     of arginine biosynthesis human ortholog is associated with
                     hyperammonaemia-hyperornithinaemia-homocitrullinuria (HHH)
                     syndrome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454073.1"
                     /db_xref="GeneID:2893943"
                     /db_xref="GOA:Q6CPR6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR6"
                     /translation="MSDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYP
                     TTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLT
                     KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGL
                     LGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLF
                     NASVFPADTVKSVCQTEHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYT
                     YETLKKMF"
     gene            <263645..>263974
                     /locus_tag="KLLA0_E02861g"
                     /db_xref="GeneID:2894018"
     mRNA            <263645..>263974
                     /locus_tag="KLLA0_E02861g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_454074.1"
                     /db_xref="GeneID:2894018"
     CDS             263645..263974
                     /locus_tag="KLLA0_E02861g"
                     /note="similar to uniprot|P02400 Saccharomyces cerevisiae
                     YDR382W RPP2B Ribosomal protein P2 beta a component of the
                     ribosomal stalk which is involved in the interaction
                     between translational elongation factors and the ribosome
                     regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in
                     the cytoplasm"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_454074.1"
                     /db_xref="GeneID:2894018"
                     /db_xref="GOA:Q6CPR5"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR5"
                     /translation="MKYLAAYLLIAQGGVESPSATEIKNVLEAVGVEAEDSKIQALLT
                     SLEGKTIQELVAEGQTKLASVPAGGASGAAAASGAAGASAEEEKEEEKEEEKEESDDD
                     MGFGLFD"
     gene            complement(<264203..>264835)
                     /locus_tag="KLLA0_E02883g"
                     /db_xref="GeneID:2894038"
     mRNA            complement(<264203..>264835)
                     /locus_tag="KLLA0_E02883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454075.1"
                     /db_xref="GeneID:2894038"
     CDS             complement(264203..264835)
                     /locus_tag="KLLA0_E02883g"
                     /note="similar to uniprot|Q12493 Saccharomyces cerevisiae
                     YDR383C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454075.1"
                     /db_xref="GeneID:2894038"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR4"
                     /translation="MDLESEIIQLVRQNIRPKFPSLNDEQQARLDNALKYDVNYDILK
                     KELVEYIDDWKRNEYYDVLTNIGDLQRLDLGNMLNGDGVSFPKLHSDLANLPRFRLID
                     NENEMDQSLLHKYDSLRTRLIEKCRAIELIRSATNTDVNYQDINSMLSVVELRQWRDE
                     IQMEWKELAQNLELILKTWPDLTEEKRSKLLQLIDSSSLKSILHIKDNIE"
     gene            complement(<265432..>266232)
                     /locus_tag="KLLA0_E02905g"
                     /db_xref="GeneID:2893780"
     mRNA            complement(<265432..>266232)
                     /locus_tag="KLLA0_E02905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454076.1"
                     /db_xref="GeneID:2893780"
     CDS             complement(265432..266232)
                     /locus_tag="KLLA0_E02905g"
                     /note="similar to uniprot|Q12359 Saccharomyces cerevisiae
                     YDR384C ATO3 Plasma membrane protein regulation pattern
                     suggests a possible role in export of ammonia from the
                     cell member of the TC 9.B.33 YaaH family of putative
                     transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454076.1"
                     /db_xref="GeneID:2893780"
                     /db_xref="GOA:Q6CPR3"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR3"
                     /translation="MSINSSQDLEKGVTDTQNIEDSHQPYQHHIHNVSIDGDYVRLGN
                     QTYKRSELLNAFAGDFNPGIHPRPPPALANPVPLGLASFSFCCLVLSLINAQVRGVTN
                     NKVLVGACLFYGGFIELVAGLLCYPIGNSYGMTVFGAFGGFWISYGCIITDQFHVVSS
                     YEDDPQMFNNAMGFFLAGWAVFTFLMLLCTLKSTWGLFLLLSFLELTFLMLTIGSFTG
                     NEKVSIAGGYFGILSSVCGWYSLYSGIADDTNSYFPVKAYFMPNAPTV"
     gene            complement(<267778..>268788)
                     /locus_tag="KLLA0_E02927g"
                     /db_xref="GeneID:2894235"
     mRNA            complement(<267778..>268788)
                     /locus_tag="KLLA0_E02927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454077.1"
                     /db_xref="GeneID:2894235"
     CDS             complement(267778..268788)
                     /locus_tag="KLLA0_E02927g"
                     /note="some similarities with uniprot|Q12359 Saccharomyces
                     cerevisiae YDR384C ATO3 Plasma membrane protein regulation
                     pattern suggests a possible role in export of ammonia from
                     the cell member of the TC 9.B.33 YaaH family of putative
                     transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454077.1"
                     /db_xref="GeneID:2894235"
                     /db_xref="GOA:Q6CPR2"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR2"
                     /translation="MTEYREDSIKQLPKVTATETSNTLFTIERINSNSDEYDEEDVPK
                     MLVDERDDDDSSSFDGDDDDSMDKNRQRRHNKRAKEEYVVIGGKTYMTSDLEQWLARD
                     HDLENQTEELTRAKTNVTLLQGELADLDTDHKVYANPLPLGLSSFGFSCLLLSMVNAQ
                     VRGVTNNKIVLGAAIFYGGIIELIAGLFCFPLGDTFGMTVLGAYGGFWLSYSVILTDQ
                     FNIVSSYSDDPAMLKNALGLYLTCWTVFTTLCWLCTMKSTWGLFLCFTFLEMTFIMLA
                     CSEFLDSVPIAKAGGYFGMFSAMCAFYVLYSGLANADNSYVPLRQFSLPKTQRVITSS
                     RV"
     gene            complement(<270871..>271603)
                     /locus_tag="KLLA0_E02949g"
                     /db_xref="GeneID:9487322"
     mRNA            complement(join(<270871..271412,271513..>271603))
                     /locus_tag="KLLA0_E02949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999346.1"
                     /db_xref="GeneID:9487322"
     CDS             complement(join(270871..271412,271513..271603))
                     /locus_tag="KLLA0_E02949g"
                     /note="similar to uniprot|Q12486 Saccharomyces cerevisiae
                     YOR131C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999392.1"
                     /db_xref="GeneID:9487322"
                     /db_xref="GOA:B4UNA0"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B4UNA0"
                     /translation="MLRLKATDKSIRSFVFDMDGTLCLPQTWMFKAMREAVGCLDKSI
                     DILHFIENLPTIEERVEAHNKIEAVEQRAMDEMQPQSGLIELFQYLNDNDVSKSICTR
                     NLIKPVNYLIDSFVPTELNEFKCIVTREFQPPKPKPDPLLHIARRLNINPSEMVMVGD
                     SIDDMQAGLEAGFTTILLENDVNKHLTKDTTLVHYSVKKLSDIIDLLGCI"
     gene            <271880..>273535
                     /locus_tag="KLLA0_E02971g"
                     /db_xref="GeneID:2893786"
     mRNA            <271880..>273535
                     /locus_tag="KLLA0_E02971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454079.1"
                     /db_xref="GeneID:2893786"
     CDS             271880..273535
                     /locus_tag="KLLA0_E02971g"
                     /note="similar to uniprot|P32913 Saccharomyces cerevisiae
                     YOR132W VPS17 Peripheral membrane protein required for
                     vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454079.1"
                     /db_xref="GeneID:2893786"
                     /db_xref="GOA:Q6CPR0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:Q6CPR0"
                     /translation="MTSSVPYDPYDDMDNNPFAEPVEPLAVPETINSITRGDQEQQPD
                     TERNNKEHSSHKDNDSESTNTTNQQENGNDSAVNDIPIDELLPERKNNKYNLFVQVTG
                     IERAGSLTNKKENPSIKFDCTTNLPTFRKPKHKKLKKTYTEFYKLFKYLNAAIPETFV
                     PSLPNSFTSYGINNEEDAIKTAANFQSWFNRITSDPLIIRSDEVAIFIESDFNTYTPL
                     KKVSSISGLKRKTLKQLSPPYDETLALAEFRPLVKSIYHTTQEIKAKLLKMATVRRQL
                     SQEVNQFGQAFQPLSLDNSDLYHKFGRVITAIGDIESIVANLDMATLFDPLESIEHDS
                     YIIKEALTNRHFVMRELLQAQQTSRQRQENARKLRAKRDINPLKVDESIRQLKESTKN
                     EHDLTIKLKRITANMLIERERWLVYLQETLAQAIKEFVLRKIEYDRKKLSLLERIRLT
                     VRTADGKGGLSRLGRSSLPTISTLSSSQSYSGDSWTGDKTRTPHLIGGIVTTEFDNAV
                     FNPNNSHGETNTSQPQSSRQSENIEQVGLSARQAASLLGDGTF"
     gene            <274095..>276623
                     /locus_tag="KLLA0_E02993g"
                     /db_xref="GeneID:2893753"
     mRNA            <274095..>276623
                     /locus_tag="KLLA0_E02993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454080.1"
                     /db_xref="GeneID:2893753"
     CDS             274095..276623
                     /locus_tag="KLLA0_E02993g"
                     /note="highly similar to uniprot|P32324 Saccharomyces
                     cerevisiae YOR133W EFT1 and to uniprot|P32324
                     Saccharomyces cerevisiae YDR385W EFT2 Elongation factors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454080.1"
                     /db_xref="GeneID:2893753"
                     /db_xref="GOA:Q6CPQ9"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVAFTVDQIRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAG
                     IISAAKAGEARFTDTRKDEQERGITIKSTAISLFSEMSDDDVKDIKQKTDGNAFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQSLAERIKPVVVINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPQRGTVAFGSGLHGW
                     AFTVRQFANRYSKKFGVDREKMMDRLWGDSYFNPKTKKWTNKERDADGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKEEIPVLLEKLEINLKGDEKELEGKNLLKVVMRKFLPAADAL
                     LEMIILHLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCDPKSDLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNFIPGKKEDLFIKAIQRAVLMMGRFVEPIDDCPA
                     GNIIGLVGIDQFLLKTGTLTTFEGAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLVSMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEGESSQTALSKSPNKHNRIYLKAQPIDEEVSLAIEGGKINPRDDFKARARIMADEFG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAI
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPINESFGFTGELRQATGGQAFPQMVF
                     DHWATLGTDPLDPSTKAGEIVLAARKRQGMKEEVPGWQEYYDKL"
     gene            <277093..>278937
                     /locus_tag="KLLA0_E03015g"
                     /db_xref="GeneID:2893880"
     mRNA            <277093..>278937
                     /locus_tag="KLLA0_E03015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454081.1"
                     /db_xref="GeneID:2893880"
     CDS             277093..278937
                     /locus_tag="KLLA0_E03015g"
                     /note="similar to uniprot|Q04149 Saccharomyces cerevisiae
                     YDR386W MUS81 Helix-hairpin-helix protein involved in DNA
                     repair and replication fork stability functions as an
                     endonuclease in complex with Mms4p interacts with Rad54p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454081.1"
                     /db_xref="GeneID:2893880"
                     /db_xref="GOA:Q6CPQ8"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /translation="MSIPSDAKQLYAEFLQQEVNQSTSAHQEKLVMVLNRALFALKNY
                     PDPIYHPKDLLKVKGIGQTTMNKLSKRLKTYCEENGYSFPEESSSTDNTQSTQNDSNP
                     SNTQKTRVRTLEPEENESQGTRKRRKKKYIPRNRSGGYGILLGLLELGCDKDGTACTR
                     RQLIAVASKYCDQSYEKNPSTKEFYSAWSAIKSLKTNDLVIEQGRPSQFSLTEAGTIL
                     ADSLKTANNIEFDVSSVYERRLNRGNTQNSFTNDEHDHTVNFSGLMNHANMSINESAN
                     SSRLFLDATANSSRIEQNEEPEVSAEISTPIPKQKVSKGRWKGVKYELWKPDSYDIIL
                     HIDHREVRSKEDRGFFARKLLQRGIETESSSLTVGDMIWLAKHKQSGQQCALDFIVER
                     KRLDDLVISIRDNRFSEQKNRLQKTGCKHIFYLVEETTGYNVSDSADMMKTSIWTTVI
                     YNDFHIKRTRNADTTVQWLTDMSLIIKELYSRKSLVVINHDHITNQSIYLTSLKMFRT
                     EFERNKEIECCHNYESMQSAMVKTNLMTVKELYLRALMSVKGISLEKALMIQSRYPTF
                     KTLLKAYRRCAAEADAKTLIQNELKDAPGNRKIGKSLSHTLWETFGKL"
     gene            complement(<278965..>280587)
                     /locus_tag="KLLA0_E03037g"
                     /db_xref="GeneID:2894003"
     mRNA            complement(<278965..>280587)
                     /locus_tag="KLLA0_E03037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454082.1"
                     /db_xref="GeneID:2894003"
     CDS             complement(278965..280587)
                     /locus_tag="KLLA0_E03037g"
                     /note="similar to uniprot|Q04162 Saccharomyces cerevisiae
                     YDR387C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454082.1"
                     /db_xref="GeneID:2894003"
                     /db_xref="GOA:Q6CPQ7"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ7"
                     /translation="MVDDIVRSSSPQRDSSVEDVYSDLYSTFSQMTTTTANDIEQRPY
                     PFTWRTGIMFVSSTIGGMLFGYDTGVISGVLIAMNPKDLNFHSLEIWQKEIITSITCA
                     GSFIGSIIAFPLADRCGRKHTLTVCCIIFAASSMLMAVSYTFEMLVTGRLVVGIAVGI
                     AAQCIPIYLTEISPAKIRGTMLTLNSISITGGQFAAYVIAYFMIDNDHPQSTAAWRYL
                     FALGSIPAIVFLLTLDFIPESPRWLLSKSRLVEAELALHKVYPAATVPEIRHKLRKLT
                     SDLNKLRYHNDETDPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKR
                     ALIIGCVLMFFQQTSGFNAFMYYSATIFEQVGFTNPLVPAIIVAFTNFSFTLLAMKLI
                     DTMGKRTLLLMTIWIMTVGLLLCSVGFELNNLALLVVSVIVYVGAYATGMGVVPWSSV
                     EFLPLNRRAVGGSMISCTNWLTNSVLSLTYLTITDRIGNENTMLLFALFTIFNWLFVY
                     IWYPEVKGLSLEEIGQVFENGVDVHFIYRNYH"
     gene            <281543..>282829
                     /locus_tag="KLLA0_E03059g"
                     /db_xref="GeneID:2893690"
     mRNA            <281543..>282829
                     /locus_tag="KLLA0_E03059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454083.1"
                     /db_xref="GeneID:2893690"
     CDS             281543..282829
                     /locus_tag="KLLA0_E03059g"
                     /note="similar to uniprot|P39743 Saccharomyces cerevisiae
                     YDR388W RVS167 BAR adaptor protein subunit of a complex
                     (Rvs161p-Rvs167p) that regulates actin endocytosis and
                     viability following starvation or osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454083.1"
                     /db_xref="GeneID:2893690"
                     /db_xref="GOA:Q6CPQ6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ6"
                     /translation="MSFKGFTKAVARAPQSFRQKLNMGQQTVDPVYEDADRRFKELES
                     ETKKLSDESKRYFNAVNGMLEHQIGFSKAMSEIFKPISGKMSDPNAAVPEDNPEGIEA
                     SEQYSAIVSELQATLKPDLTLIDEKIVKPAQELLNIINYIRKMSTKRNHKKLDLDRSL
                     NTYNKYEQKQNPTPKDEEKKYKAEAQVAVMQQEYDYYNDMLKTELPILFQLESEFVKP
                     LFVSFYYMQLNIFYTLYNRFQDMKIPYFDLDTDILEAFQAKRGNIEEQTDALTITHFK
                     LGYSKAKLDLTRRRYGATDDSSPGSPMSPPAYGQTYGQPEQPQQMGYDSKLQQPQQQQ
                     QYPIGGVAGAAGIAGYNSVPTTATQASYTPPTSAGVETCTALYDYTAQAEGDLTFPAG
                     AIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVELSKQ"
     gene            <284154..>285815
                     /locus_tag="KLLA0_E03081g"
                     /db_xref="GeneID:2893691"
     mRNA            <284154..>285815
                     /locus_tag="KLLA0_E03081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454084.1"
                     /db_xref="GeneID:2893691"
     CDS             284154..285815
                     /locus_tag="KLLA0_E03081g"
                     /note="similar to uniprot|P17121 Saccharomyces cerevisiae
                     YDR389W SAC7 and similar to uniprot|Q12128 Saccharomyces
                     cerevisiae YOR134W BAG7 GTPase activating proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454084.1"
                     /db_xref="GeneID:2893691"
                     /db_xref="GOA:Q6CPQ5"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ5"
                     /translation="MSSLGNPSAADGFSHSQSPSKNQLTNWWRQFRNNPKSVSSETLS
                     ENRRKGNGSSVSRTNGHGSIPAFRDPSDEDFKEYRDAFLNQRHGFSGQVFNVPLSQSL
                     SVASAEVIVQTELSSFGRIPIVVAKCGAYLKQQGLETSGIFRIAGNTKRIKELQYIFS
                     TPPNYGAKFSNWDEFTVHDVASLLRRFLNHLQEPLIPLALYDSFRKPLIDRPRIIQHL
                     KKASNDGSSQQSDEADDPEPREVEDYDVQEGAEINSAAKELKRQKRQRSKKRLAKDIK
                     NAIKDYDQLFELLPDDPRQLFIYLLDLLSLFAQQSDKNLMTSANLAAIFQPSMISHPD
                     HDMDPREYEISRLVVEFLLCYSYKILPHLLKLKKRKPQSITIISDKEKPSPSPDCDED
                     VEPSKENVDSTIVVPVTPVDTTKFNESDIGVLTPPDPHYLEVPKTRPYSKSLSSANAP
                     SDMIASRRHSKIPFLNKLFVSDTEDEYDSSSRPSSPMLRKTGSTNSAKMLQLPSIVGI
                     SKDDFPTSKTDSDFEDGQEERQPRSKKRESWLQRLKSHSRSSIRE"
     gene            complement(<286113..>287987)
                     /locus_tag="KLLA0_E03103g"
                     /db_xref="GeneID:2894209"
     mRNA            complement(<286113..>287987)
                     /locus_tag="KLLA0_E03103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454085.1"
                     /db_xref="GeneID:2894209"
     CDS             complement(286113..287987)
                     /locus_tag="KLLA0_E03103g"
                     /note="similar to uniprot|P52488 Saccharomyces cerevisiae
                     YDR390C UBA2 Nuclear protein that acts as a heterodimer
                     with Aos1p to activate Smt3p (SUMO) before its conjugation
                     to proteins (sumoylation) which may play a role in protein
                     targeting essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454085.1"
                     /db_xref="GeneID:2894209"
                     /db_xref="GOA:Q6CPQ4"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ4"
                     /translation="MARETNLVKCIGKESFEKLRDMKVLLVGAGGIGCELLKDLILLE
                     IGEIHIVDLDTIDLSNLNRQFLFRKRDIKQPKSNTAMKAVQRFSNSKLVSYQNNIMDT
                     EKFPLSWFDQFSIIYNALDNLAARRYVNKMCQFTNKPLIESGTSGFDGYIQPIFPSVT
                     ECFDCTTKETPTTFPVCTIRSTPSQPIHCVVWAKNFLFGQLFAESSEETVNDQDLGTD
                     DKEEIARIKEETNELHALQQLVKSGDETKITDILKKLFVDDINKLLKIENLWKTRVKP
                     TPLGALLPSDNIPTDLAQVWTLQENVDKFIEVTKTLMLRLRQEPFIEFDKDDDDTLLF
                     VACAANIRSYIFHIAPKSVFDIKQMAGNIIPAIATTNAIIAGLSSLVSLRVLNLLSNV
                     SNNPLEIPMAFTARASNITTNRYLSNPTLAPKNPHCSVSSNIQRAVLKIPKAIVEHMS
                     LYDLNQKIISKYEFTGEYSVLDTNTNSLLYDFDFDDLECRKLSRFNFRTGTFLLYKDE
                     EMEDGAQLRQSIEFYLEFVPENSGEDLQLPNLPRDTYTYHSPYENAEDEQTAVDADQD
                     RTEDHIQAIETLIVDDEPAEDERNNLKRHLSNSIPSPPTKTPKLNASQSDEDDLILLD
                     "
     gene            <288825..>289931
                     /locus_tag="KLLA0_E03125g"
                     /db_xref="GeneID:2894289"
     mRNA            <288825..>289931
                     /locus_tag="KLLA0_E03125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454086.1"
                     /db_xref="GeneID:2894289"
     CDS             288825..289931
                     /locus_tag="KLLA0_E03125g"
                     /note="highly similar to uniprot|P28241 Saccharomyces
                     cerevisiae YOR136W IDH2 Subunit of mitochondrial
                     NAD()-dependent isocitrate dehydrogenase which catalyzes
                     the oxidation of isocitrate to alpha-ketoglutarate in the
                     TCA cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454086.1"
                     /db_xref="GeneID:2894289"
                     /db_xref="GOA:O94230"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /translation="MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGD
                     GVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPL
                     ATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIE
                     HVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVA
                     KKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSL
                     GLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEK
                     AVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL"
     gene            complement(<290622..>292358)
                     /locus_tag="KLLA0_E03147g"
                     /db_xref="GeneID:2893910"
     mRNA            complement(<290622..>292358)
                     /locus_tag="KLLA0_E03147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454087.1"
                     /db_xref="GeneID:2893910"
     CDS             complement(290622..292358)
                     /locus_tag="KLLA0_E03147g"
                     /note="weakly similar to uniprot|Q12212 Saccharomyces
                     cerevisiae YOR137C SIA1 Suppressor of eIF5A High-copy
                     suppressor of temperature-sensitive tif51A-1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454087.1"
                     /db_xref="GeneID:2893910"
                     /db_xref="InterPro:IPR029052"
                     /translation="MFRNRRILLYARRFFLVWICFLFITSWSLIQRHLKNWLVQAPDL
                     KLSGSLQDTGIKVRDVRISKCYSWFSNCDAIWDYSLQDDLVTWYRIDMGKMQDTSIGQ
                     GFGWTSYVYWQPLYPNERGSAVVDLALSRNGLPLGLANERYNKIKNNDIDGYHVHSNT
                     DNEFYVKDDSSNRFNPDMKWSAKFGNHLEDWFWRGDGIWCKYGRRSNGIKEIKAFIGE
                     DFIESRPMWKEMVHCLHREGYSKPISISFQKSRLDDFTYGKEKDLSQISEPSLVMKRA
                     DFKILQISDLHFGRHIVSDSRKEKPDSIFRYDWPNVQFIHSVIRNERPDLAVITGHIF
                     KDFNKNLDYESQILKMVSPIISNGIPFLFTWGEPQVTTEFKVNILNFIKSLPFCLNKF
                     DLKNSTYLMLPLLLPAKTPGSQKQIGTIFAFDSNVTESYNFLDKFPRSPQSVYNLAFQ
                     HLPLHEYRPQGSFALIGNYEQKGSLDYIPHTKAFRNLLGEKDIKAISCGHEHGNDCCV
                     LSDGKQQNLKNNMWLCYGGVTGYDQAYESKVRIFKIDTEKNDITSWKRSIKDTSKVSD
                     YQYIWSRTLNTQ"
     gene            complement(<292918..>294552)
                     /locus_tag="KLLA0_E03169g"
                     /db_xref="GeneID:2894535"
     mRNA            complement(<292918..>294552)
                     /locus_tag="KLLA0_E03169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454088.1"
                     /db_xref="GeneID:2894535"
     CDS             complement(292918..294552)
                     /locus_tag="KLLA0_E03169g"
                     /note="weakly similar to uniprot|Q12242 Saccharomyces
                     cerevisiae YOR138C RUP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454088.1"
                     /db_xref="GeneID:2894535"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ1"
                     /translation="MQSGFDQEELLRKLDAVDSDSSSNDGITSLPSRLPNSLLNTTIE
                     HWWKKDPSQLVGILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKG
                     ELVQSDYRLVHRNAGPLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVA
                     SELINKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLCLKDDKSTSKLFLSKALHR
                     PNVLEPFQPTSLSVLNFSPENYAYTLYEMFNPMLLPEDSGRGYEIENAFDFLAPVFTI
                     IFDDMDDTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQ
                     MSSLQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMAD
                     YTETQRQIDLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGN
                     TGMETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKD
                     HIDAPQDILASISENETLTNFLKEEHTTYVNYKQSP"
     gene            <296592..>298904
                     /locus_tag="KLLA0_E03191g"
                     /db_xref="GeneID:2894741"
     mRNA            <296592..>298904
                     /locus_tag="KLLA0_E03191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454089.1"
                     /db_xref="GeneID:2894741"
     CDS             296592..298904
                     /locus_tag="KLLA0_E03191g"
                     /note="some similarities with uniprot|P20134 Saccharomyces
                     cerevisiae YOR140W SFL1 Transcription factor with domains
                     homologous to Hsf1p and to myc oncoprotein required for
                     normal cell surface assembly and flocculence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454089.1"
                     /db_xref="GeneID:2894741"
                     /db_xref="GOA:Q6CPQ0"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6CPQ0"
                     /translation="MSEQKSEISAVKNQEHPDTEPKQEQEGESPNKRIHLDTRDGKEQ
                     PEKSGQEKKDDKSNGSNATEGTSNVKSEVQPTVQNSSTPQNPHFIHKLYSMLEDDDLK
                     NLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQLNMYGFQKVSDHKSTWAAN
                     TDDSDEPSINLWEFKHSSGYFRKGDTESLKSIKRGSSKYHMSNNRKNSAPTASTFSGS
                     GSQDSASWNEFPPPNRSHSYTSHDAAHIMPNPLYNTQDGLALYPTGANYPVNLVPSVD
                     YYNSPQHHIKNKQQQQQQHQHQQQQQQQQSIDTNVHELHQSISGLRNEHSDLQHSYEM
                     AVEELRATNIDMIKMLDIVQKTMVERIGSPLNEDGSVPRPRTPLSNATRKGSMLSPGS
                     KPPAHTLKTNKEFNSDEQRASTMNELAKIRESIFARFQKFHETMQHSISVMDLKPQSF
                     SSLQPNMNSSTLPSSVNLLQHQYNAFNGNAGPSPQSYHMNPRGSQSDQHVNLMMNPFE
                     RRISSTGSSKKRHMSVLMDPLAPAPPQQPLQAQIQLQPQQQPQQQSQQQSQQQQQQQQ
                     QQQPHQQQHQQQHQQLQANQNPQQAFTIAQGSSQPNVISYKPYYPYGTVPVSNFSGSQ
                     LYSNTPINSTPGHSSVPSEYGLAIEAQGNFVINGPQTPVNIIKPIPAKVPYTVLSDHT
                     TPTGLGPLHGSATQLPQVLSQHQHQHPAFQPAHTLVQPQPISQPQSLSQPPQAPPSMN
                     TSQFSVSKQPQHQSGSNSGLHSLLTHDSRN"
     gene            complement(<299014..>301380)
                     /locus_tag="KLLA0_E03213g"
                     /db_xref="GeneID:2894174"
     mRNA            complement(<299014..>301380)
                     /locus_tag="KLLA0_E03213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454090.1"
                     /db_xref="GeneID:2894174"
     CDS             complement(299014..301380)
                     /locus_tag="KLLA0_E03213g"
                     /note="similar to uniprot|Q12386 Saccharomyces cerevisiae
                     YOR141C ARP8 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454090.1"
                     /db_xref="GeneID:2894174"
                     /db_xref="GOA:Q6CPP9"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP9"
                     /translation="MDTEIDPTESPSKEPSKEPSKEPLLGSDGKISKDIPSKKVPQHL
                     LEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLKPVSVINQKNYSSNYLKNDD
                     QIFYMRERKHLRQQGQTGGSSSAPAAGIGTPALDDDNMADSNAIEDDELDSIIIHPGS
                     SFIKIGPNYDIFPQQVPNLVAVPTHGGTVPSPQEDISNNEIFQQLKDDIQFDFKERMR
                     YYKRRIMPNSTEQAAAFNAKSDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDF
                     KLRSPFLNGSFNLNEPNYNSFQEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVP
                     DLFDKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACV
                     DDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCIT
                     FQDADIAIQLYSFIKRDPYARKYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQH
                     KPNEYVIRQCPRSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDT
                     DDLDEQNDDESAGSKEETQINDEIEDINLRQYNNLSMPLEKAIIESITNASMLLGDNM
                     SKLNVLYSNILIVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYE
                     TDNKLDLEPTDPQAAIAYKKKLSKLIKAEIEAYWDSLQTLHSDDDLLPINILPPPHDM
                     DPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFEYFDH"
     gene            <302753..>303709
                     /locus_tag="KLLA0_E03235g"
                     /db_xref="GeneID:2894006"
     mRNA            <302753..>303709
                     /locus_tag="KLLA0_E03235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454091.1"
                     /db_xref="GeneID:2894006"
     CDS             302753..303709
                     /locus_tag="KLLA0_E03235g"
                     /note="similar to uniprot|P53598 Saccharomyces cerevisiae
                     YOR142W LSC1 Alpha subunit of succinyl-CoA ligase which is
                     a mitochondrial enzyme of the TCA cycle that catalyzes the
                     nucleotide-dependent conversion of succinyl-CoA to
                     succinate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454091.1"
                     /db_xref="GeneID:2894006"
                     /db_xref="GOA:Q6CPP8"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP8"
                     /translation="MLRVAGRRFFSREAVPYDKTIKNLLLNHDTKVIFQGFTGKQATF
                     HAKISQEYGTNIVGGTNPKKAGQVHLGQPVFASVAEAVKETGATATGIFVPPSIAAPA
                     IKEAIEAQIPLAVAITEGIPQHDMLYIAEMLKSQDKTRLVGPNCPGIISPSARCRIGI
                     QPTSIFKPGKIGIVSKSGTLTYEAVQQTTITDLGQSLVIGIGGDAFPGTDFIDALTLF
                     LNDPQTEGIILLGEIGGTAEIEAAEYLKSYNLTREKPLPVASFIAGTVAGQMKGVRMG
                     HSGAIVEGSGTDAESKKKALRSANVAVVESPGHLGKALLDQF"
     gene            complement(<304025..>304939)
                     /locus_tag="KLLA0_E03257g"
                     /db_xref="GeneID:2894658"
     mRNA            complement(<304025..>304939)
                     /locus_tag="KLLA0_E03257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454092.1"
                     /db_xref="GeneID:2894658"
     CDS             complement(304025..304939)
                     /locus_tag="KLLA0_E03257g"
                     /note="similar to uniprot|P35202 YOR143C Saccharomyces
                     cerevisiae THI80 Thiamine pyrophosphokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454092.1"
                     /db_xref="GeneID:2894658"
                     /db_xref="GOA:Q6CPP7"
                     /db_xref="InterPro:IPR006282"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP7"
                     /translation="MSIITENNDIEDIKIEGEYDGIIELDQWFDPKAENSVLLILNQR
                     IKLDHSAFEALWNSYTIKICADGAANRLFDYYRDSDGKRYHPDVIAGDMDSIREDVLE
                     YYEAIETTTVIKQNTQYSTDFTKSVNVATLLLLGIDLNAVEINEYDGIHKLYQQADKS
                     QLKDIPLLILNGIDGRFDHTIHSMVQFYALRRQDPYFKMCFLTMSDMIILIPSSKKGY
                     WLKLDKVKPLIGNCGLLPLAGPNIITKTKGLKWDVEDWPTSIESGNVSSSNRFVGENC
                     LIACEESIVMSVELKWDKITQHLIDESE"
     gene            <305245..>306231
                     /locus_tag="KLLA0_E03279g"
                     /db_xref="GeneID:2894275"
     mRNA            <305245..>306231
                     /locus_tag="KLLA0_E03279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454093.1"
                     /db_xref="GeneID:2894275"
     CDS             305245..306231
                     /locus_tag="KLLA0_E03279g"
                     /note="uniprot|O13472 Kluyveromyces lactis KLLA0E03212g
                     SPT3 Protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454093.1"
                     /db_xref="GeneID:2894275"
                     /db_xref="GOA:O13472"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSDKYKYRVEIQQMMFVSGENNEPPVETTSLIEDIVRGQVVEIL
                     LQATRTANCRGSKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDAQQAAAG
                     GGAGDGSGPGGIDDDDAGKKDKDGAGVNMKVKKSSIKLPWELQFMFNEQPLENPDEDD
                     MDDDEREANMATLKRLKMADDRTRGMTKEEYVHWSDCRQASFTFRKSKRFKDWSGISQ
                     LIDSKPHDDVIDILGFLTFEIVCAITETALKIKTRYERIRSMKTQSQPQEYSVGTTRR
                     KKRLFDGPDNVVNPLKPEHIEEAWRVLQTVNMKHRALSNYKGGRLSSRTVIM"
     gene            complement(<306319..>308568)
                     /locus_tag="KLLA0_E03301g"
                     /db_xref="GeneID:2894716"
     mRNA            complement(<306319..>308568)
                     /locus_tag="KLLA0_E03301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454094.1"
                     /db_xref="GeneID:2894716"
     CDS             complement(306319..308568)
                     /locus_tag="KLLA0_E03301g"
                     /note="weakly similar to uniprot|Q12050 Saccharomyces
                     cerevisiae YOR144C ELG1 Protein required for S phase
                     progression and telomere homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454094.1"
                     /db_xref="GeneID:2894716"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP5"
                     /translation="MGEKEGPLISNILNGYRRRGTGNVNQQSSKQDDDLAIDPALLEE
                     VEEVPSSPLRELEEPINVSSQTQALTENNVKKRVNLKSLLSGYTKKSKPDSKQKQANK
                     KDIILLDESPVKVDSANRFDASHITSDGLQAAKNSNIASFLNMERSTVQRQNKISKEQ
                     VLHAPLPHIQHTPHYILGKQNSISLHKKVVKPLDLSFNASEYSFLVNSDKPDGSKEAL
                     NINDRISYSDDTTNTQLWTSLFKPTSIEDVLIDSDTKSSVREWFKDAFDLLNRKTDRS
                     ALYNRKVDGDLDNFIVDDSFLGSGDDTSVKQFVPLIILYGGIGKNTLIDVLMDEQDAH
                     IFEINCSMNRAKRDISDMLHDFATTKYVKDTQSKGIILFDDVDVLLTESDKFFWNSVH
                     ATLIVSRRPVVITCGDYRFIPSNLLEVAEEQHSIFNIKSAPKQQIMEYTSRCLEQKGI
                     EINKNLLNIILQRNNYHIRKCLMDLQWVCTKPGVVPIKDSHFPRNQNDNTENIKDAWL
                     KLDFSSSYDVIQNCIEGKSFVKDDIDLTLNYAKHQISNDEETSYDVVWDYVEHLWDIN
                     HNTLFPWEKQMQSLMEEKCKQFLRFNDNEDVNVVAHDKVSICVNEMIKYLKTRVNNSP
                     QGNVLTMLGNTRSSRRKTGVLKDYRLKSEDNSDAFELDFINNLALEFSATHKLKDISR
                     WYLPFMSRIAESETEIKNKNVSLFQRYREHYGPEYNANDIIQEMVDKRLILAAFFRGS
                     PQGFLHAYK"
     gene            complement(<309039..>309716)
                     /locus_tag="KLLA0_E03323g"
                     /db_xref="GeneID:2894717"
     mRNA            complement(<309039..>309716)
                     /locus_tag="KLLA0_E03323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454095.1"
                     /db_xref="GeneID:2894717"
     CDS             complement(309039..309716)
                     /locus_tag="KLLA0_E03323g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454095.1"
                     /db_xref="GeneID:2894717"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP4"
                     /translation="MIPISKRIKRGTRKRTTCDDSESELLPLRAKSTNVKKRTGFDKN
                     IRFLGDTNSVGGGKADKYMKQADYKDSDNLLFASDHVSIRLGELTPKRERRPKGSPQN
                     SQRDQQEQRLIDSPNTSLQISDFDVPPESTSTPLPSPGKPNTSLINRSEEVRFSPIYH
                     STNYNWIPELHDPETIGQRIYSPPKTGKRYYRSLTAHKTSSGTSDDIAYHSSAGDATY
                     HGSESNT"
     gene            complement(<309713..>310453)
                     /locus_tag="KLLA0_E03345g"
                     /db_xref="GeneID:2893834"
     mRNA            complement(<309713..>310453)
                     /locus_tag="KLLA0_E03345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454096.1"
                     /db_xref="GeneID:2893834"
     CDS             complement(309713..310453)
                     /locus_tag="KLLA0_E03345g"
                     /note="similar to uniprot|Q03337 Saccharomyces cerevisiae
                     YDR472W TRS31 Component of the targeting complex (TRAPP)
                     involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454096.1"
                     /db_xref="GeneID:2893834"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP3"
                     /translation="MAEQIINPSTTHSTKVAGQGYDYTIGPTQTLPNTSTATTSGTGF
                     VVPTTGIYGQSLISKEKQVSLSAYAFLFQSIVSYHRDSSKNVQEIERKLNSSGYTIGM
                     RLTEILNFRDSVPNKTGLTNMDSVAGTITNMKRRNLKILETLQYIHLTVWQYLFSRPS
                     NDLVKSSERDNEYMIIDNEPTISQFIQHTSVQCESFTCGIIEGFLDMAGFPCHVTSHF
                     VEETGFSNRTVYLIQFDKAVVERENLRQ"
     gene            <310765..>311457
                     /locus_tag="KLLA0_E03367g"
                     /db_xref="GeneID:2893909"
     mRNA            <310765..>311457
                     /locus_tag="KLLA0_E03367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454097.1"
                     /db_xref="GeneID:2893909"
     CDS             310765..311457
                     /locus_tag="KLLA0_E03367g"
                     /note="highly similar to uniprot|P07347 Saccharomyces
                     cerevisiae YHR013C ARD1 Subunit of the N-terminal
                     acetyltransferase NatA (Nat1p Ard1p Nat5p) N-terminally
                     acetylates many proteins which influences multiple
                     processes such as the cell cycle heat-shock resistance
                     mating sporulation and telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454097.1"
                     /db_xref="GeneID:2893909"
                     /db_xref="GOA:Q6CPP2"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP2"
                     /translation="MPITIRHATIDDILAMQNANLHNLPENYMLKYYMYHILSWPEAS
                     FVATTTDDVDDIMDQLTGEEEEDGKILSLPTETKLDPSYIAHTGEKLVGYVLAKMNDD
                     PDSKETEPNGHITSLSVMRTYRRMGLAEKLMRQALFALCEVHKAKFVSLHVRQSNRAA
                     LHLYRDTLAFQVLSVESSYYQDGEDAYAMEKRLELEQLLPSSFQNAQEEDNLESDLFE
                     DIVKQGVEEISV"
     gene            complement(311669..311784)
                     /gene="SNR13"
                     /locus_tag="KLLA0_E03389r"
                     /db_xref="GeneID:9487318"
     ncRNA           complement(311669..311784)
                     /ncRNA_class="snoRNA"
                     /gene="SNR13"
                     /locus_tag="KLLA0_E03389r"
                     /product="snR13"
                     /note="C/D snoRNA monocistronic SNR13"
                     /transcript_id="XR_002633598.1"
                     /db_xref="GeneID:9487318"
     gene            complement(<312058..>312990)
                     /locus_tag="KLLA0_E03411g"
                     /db_xref="GeneID:2894227"
     mRNA            complement(join(<312058..312849,312943..>312990))
                     /locus_tag="KLLA0_E03411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454098.1"
                     /db_xref="GeneID:2894227"
     CDS             complement(join(312058..312849,312943..312990))
                     /locus_tag="KLLA0_E03411g"
                     /note="similar to uniprot|P38759 Saccharomyces cerevisiae
                     YHR012W VPS29 Protein involved in vacuolar protein
                     sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454098.1"
                     /db_xref="GeneID:2894227"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP1"
                     /translation="MLLLALSDAHIPERAIDVPLKFRKLLNVPNKIQQVTLLGNCTKS
                     ASFLKFVNTISENIVFVRGEFDPATVSTTKNPAEEMPLSTVISQGPFRIGCCNGYTLV
                     PKNDPLSLLTLARQLDVDILLWGGTHNVEAYTLEGKFFINPGSCTGAFSTDWVQEDVE
                     ENYKTSEQQEPAEASTNGSNQQPKEIKEEIKEPSNNDSEKSGEDKADIIEDKGNSEEH
                     LQEGKEYEHDSSDDEFDDIDINGGGIPSFCLLDIQDITCTLYIYTYVDNEIKVDKVVY
                     RKD"
     gene            complement(<313281..>314615)
                     /locus_tag="KLLA0_E03433g"
                     /db_xref="GeneID:2894059"
     mRNA            complement(<313281..>314615)
                     /locus_tag="KLLA0_E03433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454099.1"
                     /db_xref="GeneID:2894059"
     CDS             complement(313281..314615)
                     /locus_tag="KLLA0_E03433g"
                     /note="similar to uniprot|P38705 Saccharomyces cerevisiae
                     YHR011W DIA4 Probable mitochondrial seryl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454099.1"
                     /db_xref="GeneID:2894059"
                     /db_xref="GOA:Q6CPP0"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:Q6CPP0"
                     /translation="MVTKRLFHSIGRLRTVKKPQFNVKYMISKLDEFSDSIQARELVD
                     GEELQISLKMLPELYQKSRVADHTIANLQHSRKTIEAQVKQDKTRARELGSELKSLKK
                     QYQDLLKTQREVKDQITEVCGSLPNLIHPSVPKTSSPIIDQWINKQAQYKPDERFEHL
                     KIMVNKGMVDFETASNVTGTSWYYLCNDGARLEHALVQYATTKARKANFNLVIPPSVV
                     RNEVIDACGFRPRDTNNEQQIYRLSDTDLGLTATAEIALAGMGLDSILDLSSGPKKIC
                     GVNRAYRAEAGASGKDTKGLYRVHEFTKVELFVWAKPEQSDQILEELKQFQIDIVREL
                     GLSAQVLNMPSNDLGSPAYKKYDIEAWMPGRGSFGEITSTSNCTDFQSRRMHTRFRNE
                     EGELEYAHTLNGTAMAVPRVIVALVENNYDPVSDTISIPQALQPYLDGMEFM"
     gene            complement(<314899..>315900)
                     /locus_tag="KLLA0_E03455g"
                     /db_xref="GeneID:2893895"
     mRNA            complement(join(<314899..315278,315870..>315900))
                     /locus_tag="KLLA0_E03455g"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_454100.1"
                     /db_xref="GeneID:2893895"
     CDS             complement(join(314899..315278,315870..315900))
                     /locus_tag="KLLA0_E03455g"
                     /note="highly similar to uniprot|P38706 Saccharomyces
                     cerevisiae YHR010W RPL27A and to uniprot|P38706
                     Saccharomyces cerevisiae YDR471W RPL27B proteins component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_454100.1"
                     /db_xref="GeneID:2893895"
                     /db_xref="GOA:Q6CPN9"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN9"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGTKSHPFGHALVA
                     GIERYPLKVTKRQGAKKVAKRTKIKPFIKVINYNHLLPTRYTLDVEAFKSVVSTETFE
                     EPSQREEAKKVIKKAFEERHQAGKNQWFFTKLNF"
     gene            <316716..>317579
                     /locus_tag="KLLA0_E03477g"
                     /db_xref="GeneID:2894140"
     mRNA            <316716..>317579
                     /locus_tag="KLLA0_E03477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454101.1"
                     /db_xref="GeneID:2894140"
     CDS             316716..317579
                     /locus_tag="KLLA0_E03477g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454101.1"
                     /db_xref="GeneID:2894140"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN8"
                     /translation="MIEGKNNVKIIPQPRVRNKDAVDEDLVGGNIYTMPNQEIEEIIL
                     SLKKLLDGNRMVRERVDAIDDQVRRTQMDLESLVSRSSNNNKHLQSLLLSSKDIKELH
                     DVLDKLSVQQHEQMEKNRDVESVLTRLMEKQSLELKSSMENVEIQTLEQKISQLEAKS
                     GKLESLDAQVIAKEKQLAIIETKLQERKERFDELRQRAKEVQSSLQDDLLTRYKTVHD
                     TMSVSMANLANGSRPAGNTSRVASLLRNKYMNDTFNGNRRVISLNEPRPSSSSAFDSI
                     PQNNSDFEDSS"
     gene            <317949..>319391
                     /locus_tag="KLLA0_E03499g"
                     /db_xref="GeneID:2894141"
     mRNA            <317949..>319391
                     /locus_tag="KLLA0_E03499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454102.1"
                     /db_xref="GeneID:2894141"
     CDS             317949..319391
                     /locus_tag="KLLA0_E03499g"
                     /note="similar to uniprot|Q03327 Saccharomyces cerevisiae
                     YDR470C UGO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454102.1"
                     /db_xref="GeneID:2894141"
                     /db_xref="GOA:Q6CPN7"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN7"
                     /translation="MEEIKDSSILRPYYDPETFNVGYSAVFQNDKGVIDQNGLNIASK
                     LTIVNQSVGSGLKSLNRSLSGGNTLTELTTGLKNKFLHGIMNSKHGNNAKSLNDLEWN
                     DFINVNVWRHLLERLLRQLSSKYFQHLIRQPFEIAKLLLQVGDFDYLTDGNKSAYYND
                     NDNVNDNHEFEDDDDDEAEPNFFVNESQANLIERAAKEEQGVADENGTLIKPASIHTI
                     DILNSIMDKEGIQGVWRANNTEFIYNFLSISLDAWFTGLLSPLMQIPDPYFIDIIHSP
                     DVTKSASLILLASCMTRLVLLPLDLVRVRLIISSVRNDGSLSDNDRSLRKLLRKWSWR
                     ENISKLNKELVFLNILYSLVGTGFSKLTGAILYHQFNVDKFTNVILYNTLKFCSKVCE
                     LFVKLPIENLLRRSQVKFLFTENPFQVQSEMLIIKPREYQSIYLTVFKQCDRISELWR
                     GWRLGLLSILCGYGLKILNKPSEILEEEKF"
     gene            complement(<319500..>319904)
                     /locus_tag="KLLA0_E03521g"
                     /db_xref="GeneID:2894657"
     mRNA            complement(<319500..>319904)
                     /locus_tag="KLLA0_E03521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454103.1"
                     /db_xref="GeneID:2894657"
     CDS             complement(319500..319904)
                     /locus_tag="KLLA0_E03521g"
                     /note="some similarities with uniprot|Q03323 Saccharomyces
                     cerevisiae YDR469W SDC1 Subunit of the COMPASS complex,
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454103.1"
                     /db_xref="GeneID:2894657"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN6"
                     /translation="MSEPVMENMAPEDVVKLEKEEHIVPDIGVSSISTTEPLSPSGIP
                     RESSGTVTSATAATTEREVSPKKELQIDHDRVDPVAMIGGSTTRRYLNEHVTKHLLEG
                     MKLIAREKPEDPLRVLGQFLIDASEMNQKPSS"
     gene            <320167..>320862
                     /locus_tag="KLLA0_E03543g"
                     /db_xref="GeneID:2893702"
     mRNA            <320167..>320862
                     /locus_tag="KLLA0_E03543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454104.1"
                     /db_xref="GeneID:2893702"
     CDS             320167..320862
                     /locus_tag="KLLA0_E03543g"
                     /note="similar to uniprot|Q03322 Saccharomyces cerevisiae
                     YDR468C TLG1 member of the syntaxin family of t-SNAREs
                     tSNARE that affects a Late Golgi compartment"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454104.1"
                     /db_xref="GeneID:2893702"
                     /db_xref="GOA:Q6CPN5"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR015260"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN5"
                     /translation="MDPFIQVFKDTEEQLNQLLQILDRKKKGRSNTSSKEISEIISEA
                     QETIQDLNESIEMMKQEQAIPEYEIQTREKSMANLESKLKQCQSLNIETTRDTDAATQ
                     SSLLPQQQQRGDSFDLDIEATAGTDQSDAANHDAVQEQLLREQDNQLDMIHQTMQNIH
                     LQASTMGQELTEQGMILEEMDGNVDGVMNKLSRGRRQLEWVYEHNKERVNDCCIFLLI
                     IALIILLVLAFIL"
     gene            <321977..>323488
                     /locus_tag="KLLA0_E03565g"
                     /db_xref="GeneID:2894056"
     mRNA            <321977..>323488
                     /locus_tag="KLLA0_E03565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454105.1"
                     /db_xref="GeneID:2894056"
     CDS             321977..323488
                     /locus_tag="KLLA0_E03565g"
                     /note="similar to uniprot|P38758 Saccharomyces cerevisiae
                     YHR009C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454105.1"
                     /db_xref="GeneID:2894056"
                     /db_xref="GOA:Q6CPN4"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN4"
                     /translation="MSNTEFIDKLEFASQPSGKSEGKHHIVIVGAGIIGVCTAYYLTR
                     HPSFSKDTHHITVIESKRVAGGASGKAGGLLAMWAFPQQIVPLSFQLHQELSDEYNGE
                     TKWDYRRLTTVSLEANVQDDTVSLDPKETGSSVNDNSNDGDDDESYASNDGKTTSRAK
                     PSQKKKSKKACAVVNNEPVSRVGTTEDDEDYEYSYGEDDEEDEAPASELDTKSSIALS
                     KDPLRLPSDLNWIKKRLVRDWSSLGGTDSTAQVHPFKFTHYLLLKAMETGAVDLILGK
                     VSQLHFNDQCAAAGVSYIPTVDDPEEQRLQEPVDLLDVDQVVLCMGPWTSRLLPDCPI
                     SGLRAHSITIKPSTGTVSPYAIFTELKISSNKYFSPEMYARKDEVYVCGEGDTLVELP
                     ETSDAVEVVKEKCDELYHYVSKLSPNLSRGHILKRQACYLPVLNVPTSSGPLIGETNV
                     EGLFIASGHSCWGINNAPATGKVMSELLLDGEAKSADISALDPSLYFDASIFE"
     gene            complement(<323764..>325707)
                     /locus_tag="KLLA0_E03587g"
                     /db_xref="GeneID:2894190"
     mRNA            complement(<323764..>325707)
                     /locus_tag="KLLA0_E03587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454106.1"
                     /db_xref="GeneID:2894190"
     CDS             complement(323764..325707)
                     /locus_tag="KLLA0_E03587g"
                     /note="weakly similar to uniprot|Q03306 YDR466W
                     Saccharomyces cerevisiae YDR466W Protein kinase with
                     similarity to mammalian phosphoinositide-dependent kinase
                     1 (PDK1) and yeast Pkh1p and Pkh2p, two redundant upstream
                     activators of Pkc1p; identified as a multicopy suppressor
                     of a pkh1 pkh2 double mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454106.1"
                     /db_xref="GeneID:2894190"
                     /db_xref="GOA:Q6CPN3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN3"
                     /translation="MSRKRTPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKK
                     HIISENKVKYVTIEKNTLNLLAHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLL
                     QTQGRFNEAWTKHFMCQLIDALEYIHGCKVVHRDLKPENLLLSSEGKLMITDFGVASN
                     LAATDNLSSTSSFVGTAEYVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRGENE
                     LAAFEKIVNLDYHWIYMVSQHITDLVSKILVLDPDSRYTLPQIKNHAWFQGIDWTNKE
                     LIWKGIWQLFGNRNHNNFNGPSMMNKQLHVIDTTIKNIPIQPRKRKPMKVTQTTSSIV
                     EWRKTLGLSPVSGSVGPNGLPKQMKSHVPSRSTPNSPSRALTGKGYTKAMPNTAPPLE
                     TCKTPMMPVSPLYITTPGASASFSPKKFNNASDSNRLLTPPASPKALKQGWVKILEIP
                     YVSSSKKTFSSTEYSFIDDRLITRFITEQKSQIINSSMLSLLTLEPNGQFSYTPKGDS
                     TRQMISIVDQNLSIYDLEFNETKNSGYLIFEKFKSKVWLIALPKSAPSDFVINSRQKW
                     VDSLFKTKAALESEKLTKKVDNLSLKPPETCSTSSKPRKSPQDNMFVSSSRAEVLYTL
                     NKQKRSNTDAANGARAAFKNMNK"
     gene            <326893..>327573
                     /locus_tag="KLLA0_E03609g"
                     /db_xref="GeneID:2894718"
     mRNA            <326893..>327573
                     /locus_tag="KLLA0_E03609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454107.1"
                     /db_xref="GeneID:2894718"
     CDS             326893..327573
                     /locus_tag="KLLA0_E03609g"
                     /note="highly similar to uniprot|P00447 Saccharomyces
                     cerevisiae YHR008C SOD2 Manganese-containing superoxide
                     dismutase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454107.1"
                     /db_xref="GeneID:2894718"
                     /db_xref="GOA:Q6CPN2"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN2"
                     /translation="MFAKSVARRALQLQPTLLAKRTKVSLPELDWDFGALEPHISGQI
                     NELHYTKHHQTYVNGFNAAVEQFDELKSKLDNDPAVAKQIVAVQQNLKFHGGGYVNHC
                     LFWKNLAPTSQGGGEAPTGALAKQIETQFGSLDNLISLTNAKLAGVQGSGWAFIVKNV
                     ENGNQLEVVQTYNQDTVTGPLKPLVAIDSWEHAYYLQYQNQKANYFKAIWNVINWKEA
                     AKRFEAAA"
     gene            <327965..>329188
                     /locus_tag="KLLA0_E03631g"
                     /db_xref="GeneID:2894719"
     mRNA            <327965..>329188
                     /locus_tag="KLLA0_E03631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454108.1"
                     /db_xref="GeneID:2894719"
     CDS             327965..329188
                     /locus_tag="KLLA0_E03631g"
                     /note="similar to uniprot|Q03305 Saccharomyces cerevisiae
                     YDR465C RMT2 Arginine methyltransferase ribosomal protein
                     L12 is a substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454108.1"
                     /db_xref="GeneID:2894719"
                     /db_xref="GOA:Q6CPN1"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSDLHHLLTFPERPISESSYLPELTRLLSAGIPATYTLEQAAAF
                     ERGEEVTEEDSNTTPLHILCRSLPSFEGSSKLSEDEESVVLKLMDTLLEYGAGWNFLD
                     YENKHIGDLVLERKYPQDHCIYQRIVDAGVSAELLLRKIDGGEIEFIEDPEDAATEAA
                     TEAATEAEVIEGVTKGSEEAPFEDATAADQATYLKTDLEYTDDALVTKENRDGVMMDW
                     ETDIMSMAAKSLVSTRSTDECVVLNIGFGMGIIDNFIQDEKVTKHYICEAHPDVLAKM
                     KETGWFDKENVVILEGRWQSRLNELLDQGEVFFDGIYYDTFSEHYQDMLDLYDVIVGL
                     LKPEGTFSFFNGLGADRPVCYDVYRKIVELDVANYGMECRYQVINLRTLPNWNDVKRS
                     YFNCTYYYHPEIRFA"
     gene            <329904..>331487
                     /locus_tag="KLLA0_E03653g"
                     /db_xref="GeneID:2893694"
     mRNA            <329904..>331487
                     /locus_tag="KLLA0_E03653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454109.1"
                     /db_xref="GeneID:2893694"
     CDS             329904..331487
                     /locus_tag="KLLA0_E03653g"
                     /note="highly similar to uniprot|P10614 Saccharomyces
                     cerevisiae YHR007C ERG11 Lanosterol 14-alpha-demethylase
                     catalyzes the C-14 demethylation of lanosterol to form 4
                     4''-dimethyl cholesta-8 14 24-triene-3-beta-ol in the
                     ergosterol biosynthesis pathway member of the cytochrome
                     P450 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454109.1"
                     /db_xref="GeneID:2893694"
                     /db_xref="GOA:Q6CPN0"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6CPN0"
                     /translation="MSTKSESVVVKVFEAAQAVLGQFLAFSIAQQISIVILLPFVYTI
                     VWQLLYSMRKDRVPLVFYWIPWVGSAVSYGMRPYEFFEECREKYGDIFAFVLLGKVMT
                     VYLGPKGHEFILNAKLADVSAEAAYTHLTTPVFGNGVIYDCPNHRLMDQKKFVKGALT
                     TDAFRKYVPLIAEEVQKYFLTSKNFSIGEKDHGKINVMVTQPEMTIFTASRSLLGSEM
                     REKLNTDFAYLYSDLDKGFTPLNFVFSHLPLDNYRKRDNAQRVISSTYLSLIKKRRDT
                     NDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWVILHLAER
                     PDIQEKLYEEQMKVLDNGTKELTFDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDM
                     PVPNSSYVVPKGHHVLVSPGYCHLQDKYFPNASEFNPNRWDNDAASSYASNEKVDYGF
                     GSISKGVSSPYLPFGGGRHRCIGEHFAYMQLGTILSNYIRTLTWKFADPSATVPTPDF
                     QSMVTLPLEPSEIEWTLRK"
     gene            complement(<331890..>335921)
                     /locus_tag="KLLA0_E03675g"
                     /db_xref="GeneID:2893785"
     mRNA            complement(<331890..>335921)
                     /locus_tag="KLLA0_E03675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454110.1"
                     /db_xref="GeneID:2893785"
     CDS             complement(331890..335921)
                     /locus_tag="KLLA0_E03675g"
                     /note="some similarities with uniprot|P38904 Saccharomyces
                     cerevisiae YDR464W SPP41 appears to control expression of
                     spliceosome components PRP4 and PRP3 negative regulator of
                     prp genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454110.1"
                     /db_xref="GeneID:2893785"
                     /db_xref="InterPro:IPR021386"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM9"
                     /translation="MSDDQGTDLNLSELVGNILAASDDNIPSLEDTQRHDEHQNDNDH
                     IGEDDILPDLLPISQIPDDEHAQDHSLASMVSQAINTMNNETGDPTHVNESHSDLQSK
                     EQEWANILRQGILQADEEIRDQHVETYAEPAHRPTEDQVLDQDDENLRLAILDSLQHL
                     DQEKKPKKHSKKEKKSKEKKKTSKKGDKEKEKSKKKEKKSKEKKSSSNNDVLNFEDVI
                     KGFMEQTEAAPAVASQVEPNAPIGDAETQALVEATLKAFENQLIGGPSTAKPKTSSTR
                     KPPKTTSHKFSKSLPPPLPMPFFPITQKRKVKSKSTEKAKEGQDKESQAAATSPKKKK
                     KASKKKEKKKDDYNEDEFSKALAEMVNQVVNTSLMDNAQTAQVPTTEETKLEKTSKKK
                     NKSKSKSRSGDDYAPKGKSKVPKDTKKKGTSSSKINQEIKAIPLDPELVKESASQAAV
                     APDAKDTTDVSHLSTSDGFDLHQIMQNAMSMAFQEQVQNQLHPSVMERFDKELSESQF
                     SDGLSRKTIGDRSVLRSRFVPPKKKKKEKKKGELKFNNIHGGLSNTKFSGSNKTNVGS
                     KIVVFKPQKIKHELVNKGLSTTEERLRRKYSKIARECAKTAKRLTTERKKKLKEEHKM
                     EKDRLKNHRKQLKEEQKINREQERKALEEIVSKGPPYPKNLCLTSAGRPKKPYRFYSA
                     EEMKQRESMTVEELASFDALNDTKLSEKQQIKSIPLYKLKQLTLFNPNLPESTNRLND
                     IRGSLEKAGKRTVTKMPVRKEAKRKQKYFFDPSVKTVVHREKIPFHPPWQFPVNPPFA
                     LPVAKRPKSHSVEKMSRRKRAIYQRTLLSNTLLPILQTLRAAAKATASVGVDPEKSKE
                     HLRSMLQQARLTIAETLQKARSSSTSSLTDGSKPIFQEAREKEVSTPTLSIPIMRTTS
                     KVKTEEPKIPAFNSVSVQENNKAQSLIPTEQSSIKEIPLAVSKKRSSDETSDVSDIRQ
                     NVSQVIDKLSTLIPSLTKAKALPILVPSKKKQKSILNMDEVKIPLAKAKGPNFSKPTL
                     KSTMNTPKSVTIIKTEEPGTDSSMFDTETAPVLVQDTSPSKRVEDVKVPIHPPVIQTS
                     KKTTELFNKYHFDLPSVDSDGRPVKTIPVMKRVKQYLSAEDVKKLKKVKETYRKRKWR
                     LANADKNKDLELRTRIKIAARKQFGEDESEAKRTWISTEYETRKIKLELDPEIKSSAA
                     VMVSDKELLNIIAVSLEKLEIARSIEHDIIEEAKNYTKPKKRKQQKIEIDNGVNTAVD
                     ILKENMAKEHVLPASTVTPISETPDVNKADSASTPNESEDGRISEHSIDPNLAASTKR
                     PREGPVTDSVITAEIGPNSKRAC"
     gene            complement(<336505..>338727)
                     /locus_tag="KLLA0_E03697g"
                     /db_xref="GeneID:2894245"
     mRNA            complement(<336505..>338727)
                     /locus_tag="KLLA0_E03697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454111.1"
                     /db_xref="GeneID:2894245"
     CDS             complement(336505..338727)
                     /locus_tag="KLLA0_E03697g"
                     /note="similar to uniprot|P32486 Saccharomyces cerevisiae
                     YPR159W KRE6 Protein required for beta-1 6 glucan
                     biosynthesis putative beta-glucan synthase appears
                     functionally redundant with Skn1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454111.1"
                     /db_xref="GeneID:2894245"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM8"
                     /translation="MSRRANDNQFGRTAGGTNNGSFDSDYNDNYRAQDPGSSNPFLDE
                     SELNGLFNSGKNSATSLLHQDSTSDSVPSSGYNNSNPSAQLLHPSNNNTNSNKNLNNQ
                     PVSDYKGYYARNNNNNSSNSGNIQGRSPNGAGLRVPSTISQQQPNHGFPSSTSMASNL
                     IATSDIMSPPAFDRYPQVGNSRTVSMHAGGTPLQGSSSGNNSNSSINSSNPFLSDQDF
                     SPFGGYPASSFPLKMDEKEDDDYLHNPDLEEDLRLDKKRFELDLKNMDKRSAGGLIGI
                     LLLFLGAIAVFIILPVVTFTGAGRHGSAEVTELLTLYEYPQLSAIRTSLVDPDTPSSA
                     KTVKSLSGDTWELVFSDEFNAEGRTFFDNEDQFWTAPNFHYDATKDLEWYSPQQVITS
                     EGTLKLRMDAYKNNDLYYRSGMLQSWNKLCFTQGRLEISVNLPNYGTISGLWPGAWTL
                     GNLGRPGYQATTEGVWPYSYEACDAGITPNQSSPDGISYLPGQKLSACTCDGEDHPNL
                     GVGRGAPEIDIIEIETDTSLHGTGVGVASQSYQVAPFDIWYIPDYDFVEIYNESITSM
                     NTYCGGPFQQAVSAVSTLNASWYEFGQTAGHYQKYAIEYLHDNDDGYIRWHVGDNPTF
                     TVFATALHPNGNIDWRRISKEPMSIILNLGISNNWAYIDWQSIYFPVTMSIDYVRLYQ
                     PNDSISVTCDPSDHPTYDYIVAHETAYYNVNLTSWEAAGYTYPKNALTGNCKSSKFSG
                     "
     gene            complement(<340439..>341320)
                     /locus_tag="KLLA0_E03719g"
                     /db_xref="GeneID:2893917"
     mRNA            complement(<340439..>341320)
                     /locus_tag="KLLA0_E03719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454112.1"
                     /db_xref="GeneID:2893917"
     CDS             complement(340439..341320)
                     /locus_tag="KLLA0_E03719g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454112.1"
                     /db_xref="GeneID:2893917"
                     /db_xref="GOA:Q6CPM7"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM7"
                     /translation="MEFTDLLYHHALAFEDAALFYYDKDELQNLHQTLNNMVNSLRNG
                     GKLIFVGCGKSYKIICKTVAMLTSMGIPARDLHPIEAMHGDMGCCQPNDSLIFCSTSG
                     ETDEVLNLLRYLKAGGSYWEKCIRIAVTGNRNSTLATHCQHTIVVPQADRFKEPKFQR
                     GLRAPTISTSLMVTVLDCICIEISKAWFGNDPVKREIFFNERHPGGGIGKITSSTNLT
                     QLVRAPTDYQTPQYHSYMVKRNETLTETQFLSLLITFDYIQFSPKNVRVPTCLLREEH
                     KRAVHSGTVPEWFRRYL"
     gene            complement(342576..342648)
                     /locus_tag="KLLA0_E03741r"
                     /db_xref="GeneID:9487381"
     tRNA            complement(342576..342648)
                     /locus_tag="KLLA0_E03741r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:9487381"
     gene            complement(<342937..>343965)
                     /locus_tag="KLLA0_E03763g"
                     /db_xref="GeneID:2893617"
     mRNA            complement(<342937..>343965)
                     /locus_tag="KLLA0_E03763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454113.1"
                     /db_xref="GeneID:2893617"
     CDS             complement(342937..343965)
                     /locus_tag="KLLA0_E03763g"
                     /note="some similarities with uniprot|P53286 Saccharomyces
                     cerevisiae YGR142W BTN2 Cytosolic coiled-coil protein that
                     modulates arginine uptake interacts with Rhb1p possible
                     role in mediating pH homeostasis between the vacuole and
                     plasma membrane H()-ATPase may have a role in
                     intracellular protein trafficking"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454113.1"
                     /db_xref="GeneID:2893617"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM6"
                     /translation="MLACTLPEISPFMFTQNCPYKKRRTTHQKPTVRYQVQHLPNEII
                     VDLKKTAPKETIEHHILSHVRNFQDTIPRYKLVTDWLGNQYYVENDINQETIFNEVLR
                     SINWTQFGINMCKKLFRDYDIQLKHDGKELRVTSKMDGIDQIFELNEEVDDVEIMGLQ
                     LSDDLHDAVLKLRLIKKEMQEEKVKSVQCEHKESVHKKEPSEFETKKPSQVTESKEIL
                     KRKNRHYHHHHSKNEPRNKTKSNSRKVKKVEKELPTSDDDNTQLEASKPKAFKIDVLF
                     DSSDSEKSENNVNSSNNYDNGVSPPRRNSASSVNSVVLEEVEDEEVRRWQKSLTQTPS
                     GHSVLEDV"
     gene            complement(<344351..>345637)
                     /locus_tag="KLLA0_E03785g"
                     /db_xref="GeneID:2893619"
     mRNA            complement(<344351..>345637)
                     /locus_tag="KLLA0_E03785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454114.1"
                     /db_xref="GeneID:2893619"
     CDS             complement(344351..345637)
                     /locus_tag="KLLA0_E03785g"
                     /note="similar to uniprot|P53285 Saccharomyces cerevisiae
                     YGR141W VPS62 and similar to uniprot|Q06466 Saccharomyces
                     cerevisiae YPR157W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454114.1"
                     /db_xref="GeneID:2893619"
                     /db_xref="InterPro:IPR009291"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM5"
                     /translation="MRFYILFLYLFGTLVAAIHLDDPLTNFNFTPPIKSPNDLLDHER
                     TLTDGEIPRYVLDHSPLIHLYSEEKYLPGDIQSFVPHFQLVTSNYETVVNEPLKISDL
                     KGEYNVAGEVLSSETLYLHTTEKFEEDPSWLRGTHPEYGTGLTRDASSIVIVVDKGNG
                     WVDAYWFYFYPFNLGPFIMGYGPWGNHIGDWEHSLVRFFKGDPQYIWMSAHGGGASYT
                     YRCIEKKDRWRVTPEGKFDKTQVIKRPLLFSARGTHANYASVGQHAHDVPFFFSALSD
                     FTDRGPLWDPSLRFYGFTYDGKSFYEKEGQEIGTSWLYFLGQWGNKQLKWSDPRQKWC
                     PVQWKYIDGPKGPAAKNLVRTTLCERSKWWNFWHGCPVRRMIKRGQGLDAERNDLVGD
                     NCGIALYRIRPKWLRSLFRLITWRGAFCAFMDYFTG"
     gene            complement(<345816..>348026)
                     /locus_tag="KLLA0_E03807g"
                     /db_xref="GeneID:2893666"
     mRNA            complement(<345816..>348026)
                     /locus_tag="KLLA0_E03807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454115.1"
                     /db_xref="GeneID:2893666"
     CDS             complement(345816..348026)
                     /locus_tag="KLLA0_E03807g"
                     /note="similar to uniprot|Q753I9 Ashbya gossypii AFR323W
                     AFR323Wp and weakly similar to YGR140W uniprot|P32504
                     Saccharomyces cerevisiae YGR140W CBF2 Essential
                     kinetochore protein component of the CBF3 multisubunit
                     complex that binds to the CDEIII region of the centromere
                     Cbf2p also binds to the CDEII region possibly forming a
                     different multimeric complex ubiquitinated in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454115.1"
                     /db_xref="GeneID:2893666"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="PDB:3SQI"
                     /db_xref="PDB:3T79"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM4"
                     /translation="MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLF
                     LSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDIENNDVLVLQQRLYGLVKLLEFD
                     YSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVS
                     LKDLQCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYK
                     GDGYQILSQLEHIPIIRGKSLDQYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWP
                     QFPDFSDSSENTSTLAESDSENTIGIPDFYIEKMNRTKLQPCPQVHVHLFPTDLPPDI
                     QAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLA
                     QLIDKTGTVSELVPNPVKIDQNEHTLTPIGTSLSQTDIPMLDQLKTELQKLIQLQTST
                     GFSQLITVLLEIFQRLDFKKSNKQFVIDLLQSCRKDMRNKLMDPCSLSTNFADELSDD
                     ENEKGNKTGAIYDPETDNGNEESVSDYEPSFKKSKPNYTEEPLSDDENMEEVAQLVNQ
                     LITRKFNENLEQQTDRIISSIQPTLRDMVRTEVADALNLSLREASRDSVNKKNSDENF
                     QNYSLTEDHFEMNPDCSDIKSIILEWFTPNRECVHSMNKKYGNKWRLTEPNLSLYRIR
                     KPIVQYYIHLINVENLNKFDALNKLEAVLEKHHSVPLLSSFLEKAKKNGYASVT"
     gene            <349784..>351613
                     /locus_tag="KLLA0_E03829g"
                     /db_xref="GeneID:2893668"
     mRNA            <349784..>351613
                     /locus_tag="KLLA0_E03829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454116.1"
                     /db_xref="GeneID:2893668"
     CDS             349784..351613
                     /locus_tag="KLLA0_E03829g"
                     /note="highly similar to uniprot|Q06451 Saccharomyces
                     cerevisiae YPR156C TPO3 Polyamine transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454116.1"
                     /db_xref="GeneID:2893668"
                     /db_xref="GOA:Q6CPM3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM3"
                     /translation="MNNEELQSIDSYEEQFPQSYVPEPAPYDGAGTASGGEAGSSNLK
                     LVPTETAKSLQDMGLTSEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSL
                     GRTPTAISRTRTRQMDRQDASSSEEKNDEEPDEELPSHIDKEVEFVTFVTNDPENPHN
                     WPLWIRWSYTILMSVLVIAVAYGSACITGGLFTVEEKFHVSQEVAILSCSLMVIGFSL
                     GPLIWSPVSDLYGRRVAYFISLGLYVIFNIPCALAKNIGTLLVCRFLCGVWSSSGLCL
                     VGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNGFIAISTNRMDLIFWVNMAFAG
                     VMWIIVSCIPETYAPVILKKRAKRLRIELNNPKIMTEQEAQGMSVSELVRACLLRPLY
                     FAVTEPVLDLMCFYVCLIYSLLYAFFFAYPVIFGKLYGYKDNIIGLMFIPILIGASGA
                     LATTSWCESRYVALTHKRKPTPEDRLLGAMIGAPFAAIALWILGATSYKHIIWVGPAS
                     SGLAFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTSQMYDRLG
                     LQWASWLLAFISTAMILIPFAFYYYGKALRAKLSKKDYSADAM"
     gene            <352621..>354423
                     /locus_tag="KLLA0_E03851g"
                     /db_xref="GeneID:2893872"
     mRNA            <352621..>354423
                     /locus_tag="KLLA0_E03851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454117.1"
                     /db_xref="GeneID:2893872"
     CDS             352621..354423
                     /locus_tag="KLLA0_E03851g"
                     /note="some similarities with uniprot|Q12374 Saccharomyces
                     cerevisiae YPR155C NCA2 Protein involved in regulation of
                     mitochondrial expression of subunits 6 (Atp6p) and 8
                     (Atp8p) of the Fo-F1 ATP synthase functions with Nca3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454117.1"
                     /db_xref="GeneID:2893872"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM2"
                     /translation="MLNDSLISQRLKQVTNSLEEQFAFWSRDKEISQSALSLPLNEFV
                     IELKQEADQVIAAIEKNVRHDMHWDTLQTKWSQLISHGQDTRDATAMKDIDVAGHETL
                     NDDIVTVPNVSTDIGFEHGVNESQATNADKYLFDIILQYMDILQFYYDMQLSMDHYHA
                     LVQARDYYSKLRGSVWKYTVIPFQFWKHGFQVSTLRTMFTAKTLKVNDLVNAADILAT
                     PTRLVNFQLDDVSKKLTSEIDSLLVSTGEELSRFENKTYDENDGGKKADTESTLKDVS
                     LDKIMSRLNAVSHLQFTIPEDVRIPPWYQRQWFQLSVLSIYGPMLLKKLVQNGQSLWT
                     TVSQGSYEFVSGLWENWIWTPITQIWDTVRFDSGELYVTTKDNLTSELNSLIRMIVEF
                     LRDRSPPGTNVDVDSLTKQIMDGDLQDFMKIYEHQIENPVKSIVFDNMVRSLLIQLQK
                     VKVDGSMAMNGINKLLKSQQLLFSIVSLLPALLIIWALRNFLSHSISSGVEWAKDLEG
                     TKFTINRSLNEIERLLNVPLSEEVIPHDEQMKSLALLNLEVATLKMVMVKYLPKNYKP
                     IWVRDCNDLGDYGSTNEAKINVINRIHHMYGKFM"
     gene            complement(<354700..>355362)
                     /locus_tag="KLLA0_E03873g"
                     /db_xref="GeneID:2893877"
     mRNA            complement(<354700..>355362)
                     /locus_tag="KLLA0_E03873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454118.1"
                     /db_xref="GeneID:2893877"
     CDS             complement(354700..355362)
                     /locus_tag="KLLA0_E03873g"
                     /note="similar to uniprot|Q06449 Saccharomyces cerevisiae
                     YPR154W PIN3 Protein that induces appearance of [PIN ]
                     prion when overproduced"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454118.1"
                     /db_xref="GeneID:2893877"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6CPM1"
                     /translation="MPSVEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPP
                     VADTMGQNNEIVEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPS
                     NYVKSVDTKDVEKRSSSATPVANLPQYAAYTPPGQQMQVQPPVQQQSPFPPQFTGYYQ
                     QPVQQQPMQQYPQQQPQEQPQEQSSHQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNS
                     IF"
     gene            complement(<355734..>356234)
                     /locus_tag="KLLA0_E03895g"
                     /db_xref="GeneID:9487517"
     mRNA            complement(join(<355734..356151,356230..>356234))
                     /locus_tag="KLLA0_E03895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999347.1"
                     /db_xref="GeneID:9487517"
     CDS             complement(join(355734..356151,356230..356234))
                     /locus_tag="KLLA0_E03895g"
                     /note="similar to uniprot|Q06HN0 Saccharomyces cerevisiae
                     YPR153W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999393.1"
                     /db_xref="GeneID:9487517"
                     /db_xref="UniProtKB/TrEMBL:B4UNA1"
                     /translation="MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWR
                     FTIFWTMILFAIVYGTTGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIA
                     IIYKAGLFAMSTWIPLCCAVVQILFNVSTSYSMTSPII"
     gene            complement(<356540..>357289)
                     /locus_tag="KLLA0_E03917g"
                     /db_xref="GeneID:2893875"
     mRNA            complement(<356540..>357289)
                     /locus_tag="KLLA0_E03917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454120.1"
                     /db_xref="GeneID:2893875"
     CDS             complement(356540..357289)
                     /locus_tag="KLLA0_E03917g"
                     /note="highly similar to uniprot|P23638 Saccharomyces
                     cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
                     the only nonessential 20S subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454120.1"
                     /db_xref="GeneID:2893875"
                     /db_xref="GOA:Q6CPL9"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL9"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGI
                     VLAAERKVTSKLLEQDTSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTY
                     NEEIPVEMLVRRLSDLKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGW
                     KAISVGANTQAAQTLLQMDYKDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISK
                     DAEGKIYQKIYKPTEIATLLEKTEIVKKDDD"
     gene            <357695..>359002
                     /locus_tag="KLLA0_E03939g"
                     /db_xref="GeneID:2893670"
     mRNA            <357695..>359002
                     /locus_tag="KLLA0_E03939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454121.1"
                     /db_xref="GeneID:2893670"
     CDS             357695..359002
                     /locus_tag="KLLA0_E03939g"
                     /note="similar to uniprot|Q06525 Saccharomyces cerevisiae
                     YPR152C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454121.1"
                     /db_xref="GeneID:2893670"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL8"
                     /translation="MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRV
                     PVFCLPLRNYWNLVICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGV
                     ARGFNLRNDRDVYGEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNIL
                     VSGYSSSSDDSGEESEVEEKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPY
                     STWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEE
                     DSDVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFA
                     SKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISEKLSQLMLEETPSDSFKLETQLLQL
                     ENALLILDNLQNSYMQNEIMYYILGIKDKLAALKEILRDQYSK"
     gene            complement(<358995..>362393)
                     /locus_tag="KLLA0_E03961g"
                     /db_xref="GeneID:2893673"
     mRNA            complement(<358995..>362393)
                     /locus_tag="KLLA0_E03961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454122.1"
                     /db_xref="GeneID:2893673"
     CDS             complement(358995..362393)
                     /locus_tag="KLLA0_E03961g"
                     /note="weakly similar to uniprot|P53280 Saccharomyces
                     cerevisiae YGR134W CAF130 Part of the
                     evolutionarily-conserved CCR4-NOT transcriptional
                     regulatory complex involved in controlling mRNA initiation
                     elongation and degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454122.1"
                     /db_xref="GeneID:2893673"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL7"
                     /translation="MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQL
                     INDAKRTNDVDGVECLIRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERY
                     SDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLDYLHNAKPLIESVLKKLDGSQFLQCL
                     MKYNRLYEFNGSYQWFTPPQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKT
                     GDIRLNSLESYGKNSGHNNPPLSKQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAE
                     QFNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVKLIPNYQKVWKIHLSAN
                     LETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIA
                     GLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIV
                     SAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYF
                     AALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTS
                     TKNELEQKNRFRMLRGLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQI
                     NEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYM
                     DDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITATS
                     AEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLI
                     YHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAI
                     EFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEE
                     FFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEAC
                     SMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTS
                     IENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDH
                     ILPLDIRTHQSLHREFLAVFDIDYLDILEARQQEAEEECDEMSI"
     gene            <363400..>363975
                     /locus_tag="KLLA0_E03983g"
                     /db_xref="GeneID:2893675"
     mRNA            <363400..>363975
                     /locus_tag="KLLA0_E03983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454123.1"
                     /db_xref="GeneID:2893675"
     CDS             363400..363975
                     /locus_tag="KLLA0_E03983g"
                     /note="similar to gnl|GLV|CAGL0L08426g Candida glabrata
                     CAGL0L08426g and weakly similar to YPR151C uniprot|Q06524
                     Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
                     protein required for degradation of unstable forms of
                     cytochrome c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454123.1"
                     /db_xref="GeneID:2893675"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL6"
                     /translation="MPFPKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSP
                     LRDNPLFQAKVKELEVEREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGT
                     WRYNPRIPNKLLQSALWSSSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQDKKMTLKF
                     PPKQTDELSDEKSVDQYEEVVQEYLQQWKLK"
     gene            complement(<364475..>364888)
                     /locus_tag="KLLA0_E04005g"
                     /db_xref="GeneID:2893677"
     mRNA            complement(<364475..>364888)
                     /locus_tag="KLLA0_E04005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454124.1"
                     /db_xref="GeneID:2893677"
     CDS             complement(364475..364888)
                     /locus_tag="KLLA0_E04005g"
                     /note="weakly similar to uniprot|P40185 Saccharomyces
                     cerevisiae YIL051C MMF1 Mitochondrial protein involved in
                     maintenance of the mitochondrial genome and weakly similar
                     to YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
                     HMF1 Member of the p14.5 protein family with similarity to
                     Mmf1p, functionally complements Mmf1p function when
                     targeted to mitochondria; heat shock inducible;
                     high-dosage growth inhibitor; forms a homotrimer in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454124.1"
                     /db_xref="GeneID:2893677"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL5"
                     /translation="MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVT
                     NELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPN
                     QPARSCIVVAFPNNKLKVELECIAEIPSKKRWFKL"
     gene            complement(<365119..>365595)
                     /locus_tag="KLLA0_E04027g"
                     /db_xref="GeneID:2893849"
     mRNA            complement(<365119..>365595)
                     /locus_tag="KLLA0_E04027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454125.1"
                     /db_xref="GeneID:2893849"
     CDS             complement(365119..365595)
                     /locus_tag="KLLA0_E04027g"
                     /note="similar to uniprot|P29340 Saccharomyces cerevisiae
                     YGR133W PEX4 Involved in peroxisome biogenesis Member of
                     ubiquitin-conjugating protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454125.1"
                     /db_xref="GeneID:2893849"
                     /db_xref="GOA:Q6CPL4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL4"
                     /translation="MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGP
                     SESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWT
                     PIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV"
     gene            <366535..>368304
                     /locus_tag="KLLA0_E04049g"
                     /db_xref="GeneID:2893850"
     mRNA            <366535..>368304
                     /locus_tag="KLLA0_E04049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454126.1"
                     /db_xref="GeneID:2893850"
     CDS             366535..368304
                     /locus_tag="KLLA0_E04049g"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015W BAR1 Aspartyl protease secreted into the
                     periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454126.1"
                     /db_xref="GeneID:2893850"
                     /db_xref="GOA:Q6CPL3"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL3"
                     /translation="MKLSDVCLGALLASLGSAGYITKRDVSQVGEANKKHVFMSFDKL
                     RGNDASEASLSKRRVGHLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGS
                     SDLWVPGSGNPFCSASRSSSKKKRQDYTALLSSLLSVFGTDVATDYTYTGIASATGSA
                     GTQTVPTALTSGTVAATSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYAD
                     GTFADGDWGVDEIHLDDVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNR
                     YQYDNFPIVLQRNGVIEKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNAL
                     RSIGYTEQIRLSITLQGIGVTSSYGNETVTQTKYPALLDTGATFCYFPSSLAAAIASS
                     VSATYSSSSGYYFVDCDSGSDYDLVFDFGGFHIISPLSDYIVTTSSSSQCVLGILPQS
                     DNEITLGDAFLTSAYVVYDLEELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSST
                     WSTAASLSTGGNIFTVTNNANGTVSTGTGSSGSGSSTSGNSGSTSTGSSSKKEGAASS
                     LPVPHLAALICLLLSAVSIPSLF"
     gene            <369201..>371315
                     /locus_tag="KLLA0_E04071g"
                     /db_xref="GeneID:2893846"
     mRNA            <369201..>371315
                     /locus_tag="KLLA0_E04071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454127.1"
                     /db_xref="GeneID:2893846"
     CDS             369201..371315
                     /locus_tag="KLLA0_E04071g"
                     /note="some similarities with uniprot|P22470 Saccharomyces
                     cerevisiae YDR143C SAN1 Ubiquitin-protein ligase controls
                     turnover of a specific class of unstable nuclear proteins
                     including Sir4p but not Sir2p or Sir3p san1 mutations
                     suppress sir4 spt16 and cdc68 mutations suggesting a role
                     in chromatin silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454127.1"
                     /db_xref="GeneID:2893846"
                     /db_xref="GOA:Q6CPL2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL2"
                     /translation="MSDNHDQSRDSAPDRGGSESSENGASGPSRSHFTIAINYASLSG
                     NDEQAGNDAANTAFTPMILRFADVPSDTSSGRLNEVIALASEYIFQTLTRDQRRHSGL
                     TREAFEKLEVQKVDTLDEKTCAICYDDLINDPKDFASTSSKRGREEIGSAESPNSKRQ
                     RNEEAAPLPHQEGLPENESDQRVDNELPDPESSAHHTGEQEGGQEDTPTYGHSATVLP
                     CGHVFGRECLYKWTTEHNSCPICRAPILSEEELQALHSSDDTSSRGNNGPDATQQSTF
                     ESIRRLLYERSPEPAVVNTIRENQLNTSSAESMTTGTTASNQTDGSRVTENSNTNENR
                     QQPESAQDITNDTNNQSRTFSTSFIFFLSDPNANQPTALTTPPVANTGVTPTAAATTA
                     TSPAATGERSTENQQATNPVPVNTADNNTTHAAGRTNTPVITHFNDLPEDNQRLLGNI
                     RAILRRAHEERTSTGRGNDDNNDDNNNNNTATNAENTNSQQNSHVGHDFAQTTRRFFN
                     LLPLLGRRQRGQNTNTQIPSNIQPPPANPHTDPALENRYSAYLEHLNTLRNGNRPSSE
                     ANGSRFRLPSFFRLGRNTAGHRHEGGSRTSAPLSNPQIDPLLSSNIFSSGVASYRHAN
                     GVRTVNFTGDIPEPPNQTSQTSSSNVDSTTTNSQPTSANIASHTEESSNNHAENPEIS
                     AVHTERATSDGNQNNVTDATNE"
     gene            <371642..>372760
                     /locus_tag="KLLA0_E04093g"
                     /db_xref="GeneID:2893852"
     mRNA            <371642..>372760
                     /locus_tag="KLLA0_E04093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454128.1"
                     /db_xref="GeneID:2893852"
     CDS             371642..372760
                     /locus_tag="KLLA0_E04093g"
                     /note="similar to uniprot|P39108 Saccharomyces cerevisiae
                     YDR142C PEX7 May serve as intraperoxisomal receptor for
                     type 2 peroxisomal proteins (such as thiolase) Member of
                     beta-transducin-related (WD-40) protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454128.1"
                     /db_xref="GeneID:2893852"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL1"
                     /translation="MLKYHMKGYSGYGVAYSPFYDNKLAVASGSNFGLVGNGKLIILD
                     IMPNGQLVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLKDYPIAIYKE
                     HQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAASTLSRTSAV
                     APVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLP
                     QHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEI
                     QGHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFI
                     FMEHSEFVFGADWSLWGTPGFVASTGWDGQVCIWNGIR"
     gene            complement(<372858..>373421)
                     /locus_tag="KLLA0_E04115g"
                     /db_xref="GeneID:2893911"
     mRNA            complement(<372858..>373421)
                     /locus_tag="KLLA0_E04115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454129.1"
                     /db_xref="GeneID:2893911"
     CDS             complement(372858..373421)
                     /locus_tag="KLLA0_E04115g"
                     /note="weakly similar to uniprot|Q99176 Saccharomyces
                     cerevisiae YLR119W SRN2 Component of the ESCRT-I complex
                     which is involved in ubiquitin-dependent sorting of
                     proteins into the endosome suppressor of rna1-1 mutation
                     may be involved in RNA export from nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454129.1"
                     /db_xref="GeneID:2893911"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="InterPro:IPR017435"
                     /db_xref="UniProtKB/TrEMBL:Q6CPL0"
                     /translation="MSLPELPPRPDRPKSTESLHCSDVELPQNVDLLTFNDIQQLLQQ
                     QDMPKEYAKRFNDNLVQDISNKSVAWKAQAEQLIEGLNKLAENKRHLKGELDSFKKLE
                     FEYMKKWQDLDLLINSKFSNDALKKQLRHNVINLDEKSSHMVNEVPVTDESLDLFLEQ
                     YVNERTEYHLQREKLATWEQQDTLRLP"
     gene            complement(<373677..>375335)
                     /locus_tag="KLLA0_E04137g"
                     /db_xref="GeneID:2893913"
     mRNA            complement(<373677..>375335)
                     /locus_tag="KLLA0_E04137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454130.1"
                     /db_xref="GeneID:2893913"
     CDS             complement(373677..375335)
                     /locus_tag="KLLA0_E04137g"
                     /note="similar to uniprot|P43609 Saccharomyces cerevisiae
                     YFR037C RSC8 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex essential for
                     viability and mitotic growth homolog of SWI/SNF subunit
                     Swi3p but unlike Swi3p does not activate transcription of
                     reporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454130.1"
                     /db_xref="GeneID:2893913"
                     /db_xref="GOA:Q6CPK9"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK9"
                     /translation="MSVEPPADVKTGSPADVMGSGPIFPHLQQQQQQIVIENSKIDYD
                     AEAKKLEDKASRFLAKQTHPVIIPSFAAWFDFDDIHELERRALPSFFNESSRFKTPKA
                     YKDVRNFMINTYRLSPYEYLTVTAIRRNIAMDVASVLKIHQFLEKWGLINYQIDPRSK
                     PSLVGPSFTGHFQVVLDTPQGLKPFVPPEVTEAETTPVGSTPAVADDAANATAESADD
                     NKEEKKLEFKRPEPFPVNLSLRKNVYDTIHDFNALRQLNLQARQINKQYVCFSCGNDA
                     TTIRYHNLRSKNVNICSRCFQEGHFGANFHSSDFIKLTENSTVSNSSWTDQELLLLLE
                     GLEMYEDKWDKIVDHVGGTKTLEMCIEKFLSLPIEDKYINEILPTQGSVKHNREKPIR
                     TTDAIDATIKSLLDGLNDKVLHEDVPKSAERISKKYIEESQVVVQDLVENTLDKLDFK
                     FQKLDQLEKSMKAEREIYLKETERLVNERLKLTKQIKDINSHLAELQITKRIVLSSDQ
                     KSETDISLMEKADVEGETELKKNDEIDIQSISKSEPQLYTKWSL"
     gene            <375999..>378479
                     /locus_tag="KLLA0_E04159g"
                     /db_xref="GeneID:2893915"
     mRNA            <375999..>378479
                     /locus_tag="KLLA0_E04159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454131.1"
                     /db_xref="GeneID:2893915"
     CDS             375999..378479
                     /locus_tag="KLLA0_E04159g"
                     /note="similar to uniprot|P43610 Saccharomyces cerevisiae
                     YFR038W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454131.1"
                     /db_xref="GeneID:2893915"
                     /db_xref="GOA:Q6CPK8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK8"
                     /translation="MAMDIIQMMKRGSGARAKPVASYKEKSENDLTADVYLDSDSDTD
                     VKDTTDEPIWLDGKGPDEDDDTLLDSDDSDGSDEELDGLIDEKSAGRKASSEDAAKNE
                     DSDENFENDSHTISLKIKKLQEFVQQSQVYSSIIADTLLERAGQNDEDETPQKKKQKK
                     EAIQTLMKRDEPKDEGSPSTSLSSSFMQPSFLKNCQLKPYQKEGLNWLITLYENGLNG
                     ILADEMGLGKTIQSIALLAFIYEMDTKGPFLIAAPLSTVENWMNEFARFAPDIPVLKY
                     YNSEGQAARHAMMGKFFKNNKGEGVIITSYEIIIRDIELILSYQWKFLIVDEGHRLKN
                     INCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFEIFNKWFDFSD
                     LNLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPKREYIITCP
                     VTPLQKKYYKQALKGNLKQTIQKQAIKDFFTLNAEYIGTVSNKSIRDFIEWKLSADSQ
                     DIPNDNIGKMEKLYDMHIHKELLNKRLQNMMIQLRQIVNSTYLFYFPLLEPTDLTLEN
                     LLKTSGKLQVLQKLVPELIKKKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSMQN
                     NSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRA
                     HRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVIQMGKFNTLKKLAFNEQTFL
                     KMNGSSLATTTKQSANKELVKELSQLLISNETNQGQADTSKIENSDDILEESEMKELL
                     DRSPPAYIPHETQFNHIRLFETTTGFDN"
     gene            <378888..>380288
                     /locus_tag="KLLA0_E04181g"
                     /db_xref="GeneID:2893813"
     mRNA            <378888..>380288
                     /locus_tag="KLLA0_E04181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454132.1"
                     /db_xref="GeneID:2893813"
     CDS             378888..380288
                     /locus_tag="KLLA0_E04181g"
                     /note="similar to uniprot|P07278 YIL033C Saccharomyces
                     cerevisiae BCY1 Regulatory subunit of the cyclic
                     AMP-dependent protein kinase (PKA)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454132.1"
                     /db_xref="GeneID:2893813"
                     /db_xref="GOA:Q6CPK7"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /translation="MATYQTELDLFKNEVEQKQPNDFLQFAANYFTKRLEQQRTFVRN
                     QESLALSKGIVLFPSTSKHDSVAASSASLSHGSSKANASQSGISSSGVDEDVLFKSPF
                     VDRGPHSTHIVDHLDSTHSNTTASPAKASGGDAPGIFKGNFNVGTESQRKVNSSVDPM
                     APEPTATTHSFPRRSVVNPKPLPINFNAQRRTSVSGETLQPDHLDDWKPENFQEKSPE
                     QVSRLEKAVGKNFLFNKLDSDSKKLVINSLEEKSIPQGKEIIKQGDEGDYFYIVEDGT
                     VEFYVNNQKVNTSGPGSSFGELALMYNSPRAATVIASTDCILWALDRLTFRRILLGGS
                     FKKRILYDDLLKNIPILKSLSTYDRAKLADALDTEYYEAGQTIIKEGDTGENFYFIEY
                     GEADVSQEGKGVITKLGKGDYFGEVALLNDLPRQATVTATARTKVATLGKSGFQRLLG
                     PVVDVLKLNDPTRSKH"
     gene            complement(<380555..>381004)
                     /locus_tag="KLLA0_E04203g"
                     /db_xref="GeneID:2893814"
     mRNA            complement(<380555..>381004)
                     /locus_tag="KLLA0_E04203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454133.1"
                     /db_xref="GeneID:2893814"
     CDS             complement(380555..381004)
                     /locus_tag="KLLA0_E04203g"
                     /note="highly similar to uniprot|P40030 Saccharomyces
                     cerevisiae YER044C ERG28 Endoplasmic reticulum membrane
                     protein may facilitate protein-protein interactions
                     between the Erg26p dehydrogenase and the Erg27p 3-
                     ketoreductase and/or tether these enzymes to the ER also
                     interacts with Erg6p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454133.1"
                     /db_xref="GeneID:2893814"
                     /db_xref="GOA:Q6CPK6"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK6"
                     /translation="MLSFTEVSECVQKSLASLAPGYLSKWLLFISVVSIFNSVQTYIN
                     IDLTRRVYENKPNETTPLSARTFGTWTLVSCIIRLYGALYLTENHVYQLTFISYVIAL
                     LHFGSELLIFRTCKLGTGFLGPLVVSTTSLVWMYCQKEFYTGIPFPF"
     gene            <381615..>382454
                     /locus_tag="KLLA0_E04225g"
                     /db_xref="GeneID:2893811"
     mRNA            <381615..>382454
                     /locus_tag="KLLA0_E04225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454134.1"
                     /db_xref="GeneID:2893811"
     CDS             381615..382454
                     /locus_tag="KLLA0_E04225g"
                     /note="similar to uniprot|P13517 Saccharomyces cerevisiae
                     YIL034C CAP2 Beta subunit of the capping protein (CP)
                     heterodimer (Cap1p and Cap2p) which binds to the barbed
                     ends of actin filaments preventing further polymerization
                     localized predominantly to cortical actin patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454134.1"
                     /db_xref="GeneID:2893811"
                     /db_xref="GOA:Q6CPK5"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /translation="MSVDEKYDAACELLYRLDPTKVKTHLQNLIALEPEIAEGLLSSI
                     DIPLTIKKDTDANNKEFLCCDYNRDIDSHRSPWSNQYFPELSAEDLKESPFPSEPLRE
                     LEVACNNSFELYRDLYYEGGYTSTYLWDVDESTDFAGVILFKKAESDDSKWDSIHVIS
                     ATHDEEGMEVTYNVTTTVILHLENLSKEQQLSLSGNLTRENSKTVKLQNVSTVEQLVP
                     AHSSSLGSMIEDIESKLRSMLEIVYFEKTLDIYNVLRERNDDSTKLQKEQHSELIENF
                     QKL"
     gene            <382874..>383995
                     /locus_tag="KLLA0_E04247g"
                     /db_xref="GeneID:2893816"
     mRNA            <382874..>383995
                     /locus_tag="KLLA0_E04247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454135.1"
                     /db_xref="GeneID:2893816"
     CDS             382874..383995
                     /locus_tag="KLLA0_E04247g"
                     /note="similar to uniprot|P15790 Saccharomyces cerevisiae
                     YIL035C CKA1 alpha subunit of protein kinase CK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454135.1"
                     /db_xref="GeneID:2893816"
                     /db_xref="GOA:Q6CPK4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK4"
                     /translation="MKSKVWSEARVYSDANEIRGQRYWDYENTSIEWKANNSQYEVEC
                     KVGRGKYSEVFQGVQLSTRNKIVIKMLKPVKKKKIKREITILANLSNEKNPPTAQPYD
                     EAKYYTNRREEVLKYARDKVYDLPHNGHENIITLLDVVRDPISKTPALIFEHIDNTEF
                     RRLYASFSDLDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQHKLRLIDWGLA
                     EFYHPSMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGAMLASMVFLKEPFFYGSS
                     NTDQLVKIVRVLGSDDFERYLQKYQITLPDEFIDMDQYIRRPWQKFVNDSNKHLCGND
                     DIIDLIDNLLRYDHQERFSCKEAMAHPWFAPIRNNEYTL"
     gene            complement(<386095..>387441)
                     /locus_tag="KLLA0_E04269g"
                     /db_xref="GeneID:2893823"
     mRNA            complement(<386095..>387441)
                     /locus_tag="KLLA0_E04269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454137.1"
                     /db_xref="GeneID:2893823"
     CDS             complement(386095..387441)
                     /locus_tag="KLLA0_E04269g"
                     /note="weakly similar to uniprot|P40535 Saccharomyces
                     cerevisiae YIL036W CST6 Basic leucine zipper (bZIP)
                     transcription factor of the ATF/CREB family activates
                     transcription of genes involved in utilization of
                     non-optimal carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454137.1"
                     /db_xref="GeneID:2893823"
                     /db_xref="GOA:Q6CPK2"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK2"
                     /translation="MEADGSESLIKSEMDSGRNMNNSNNNALGAVGVSIPFPEDLLGV
                     PQDSLNGAGAGPASQGVPNYPQAGIPGAAPSSSGVSPATGNVNANGHRDSSGQTPVQG
                     GQISQNVNYHPAGIQGSAAELNFGNGPSLAEETSKYIHSRMANQNFAMFPSYMQTHSL
                     MDPSIQESLSPFFQPFGVDASHFPMTNPPIFQSALATDSFNPRRRRISISNGQIGQLG
                     EDEDNVESIYYSQPPPMPPLRPNQMQNNNTRVKVEINGEDSLGLNQNNGSDNNKQSST
                     NLFPSRLSFQELQEESKVLDNVIDPSNPRVSNGGNQRQSVAMSKQMSETSSIKSSNSA
                     MSTEKHVLPGTAAWKRARLLERNRIAASKCRQRKKIAQEQLQKDATVLRNSNRIMKTK
                     LEYYQKLVSKFKRYIELHMQSCGGNNDGLTIIEDMLKIDHDLHQDEHGNLVNSNKN"
     gene            <388682..>389479
                     /locus_tag="KLLA0_E04291g"
                     /db_xref="GeneID:2893821"
     mRNA            <388682..>389479
                     /locus_tag="KLLA0_E04291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454138.1"
                     /db_xref="GeneID:2893821"
     CDS             388682..389479
                     /locus_tag="KLLA0_E04291g"
                     /note="some similarities with uniprot|P40031 Saccharomyces
                     cerevisiae YER046W SPO73 Meiosis-specific protein of
                     unknown function required for spore wall formation during
                     sporulation dispensible for both nuclear divisions during
                     meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454138.1"
                     /db_xref="GeneID:2893821"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK1"
                     /translation="MPDAIDQERVAEHQRGVCLFGYPFFSEKLLIPGIDPSRFLALIG
                     NDQDGFKALPVMYTHGNQGNSNSKNLRKMIPLPLEETRSGTVSEHASRSRERSNGCAD
                     HVYRSNEEENWYVMMDNELADVDDQGWMYSWSFKAKHWKGKYGFVRKRVWVRLPSATP
                     DLIRLGDLGSRHRVEKKATEVTGDSSSEDNWWDATDDLIMLLSQLRNCKLDRERFQFI
                     DGVFHNLSKDDLVKLSTEPILSRVLGTFQFETSKEKFRNELKARISS"
     gene            <389694..>391448
                     /locus_tag="KLLA0_E04313g"
                     /db_xref="GeneID:2893825"
     mRNA            <389694..>391448
                     /locus_tag="KLLA0_E04313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454139.1"
                     /db_xref="GeneID:2893825"
     CDS             389694..391448
                     /locus_tag="KLLA0_E04313g"
                     /note="weakly similar to uniprot|P40534 Saccharomyces
                     cerevisiae YIL037C Pheromone-regulated protein, predicted
                     to have 4 transmembrane segments and a coiled coil domain;
                     regulated by Ste12p, PRM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454139.1"
                     /db_xref="GeneID:2893825"
                     /db_xref="UniProtKB/TrEMBL:Q6CPK0"
                     /translation="MKFLLEPISLKVKILRSLTNPILLFPTLTILFLIWFMNAVNSFA
                     ETVAENGYSTTITVTKTLLSTATTTATTTSLINAPTSTAIDNTSNLSNLKEYLNSCIN
                     STLELNSRLVNVDITKRLTPLAKSNIQNWQTSFYNTKVLLNNTRTQFLKLNDSVLTDL
                     DEQSDRLNAAVTTLTDLGLIVASSADEDNALQNIYLDFSNVTEEFSWFEGLLNSSSAD
                     TISLSSPNVSFETFDLHTTAYSDSVALLISNISSSLGHATAAEKKLSLKKRQVSEESS
                     KFVKLTIIFLCIYPMQVIGWVILEWFSHAIRRDMILGTLDCQLLEMEDKKTTLQRYDD
                     WKPRLSKLCESVQNPFTVQSATALLKIGDHMWLRRKQNSDYPTDVQCNRTTAKKVGKL
                     TWWFYNSCAYQLYFLLLILMTWVVISSTIPASYSTSLSKRAVELSSSATYIPTNSIGK
                     LCESFDTEINTNIEELVRNFYNTSINQSLEKYNDKMTALVTKLPSSISEYVQWDNFTG
                     TEFNTIVPFNSSAVVSTYLGLSDPYDASSTDADASLFKREQTAEFDLKFALNKLFRNS
                     IIIWACIHLFQLVICIIF"
     gene            <391816..>394092
                     /locus_tag="KLLA0_E04335g"
                     /db_xref="GeneID:2893826"
     mRNA            <391816..>394092
                     /locus_tag="KLLA0_E04335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454140.1"
                     /db_xref="GeneID:2893826"
     CDS             391816..394092
                     /locus_tag="KLLA0_E04335g"
                     /note="similar to uniprot|Q75AN0 Ashbya gossypii ADL108C
                     ADL108Cp and some similarites with YIL038C uniprot|P06102
                     Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
                     CCR4-NOT complex which is a global transcriptional
                     regulator with roles in transcription initiation and
                     elongation and in mRNA degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454140.1"
                     /db_xref="GeneID:2893826"
                     /db_xref="GOA:Q6CPJ9"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ9"
                     /translation="MAHRKLQQEIDRVFKKVNEGLEIFDMYYERHENCVNNPSQKDKL
                     ESDLKREVKKLQRLREQIKSWQSSPEVKDKDSLLNHRRSVEVAMEKYKAVEKASKEKA
                     YSNISLKRSDVLDPLEKERRDVEEFLSNQIEELERQFDLLQIDVDRLILLQKKRKTAT
                     PENEKELQRFKDLQGRYRYHQQQMELALRLIANEELEPQQVRDIEEEILFYVEENQTE
                     GFVEDDSIYEGLDLQSNEAIAHEVAAAFASRAAGDASGDDNESKDGKLSKKELRRLER
                     EAKKNAKAAAKTTALDENPTPVITGKKLPDLANEMQEADSQDSITIPETPTPPPSKSV
                     SPSPPVTAGSANVPLTTANTTAPSKPHTPLAKSAHLSSNPTSQASLSPDSQPHGFTHI
                     HQSLNGLTTTTLKPAPVKPISENKWALATEKKLASLKAKSLASAPVTTKVSLTPTNML
                     PGASTVALPMVSKPLEPTLSISNSIKIIPQELQGNNTVKQHTGDATEPDLILDDYDAE
                     STDDELENEPTPEIFTAEQISSRLTLSNEVQDSLYSDLELLTLPAGIKDFVMGSVISK
                     NKLYPNDGKLGGYRRYYDICQPCRLNEIPSGVFPPQPLDVARCTQQWDQVILSLNIDG
                     LTVETVPKEFENLETFTLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLRQGA
                     VKFSNDQCEVADYKIFKMDIWTVVDKLNFKLDYSLLADVASLGQVDHADHADSSVNLP
                     TFGKQLLQTLKHGKVEQQ"
     gene            complement(<394269..>395390)
                     /locus_tag="KLLA0_E04357g"
                     /db_xref="GeneID:2893837"
     mRNA            complement(<394269..>395390)
                     /locus_tag="KLLA0_E04357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454141.1"
                     /db_xref="GeneID:2893837"
     CDS             complement(394269..395390)
                     /locus_tag="KLLA0_E04357g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454141.1"
                     /db_xref="GeneID:2893837"
                     /db_xref="GOA:Q6CPJ8"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ8"
                     /translation="MPVTVLPLENTPLGAKIQLPDGCSDPSELSEEDFKDLYDALMTY
                     SVVVIPGMEDLKPESQWRLTTMFDPTCDQTGKSYGHGKEFRHQNSVLRRDGMTIPDQP
                     QVQVLGQGQWPAGHYGMGELNLRHPTHFDFHDKPLTDQEAFEEDKTRFYRWHIDSALY
                     ALSPPVVTTLLGIHVPPESRKQKIHYDDTGDVLEVTQGATSFVSGANAFDLLSEEDQQ
                     RALKTTVVYAPHPYIFISPARATSDGLTMVSDGKEMKFEDLPPWEESKIKRLPLVWTN
                     PVTKKHHLQVHGCCIHQLELPDGTVLDLEDARKEVYRMMRPAISPDQVYAHAWDKGDL
                     VIFHNRGVWHSVTGQFKEGEKRLMHQCNIASGIDPVTVL"
     gene            complement(<396027..>398216)
                     /locus_tag="KLLA0_E04379g"
                     /db_xref="GeneID:2893635"
     mRNA            complement(<396027..>398216)
                     /locus_tag="KLLA0_E04379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454142.1"
                     /db_xref="GeneID:2893635"
     CDS             complement(396027..398216)
                     /locus_tag="KLLA0_E04379g"
                     /note="similar to uniprot|P39955 Saccharomyces cerevisiae
                     YER047C SAP1 Putative ATPase of the AAA family interacts
                     with the Sin1p transcriptional repressor in the two-hybrid
                     system"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454142.1"
                     /db_xref="GeneID:2893635"
                     /db_xref="GOA:Q6CPJ7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ7"
                     /translation="MDNHGLLMKFSRIRKKPQQPLNSLAELYSRIANETIHYLGLEQR
                     HEYKAAIQGWKLMATDAMYKLNNIDRQYPNFASYTEEELNLQTGIRELCDKAMKNVER
                     VQLLCEDVPKPDNNSGKTFSIGNGGKFKVHTLRDGMYKMRYNKSGSGLGLKNDKNVQT
                     ANPVNFSASKSLPAVIPQDPFEDFDNEVNLIDLTDAETVPYDPSPLPTFSISSDPKQE
                     PYTDYLNISEEDMTRLKTLDKLNGTADAFSLLSVDTAEAQRPSPRRPSPPPVPPQRKP
                     SAKQKTTTSDTNVDAALKSSPPTQPKQQRPVQRRNTSISAAVAASQPQLKAKAVKRPV
                     VTAKKSIQNGNSTSKLKKPISKSSPSLINTVVRTTSQTKTRVNPTSVAATTKTSAIST
                     NPTITKPAPQSLDEVTQTKEQLEDELIESLPGVDKTAAKQIFSEIVVHGDEVYWDDIA
                     GLETAKNSLKEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESKSTF
                     FSISASSLTSKYLGESEKLVRALFAVAKKLSPSIIFVDEIDSIMGSRNNESENESSRR
                     IKNEFLVQWSSLSSAAAGKDSKDTDDRVLVLAATNLPWSIDEAARRRFVRRQYIPLPE
                     ATTRKVQLKRLLLNQRHTLTDEEFEELVLLTDGYSGSDITSLAKDAAMGPLRELGDEL
                     LFTETDSIRSVNLEDFRNSLKYIKPSVSKDGLNRYEEWAASFGSSGV"
     gene            complement(<398654..>400030)
                     /locus_tag="KLLA0_E04401g"
                     /db_xref="GeneID:2893625"
     mRNA            complement(<398654..>400030)
                     /locus_tag="KLLA0_E04401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454144.1"
                     /db_xref="GeneID:2893625"
     CDS             complement(398654..400030)
                     /locus_tag="KLLA0_E04401g"
                     /note="similar to uniprot|P40533 Saccharomyces cerevisiae
                     YIL039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454144.1"
                     /db_xref="GeneID:2893625"
                     /db_xref="GOA:Q6CPJ5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ5"
                     /translation="MALPKAIKKFTLLLTAIALIFNVYIYTYPSLNPKQCSWRCFEQD
                     AKQGQSNLIFSYFNDILHSHDDKNPNDVKLMALGDPQIKGIWANTPYISRLDTFGNDY
                     YLGHIFRTMYNRLKPSHVVVMGDLFSSQWIGDSEFFNRTVRYTKRLFNRDVKWLYDLQ
                     EEHHGDDGTYKVNWVEWADNLNKIRTGDRPMNFSFGYQDIYNWTSAENYLFINVSGNH
                     DIGYSGDATYQHMARYRELLGKDNYWIEYNAGTDNAWRIIVLNDLLLEGPALQPELLE
                     TNWEFLYQLFERKFEGSTVLLTHIPFYKPSGLCYDGPEFRYYPEDYQREPYKSKLLRS
                     QNHLSAEASNRVLNLIFDAEKPGIILTGHDHEGCETVYNKDDKGNWTASKTTDPKNLN
                     IKEITVRSMMGEYHGNTGLVTGHFNEATRQWEWSFNLCPFSIQHIWWFTKVVTIITGF
                     LWSSAFFF"
     gene            complement(<400495..>401781)
                     /locus_tag="KLLA0_E04423g"
                     /db_xref="GeneID:2894063"
     mRNA            complement(<400495..>401781)
                     /locus_tag="KLLA0_E04423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454145.1"
                     /db_xref="GeneID:2894063"
     CDS             complement(400495..401781)
                     /locus_tag="KLLA0_E04423g"
                     /note="similar to uniprot|P39101 YER048C Saccharomyces
                     cerevisiae CAJ1 Nuclear type II J heat shock protein of
                     the E. coli dnaJ family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454145.1"
                     /db_xref="GeneID:2894063"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ4"
                     /translation="MVKDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQA
                     QTKFQELAKAYQVLIDDDLRKKYDQFGLDETNGEIPMDQDPYEMLMTVFGGDSFTSWI
                     GEYGLLKNFLNESEMFQDEDEEGEEEGGTANGKDKNKSETSDSDKNESTELSKHNGKK
                     AAAEKDAAREKARARREKMREFETKRLEDQRIQVEMLVSNLNKKYEEYTISKKSGSES
                     DFLNKLQKEIDDNLKYESFGLELLQLIASVYKRKAKNFIMSKKTKGLSKIFTGTREKG
                     KTVASMYKTVSAAMDAMKTQQLTEDIDWDAMDPFQRANVETQIQGKSMGLFWALNKFE
                     LEQKLKMVVDKLLDDKSIPSKERINKANFLIMISDKFNSATRNPEDMDPVILEFEELV
                     TNAKNIKVDAPLKTKVGEKGQIESAADHSTTAEVAK"
     gene            complement(<402193..>402642)
                     /locus_tag="KLLA0_E04445g"
                     /db_xref="GeneID:2894066"
     mRNA            complement(<402193..>402642)
                     /locus_tag="KLLA0_E04445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454146.1"
                     /db_xref="GeneID:2894066"
     CDS             complement(402193..402642)
                     /locus_tag="KLLA0_E04445g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454146.1"
                     /db_xref="GeneID:2894066"
                     /db_xref="InterPro:IPR024316"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ3"
                     /translation="MNSYQEYQRLQHLLSDPKYQPYVNLAKKLTYYASYYLIWALQTV
                     HSLVSRYPQVSDWLGYLFSLYMAYLTIKRAIRVVKSSSYVILVVFGLYVWQRGVSQVI
                     LMDLPYLADRLKQYVHNLPRDAHGNGSFLKDVYAPFYDLYNSLQALF"
     gene            <403312..>403587
                     /locus_tag="KLLA0_E04467g"
                     /db_xref="GeneID:2894067"
     mRNA            <403312..>403587
                     /locus_tag="KLLA0_E04467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454147.1"
                     /db_xref="GeneID:2894067"
     CDS             403312..403587
                     /locus_tag="KLLA0_E04467g"
                     /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
                     YER048W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454147.1"
                     /db_xref="GeneID:2894067"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ2"
                     /translation="MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRA
                     NKNVENPEKISELLSEAEKDLGVLKRQSVISNMYTFDKLVVEPLKKR"
     gene            <404611..>406413
                     /locus_tag="KLLA0_E04489g"
                     /db_xref="GeneID:2894068"
     mRNA            <404611..>406413
                     /locus_tag="KLLA0_E04489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454148.1"
                     /db_xref="GeneID:2894068"
     CDS             404611..406413
                     /locus_tag="KLLA0_E04489g"
                     /note="similar to uniprot|P40032 Saccharomyces cerevisiae
                     YER049W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454148.1"
                     /db_xref="GeneID:2894068"
                     /db_xref="GOA:Q6CPJ1"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ1"
                     /translation="MTVVESKRPAEETALGSDEKVRLLESSKAVGSFNSKIWDKSFQD
                     DLRQEIKNAQPYNWGTIRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANL
                     SGLDDADLSKLPSLVKLRELLYSEKYRDFIAYVTQSGKLSGSKTDISINTYTKGCHLL
                     THDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLFPSIVPNVPFSDHSAKLVPQFNQI
                     AFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIPQEGEPGYTPGEEEEWIKTNISTLSQ
                     LVNSPLQDYEFPKIDRTPLSHYESGKLDRTDDLLTEDDITFLSKFLNPEHLTTESMRK
                     ISDKFVEDSFINIESFLNDEYSSLLKKLIMDKEFNYDCPYESVNVRHPWKTSLPPHKW
                     RYLYIDGKSYTNFRNEEDIKKALNNPELPNFHQLLSSFADKEEFNCEAKLCELAIFLQ
                     SISFKKWIVQLTKLVILSEQLLIRRFRPGKDFTLATTTEVNELLKTIPGFVEAILECT
                     LCLTPSKGWDSGEVGGYELYMNNQDDDEDDDAAIYRADDDGDSVLINKPASWNSLNLV
                     LRDENVLQFIKYVSWAAKSSRWDISLQWDVKSEE"
     gene            complement(<406764..>407672)
                     /locus_tag="KLLA0_E04511g"
                     /db_xref="GeneID:2894072"
     mRNA            complement(<406764..>407672)
                     /locus_tag="KLLA0_E04511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454149.1"
                     /db_xref="GeneID:2894072"
     CDS             complement(406764..407672)
                     /locus_tag="KLLA0_E04511g"
                     /note="similar to uniprot|P40531 Saccharomyces cerevisiae
                     YIL041W GVP36 Golgi-vesicle protein of unknown function
                     green fluorescent protein (GFP)-fusion protein localizes
                     to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454149.1"
                     /db_xref="GeneID:2894072"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6CPJ0"
                     /translation="MSQYFDSFSKKVQELSTSVSQKAQEAQLDQKFKDLKTNLPLLAN
                     STQRMLQEKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNV
                     KESVDEFSKLVGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHV
                     EDESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQ
                     KRLQYDVVRSNRLKNTKPEKQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSAN
                     LHELVAAQLAYHKSSAEILEELVNEV"
     gene            <408415..>409680
                     /locus_tag="KLLA0_E04533g"
                     /db_xref="GeneID:2894070"
     mRNA            <408415..>409680
                     /locus_tag="KLLA0_E04533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454150.1"
                     /db_xref="GeneID:2894070"
     CDS             408415..409680
                     /locus_tag="KLLA0_E04533g"
                     /note="similar to uniprot|P40530 Saccharomyces cerevisiae
                     YIL042C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454150.1"
                     /db_xref="GeneID:2894070"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI9"
                     /translation="MTVCGILRKQASITARNRCRFFSVHRSPLFNTHIKNDEKTVSSH
                     NRLHRRNNHRKRSKEMTELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQYRGPL
                     QDNEKYFLTIKTLNLLLTLTCHRLASLQELPYIALVNPNIEQSNRLYLKTLESLLSIE
                     YPYDLYDTDKIQNLTEEFLNDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRIL
                     MKLLTTNYLKLLEQTSSDEVIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIM
                     EGSDVKFSYIPTDLEYVLQELLKNSSRAHIENNVDKDVEVTIVKNDDQLEIRIRDFGG
                     GIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLELFN
                     GTLDIQSLWGWGTDVYIRLHGPSDRLFDK"
     gene            complement(<409814..>410281)
                     /locus_tag="KLLA0_E04555g"
                     /db_xref="GeneID:2894074"
     mRNA            complement(<409814..>410281)
                     /locus_tag="KLLA0_E04555g"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_454151.1"
                     /db_xref="GeneID:2894074"
     CDS             complement(409814..410281)
                     /locus_tag="KLLA0_E04555g"
                     /note="some similarities with uniprot|P40033 Saccharomyces
                     cerevisiae YER050C"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_454151.1"
                     /db_xref="GeneID:2894074"
                     /db_xref="GOA:Q6CPI8"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI8"
                     /translation="MFSRSCARFFSTTRYVCNSLDQKLLKEGMSEANSKPTIKKLESK
                     LIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFNKLKINPLDLYTNPEFLSRFV
                     TSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDISVLPQRTANRS"
     gene            complement(<410511..>410897)
                     /locus_tag="KLLA0_E04577g"
                     /db_xref="GeneID:2894076"
     mRNA            complement(<410511..>410897)
                     /locus_tag="KLLA0_E04577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454152.1"
                     /db_xref="GeneID:2894076"
     CDS             complement(410511..410897)
                     /locus_tag="KLLA0_E04577g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454152.1"
                     /db_xref="GeneID:2894076"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI7"
                     /translation="MGDFYVRQQRASAPLIKDPLLLQVTDNESQLASMLAHEISHVTK
                     RNAPLTWVGTRLHFAGYNQPDCRHSSAQRYRRRYPANGSSVLARSKNRRPIASACRCW
                     SAPGLIHRDARLPARAFRSIALHLQG"
     gene            complement(<411182..>411559)
                     /locus_tag="KLLA0_E04599g"
                     /db_xref="GeneID:2894078"
     mRNA            complement(<411182..>411559)
                     /locus_tag="KLLA0_E04599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454153.1"
                     /db_xref="GeneID:2894078"
     CDS             complement(411182..411559)
                     /locus_tag="KLLA0_E04599g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454153.1"
                     /db_xref="GeneID:2894078"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI6"
                     /translation="MINKDKIVDGVVFKDEDDPEETVVFNFHTWVEMLKAIIVKYANK
                     KEDEAELMVLSSSLVCKPIDSYLAVCLRSHELEYHWAMLIAYGEQFWLKGVSSKQPDD
                     YLILDESYRKDHNLAEESFVFND"
     gene            <412009..>413178
                     /locus_tag="KLLA0_E04621g"
                     /db_xref="GeneID:2894079"
     mRNA            <412009..>413178
                     /locus_tag="KLLA0_E04621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454154.1"
                     /db_xref="GeneID:2894079"
     CDS             412009..413178
                     /locus_tag="KLLA0_E04621g"
                     /note="some similarites with uniprot|Q06523 Saccharomyces
                     cerevisiae YPR148C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454154.1"
                     /db_xref="GeneID:2894079"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI5"
                     /translation="MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSIL
                     KRRHQLQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNL
                     TESFNDWWSGNKDSIFSFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILK
                     QLKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTK
                     CQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL
                     KLQEKEVVASSEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVS
                     ATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSEDK"
     gene            complement(<413277..>413942)
                     /locus_tag="KLLA0_E04643g"
                     /db_xref="GeneID:2894082"
     mRNA            complement(<413277..>413942)
                     /locus_tag="KLLA0_E04643g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454155.1"
                     /db_xref="GeneID:2894082"
     CDS             complement(413277..413942)
                     /locus_tag="KLLA0_E04643g"
                     /note="similar to uniprot|P53277 Saccharomyces cerevisiae
                     YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
                     involved in pre-mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454155.1"
                     /db_xref="GeneID:2894082"
                     /db_xref="GOA:Q6CPI4"
                     /db_xref="InterPro:IPR013260"
                     /translation="MNILRYLPGDRKCSPYLNATNHIVNWTQADNKYSKMNDLMEIEK
                     KLKSLRKQKVEVSIRNKKAIIAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLAN
                     YSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGK
                     VQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNS
                     EFK"
     gene            <414183..>416126
                     /locus_tag="KLLA0_E04665g"
                     /db_xref="GeneID:2894087"
     mRNA            <414183..>416126
                     /locus_tag="KLLA0_E04665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454156.1"
                     /db_xref="GeneID:2894087"
     CDS             414183..416126
                     /locus_tag="KLLA0_E04665g"
                     /note="similar to uniprot|P53276 Saccharomyces cerevisiae
                     YGR128C UTP8 Nucleolar protein required for export of
                     tRNAs from the nucleus also copurifies with the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454156.1"
                     /db_xref="GeneID:2894087"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI3"
                     /translation="MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNI
                     GISGSSISQYLINPTPKLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLH
                     LATKPMIQDAVSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYEL
                     KLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDEKICYKLFQVRSESVSCIELNS
                     IILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKP
                     VSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALD
                     VTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVKQKQKLQKLFEESNEDDDVELPS
                     PDYERIIKQLHICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNF
                     KDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNI
                     TNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQI
                     FQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNK
                     SNSSTNSSSTQPISAYTVDYLEC"
     gene            complement(<416178..>417098)
                     /locus_tag="KLLA0_E04687g"
                     /db_xref="GeneID:2894088"
     mRNA            complement(<416178..>417098)
                     /locus_tag="KLLA0_E04687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454157.1"
                     /db_xref="GeneID:2894088"
     CDS             complement(416178..417098)
                     /locus_tag="KLLA0_E04687g"
                     /note="similar to uniprot|P53275 Saccharomyces cerevisiae
                     YGR127W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454157.1"
                     /db_xref="GeneID:2894088"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI2"
                     /translation="MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPY
                     DMAIEKKGQGYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQ
                     QEDNAPFDNWDSWEKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME
                     HMVISNDIFHCAVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTF
                     NEGEDVDSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEE
                     HVIYESDEDCETYSFMDPKEVIQFQFNMES"
     gene            complement(<417351..>417851)
                     /locus_tag="KLLA0_E04709g"
                     /db_xref="GeneID:2894090"
     mRNA            complement(<417351..>417851)
                     /locus_tag="KLLA0_E04709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454158.1"
                     /db_xref="GeneID:2894090"
     CDS             complement(417351..417851)
                     /locus_tag="KLLA0_E04709g"
                     /note="weakly similar to uniprot|P53274 Saccharomyces
                     cerevisiae YGR126W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454158.1"
                     /db_xref="GeneID:2894090"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI1"
                     /translation="MVISKERSIPTITKTKHSHHSMSSLVQKQSSPLSKISTTQEVED
                     YVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGLVKVA
                     TLHQLNRLDTRVTTHSSKKSTKEKNTSCGYDNDKLQKCIERNQKEIDSYHKKSGFKKF
                     IGKLFG"
     gene            complement(<418094..>421276)
                     /locus_tag="KLLA0_E04731g"
                     /db_xref="GeneID:2894110"
     mRNA            complement(<418094..>421276)
                     /locus_tag="KLLA0_E04731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454159.1"
                     /db_xref="GeneID:2894110"
     CDS             complement(418094..421276)
                     /locus_tag="KLLA0_E04731g"
                     /note="similar to uniprot|P53273 Saccharomyces cerevisiae
                     YGR125W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454159.1"
                     /db_xref="GeneID:2894110"
                     /db_xref="GOA:Q6CPI0"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q6CPI0"
                     /translation="MSTAQNSSVSMSQSQSTAKNRKYSFQMPTTSTYLGRSYVGSFIS
                     PPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSEGSKLIHESGNLHKQTAFLSNTFDNDA
                     GNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRGRMSVDAAADIEADAHL
                     MDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTENLALLPTNSHNSMYVEYGTFD
                     EENQPATQYISLLPDGASSGGFTSQGFRSSMSHYDKARDLMLRIFQYTPAVGLGLLLN
                     ILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIE
                     ITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFF
                     PRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTL
                     ILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWY
                     DFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKELIA
                     HGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFI
                     PICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILL
                     ACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGT
                     IISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKER
                     IHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRAR
                     KLAQLKKSQNRMSKLPVNTPRNHQFVSEVRNIYTEEMEIQKLSNELKERQQFLPIFLM
                     SIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLN
                     LTHHLIQGEFYETMSPKTAYGVISNVNSDPLAVSITTDTECVLRYIDAESLADLKLTD
                     PELFTELLILVMAIHRDRFRELLGYSLISM"
     gene            complement(<423256..>424248)
                     /locus_tag="KLLA0_E04753g"
                     /db_xref="GeneID:2893903"
     mRNA            complement(<423256..>424248)
                     /locus_tag="KLLA0_E04753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454160.1"
                     /db_xref="GeneID:2893903"
     CDS             complement(423256..424248)
                     /locus_tag="KLLA0_E04753g"
                     /note="similar to uniprot|P52919 Saccharomyces cerevisiae
                     YLR457C NBP1 Component of the mitotic apparatus containing
                     a coiled-coil domain essential for the G2/M transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454160.1"
                     /db_xref="GeneID:2893903"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH9"
                     /translation="MENLKQYWNSWWYENDGRKSDKYPLKTRYRGTKTSDRYYKVQKP
                     NTTRASRLRREPEVSEYRKPNPAENGSQPSTWSKIKSLFDSNRRDITELKQAYLDYRL
                     PNTEPSNTQADIDRLVVNERFKKKLLERKYERNMLNELRRGRQPYRRNREHRPSVNSP
                     INHADEVILLRKKLDELEQRLSDAVEELVITKKKLEFVQQKNNLLEELFDDGKMETEY
                     VKSRRNITNLQNSERKPELKQLPRSPSPVLHVDPMFTSSPIRATNNILGEGSPQHVQQ
                     HDNFYEKYPRIPKTERLDNYRSSLANHEDDYQDRHAENSLSPVRVDYSKYSSGV"
     gene            <424886..>427018
                     /locus_tag="KLLA0_E04775g"
                     /db_xref="GeneID:2893904"
     mRNA            <424886..>427018
                     /locus_tag="KLLA0_E04775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454161.1"
                     /db_xref="GeneID:2893904"
     CDS             424886..427018
                     /locus_tag="KLLA0_E04775g"
                     /note="similar to uniprot|P24482 Saccharomyces cerevisiae
                     YPR175W DPB2 Second largest subunit of DNA polymerase II
                     (DNA polymerase epsilon) required for normal yeast
                     chromosomal replication expression peaks at the G1/S phase
                     boundary potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454161.1"
                     /db_xref="GeneID:2893904"
                     /db_xref="GOA:Q6CPH8"
                     /db_xref="InterPro:IPR007185"
                     /translation="MAGVVLPASIQPQLLRPLAYRILTKKFGLNIKSDGLVALAAYIG
                     TVFGLYWRQNSETTKFLEQFAIIWREQGRGLFVDELNVSQVINEIKEREKIEQDQHVE
                     KRNNLHKANNLDAFLKRPNSPTDTEITTLSQGSATSVVNPDSHSPMMLEEGSPINSDS
                     EPISEHERANGISNVDQQLDWLDYFKVIDAFNQQTFTYDHTKRQYIYVPRPKEVEKNM
                     LSIAKLKLPNVESKVSLFTTRYHIIKDKVLRNEKFQNNDIFNPLSSIIEMGKHMNESD
                     VSPLNSASYMKITQIKNLLGHDGKNFLLLGLLDQNSKGNWSLEDPSGSIELHLQQAIP
                     TKGTYYVPGCIVLVEGIYYTASNTFVVSSITHPPGEKREDTIEAIGNLDLLGAYNPSN
                     ENYVARLDKDLKIRLHYLEQELSDNKFVILGGDIYLDEMTTMDGLKKTFDKLTTDPPV
                     AIVFNGSFVSVPVHPSLNAKNVSATVSYKNNFDALATLLSNYENLINDTHMIFIPGPN
                     DPWTSMVGLGTTTMWPQKIIPSSFTQKMSRICRKVHWGSNPLRIAYLSQEIVLTRDDL
                     ANRFKRYNIVFPTVEEEKYLENAELQEQYSRNPDVSVGQLIAFKNNLPVSVLESRKLV
                     KTLLDQQHLSPFSSRIRPTVWDLDFTLQLSPLPSSIMLCDTSAPAFDVTYNGCKTINP
                     GRFIHKRAAKYIEFFPASKVLVEEELPF"
     gene            complement(<427096..>428070)
                     /locus_tag="KLLA0_E04797g"
                     /db_xref="GeneID:2894571"
     mRNA            complement(<427096..>428070)
                     /locus_tag="KLLA0_E04797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454162.1"
                     /db_xref="GeneID:2894571"
     CDS             complement(427096..428070)
                     /locus_tag="KLLA0_E04797g"
                     /note="highly similar to uniprot|P20133 Saccharomyces
                     cerevisiae YPR176C BET2 Beta subunit of Type II
                     geranylgeranyltransferase required for vesicular transport
                     between the endoplasmic reticulum and the Golgi provides a
                     membrane attachment moiety to Rab-like proteins Ypt1p and
                     Sec4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454162.1"
                     /db_xref="GeneID:2894571"
                     /db_xref="GOA:Q6CPH7"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH7"
                     /translation="MSEQQLLRDKHIDYIASLDTKKDDLEYWLSEHLRLNGVYWGLTA
                     LYLLDSIETFNKEDVIQFVLSCWDHKTGGFAAFPRHDGHLLTTLSGLQILATYNALER
                     LGSEKQEQLEKFILSNQKADGSFQGDSFGEVDTRFVYTALSCLSILHKLTKEVVEPAV
                     SYILRCYNFDGGFGLNPEAESHAAQAFTCIAALAIVGKLDSLTPAQQENIAVWLSERQ
                     VPEGGLNGRPSKLPDVCYSWWVLSTLSILQKADWIDFPKLTEFILHCQDPKNGGISDR
                     PDNEVDVFHTVFGLGGLSIMKYPGLRDIDPVYCMPYTVTKYFQRKYSD"
     gene            <428278..>429657
                     /locus_tag="KLLA0_E04819g"
                     /db_xref="GeneID:2894503"
     mRNA            <428278..>429657
                     /locus_tag="KLLA0_E04819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454163.1"
                     /db_xref="GeneID:2894503"
     CDS             428278..429657
                     /locus_tag="KLLA0_E04819g"
                     /note="similar to uniprot|P20053 Saccharomyces cerevisiae
                     YPR178W PRP4 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454163.1"
                     /db_xref="GeneID:2894503"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR014906"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH6"
                     /translation="MVELDDLQVDVDYKNQDGQSVGDALKRLEFQRQERLKIVPTLDT
                     DVRRALELVGEPVDIAGEDNYSRRDRLSDLILSDPKARERVTRLVESTSKDQTKIDTE
                     RSKVDDEDEEFYTPASQQLIEMRKFLIIYSMQRSKLRLEEERRRLVSQNVKNVISKRR
                     DLESKLKQFSLKGMQVIDEKPISEINTSPGGDLMACGSWSGNLSLVDNSLSKIYCNRS
                     LSGTKISGLDWSVDSKNIFVCTHDGRIVIYDSGDETTVKILYKNDARFAQVRCHPCNS
                     FIGSTSFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDI
                     RSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIV
                     SQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSIDIVGPDIYSAGW
                     DRSVNKWGV"
     gene            complement(<429714..>431624)
                     /locus_tag="KLLA0_E04841g"
                     /db_xref="GeneID:2893633"
     mRNA            complement(<429714..>431624)
                     /locus_tag="KLLA0_E04841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454164.1"
                     /db_xref="GeneID:2893633"
     CDS             complement(429714..431624)
                     /locus_tag="KLLA0_E04841g"
                     /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
                     YPR179C, Subunit of a possibly tetrameric trichostatin
                     A-sensitive class II histone deacetylase complex that
                     contains an Hda1p homodimer and an Hda2p-Hda3p
                     heterodimer; required for the activity of the complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454164.1"
                     /db_xref="GeneID:2893633"
                     /db_xref="GOA:Q6CPH5"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH5"
                     /translation="MDLLKILDTAPDPAIVDAQTMGVSGDTSGDYWLPASMCLYQKEL
                     TDQIVSLHYSDILKYFETSDYREDIVIGSMKSMCLNSEYVATHPYLLIDHFMPKSLIT
                     KDIPGHLAETSGKFAVLRDLITLVQEYETHTVLMARSDRTMDLLEALLLGNKVNIVRH
                     DGQTIKTKNKPKNFSCTCHLICSDNIKQIESSFPKDIRVDMVVCLDPTCNPEDLVIQK
                     IRQQNRPKRGADSNAPAIRLTTINSIDHCELYFGKHFKKDSREYLVNVAAAVVVLRDI
                     VGTLPPDLRPIYSQNLKYLSSWLNDPNMAWPLPDVYPISIYTAIDVEKSLLTEVTYSQ
                     TGNDLKEQFINDRKRRNRGHSKERSSLLYYKSKRVKNDYSTNPLKQDMAVLTWVSASG
                     RQNGEIDYHLATDILTHKMIQSIENIYAMNQRQKLELDDFERMESIQNHHFNKVNKDY
                     NDIKEKLEESEKKLKDDDVKVKDFLEESEKKHKQIEFIDSEINDLMTKLGSKSEPHKV
                     LKGLLEEISNLQDAREREKRNSESKSSERTYMQKEIERAAQSVDESNKEQDKLREEIK
                     LLKTKIEDSVAENKKKVASAEQRIDLLKSQLQQEGQNLGGLHSKLGYITDRLSKIQPS
                     RGRQATNGRSKK"
     gene            <432000..>433140
                     /locus_tag="KLLA0_E04863g"
                     /db_xref="GeneID:9487340"
     mRNA            join(<432000..432027,432140..>433140)
                     /locus_tag="KLLA0_E04863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999348.1"
                     /db_xref="GeneID:9487340"
     CDS             join(432000..432027,432140..433140)
                     /locus_tag="KLLA0_E04863g"
                     /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
                     YPR180W, RHC31 nuclear protein that acts as a heterodimer
                     with Uba2p to activate Smt3p (SUMO) before its conjugation
                     to proteins (sumoylation), which may play a role in
                     protein targeting; essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999394.1"
                     /db_xref="GeneID:9487340"
                     /db_xref="GOA:B4UN66"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B4UN66"
                     /translation="MSGAGELSADEIALYDRQIRLWGMTAQANMRSASVLLINLGAIG
                     NEITKNIVLSGIGSLTILDSHDVTEEDLGAQFFIGKDDIGTKRLEAARRHIEDMNPRV
                     KLTVDISDLQSKNKEFFSQFNLIVITDLFPADIEKLNEVTRELNVPIYVAGINGLSGY
                     IFTDLVEFISTDEKVKSARPEQLGKQSPNKEIINLSERKDEENNAVYQVITTKHTYKP
                     LKELLKSATLINQLSRRQLKRMTPKVPLTLTLLQYETFQNINLDDFRKKYDLTRKQLG
                     LLIGEISNDTIEEFVEQAAVEISPVAAIIGGAVAQDVINILGKRQSPLNNFVVFDGTS
                     LDMWVFEL"
     gene            complement(<433298..>435580)
                     /locus_tag="KLLA0_E04885g"
                     /db_xref="GeneID:2893755"
     mRNA            complement(<433298..>435580)
                     /locus_tag="KLLA0_E04885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454166.1"
                     /db_xref="GeneID:2893755"
     CDS             complement(433298..435580)
                     /locus_tag="KLLA0_E04885g"
                     /note="highly similar to uniprot|P15303 Saccharomyces
                     cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454166.1"
                     /db_xref="GeneID:2893755"
                     /db_xref="GOA:Q6CPH3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MDFEQNEDINGVRFSWNVFPASRTDANKNVVPVGCLYTPLKERE
                     DLAVAGYNPVVCGNINCKSVLNPYCEIDVRSNTWTCPICKTRNILPQHYANMTQETLP
                     LELTNTTVEYITSVPVQVPPIFFFIVDTTAEEENLQALKESIITSLSLLPANALVGLI
                     TYDNVIQLHDLSSASIDKCNVFRGDREYQLAQLVEMLTGEKLNAAQAVNINAPTKVTP
                     FSLNRFFLPLEQVEFKLTQLLENLKPDQWDVKSGFRPLRATGSALNIASLVLEGCYKN
                     VAARIILFSSGPGTVGPGLVVSPELKDPLRSHHDIDSDSAKHYKKACKFYNQLAQKVA
                     DNGHTVDIFAGCYDQVGMSEMKRLTDSTGGVLLLTDAFSTAIFKQSYLRFFSKDEEGY
                     LQMAFKGTLSVKTSSDLKLQGLIGHASAVKTKTEASNVSDSEIGIGGTSSWKMSSLSP
                     RHTYAVFFEIVNPGASAEVMTDRPKLAYTQFITSYEHSSGTNRVRVTTVANQMLSFGN
                     PAIASSFDQEAAAVLMARIAVDKAESDDGADVIRWIDRTLIKLCQKYADYNKNDPSSF
                     RLSPQFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSF
                     SMEEEPQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSL
                     LEEPKLEAAELLIDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQSGAVAGSTIVLTD
                     DVSLQNFMSHLQQVTVNGQT"
     gene            <436221..>437399
                     /locus_tag="KLLA0_E04907g"
                     /db_xref="GeneID:2893783"
     mRNA            <436221..>437399
                     /locus_tag="KLLA0_E04907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454167.1"
                     /db_xref="GeneID:2893783"
     CDS             436221..437399
                     /locus_tag="KLLA0_E04907g"
                     /note="similar to uniprot|P41733 Saccharomyces cerevisiae
                     YLR459W GAB1 GPI transamidase subunit involved in
                     attachment of glycosylphosphatidylinositol (GPI) anchors
                     to proteins may have a role in recognition of the
                     attachment signal or of the lipid portion of GPI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454167.1"
                     /db_xref="GeneID:2893783"
                     /db_xref="GOA:Q6CPH2"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH2"
                     /translation="MVSSEWQVVWACFASRLAVSYLFPSLQQQLDRTVEFSTPVTSYR
                     SLQEGAYLLLHNLPIYDGGVVHHVPLLVALMAFVQQAEFLMPVLFAAMDTLIAYQLMQ
                     IAKIYQRQLQIPSYIPGVVYAVNPLVLLSCVSQSTCLFVNLSISTSLLFALSRQFSLS
                     AICIALAGYLSPYAYLLLIPLAGICGSNSFGLVVKCTLVSIVLQLISFKLNNDNWNYL
                     TSTYWILITFSKIRPNLGLWWYFFIEMFEFFIPFFKSVFNIFVVSFIPPFTIRFNQQS
                     FYAFVLCLGWITLTKSYPTLGDGGFFLSFIPFFKPIFGYLRYPVISTLLFIHAIILSP
                     IFYYLWIGLGSGNSNFFYAISLVYALAISSVIVDLTWAMLRIEYDSGKPNLSLKLTQI
                     "
     gene            <437719..>438168
                     /locus_tag="KLLA0_E04929g"
                     /db_xref="GeneID:2893784"
     mRNA            join(<437719..437721,437833..>438168)
                     /locus_tag="KLLA0_E04929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454168.1"
                     /db_xref="GeneID:2893784"
     CDS             join(437719..437721,437833..438168)
                     /locus_tag="KLLA0_E04929g"
                     /note="similar to uniprot|P54999 Saccharomyces cerevisiae
                     YPR182W SMX3 Sm or Sm-like snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454168.1"
                     /db_xref="GeneID:2893784"
                     /db_xref="GOA:Q6CPH1"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH1"
                     /translation="MDPEEFKPINPKPFLHQLIDKDVLVTLKFNKIQYKGRLVSVDTY
                     FNLQLTDAEEIINDVSSGKVGDIFIRCNNVLYVGEDVNKQSDQPPTPTGTTEKSDDKE
                     ENGELAEEAN"
     gene            complement(438507..438614)
                     /locus_tag="KLLA0_E04951r"
                     /db_xref="GeneID:9487441"
     tRNA            complement(join(438507..438543,438578..438614))
                     /locus_tag="KLLA0_E04951r"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:9487441"
     gene            complement(<439551..>440402)
                     /locus_tag="KLLA0_E04973g"
                     /db_xref="GeneID:2894085"
     mRNA            complement(<439551..>440402)
                     /locus_tag="KLLA0_E04973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454169.1"
                     /db_xref="GeneID:2894085"
     CDS             complement(439551..440402)
                     /locus_tag="KLLA0_E04973g"
                     /note="similar to uniprot|P18496 Saccharomyces cerevisiae
                     YLR393W ATP10 Mitochondrial inner membrane protein
                     required for assembly of the F0 sector of mitochondrial
                     F1F0 ATP synthase interacts genetically with ATP6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454169.1"
                     /db_xref="GeneID:2894085"
                     /db_xref="GOA:Q6CPH0"
                     /db_xref="InterPro:IPR007849"
                     /db_xref="UniProtKB/TrEMBL:Q6CPH0"
                     /translation="MLPIFGSKRCLSTSSISYGLFRRLNNNILNSAPRDIKIEELKKP
                     IGLEKPPFNTKEYKYGNSFLDLFNSEKTGKRAEELEVEFRKSGFHDLYVLKKTNGKIF
                     ISPPSYWKADKSLYFPHVVGQRLSDNKECNVEDTLKGKVSIIRLFTTDVGKNLINSYF
                     IDNKHNLDYLKNDESLLKVQDGLKSAQIVEINLAENWLKTMVVKLVKNRYASIVPPHR
                     HDKTFISNRDQLPFQIREQLQINNLYSGYVFVVDENLKIRWAACGEATQKDFNLLWKC
                     VKAVRSE"
     gene            complement(<440889..>441635)
                     /locus_tag="KLLA0_E04995g"
                     /db_xref="GeneID:2893944"
     mRNA            complement(<440889..>441635)
                     /locus_tag="KLLA0_E04995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454170.1"
                     /db_xref="GeneID:2893944"
     CDS             complement(440889..441635)
                     /locus_tag="KLLA0_E04995g"
                     /note="some similarities with uniprot|O13547 Saccharomyces
                     cerevisiae YLR390W-A CCW14 Secretory Stress Response
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454170.1"
                     /db_xref="GeneID:2893944"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG9"
                     /translation="MRFSTALGAAFSLAVLSTEVVATPPACLLACVAQVNKKSDCDGM
                     QDIACMCKSDGSDLTSCLKSICPDGEADAAQDALESTCKAQGVTLDDDVTSSSSSSSS
                     SSSSSSSSSSSSSSSTPSSSTSSSSSTPSSSSSSSSSTSEEPTTSSAEPSSSAEPSSS
                     AEPSSSAEPSTSEEPSTSEEPTSSAEPTTSSSIVSETTAAPTSTLATSTSAEPTSTPT
                     TIATISSDGANALSLGNAVFGGLAVAGLLL"
     gene            complement(<442199..>443101)
                     /locus_tag="KLLA0_E05017g"
                     /db_xref="GeneID:2893685"
     mRNA            complement(<442199..>443101)
                     /locus_tag="KLLA0_E05017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454171.1"
                     /db_xref="GeneID:2893685"
     CDS             complement(442199..443101)
                     /locus_tag="KLLA0_E05017g"
                     /note="similar to uniprot|Q07418 Saccharomyces cerevisiae
                     YDL065C PEX19 Chaperone and import receptor for
                     newly-synthesized class I peroxisomal membrane proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454171.1"
                     /db_xref="GeneID:2893685"
                     /db_xref="GOA:Q6CPG8"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG8"
                     /translation="MSDNKVDEFDDLDDYLEDPRKLDEQEKQETVPNEAVTKGEPATQ
                     SDDPEVVEMMEDLQKQFQQLMQQEGGDTDQEMVQNFETLLTVLGDASKEKDHNSVKHV
                     QEQLKSGTGFKNIISNTLDRLKENSTKVDESLEEEKKNQNSDDILSQLLDQLVENGDG
                     NGTDGEGMDNAILKMLSQMSSKEVLYQPMKQMQGEFTEWMGLHEEDPEHSDKIDNYKK
                     QYALVNQIIGVFESDDYTNEKYHAEIADLLDELEQLGDSPVAKGTSNDPGNDMSELAK
                     MLEIQGDENLGNIDKDLEDTCKQQ"
     gene            <443446..>443919
                     /locus_tag="KLLA0_E05039g"
                     /db_xref="GeneID:2894145"
     mRNA            <443446..>443919
                     /locus_tag="KLLA0_E05039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454172.1"
                     /db_xref="GeneID:2894145"
     CDS             443446..443919
                     /locus_tag="KLLA0_E05039g"
                     /note="highly similar to uniprot|P50623 Saccharomyces
                     cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
                     in the Smt3p conjugation pathway nuclear protein required
                     for S- and M-phase cyclin degradation and mitotic control
                     involved in proteolysis mediated by the anaphase-promoting
                     complex cyclosome (APCC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454172.1"
                     /db_xref="GeneID:2894145"
                     /db_xref="GOA:Q6CPG7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG7"
                     /translation="MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAG
                     IPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQD
                     WRPAITLKQLLLGVQDLLDSPNPNSPAQEPAWRAFSKNIKEYERKVSEQALRYTK"
     gene            complement(<444262..>446112)
                     /locus_tag="KLLA0_E05061g"
                     /db_xref="GeneID:2894031"
     mRNA            complement(<444262..>446112)
                     /locus_tag="KLLA0_E05061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454173.1"
                     /db_xref="GeneID:2894031"
     CDS             complement(444262..446112)
                     /locus_tag="KLLA0_E05061g"
                     /note="similar to uniprot|Q7LGT0 Saccharomyces cerevisiae
                     YDL063C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454173.1"
                     /db_xref="GeneID:2894031"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG6"
                     /translation="MGKSKRRSRASNARANPLLRNAAKDDQIRTKRIQPLIEQLSSVI
                     PNDRSIALGTIMVLCEDPHMRSLFLKEKLVNVVTSKLLTDSNTDIVVESYGVLRNLAL
                     EEGYDLATHIWRLNIWVNIESGLSQVQQSLQSMKSDESKAKKESKRLLYDFAENILSL
                     LVALVNGSDAILDDVVKTDKLDKVFAVMTNILSYGMVISDNTVTLKTTTQLFNTVLDL
                     IYDISSDSSEFIDKVSAHEFLSPFVENIINWEFANDNELTKVLIQGIYLQFMDTDISY
                     DIAASIITKVLQSVEHINLAEVKSTLSNKTEDSELMKESNEEITKKIKDYTKKRTEAM
                     IKFQSIEISLDVIAAAIELIGAKYEESHKPLNGSLLPVLTQNVPSVFSALYTDFTSRV
                     LIGWNNLLWLYLSVGISFFELGNYWEHLWSAMQNGSEDKDFGIKIGKLSVTWALLKNV
                     QAVFGTSGSGDFFRVVQINNQQFIDSIINVFNEGKSLNPEEGVELQQRCCGVLGTLAG
                     FQNQIELNKAIGDFFINTLSSKETKAPVVVDFMNTFFEIYSDMNFDYDEPVFVNLNYL
                     SILQTQVSLNLKNVFKFVDKNKDPQLKERCQDCFSTLDSFIAYKQNERNK"
     gene            complement(<446469..>446741)
                     /locus_tag="KLLA0_E05083g"
                     /db_xref="GeneID:2894032"
     mRNA            complement(<446469..>446741)
                     /locus_tag="KLLA0_E05083g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454174.1"
                     /db_xref="GeneID:2894032"
     CDS             complement(446469..446741)
                     /locus_tag="KLLA0_E05083g"
                     /note="some similarities with uniprot|Q06011 Saccharomyces
                     cerevisiae YLR390W ECM19 Non-essential protein of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454174.1"
                     /db_xref="GeneID:2894032"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG5"
                     /translation="MVGRIRGMDVVIFSVICAIGVYTGTRFFEPIVIDQLKKDGGLRT
                     DVEIPKYDEDGNPVLPKSMLQIREELDQVLAEQKLAREQAKKKDQE"
     gene            <447645..>450659
                     /locus_tag="KLLA0_E05105g"
                     /db_xref="GeneID:2893763"
     mRNA            <447645..>450659
                     /locus_tag="KLLA0_E05105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454175.1"
                     /db_xref="GeneID:2893763"
     CDS             447645..450659
                     /locus_tag="KLLA0_E05105g"
                     /note="similar to uniprot|Q06010 Saccharomyces cerevisiae
                     YLR389C STE23 Metalloprotease involved with homolog Axl1p
                     in N-terminal processing of pro-a-factor to the mature
                     form member of the insulin-degrading enzyme family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454175.1"
                     /db_xref="GeneID:2893763"
                     /db_xref="GOA:Q6CPG4"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG4"
                     /translation="MLAAVQGILSQPTSLLASKISVSCLLTSRYRFLHYNTKMSNKYR
                     TLGTDSEFLKPDLDDRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLP
                     GLAHFCEHLLFMGNEKYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHLNHENLYPAL
                     DRFSGFFSCPLFNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFST
                     GNIKTLGDIPKLKGIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV
                     PNLNKQVPYYPARLYTESQLKKMVYCKPVKDLKKIEFTFPTPDMDPYWESKPNHYLSH
                     LIGHEGNGSLLAFLKEKGWAVELSAGSHTISKDNAVFGIEIDLTDDGMNHVNEIIIST
                     FQYLEMLKVTLPEEWIHNELKSTSVSSFKFKQKDPPSSTVSNMARCLEKEYIPVVDIL
                     STSLIREYNPSMIKKYVQSLNWENSRIMLTGQNLPVDCKEQWYGTEYKVTDYPESLLK
                     KLPNVGLNPKFHLPRPNEFICTKFEVNKLDNVKPLDEPFLLKDDHYSKLWYKKDDRFW
                     VPKGHIYVSMKLPHTFSSVVNSMLTSLYVDMIKDALVDLQYDASCADLRITLGKTNQG
                     IDIQASGYNEKLTILLTRFLEGIKSFQPKESRFNVIKNRLLQKLSNQQYDVPYNQISN
                     VFNSLVNERSWTTKAKLDVTKDLTFEHLKSFVPTIYEQLFHESLVLGNFSVEMAYEIN
                     QLVDILVVDRIPNLEVKNNKLRSYILPEESAFRYEYMLEDKANVNSCIQYLIQLGAYS
                     EELAAKASLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSAYV
                     ESRIVKFLNSFGEALKEMPEEAFEKHKSGLIKNLLQKLTNLRQEYDRFTTAIYLADYN
                     FCSYQRRADIITKLSKEDMVEFYKNFVLSPRSSRLAIHLKSQIEKKSTEEVVEGFPTG
                     TLISDIDEFKSNLFLAPVRQAVKQYEPTNARL"
     gene            complement(<451432..>451602)
                     /locus_tag="KLLA0_E05127g"
                     /db_xref="GeneID:2894091"
     mRNA            complement(<451432..>451602)
                     /locus_tag="KLLA0_E05127g"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_454176.1"
                     /db_xref="GeneID:2894091"
     CDS             complement(451432..451602)
                     /locus_tag="KLLA0_E05127g"
                     /note="highly similar to uniprot|P41058 Saccharomyces
                     cerevisiae YDL061C RPS29B Protein component of the small
                     (40S) ribosomal subunit; nearly identical to Rps29Ap and
                     has similarity to rat S29 and E. coli S14 ribosomal
                     proteins"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_454176.1"
                     /db_xref="GeneID:2894091"
                     /db_xref="GOA:Q6CPG3"
                     /db_xref="InterPro:IPR001209"
                     /translation="MAHENVWYSHPRKFGKGSRQCRISGSHSGLIRKYGLNIDRQSFR
                     EKANDIGFYKYR"
     gene            <452736..>455099
                     /locus_tag="KLLA0_E05149g"
                     /db_xref="GeneID:2894093"
     mRNA            <452736..>455099
                     /locus_tag="KLLA0_E05149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454177.1"
                     /db_xref="GeneID:2894093"
     CDS             452736..455099
                     /locus_tag="KLLA0_E05149g"
                     /note="similar to uniprot|Q03128 Saccharomyces cerevisiae
                     YDL060W TSR1 Protein required for processing of 20S
                     pre-rRNA in the cytoplasm associates with pre-40S
                     ribosomal particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454177.1"
                     /db_xref="GeneID:2894093"
                     /db_xref="GOA:Q6CPG2"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG2"
                     /translation="MAGHSHRSSVKNGHKPFKSKHASKGSLKNAFKGKVEKEAKNGKS
                     NKSVSKLERKNLSKQLRHQKILDTLETKKLFEGNNGAKKIITVIPLTADVYADDIVKK
                     LILSAENDGKTESDLEFDLKMPSVTNFRINKFKTTLQVIIPDMSNFINILDCAKVADF
                     VVFGLSGTSEVDGEFGEQIIRSLEFQGISSYLGVVSNLSQVHPKEKFQLDVKKSLESY
                     FTHFFPNEKSVYNLEKPSEAINAIRTLCQKYPRTVKWRDARGYLLADNIDFIESSENR
                     GHLVVQGIVRGAGFNIDRLIHIPGMGDFQVSKIEKLAASARRNKSTEEGTEFLPSEER
                     DILEEYAAQDMNMDEWSDYEDGFEYENLTAARYDDHGFLPGREQESKKVKLPKGTSEY
                     QARWYLDDVIEIGDEEELEEIQDENVPIQEDEMMVDDVDTFNTEQAQSEMDTQTEAGG
                     EDMFVDLSPEEEERQLREYRDQEKEDLEFPDEIELDPRESAIESLKSYRGLKNLHNCS
                     WEVDERDPDCPSEWKRVLRIGNYKNTMKKLNKEAIKSAQVVAGDIIKLYIDIPKFLLE
                     KLADPKTEVFAVYSLLKHEHKNAVVNFSIERWEEYDSPVPSSEPIIVQYGIRRYTIEP
                     LFSSASTSPNNVHKFERFLHQNYVSVATCIAPVDFTQSPAIFFKTSVTDPKGIELVGH
                     GSFLNADHTRIMAKRIVLTGHPFKFHKKLVTIRYMFFRPEDVEWFKSIPLFTKSGRSG
                     FIKESLGTHGYFKATFDGRLSAQDTVAMSLYKRVWPNASLPWSDKLL"
     gene            <455399..>456664
                     /locus_tag="KLLA0_E05171g"
                     /db_xref="GeneID:2894103"
     mRNA            <455399..>456664
                     /locus_tag="KLLA0_E05171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454178.1"
                     /db_xref="GeneID:2894103"
     CDS             455399..456664
                     /locus_tag="KLLA0_E05171g"
                     /note="similar to uniprot|Q06709 Saccharomyces cerevisiae
                     YLR387C CREH1 Protein of unknown function, similar to
                     Rei1p but not involved in bud growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454178.1"
                     /db_xref="GeneID:2894103"
                     /db_xref="GOA:Q6CPG1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CPG1"
                     /translation="MSDIVMFTCNSCMIQFQSSGLQRHHMKTEWHRYNLKRRVAQLAP
                     ISASLFAEKLQMSNREQELNQVDEFGFPVLKPINHSRGFQRKGRKLGRSRLEGLQHSG
                     QDLRSLSPASSITSHASRATFRSTDLEEEAFSDHGFTTEDSYSHYSNTDHESSDESEI
                     GNDHERISSTECIYCGKNSKQVEANVRHMFNKHGLYLPERSYLTDLTGLLKYLTDIII
                     VNKNCLCCKYQGSSVESIRAHMSSKHHCMLPYETKAERAAISQFYDFSSLDEAAVSDS
                     SAKHGTSSSVSPVTFANSESIIQTAELHSSEDGADEAEADINSNYALVHIDDSGVELQ
                     LGNGIKVGHRSMQRYYRQNVPLGSTSPDDRRTVVAADRRVTSTVQSRQMKKAEKEIKQ
                     LEKQHSNKHVRLQIRRANHQTHFRDELLQ"
     gene            complement(<456708..>459436)
                     /locus_tag="KLLA0_E05193g"
                     /db_xref="GeneID:9487404"
     mRNA            complement(join(<456708..459331,459433..>459436))
                     /locus_tag="KLLA0_E05193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999349.1"
                     /db_xref="GeneID:9487404"
     CDS             complement(join(456708..459331,459433..459436))
                     /locus_tag="KLLA0_E05193g"
                     /note="similar to uniprot|Q06708 Saccharomyces cerevisiae
                     YLR386W VAC14 Activator of Fab1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999395.1"
                     /db_xref="GeneID:9487404"
                     /db_xref="GOA:B4UN89"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR021841"
                     /db_xref="InterPro:IPR026825"
                     /db_xref="UniProtKB/TrEMBL:B4UN89"
                     /translation="MEKSIAKGLNDSIYEKRKAAAQQLEKYTRECLQNGDHEILEKII
                     DELCREYAYALDRPMARNAGLMGLAAVSIALGTKFLSKYLDTILPPVLACFGDQNDQV
                     RFYACESLYNIAKIAKGDMLLYFNEVFDVHCKIIADTDPSIKAAAEVLDRLMKDIVSE
                     CAATHVVRVNNDPNDVPPATVTDPRTSEVLSTNEPPYEEHEAKLAFSLPKFIPLLSER
                     IQVVDPNTRIFMVGWLQVLENIPDLELISYLPTFLSALFTYLGDSHKDVRVITHSLID
                     VLLHEVERVATIQKQVKDRESELLRQKQASLMDSTPIKRPEGALISERKKSLINALEG
                     LSSNDKTLSSIETSSALDITNSEPTESLNESTENLKINNSRFGSVYIPGQDIHLDFPK
                     IIEILVNNLTSSETEIQTVVLKWIDVCLNIDPNGFIPFLIKLLAVLLKLLNESDPTFC
                     EMVQNVNQKLISLTQRPDVGSEGIKYGPIVNTLTLHFLDSNAITKEACLDWLILIHHK
                     DPSQLLEHHDSTFLTLLKSLSDKDERLVAKSLELLRLLCDASPDNYFKKFIQNLLGLF
                     KSNEKLLKTRANYIIRQLCLKLSAERVYKIVSLMLDSDDDLIFTKMIVQILSSNLVTA
                     QELSKFRKSLRKGEDWSCFCILFKTWSHNPISLLALCLISENYELAYKVLKTYVEYDL
                     SVNDLIQIDILVQFLESPAFTTLRMQLLDPDKYPYLYKCLYGILMVLPQSKAFHILDN
                     RLKSVGRIASHSFPNSAGYSSSSSSLGRVSSDGSGHSGSPRKHQYQDLLDHFQQVCEQ
                     HNLDGSQKKFHENNYVLLNEILSPDNTVNPVINSTPITDAMNNTLEPALSDNESVIYR
                     SPSARSGAGERIQSVDQAK"
     gene            <459726..>460103
                     /locus_tag="KLLA0_E05215g"
                     /db_xref="GeneID:2894099"
     mRNA            <459726..>460103
                     /locus_tag="KLLA0_E05215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454180.1"
                     /db_xref="GeneID:2894099"
     CDS             459726..460103
                     /locus_tag="KLLA0_E05215g"
                     /note="weakly similar to uniprot|Q06707 Saccharomyces
                     cerevisiae YLR385C SWC7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454180.1"
                     /db_xref="GeneID:2894099"
                     /db_xref="GOA:Q6CPF9"
                     /db_xref="InterPro:IPR020195"
                     /translation="MSTQNDSIALLLLQITLYHQQELAHADSSLSLDELLVEPIVDNT
                     VVEKFTSHSMVQIYAPELAPLNIRSIKGLISDLFTNTNIQEPKNLITLANHYYSERLN
                     YLQEEKIPELIQQMKDEYRKLAE"
     gene            <460483..>464460
                     /locus_tag="KLLA0_E05237g"
                     /db_xref="GeneID:2894105"
     mRNA            <460483..>464460
                     /locus_tag="KLLA0_E05237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454181.1"
                     /db_xref="GeneID:2894105"
     CDS             460483..464460
                     /locus_tag="KLLA0_E05237g"
                     /note="highly similar to uniprot|Q06706 Saccharomyces
                     cerevisiae YLR384C IKI3 Subunit of RNA polymerase II
                     elongator complex which is a histone acetyltransferase
                     involved in maintaining structural integrity of the
                     complex iki3 mutations confer resistance to the K. lactis
                     toxin zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454181.1"
                     /db_xref="GeneID:2894105"
                     /db_xref="InterPro:IPR006849"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF8"
                     /translation="MRNLITLNHGKLQPVSQTLPDLELYTSCFDTLSDSITCVLGAAD
                     IGALEVQQYMKDGSMNVLASFYVQSYNDKLLSFIHFDDINELVFVFQQGDIISVTYDP
                     ATMDYHSSKVSIVGSIDLGIEAAEWSADQETLAIVTFERNVVLLSRQLEPIVETSLQV
                     EDLKISKHVTVGWGKKDTQFRGKGARAMEREALESLKASGLVGNELRDPTMPYRVDTG
                     AITELDSRKVKISWRGDCEYFAVTTIETVKDPSDESKTVERRALRVFTRDGQLDSASE
                     PVDGMNEHLSWKPQGSLIASVQRKTHIPDEEGLDLIFFERNGLRHGEFDLRLPSDEPV
                     LDLCWNANSEILTIVLIDRVQLWTTKNYHWFLKQEFYFNNITYAKWHPEKDFTLMVGD
                     SEKMTIVDFAYKMTAGPTMQPFDNGTSIVIDGNVVNITPLGIANVPPPLYFRDFECPN
                     NVLDAACSVSNEVYAAITKDELVIASVPSLKAMKNGKHPWIVSTFNKSSFGTAFDTLR
                     QLAFINDNTVAILLDTDNLSRIALIDITDNTNPSLITIIETFDKVVLLRSQFDYNFVV
                     FETRDGKITQLSADGQLSTITRFPQLVYDFRVKRVESATAANDWGDEQSKTVAFGLTN
                     TGKLFANEVQLTSAVTSIEITDSFLLFTTAQHNLQFIHLNTTDYKPLATVEDDTIDER
                     VRAVERGSILVNVIPSKAAVILQAARGNLETIYPRIMVLSGVRANIIAKNYKEAFVTC
                     RTHRINLDILYDYDPELFLNNLPHFITEIERVDYLDLFISSLLEDDVTKTKYRETLNF
                     DSSTAFDVAPPPPTEMQLYMKKKMFNPKTSKVNKVCQAILDVLLNTPNFRQKYLQSII
                     TAYACQNPPNLRDALQLIDTVESEEQKDSTVTYLCFLQDVNVIYKVALSLYDIHLTLA
                     VAQKSQMDPREYLPFLQSLLDAEPLRRKFMIDDYLQNYELAIEHLAAIDKVDNTVSSE
                     FIEYVEEHDLFKHALNIFKSEQDRQNIIYHVYAKSLSSQQQYGDAGIIHEMLGEWKEA
                     LDAYTLGKKWNEAMSVVLDHFPDKTEDIATELISSLTFEHRYVDASQLEIRFMKNIKA
                     GMDLLCRAYDYEAASLIAIAEHKSELIEEIVDPALGDGFGTIAELLADCKGQVNSQLK
                     RLRELRQKKAEDPFAFYGEETDQADDVSIAASETSTKESFFTRYTGKTSGTAKTGASR
                     KTAKNKRRQERKRARGKKGTIYEEEYLIQSIGRLIDRLYQTQPEAIKLIEGLLRRNKR
                     EQAYQIQKNFMELIDLLKENVQEIYSISEKDRERIDDDGQVYYLPEIPVPEIKEFPKR
                     NIVDF"
     gene            complement(<464593..>465222)
                     /locus_tag="KLLA0_E05259g"
                     /db_xref="GeneID:2894107"
     mRNA            complement(<464593..>465222)
                     /locus_tag="KLLA0_E05259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454182.1"
                     /db_xref="GeneID:2894107"
     CDS             complement(464593..465222)
                     /locus_tag="KLLA0_E05259g"
                     /note="similar to uniprot|Q12223 Saccharomyces cerevisiae
                     YDL059C RAD59 Protein involved in the repair of
                     double-strand breaks in DNA during vegetative growth via
                     recombination and single-strand annealing anneals
                     complementary single-stranded DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454182.1"
                     /db_xref="GeneID:2894107"
                     /db_xref="GOA:Q9HEU2"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="InterPro:IPR016810"
                     /translation="MSRYTDISYEGTSYTVNTGLDIKDFQIEEDWYNRPASEWSVKRI
                     GQLQGKVEQYTYRIYHSNKYGKHNLARLIPGHVLISFANECFGYDGWSSEVEEITSLE
                     HTENAASEDKRESHTVLAEARVKLVLKDDTYTFAGGFGKSTMPFKGEAFAKAKKEAIT
                     DALKNCLLGFEKVILDHEIKIKQNYYVDGVFKAEMSKIEGKTSIPRTVR"
     gene            <467253..>472520
                     /locus_tag="KLLA0_E05281g"
                     /db_xref="GeneID:2894109"
     mRNA            <467253..>472520
                     /locus_tag="KLLA0_E05281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454183.1"
                     /db_xref="GeneID:2894109"
     CDS             467253..472520
                     /locus_tag="KLLA0_E05281g"
                     /note="similar to uniprot|P25386 Saccharomyces cerevisiae
                     YDL058W USO1 involved intracellular protein transport
                     coiled-coil protein necessary for protein transport from
                     ER to Golgi Integrin analogue gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454183.1"
                     /db_xref="GeneID:2894109"
                     /db_xref="GOA:Q6CPF6"
                     /db_xref="InterPro:IPR006953"
                     /db_xref="InterPro:IPR006955"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF6"
                     /translation="MDLIQGIIQPPKAQSVEETIPTLCDRLENATLISDRRSAVLGLK
                     SFSREYRETVIASGLKTLINTLIKDQEDHDLVRALLETLLILFIRGEGEDDLTRNWIS
                     QQSRLQNGKYPSPLVMKEENETVDQFSLWITDALTQTDEVVKLLFTFLDTSAFHIKLY
                     TIQLLEALISTRPLKTREVILNIPTGVSTLVKLLDDINEPIRDETILLLMAVVNDNSH
                     FQKLVAFENVFEKLFSIIDDEGGLRGSLVVNDCLSLINNILKYNTSNQTLFFETGNLH
                     HLINLLNEPLSVEEEFFWNEQRMKNINTVLDIIRLTVEDGNSVTSAHQNILYESQVLM
                     VVLRLAFFIYTPNSIKLISLLTVADMIKNNATVQQKFSQIDVPYWDPSVPSYSSMGEP
                     KIVPVLTLLLSWTLLMNSVHIFDIRVASLEVLKAFFFNNKDNILSFLQSQIKQYELSS
                     ESMSIDDDEANILQPIFNYDPNLNLNPYKLFFSTDLLMFFMATDDTEGKIRSLIRSLS
                     SGTQEEDEESMVSVQTVGELLITNLSSQDIRIPIAFASFLIFWLYEDSASVDELLRNK
                     SLINNFISFSLQVEHQDTCLRCLTTMLLGIVYEFSSVSSPFSRADLYSLLVSRISPDN
                     YASRIKQLRENELFTNSLDVYLNPTFDETGLPNVFFSTYFSELVIDNFYRIQSSLRRG
                     PKDEPDVKITFELYEKLYVKFNKTRADLEKSTIENENVINSLNSKLEKLSKSLEHLET
                     EKVNAETELNQLNERHSALEVELNDTKIALESVNNKSQKLEELKQKNTKAIAVNQEQI
                     DKYKEKINGLQQKVKEISESKLKAEDGINKMSRELFTLTKENGKLKEDLKSHSKKLEI
                     QEKKYSSETANLEKQLKERGTEVQELRERISEDIKRIDTLEKNVTILSNQKIELETKL
                     SNQTSLIPKLTEKLKGLANNYKDLENERDTLAKKILEKEEANKTIMQNLNSEIESLNK
                     EREEMRLDLQYAAEYHQKEKENFDAHTQKLTSENNSKSESIISLQTKLDECERQIKEY
                     KTTNEELKNSLHALNVKCIELESSLESAKQSTDNSDETIEELNDSVIAINDELQSVLA
                     EKDELLKQNNKINEELCNYQQELQEKADSCQGLQDKISSLNNEIMQISEESNDKIKLL
                     EASNEEKVAEIKDLKSEISNIKQNADTKAEKLKSEIDALKSRISDLESLLETKNKLYE
                     NSQTTITELEQAKEKLQRTIQEQYKEAQYSEDSLLAGENKIKHLESQLEKLKLSSVSK
                     EKEAHLKDEEIKSVKAEIEDNVKLVQAKSTELDELKKQNSVLNSKLNKEKEKAKIEQH
                     KLRESLATARDELKSKIKDFEEERKLLSEGSSELNQQYSEKILKLEETLNNVKADHEK
                     AVQKLENTIEALEQQAEESKSSLDTERSLSSKEQQQRLQLEKILANEQKENKDLENKL
                     ADLDQLFKEHENTLESQTKISQDYKQQLEKNSQVIEELKSAESALKDKLIAAEEKIKE
                     SEILTSQLDEAVTSTSALLEEQTKLKKSISDLEAKNIKDCGEMEILRKELSKCQESLK
                     VSQRLNEEKDEANKRTETDIVSLQKEINTLKEELRTKNDEISCFEADKKEMIAKLKEL
                     EESKTLLVHSAQEKNAQMIQENTSLAEEIKELKLQVNTWTEKLVTSEQLWSSEKTELI
                     KQMDIIKTESAKQAQENSQLNVELSAIKEENMKLKNRVDDRSEVDDLVILVTDLDEQK
                     SKYKRKLIELGVELSSDEESDQESGQESE"
     gene            complement(<472583..>475879)
                     /locus_tag="KLLA0_E05303g"
                     /db_xref="GeneID:2894033"
     mRNA            complement(<472583..>475879)
                     /locus_tag="KLLA0_E05303g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454184.1"
                     /db_xref="GeneID:2894033"
     CDS             complement(472583..475879)
                     /locus_tag="KLLA0_E05303g"
                     /note="similar to uniprot|Q12749 Saccharomyces cerevisiae
                     YLR383W RHC18 Protein involved in structural maintenance
                     of chromosomes required for interchromosomal and sister
                     chromatid recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454184.1"
                     /db_xref="GeneID:2894033"
                     /db_xref="GOA:Q6CPF5"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027132"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF5"
                     /translation="MPTKRQLESDVDDLEQLKRLADESEDVQPRKRRFHDVQPMTQYP
                     TQNGESQANNQDMLQRAGFIKEIKLTNFMCHSNFSLRLGPRLNFIVGNNGSGKSAILT
                     AITIGLGAKATTTNRGTSLKDLIKQGCNTSKIVIVLCNEGLNSFEPGVYGKEIRIERT
                     IRREGYSGSFSIRSEANKEVSDKKRDLEVILDYFSIPVTNPMCFLSQDAARSFLTASS
                     PQEKYLHFMRGTLLEETKQNLESAENTMLLSRDRLSLLEETIKLLYKDFEHAQTILTE
                     LASKNDWITRRRLLQGKHMWMVCQTNNEKLKAIKTRENTLSAKKQEYVNRIADMKNKV
                     ERYLIQKEEALLDLGRKLTDRQNIEAERSSITIEIERFKSKHAQLIQQKQVTMEDLKS
                     AEKARSKTQHELSDVENRLQTQLGEDEADTKRKLSDTRRKIKDIESLRPELLRKQSEL
                     DDKMNALIVDTERPLKEFQKNISEKKQELREMNSSEDILASGFDRRMPDVRRKIHERR
                     TDFTSLPIGPIGYHISVKTEYEHFAFLIQTHINPTLEAFVVKDVGDAVLLKEIFESCQ
                     LRKIPGVITHDLQPFNYIRGKATSGLTVADALTFDIPELEYLLVDVNRMEKTILANSK
                     KEADHILRERNSENVKLVLALNNSDSGLHMALTAGSMRLNNFQFANNLRLKVGTNNSS
                     FLEKEILRQEEELKAREEHFSRKKKEIKEEKDNITRESRTSLQQLKTLERHAEELEDK
                     LNRQTNFSHIDALKESLAEENEQIEQLKANLSSIEQKIVDLGLQLQPVKERYDDVTRR
                     YRDACSSYETARHLEQSISHKIDKSSASILETQRKISASNEKIYMCEAELTSLQSKCE
                     QQREQAMKFCTEDELLNSELPSSEEHILREIRKIDESVRASERQLGMTQDEIAKLFEN
                     SKRKYETAIGKYNELDASLQKVHTALTLRRAALDLSIKGTRSDADIDFRISMKTRSGY
                     SGSLSFTDSGQLNVMVKTTNDHHARNVDTLSGGEKSFSQIALLLATWLTMRSRIIALD
                     EFDVFMDQVNRKIGTNLIIRRLGKDVKSDTQTIIITPQDIGKMANIDDKYFNIHKMKN
                     PERHNNVNSL"
     gene            <476546..>479173
                     /locus_tag="KLLA0_E05325g"
                     /db_xref="GeneID:2894486"
     mRNA            <476546..>479173
                     /locus_tag="KLLA0_E05325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454185.1"
                     /db_xref="GeneID:2894486"
     CDS             476546..479173
                     /locus_tag="KLLA0_E05325g"
                     /note="similar to uniprot|P11325 Saccharomyces cerevisiae
                     YLR382C NAM2 Mitochondrial leucyl-tRNA synthetase also has
                     a direct role in splicing of several mitochondrial group I
                     introns indirectly required for mitochondrial genome
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454185.1"
                     /db_xref="GeneID:2894486"
                     /db_xref="GOA:Q6CPF4"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR025709"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF4"
                     /translation="MGNFYHCGLVARRYFAQLSNSNLVSIGNKWNEKVLNGITKLSKD
                     DRNKNIYVLCMFPYPSGTLHIGHLRVYTISDVVNRFYQLKGYNVLHPMGWDAFGLPAE
                     NAAIERKVNPAIWTKENIGKMKAQMGMMASNFNWDREIATCDPEYYKFTQKLFLELFK
                     NGYAYRKEAEINWDPVDQTVLANEQVDSNGKSWRSGAQVEKKLLSQWFLGITRFAHEL
                     QHDLDGLDGWPSHVKRMQKNWIGESKGVEVVFNLPSIDPIKIFTTRPETLYSVQFVTL
                     ALDHSIVRKLKEEDNNLQEFIHRAEKLPEDSKKGYMLSNIFCQHPLDPKKTVPIFVAP
                     YVLGNYGHGAVMGCPAHDQRDFDFWKENCPGKPMIYTVSSAEAKIDTSGPYVSKDGVM
                     NENAGDLVGLTTHEARKLVVEKLTSLGLGKASVQFKLRDWLISRQRYWGTPIPIIHCD
                     SCGPVAVPDADLPVKLPELDVLSKTGNPLSKSDEFVNVKCPSCGAPAKRETDTMDTFM
                     DSSWYFFRFTDPHNKELPFGYDNASKFMPIDFYIGGVEHAILHLLYSRFISKFTASIG
                     MWDGSSSKGEPIKRLVTQGMVHGKTFVDSKTGRFMKPEEIDNSDPSNPRNRSTGELLS
                     VSYEKMSKSKYNGADPASCISAHGIDATRAHILFQAPVPDVLNWDESKIVGIERWLER
                     MLKFCISLCDNRSITILSKTPTDMNQHEVALHNGVQTLLSSITTSLEKILSLNTVVSD
                     YMKLFNLIEGSIKSSNIREGLSLLYLQKLTTVLYPVVPCVSEELASILMKSGYDWRQY
                     EWPLIEEIKKSEIIKYQVIINGKMRLIHEESEDFIQDTNKVIETLKCLPEGKKYLDDV
                     VIKKIITKGKIISLVVKPN"
     gene            complement(<479196..>481070)
                     /locus_tag="KLLA0_E05347g"
                     /db_xref="GeneID:2894487"
     mRNA            complement(<479196..>481070)
                     /locus_tag="KLLA0_E05347g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454186.1"
                     /db_xref="GeneID:2894487"
     CDS             complement(479196..481070)
                     /locus_tag="KLLA0_E05347g"
                     /note="similar to uniprot|Q7LHY6 Saccharomyces cerevisiae
                     YLR381W CTF3 Outer kinetochore protein that forms a
                     complex with Mcm16p and Mcm22p may bind the kinetochore to
                     spindle microtubules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454186.1"
                     /db_xref="GeneID:2894487"
                     /db_xref="GOA:Q6CPF3"
                     /db_xref="InterPro:IPR012485"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF3"
                     /translation="MESVYECIRFLEGPENEVSEQQIKNCIEFLYESATTIGLGCEDI
                     RKLIDCLCITDIIGAETKEFIITRCLVPNEYVDAKCITLIISKLGTPTFLHPYKTVPG
                     RRLQVALVRWVCHIYPWVKDKSIFKDTFSIWFEYWRLDYLQHWITYILLWTFDDRHIS
                     KWRCKVLFNIGNNPGYKNSRAYSVYILDAFLALETDLKDIISDFIQMLNSNEKSLQKI
                     ASFDYDRQFVLNTRQALSAKNLLDDDQFEEILKNYGDRKAYMKPEQTNILSLEKLARN
                     WNNFDGPYDFTRLLKFKSDVMWLKIAGHASTDPRIIQFRSYLRERHDSRTLFRDVPFP
                     LLHTATDFDLRTAKLSVAFSARLCIEDEADGVIEIIMQICHASFFAISSDNFKHALNI
                     YHAILATDILSSLTNKKTEVSLVLSALLLRSANIIGTQKHFPLIHALADHSIEQVVAV
                     NDPLLISELCWFLVRASAAIHPKHSPEILISDIDKSIHYLVEVLWNHNVTSSGSTLLP
                     NSYWESLRQSQYLSHTSFPSKLLYSVPNFGFMCFICQKLLFEKERTLGYEHFLGDFSE
                     RTLKQWVTKLGSNPQWFQEINQFSDLRKHFLRMVRSDYRYSGISEFLFTYVKNLQDIP
                     "
     gene            complement(<481399..>482733)
                     /locus_tag="KLLA0_E05369g"
                     /db_xref="GeneID:2894488"
     mRNA            complement(<481399..>482733)
                     /locus_tag="KLLA0_E05369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454187.1"
                     /db_xref="GeneID:2894488"
     CDS             complement(481399..482733)
                     /locus_tag="KLLA0_E05369g"
                     /note="similar to uniprot|Q6B265 Saccharomyces cerevisiae
                     YLR380W CSR1 Phosphatidylinositol transfer protein with a
                     potential role in lipid turnover interacts specifically
                     with thioredoxin peroxidase (Tsa2p) and may have a role in
                     oxidative stress resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454187.1"
                     /db_xref="GeneID:2894488"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF2"
                     /translation="MSSQEQPGRIETLNEEQETKLKQVWAHLFNFWDIPVDSRKVLTH
                     YHDSLRRNNTVSSEASHATVESGAKKTGKLFGRFRKSTKTEKKEPIKPRSRHSRTSSV
                     TSTRSRESIEAAYTPNMVHDALKELQPEEIRNNLWDMLRVDYPDNLVLRFLRARKWDT
                     DKTMYMLANSLRWRLKDARPDDIIKRGELGAYEDDKAGYVKNIELRKAVIHGFDRLGH
                     PIVYVRPRKHLSSDQTEAEVHDYSLLIIEQTRLFLKEPVDAATILFDLSGFTMSNMDY
                     APVKYLISCFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVASKIVFTKTAKDL
                     AEYVPEEYIPKDLGGDCTYDYDAYEKPDGSLDTKLNKKAELEEIVTERKALVDKFIQA
                     TVSWIEATDDETNAKWLAAKIELGKELTENYIKMDPYIRSRSFYEYEGTLSL"
     gene            <483509..>485374
                     /locus_tag="KLLA0_E05391g"
                     /db_xref="GeneID:2894687"
     mRNA            <483509..>485374
                     /locus_tag="KLLA0_E05391g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454188.1"
                     /db_xref="GeneID:2894687"
     CDS             483509..485374
                     /locus_tag="KLLA0_E05391g"
                     /note="similar to uniprot|Q07379 Saccharomyces cerevisiae
                     YDL057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454188.1"
                     /db_xref="GeneID:2894687"
                     /db_xref="GOA:Q6CPF1"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q6CPF1"
                     /translation="MVTDKETITVNTVKNPHEQTVPLLENEQFIYIKDQKRHTGVGLA
                     AILSKPPSLQFDTLAERVKNEFKFAFPTHKLVLLLHGHQSFKNALYQPLLADKLSKNG
                     YYVLRIDFRGLGDSEDNRVPELGRTIQQDVEDLTTIYEFVSSDACKSLLGRALTLDTI
                     IAHSRGVISMFEFARSFYVPNLINCCGRFDSQGLLLKAARRCPQWEEDGGFYCNTLRF
                     GKWQDVWIPRQETLSAGTLDTSKFEEINSETWILSVYTATDPVIPIASAAGYSNLFEG
                     RHTLEIVPNCDHNFYGFPDDTNKLNLPIRKGKVNYGAYLVAYLLEYLNPENQLQRFYN
                     THKLIKSNVNHGDVRNRWCLPYDFSQISNFRDVGGYVTTSGKQVKPGIMYRCANPNEA
                     TPAALDYMKSHLFINRVFDLRAVNEATEGGIIPNFEVENLSFNNNMTLSPEEMAKHYQ
                     GMFLSSYNFPQAYEIVLENSLPVIRRFFEYILEGNVDEKHAIVFHCSAGKDRTGILGM
                     LILGLAGVDADTISHDYELTKLGLTTEKRLIQRITGRGDKFYTILGPHGHEIASAWGV
                     SPKEMAANVLSSKYEAMRLFIDAFLLKFGSFELFFLEQLKFTEKEVEKIKIELTI"
     gene            <485919..>488183
                     /locus_tag="KLLA0_E05413g"
                     /db_xref="GeneID:2894280"
     mRNA            <485919..>488183
                     /locus_tag="KLLA0_E05413g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454189.1"
                     /db_xref="GeneID:2894280"
     CDS             485919..488183
                     /locus_tag="KLLA0_E05413g"
                     /note="uniprot|P39679 Kluyveromyces lactis MBP1
                     Transcription factor MBP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454189.1"
                     /db_xref="GeneID:2894280"
                     /db_xref="GOA:P39679"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /translation="MSSNQIYSAKYSGVDVYEFIHPTGSIMKRKADNWVNATHILKAA
                     KFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELASKLAEKFEVLDELKPLFD
                     FTQQEGSASPPQAPKHHHASRSDSTRKKATKSASVPSGKVSEKASSQQQQPVSQQQQQ
                     QPGSAPKRRGRPPRNKATVTLQRSQSEMVFPKPSIPSSSIQSTKLPSLQPQFGRSATS
                     LSPIMDVKSPLDQASPQFKELDIEDGLSSDVEPNSIMGTKHEDNTHLMNTKDEPVSSS
                     SSLPSSPSEFSQSVAFGSRSNMQTPLQLNGTTSMNMILPKFSSSQNGPSDSNQRANEY
                     LSKLVNYFISNDTQNESEIPMELLNPPLHCSPFIDTWIDPEHHTAFHWACAMGTLPIV
                     EALLKAGSSIRSLNNVGETPLIRSSIFHNCYTKRTYPQIFEILKDTVFDLDAKSRNVI
                     HRIVSRKSHTPSAVYYLDVVLSKIKDFTPQYRIDVLINQQDNDGNSPLHYAATNKDDQ
                     FYQLLLQNGALTTVQNNSGMTPNGIISGRYSMDEITKGQRLDDPYEFNKMYPSQAATR
                     TNRIIPEVINMMKEMANSYQNAYQKRQNEVLQMERTVKSMKKTITSVEMKLLEALNLK
                     ETDNVDIVLNDRKEKIDELQRRIATDKRVLINRLEEGQVKLIRKFVDEETKNVEGKTT
                     DGEESEDIEALLKELVLIQLKRKRKLNQIIDVITDNSKVYKYRKMISQGTDIDVSDVD
                     ECLDVIYQTLSKEG"
     gene            complement(<488881..>489966)
                     /locus_tag="KLLA0_E05435g"
                     /db_xref="GeneID:2894004"
     mRNA            complement(<488881..>489966)
                     /locus_tag="KLLA0_E05435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454190.1"
                     /db_xref="GeneID:2894004"
     CDS             complement(488881..489966)
                     /locus_tag="KLLA0_E05435g"
                     /note="highly similar to uniprot|P41940 Saccharomyces
                     cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase
                     (mannose-1-phosphate guanyltransferase) synthesizes
                     GDP-mannose from GTP and mannose-1-phosphate in cell wall
                     biosynthesis required for normal cell wall structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454190.1"
                     /db_xref="GeneID:2894004"
                     /db_xref="GOA:Q70SJ2"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAA
                     GVTDIVLAVNYRPEVMVETLKKYEDEFGVSITFSVETEPLGTAGPLKLAESVLKKDNS
                     PFFVLNSDVICDYPFKELADFHQAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDLIDLKPTSIEKETFPILVEQKSLYSFDLEGYWM
                     DVGQPKDFLSGTVLYLNSLSKRDPAKLAKGENIVGNVLVDPTAKISPTAKVGPDVVIG
                     PNVVIGDGVRITRSVALSNSHIKDHALVKSTIIGWNSTVGKWARLEGVTVLGDDVEVK
                     DEIYINGGKVLPHKSISVNVPKEAIIM"
     gene            complement(<490709..>491107)
                     /locus_tag="KLLA0_E05457g"
                     /db_xref="GeneID:2894729"
     mRNA            complement(<490709..>491107)
                     /locus_tag="KLLA0_E05457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454192.1"
                     /db_xref="GeneID:2894729"
     CDS             complement(490709..491107)
                     /locus_tag="KLLA0_E05457g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454192.1"
                     /db_xref="GeneID:2894729"
                     /db_xref="UniProtKB/TrEMBL:Q6CPE7"
                     /translation="MMYSSRMTKTVNNGRRKIRKKFFRKPPTQQTSATKLTKLTKLTK
                     SEQNTTASHRQKTRTSRTNTETQTAEQLLHKFLRVTTTPFRVCLWLPRELATCFFFFF
                     FFFFFAHISDTTIFTVTAGVTVKKKKSKTT"
     gene            complement(<491391..>493229)
                     /locus_tag="KLLA0_E05479g"
                     /db_xref="GeneID:2894730"
     mRNA            complement(<491391..>493229)
                     /locus_tag="KLLA0_E05479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454193.1"
                     /db_xref="GeneID:2894730"
     CDS             complement(491391..493229)
                     /locus_tag="KLLA0_E05479g"
                     /note="similar to uniprot|P38196 YBL042C Saccharomyces
                     cerevisiae FUI1 High affinity uridine permease localized
                     to the plasma membrane not involved in uracil transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454193.1"
                     /db_xref="GeneID:2894730"
                     /db_xref="GOA:Q6CPE6"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:Q6CPE6"
                     /translation="MSSALSPQFEVFEDDMQSSGEKSDTVETQAHELIETKPRNLFEK
                     CMHFFEVKQHTNTASNRRAESFIESFVYNDDLRPVEEKRRVWDWKQFFSFIVSGALNC
                     NTLETCVLGLQLGLTWYQTWIMSTLGFTFVGLYVVLACRVGNFYHISFPIASRAAFGV
                     YFSVWIVINRVVMAVVWFGVQTYIGSQTVQLMLKAIFGTDLETRINNTFSSPNLTTFQ
                     FLCFMIFWAIQLPALWFSPHSLRHLFVAKTMITPVALVAFLIWTIKKSGGNLELGSLS
                     LEPPSKSLIGWAYVRAVMTSLDNFATLILNAPDFARFSKTKRSSIYSQLIFIPVVYSI
                     LGIIGILITSAAFHMYQVNYWNPLDILNRFLDNYNSGNRAGVFLIALSFALAQLGTNV
                     ASNSISAGTDMTALLPKFINIRRGSYICAAISIAICPWDLMASSSKFTTALSAYAVFL
                     SSISGVIAADYYVVRKGYINLHHCYTNKLGTWYMYNKYGTNWRAVVAYALGMVPNFPG
                     FIGSVGPSVPEGAMRVYYLNYFVGWGVSFSIYCLLCYYFPIDGTPKGVKFFQRVWYEK
                     WVDVEHFHEERRDFEDNGYNFDDESVTTTAVHVHETADDDMKKFEF"
     gene            complement(<494499..>495056)
                     /locus_tag="KLLA0_E05501g"
                     /db_xref="GeneID:9487387"
     mRNA            complement(<494499..>495056)
                     /locus_tag="KLLA0_E05501g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999350.1"
                     /db_xref="GeneID:9487387"
     CDS             complement(494499..495056)
                     /locus_tag="KLLA0_E05501g"
                     /note="similar to uniprot|P47142 Saccharomyces cerevisiae
                     YJR102C VPS25 Component of the ESCRT-II complex which is
                     involved in ubiquitin-dependent sorting of proteins into
                     the endosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999396.1"
                     /db_xref="GeneID:9487387"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:B4UN90"
                     /translation="MTLETPQIYKFPPLYTPQTNKLIRKQQLQTWESIILQTCAQLSK
                     WCINKNGKIYDQSTGELLISIFENPEIQRACSLEFQQEIWAYMLQNETALQLKESEDS
                     NMIAIFWESLDSWSSTILEWCETSGKLNQVITIYEICESDENTNCKFYGMPSSFCLLV
                     LHRLVDRNRATLLKDQGKIVGVKIV"
     gene            <495340..>495831
                     /locus_tag="KLLA0_E05523g"
                     /db_xref="GeneID:2893703"
     mRNA            <495340..>495831
                     /locus_tag="KLLA0_E05523g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454195.1"
                     /db_xref="GeneID:2893703"
     CDS             495340..495831
                     /locus_tag="KLLA0_E05523g"
                     /note="similar to uniprot|Q12262 Saccharomyces cerevisiae
                     YPR046W MCM16 Protein involved in kinetochore-microtubule
                     mediated chromosome segregation; binds to centromere DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454195.1"
                     /db_xref="GeneID:2893703"
                     /db_xref="UniProtKB/TrEMBL:Q6CPE4"
                     /translation="MQSEVDDLERRYVSVYKELLLQLDKLFLLQNGSNMDSELKAKSR
                     LRALHQLNVSETASYLNMKDTNNDTKRQVTTLLENKYERDGELRVNIEKHWTLIEKWL
                     SQTHETIKLRQKLVELSAKFPEPAENSPPDPKLTQTLEMLRSIYSVLVIQGGYQDVVF
                     DHD"
     gene            <496271..>498007
                     /locus_tag="KLLA0_E05545g"
                     /db_xref="GeneID:2893842"
     mRNA            <496271..>498007
                     /locus_tag="KLLA0_E05545g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454196.1"
                     /db_xref="GeneID:2893842"
     CDS             496271..498007
                     /locus_tag="KLLA0_E05545g"
                     /note="highly similar to uniprot|P28274 Saccharomyces
                     cerevisiae YBL039C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454196.1"
                     /db_xref="GeneID:2893842"
                     /db_xref="GOA:Q6CPE3"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CPE3"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMN
                     LDAGTMSPLEHGECFVLNDGGETDLDLGNYERYLNVTLTKDHNITTGKIYSHVIAKER
                     KGDYLGKTVQVVPHLTNAIQDWIERVSKIPVDNTGLEPDVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGRENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCTE
                     KLDQPTIDKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQKMIHYLAERLSISKIELS
                     IEDTQRGDDLLQRWKNLTSNIDESLETVKIALVGKYTNLKDSYLSTIKALEHSSMRCK
                     RKLEIIWVEASDLEPETNENVENKAKFHHAWNCISIADGILVPGGFGSRGTEGMVLAA
                     KWARENNIPYLGVCLGLQIATIEFVRNVLGNKNGTSAEFFPESNEEDHVVVYMPEIDK
                     ENMGGTMRLGLRPTIFEHDTEWSKIRKLYGGGSQVEERHRHRYEINPKLIESLENHGL
                     KFVGRDETGQRCEILELENHPYFVATQYHPEYMSKVLDPSTPFLGLVAAASDMLNEVI
                     EARTSETGKADF"
     gene            complement(<498639..>499106)
                     /locus_tag="KLLA0_E05567g"
                     /db_xref="GeneID:2893843"
     mRNA            complement(<498639..>499106)
                     /locus_tag="KLLA0_E05567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454197.1"
                     /db_xref="GeneID:2893843"
     CDS             complement(498639..499106)
                     /locus_tag="KLLA0_E05567g"
                     /note="highly similar to uniprot|P00445 Saccharomyces
                     cerevisiae YJR104C SOD1 Cu Zn superoxide dismutase some
                     mutations are analogous to those that cause ALS
                     (amyotrophic lateral sclerosis) in humans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454197.1"
                     /db_xref="GeneID:2893843"
                     /db_xref="GOA:Q6CPE2"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /translation="MVNAVAVLKGDSSVSGIVRFEQESEDQQTKISWEITGNDANALR
                     GFHIHTFGDNTNGCTSAGPHFNPFNKNHGAPEDEERHVGDLGNIPTDAQGISKGSLTD
                     KHIKLLGPLSIVGRTVVVHAGQDDLGKGGDAESLKTGNAGARHACGVIGISNA"
     gene            <500522..>501631
                     /locus_tag="KLLA0_E05589g"
                     /db_xref="GeneID:2893844"
     mRNA            <500522..>501631
                     /locus_tag="KLLA0_E05589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454198.1"
                     /db_xref="GeneID:2893844"
     CDS             500522..501631
                     /locus_tag="KLLA0_E05589g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454198.1"
                     /db_xref="GeneID:2893844"
                     /db_xref="GOA:Q6CPE1"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6CPE1"
                     /translation="MLKISSVLLVVVWLLQLVIVGRCSSRIVHLDSSEQFYDLVHANY
                     YRNKESATNILLYVFKPGCRYCAELEPKLDFLTTVFPNDSTVKFVKVNGQQASTLVKD
                     LYIRSFPQLFIFKPIPGQSMEVTNNIRETVKDNSFLSQFHGERTVKRLAQWISNNVGE
                     MAHWPTSRVNYNIRDIDDFVRIMPQSLIESIFPTDDSVKDSGERPACLAFVNSWMDIQ
                     YVDMFNGDLNTLILEKMSDHWRSIDFYVIDSSVPELSTLSTQLQVAHSPTLCFIFKGK
                     IIKSALKPYDDNSRDREMEYFNEIISKCVVPTLQDNKVCEEHINSLPLAEFFTLSPLL
                     SNGDSDETDCNDDDDDDDDNDYDDDDEVPFDVFDL"
     gene            <501887..>502703
                     /locus_tag="KLLA0_E05611g"
                     /db_xref="GeneID:2894129"
     mRNA            join(<501887..501911,502069..>502703)
                     /locus_tag="KLLA0_E05611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454199.1"
                     /db_xref="GeneID:2894129"
     CDS             join(501887..501911,502069..502703)
                     /locus_tag="KLLA0_E05611g"
                     /note="similar to uniprot|P18414 Saccharomyces cerevisiae
                     YBL040C ERD2 Integral membrane protein that binds to the
                     HDEL motif in proteins destined for retention in the
                     endoplasmic reticulum has a role in maintenance of normal
                     levels of ER-resident proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454199.1"
                     /db_xref="GeneID:2894129"
                     /db_xref="GOA:P18413"
                     /db_xref="InterPro:IPR000133"
                     /translation="MLNVFRIAGDFSHLASIIILIQSITTSNSVDGISLKTQLLYTLV
                     FITRYLNLFTKWTSLYNFLMKIVFISSSVYVIVLMRQQKFKNPVAYQDMITRDQFKIK
                     FLIVPCILLGLIFNYRFSFIQICWSFSLWLESVAILPQLFMLTKTGKAKQLTSHYIFA
                     LGLYRALYIPNWIWRYYTEERFDKLSVFTGVIQTLVYSDFFYIYYQKVIKLGGDLELP
                     Q"
     gene            complement(<502868..>503590)
                     /locus_tag="KLLA0_E05633g"
                     /db_xref="GeneID:2893612"
     mRNA            complement(<502868..>503590)
                     /locus_tag="KLLA0_E05633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454200.1"
                     /db_xref="GeneID:2893612"
     CDS             complement(502868..503590)
                     /locus_tag="KLLA0_E05633g"
                     /note="highly similar to uniprot|P23724 Saccharomyces
                     cerevisiae YBL041W PRE7 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454200.1"
                     /db_xref="GeneID:2893612"
                     /db_xref="GOA:Q6CPD9"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD9"
                     /translation="MATTASEYGNELSKVPIQHQFNPYSDNGGTILGIAGEDFAVLAG
                     DTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKRFKNSQMWYHFNHNKKL
                     TIKSAARNIQHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGSA
                     ASLIMPFLDNQVNLKNQYEPDSNGTKRKEVKYLGVEEVIKLVRDAFTSATERHINVGD
                     GLEILIVTKDGVRKEYFDLKRD"
     gene            complement(<503859..>505592)
                     /locus_tag="KLLA0_E05655g"
                     /db_xref="GeneID:2893741"
     mRNA            complement(<503859..>505592)
                     /locus_tag="KLLA0_E05655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454201.1"
                     /db_xref="GeneID:2893741"
     CDS             complement(503859..505592)
                     /locus_tag="KLLA0_E05655g"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
                     induced under low-nitrogen conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454201.1"
                     /db_xref="GeneID:2893741"
                     /db_xref="GOA:Q6CPD8"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD8"
                     /translation="MLREKDRGPVTAKRRVLSLLTSLVSIICFLFLLKNFYNHEILNI
                     SDDGKLFQCQTYDKVSGGSTDDLNYIISDESFINGTIGKLQNIIRIPTEVSDERPDPG
                     THPDEDMYKPFYELHKQLEHDFPLVWSKLQVEIVNNLALLISWKGTDESLKPLMFASH
                     MDVVPVERKTWDEWRHPPFSGNIEFDSDNILNSKIWGRGSFDDKNMLIGELQALELLL
                     SQDFQPERGIVLAVGSDEEASGQFGAAKINEILMERYGDDGIYAIVDEGLNGIKKQEG
                     VYMASPGTAEKGFINFWIHLTTPGGHSSVPPDHTSIGIISSLVKKIESEKFPLWFTEK
                     NPVSQWHQCAAQYSLEMDNSLRYDFLNAMNDEGSNARVIEYLLQTGGRSMEYLLRTSQ
                     AVDIIHGGFKSNALPETVSVLINSRIALESTVNETMTKFINQLKEISNENDLGLEYNG
                     DELIKPTEHGTFFVEVVVGKDPAPPAPNNDAWKHFAGTVKSFYEDIVFPTKLEEDSTE
                     LVIAPTIMSGNTDCLHYLSLTENIYRFQPGFASKDTLGTIHSVNEHVDFETVMHTVAF
                     VYHYINAVQSN"
     gene            complement(<506394..>507089)
                     /locus_tag="KLLA0_E05677g"
                     /db_xref="GeneID:2894733"
     mRNA            complement(<506394..>507089)
                     /locus_tag="KLLA0_E05677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454202.1"
                     /db_xref="GeneID:2894733"
     CDS             complement(506394..507089)
                     /locus_tag="KLLA0_E05677g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454202.1"
                     /db_xref="GeneID:2894733"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD7"
                     /translation="MATILSLSQQYMLASRAKGKLLAAANKNSGRDHDLRILVGHANL
                     LDRLSSSVAKFDDIVSRSSSNDYHYNEEEADDDEYSDSDSDEEQEDFDNAPPKYQHIH
                     HSYVSSDSGSDSESDSDSDLGTNSDSSSSDSISDYDESNVRSKYLAKLQDLQDDSEDL
                     DPKYSLSSQPALYKCPSQNLTLSSISLNLMSSRTHENNNEETHVTTLLLSDEDSDNEI
                     EEDLGTLSPVYVL"
     gene            <509158..>510495
                     /locus_tag="KLLA0_E05699g"
                     /db_xref="GeneID:2893765"
     mRNA            <509158..>510495
                     /locus_tag="KLLA0_E05699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454203.1"
                     /db_xref="GeneID:2893765"
     CDS             509158..510495
                     /locus_tag="KLLA0_E05699g"
                     /note="similar to uniprot|P07256 Saccharomyces cerevisiae
                     YBL045C COR1 Core subunit of the ubiquinol-cytochrome c
                     reductase complex (bc1 complex) which is a component of
                     the mitochondrial inner membrane electron transport chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454203.1"
                     /db_xref="GeneID:2893765"
                     /db_xref="GOA:Q6CPD6"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD6"
                     /translation="MLRTATRSSILKRTIATQITPKAIVTELSNGVVVATEPNSNSAT
                     AAVGLVFGSGTTAENPYNNGVSNLLANSFVNSSIKDAQKLGFSLETKVGRDHQSYIVN
                     SQPGQYAKALEFLQSKLFAPIEDSVFESSKRATVDTVAKFEETEHEQRVFEHLHATAF
                     QNTPLSLPVRGTVETLEGLENIDLSNFVQNQFKANNSVIVGTGNVNHDELVKAVETKL
                     SLLSGDKPVPKKKSTFLGSEVRLRDDTLPKAWVSIAAEGEPINSPQYYVAQVAAEVFG
                     TFVAAEPASNLQGVKLIDEVNEYHLCDSFEHFSVSYKDSGLWGFRTTITDPHNIDETV
                     HFTLKQWNRLSISVTETEVARAKSLLKLKLASQVSTNAAAANLLGAQTLVLGAKPALA
                     EVFTKIDKITSKDIKAWASERLWDQDIAVAGTGKIEDLLDYVRMRNDMSMMRW"
     gene            complement(<511336..>512544)
                     /locus_tag="KLLA0_E05721g"
                     /db_xref="GeneID:2893683"
     mRNA            complement(<511336..>512544)
                     /locus_tag="KLLA0_E05721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454204.1"
                     /db_xref="GeneID:2893683"
     CDS             complement(511336..512544)
                     /locus_tag="KLLA0_E05721g"
                     /note="some similarities with uniprot|P38193 Saccharomyces
                     cerevisiae YBL046W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454204.1"
                     /db_xref="GeneID:2893683"
                     /db_xref="GOA:Q6CPD5"
                     /db_xref="InterPro:IPR015267"
                     /translation="MMGIKSRHLYDRLTKIVIDKDLSAFNEISPSQLIPQLSEHFSIT
                     IPKEIFNYNEDQEEDLLHRLKELSRYLVVKFAKRDKYPFTIQRICELSYHPLQYFPVH
                     SLQKFVSAMEKCCLVNTDWTPRLGKECPNTNPMEDVSLIPIEWIRTNKEDEKSLQAFI
                     SKIETIVAVNFGYDDFDDDNEDGTDHDIGRGYDNHGDVLIEEYEEMDEEFEDEDYEDH
                     EDEEEDEEDEDNDSDVDEMEAEEVEEDASDDISIGEIAENDDQDNAHTDVTDTQLKYN
                     GVPIEEELRLSSTSSVLSVSSHAANEDENESILSRKRNVTELDDYQYKETKENDGFIT
                     TPKKSKMPLNEFGSSSSMVSPVVSNQEDPSRNDDSRINTFISPDTTNSVTQAEKNELS
                     TSPLQDKKRM"
     gene            <513485..>514279
                     /locus_tag="KLLA0_E05743g"
                     /db_xref="GeneID:2893684"
     mRNA            <513485..>514279
                     /locus_tag="KLLA0_E05743g"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_454205.1"
                     /db_xref="GeneID:2893684"
     CDS             513485..514279
                     /locus_tag="KLLA0_E05743g"
                     /note="similar to uniprot|P47150 Saccharomyces cerevisiae
                     YJR113C RSM7 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_454205.1"
                     /db_xref="GeneID:2893684"
                     /db_xref="GOA:Q6CPD4"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD4"
                     /translation="MLRAGRFSLSHVHANVLARSPLVHAASIPTMQTRFQSQSVNNNA
                     STGEKLASLSDEQVDEWLKVIGSLEEEFSQQDYNPATSLAPGNQSRINILEKAMELNK
                     PSFEPSQEQINEWETLKQVPIPKKQDPVLQHVTNMIMRHGKRERAEKILSRALYIVFC
                     QTRKDPVKVLKESLDVLAPLMVIKTFKTGVAKATVVPVPLNQRQRFRLAWKWIVESSV
                     KRSSSDFSVRLGEELVSVFNGNSSGFEKRDSIHKTAIAHRAYINLK"
     gene            complement(<514352..>514798)
                     /locus_tag="KLLA0_E05765g"
                     /db_xref="GeneID:2894048"
     mRNA            complement(<514352..>514798)
                     /locus_tag="KLLA0_E05765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454206.1"
                     /db_xref="GeneID:2894048"
     CDS             complement(514352..514798)
                     /locus_tag="KLLA0_E05765g"
                     /note="similar to uniprot|Q3E743 Saccharomyces cerevisiae
                     YJR112W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454206.1"
                     /db_xref="GeneID:2894048"
                     /db_xref="InterPro:IPR006976"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD3"
                     /translation="MIRYKYAVTFFSSVCFVVFLGLTTDARLKLITSTHDKLAHCIVF
                     CIETVLFTMMFECDTVQLPAFIPKRLRSRNLAAYEPFSMNKYLLAFIVCCVCASTSSE
                     FAQQFLSRGKRSFDVNDILANFSGSLLGLGIAYKIEQQIQHNYENR"
     gene            <515081..>518767
                     /locus_tag="KLLA0_E05787g"
                     /db_xref="GeneID:2894664"
     mRNA            <515081..>518767
                     /locus_tag="KLLA0_E05787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454207.1"
                     /db_xref="GeneID:2894664"
     CDS             515081..518767
                     /locus_tag="KLLA0_E05787g"
                     /note="weakly similar to uniprot|P34216 Saccharomyces
                     cerevisiae YBL047C EDE1 Key endocytic protein involved in
                     a network of interactions with other endocytic proteins
                     binds membranes in a ubiquitin-dependent manner may also
                     bind ubiquitinated membrane-associated proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454207.1"
                     /db_xref="GeneID:2894664"
                     /db_xref="GOA:Q6CPD2"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD2"
                     /translation="MSGIAFRVPLTSEEKQAFSQHFSRLDREQLGIVTGEALRPLFSQ
                     SGLTPQQLSQIWTICDTENAGFLTVDQFNAALRMVAHLQENPGAQVTLELYQTPASKL
                     PSFGQSQKFNSASTQPSIPPPSNQSHSVQRVPSVINRSVSRTNTGSSPTYSVIPVCTP
                     HDYAKFAQLFDRSTEESGFLAGNKAREIFLKAKLPTQTLGTIWGLCDRSNSGSLDKVE
                     FVMAMHLIQLTLQQNAAVQNLPSTLPNYLWNSLNSTASSTLTPLSANNTGFSFTSGSG
                     SVVRNPGIIRKPSLSRLPSGTFSNAATDWTLTLEKKQQFDAIFDSLDKEKKGSLGSNV
                     LVPFFLTSKLGQDVLATVWDLADIHNSPVFTKVEFAIAMFLIQKKNAGIELPDVVPDQ
                     LLNSPALGLYHQQQQQQQQQRISVASTGDAGQNYQNFAAPVQAQKTSNSALDDLLGLN
                     ESFTPPPPSLPSQPQSSAQPSTHLAPNARKFRPSSTFGQTIIPEEGGNDQQQQQQQQQ
                     QQQQYMQTAPTHVGSAAPPPPPTARNSSLPSVPNFGGVSVPSREVTSNNREIVPPASL
                     SQATTELANLSTQVSSLTTQATKVHEEKTAAQNELTRITNMKASIETKLIGLRASYNE
                     EVRQTEEIQTQLNALRAQNEELSQQASVAEANYHAVQTQNEDLQTQLQQAQEEERQLK
                     ERLAQFNTLSSQLQQQLAEVQENAKAERSRVDIHAKQLELSEMTANNLQTEIQSLEQT
                     LGIYLSKHKELDDYKATIEAQHAEMENKHKQYLATSEEVHARELEVQSRTAEIEKQEQ
                     LYRDQVSRLQELFNDLNKRKSEFEAANAEFEKQQYDYADRVQKFSENQMKLAMGETPD
                     DEYTNELIQKRLQIQTAQPAEEEEKPESVFDKDVPTPVSQTEPDEEQNQQLEDDQLSE
                     QQLHDQQGNDEVAAEAMADSFEGSLNEYGIPRTESVTSSTANNPPQSVRDEVESEPKE
                     NAVLDIDQQLEDAENNDITKQGSETVQPASTDEPLPGGWSTGSTLEKDQISDSDADSI
                     KKTPILETQDKVSDAQGAEIDIPAIQDLKLEDTQVSSEDEKHEQVESSAKNVSSKPDT
                     PEFVNQFEHITHQDLDENVFHDASSVQPFDSEESAKAPVGNDEWDEIFSGLGNNGNTI
                     QTSDVPASVTPTPLQHPVPSAGSLPLSSMSKSPIDRGIAVTPKSLAIEELSSMGFSKE
                     EATKALEKCDWDLDDATNLLLDGA"
     gene            complement(<518890..>519507)
                     /locus_tag="KLLA0_E05809g"
                     /db_xref="GeneID:2893701"
     mRNA            complement(<518890..>519507)
                     /locus_tag="KLLA0_E05809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454208.1"
                     /db_xref="GeneID:2893701"
     CDS             complement(518890..519507)
                     /locus_tag="KLLA0_E05809g"
                     /note="similar to uniprot|P47149 Saccharomyces cerevisiae
                     YJR112W NNF1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules required for accurate chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454208.1"
                     /db_xref="GeneID:2893701"
                     /db_xref="InterPro:IPR007128"
                     /db_xref="InterPro:IPR016851"
                     /db_xref="UniProtKB/TrEMBL:Q6CPD1"
                     /translation="MSVDRYSGMEGTEHIRFQRLVQVCNKALEESIRKLQSWEKIHEC
                     FPNYGQTREGIENLTVCQQQVIKLWSNLSRVEFDAIFHERSIEEKLNQLDDLINKARS
                     IDTSSSSKKLRKIDDLRPLELIEGNLQGAKESTLERINNKLQIIKESNEALETNLKDL
                     NDNIFQELDQLQQVYDDMLNEKSMLPDETIKQAVSDMIIESRQTS"
     gene            <519783..>520610
                     /locus_tag="KLLA0_E05831g"
                     /db_xref="GeneID:9487463"
     mRNA            <519783..>520610
                     /locus_tag="KLLA0_E05831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999351.1"
                     /db_xref="GeneID:9487463"
     CDS             519783..520610
                     /locus_tag="KLLA0_E05831g"
                     /note="similar to uniprot|P47148 Saccharomyces cerevisiae
                     YJR111C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999397.1"
                     /db_xref="GeneID:9487463"
                     /db_xref="GOA:B4UN91"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:B4UN91"
                     /translation="MSLTAQRLVAISKWNGRFSVLNYLVAASTLSVCNESKEIPKIYH
                     LAMVMSEENSPDDSALIDAANSVVTLCDKAESNDDASAYESLYQSPTVHQRELTEKFR
                     EALLKTSPLAGLPKAINGLRALHNVTPISLLAPYQHVSKNSTNVHDLFPKTKRNTDSD
                     NEIERGMKHWNHLYGKVSGRVINNLNRSYPDLWYYTMSHAYGPLLSYSDVLDAQETSL
                     IIISSLVPQDVNPQLWGHLKGAINVGCSKEAIENARTLSIQIAQWCGVEWKGDVVKL"
     gene            complement(<520702..>522591)
                     /locus_tag="KLLA0_E05853g"
                     /db_xref="GeneID:2894017"
     mRNA            complement(<520702..>522591)
                     /locus_tag="KLLA0_E05853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454210.1"
                     /db_xref="GeneID:2894017"
     CDS             complement(520702..522591)
                     /locus_tag="KLLA0_E05853g"
                     /note="similar to uniprot|P47147 Saccharomyces cerevisiae
                     YJR110W YMR1 Phosphatidylinositol 3-phosphate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454210.1"
                     /db_xref="GeneID:2894017"
                     /db_xref="GOA:Q6CPC9"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC9"
                     /translation="MDYIKIARVDNVIWHKRGISLKGSLHLTTHHLIFTDDNSSREFW
                     VAYPTIASVFKNKGSSLISKYKHHSEWEKEALYAGKDIWMFFNIKVITKDYNIFSLDL
                     ENEKNTQDVYDSLCKLTILDDVHKLYAFIYSPNKAETPFNSWNIYDPVKEFERQGLNF
                     GDEECCKWRVSDINEDYSFCRTYPSKLVVPKTVSDTLISYSVKYRSQQRIPALTYYYA
                     KNGASITRCAQPLPGITQQRSIQDEKLIREIFNCSINKTSKNIIVDARPTTNAMAQTA
                     LGGGTENMDNYGFNQTCSRMFLGIDNIHVMRDSLNYLVDNFLVDNDLYLPIDKSMLNS
                     DKSSSWLKYIKLLLSSTDTLVKSIVFNNSNILVHCSDGWDRTAQITSLVQLSLDPYYR
                     TIEGFMVLVEKDWLAFGHRFCERSGHLSSHSVFHDNSTRLSIALAAESLSLNDKKENE
                     LGEFSTMTSPETRISSTFKKFRNGTNMKLTSPVFQQFLDCVHQLLIQYPTQFEFNERF
                     LRRLVYHLYSCQYGTFIFDNEYERVTNNAFHQTRSVWDYFRSRTHEFSNPNYREPSDD
                     EEDWILPDWEKVEWWWQLFGRRDAEMNGPCPTHEDEDTLVKKTNTIVSSLKMPKFSLE
                     IFSKK"
     gene            complement(<523476..>523850)
                     /locus_tag="KLLA0_E05875g"
                     /db_xref="GeneID:2894211"
     mRNA            complement(<523476..>523850)
                     /locus_tag="KLLA0_E05875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454211.1"
                     /db_xref="GeneID:2894211"
     CDS             complement(523476..523850)
                     /locus_tag="KLLA0_E05875g"
                     /note="similar to uniprot|P38191 Saccharomyces cerevisiae
                     YBL049W MOH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454211.1"
                     /db_xref="GeneID:2894211"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC8"
                     /translation="MGISCCVYIEKPSGEDICLKHKHDRFVIYGCRNCRTHLSSSTQL
                     MSKDYRGKTGDAYLMNEVLNVYEGEKQTRYMITGKYIVCDIYCSTCGALVGWKYLKSE
                     KSNQQYKEGKYILELLPITQCR"
     gene            complement(<525092..>527233)
                     /locus_tag="KLLA0_E05897g"
                     /db_xref="GeneID:2893804"
     mRNA            complement(<525092..>527233)
                     /locus_tag="KLLA0_E05897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454212.1"
                     /db_xref="GeneID:2893804"
     CDS             complement(525092..527233)
                     /locus_tag="KLLA0_E05897g"
                     /note="weakly similar to uniprot|Q08905 Saccharomyces
                     cerevisiae YOR381W FRE3 Ferric reductase, reduces
                     siderophore-bound iron prior to uptake by transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454212.1"
                     /db_xref="GeneID:2893804"
                     /db_xref="GOA:Q6CPC7"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC7"
                     /translation="MRSSKLQFILTFLVVFLLNGVSASVKTDLFTPRSSALKITQACT
                     QSLASVATFCTAKKAATCFCKNVDYAGSYFYCVFQHIEDDSTKKEFMNTVNQTCNGYS
                     EKKILAVYENATSHLVKVSDVPHFNKSVPISFPVYYSEKFYNNYYDTMENFYNSYHHS
                     FYYGAVLSAYFPVIFFFGGLIHWLKVFFPQKTNSVRRAMKKVWIVRVFEKHVTIPSLF
                     NGTHAAPEPVTGGHYPTRLQSIFITAWWCLTFIFLCTNYRSHIAGSKTYPSKSIYLSR
                     LIADRAGIMGVHLMVITFFLSGRNNIFLWWTGWKQSTFYAYHKAVARATVLVVCVHAI
                     GYVIRSSLLKHYHRNLMKGYWICGAFALVAASTMVIQGLGRLRKLNYEIFYILHVFLA
                     LLVLIMTAFHLKKEEYTLFSYIMGAFWAFDRFARIVRILYFGVRTAKVTVIHDEVLMI
                     SIPRHKYWPVYPGAFGYIYFMKPTIFWQSHPFSIIPSEDGKHINFYIKVKKGATKTIL
                     KHVQKQKSQTAEIKVMFEGPYGSEKPLDHYRDILFYSSGNGIPGVYPYVMNLLKDPEN
                     RDKSITLYWIIQHIESVEWFMDELAALQNYSNVETVVYVTRHPGQPVFEVFDKEKADK
                     EESTVDEMTNSIDGSEEYIKVLPNVEFRYEKPNIEELVRSDVSDLGSTDVAVVSCGHN
                     AICDTIRRTVADISGTRTSGTLDYIEELQAW"
     gene            complement(<530194..>531294)
                     /locus_tag="KLLA0_E05919g"
                     /db_xref="GeneID:2894509"
     mRNA            complement(join(<530194..531042,531265..>531294))
                     /locus_tag="KLLA0_E05919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454213.1"
                     /db_xref="GeneID:2894509"
     CDS             complement(join(530194..531042,531265..531294))
                     /locus_tag="KLLA0_E05919g"
                     /note="highly similar to uniprot|P32602 Saccharomyces
                     cerevisiae YBL050W SEC17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454213.1"
                     /db_xref="GeneID:2894509"
                     /db_xref="GOA:Q6CPC6"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC6"
                     /translation="MSDVKEIIAKAEKKAKPSSGFFSFLSGSDSYRYEEAADLYIEAA
                     NLYRLRKELDQAGDTFLRAAECQIQASNEDEAGNTYIEAYKCFKTGSSPAQAAESLAK
                     SIDIFTRRGQFRRGANFKFELAELQEQQLQDYPSAIANYETAGDWYLQDQAIALSNKS
                     YIKCADLKALNGDYLEATEILKKVVENSLGNKLSQWSLKEYLLKIGLCYLAAGDVVAA
                     DKSLNESQSLDPSFSQSREFELLSNVIEAVREGDTEKLSQKIYEYDRFNKLDHWKTTI
                     LLKVKNTIVEADDDLL"
     gene            complement(<531676..>532448)
                     /locus_tag="KLLA0_E05941g"
                     /db_xref="GeneID:2894154"
     mRNA            complement(join(<531676..531952,532447..>532448))
                     /locus_tag="KLLA0_E05941g"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_454214.1"
                     /db_xref="GeneID:2894154"
     CDS             complement(join(531676..531952,532447..532448))
                     /locus_tag="KLLA0_E05941g"
                     /note="highly similar to uniprot|P49631 Saccharomyces
                     cerevisiae YJR094W-A RPL43B Protein component of the large
                     (60S) ribosomal subunit and highly similar to
                     uniprot|P49631 Saccharomyces cerevisiae YPR043W RPL43A
                     Protein component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_454214.1"
                     /db_xref="GeneID:2894154"
                     /db_xref="GOA:Q6CPC5"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC5"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHATYNCSFCGK
                     TCVKRGAAGVWSCSSCNRTIAGGAYTLSTAAAATVRSTIRRLRDMAEA"
     gene            <534222..>534857
                     /locus_tag="KLLA0_E05963g"
                     /db_xref="GeneID:2894453"
     mRNA            <534222..>534857
                     /locus_tag="KLLA0_E05963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454215.1"
                     /db_xref="GeneID:2894453"
     CDS             534222..534857
                     /locus_tag="KLLA0_E05963g"
                     /note="similar to uniprot|P21190 Saccharomyces cerevisiae
                     YJR094C IME1 Master regulator of meiosis that is active
                     only during meiotic events, activates transcription of
                     early meiotic genes through interaction with Ume6p,
                     degraded by the 26S proteasome following phosphorylation
                     by Ime2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454215.1"
                     /db_xref="GeneID:2894453"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC4"
                     /translation="MHCELDISSYLKLDDLQECGVNMEWHGELALSDLEDDVSLDFHE
                     KHVISRHDLQPRSIHMPSMIHTQPVHLIHVHNLKFLQTSFEEEDEQRIICSSSTPPSL
                     ADTRHSSVFSSTRSINVLLEEDEQDLDNDLQCMAPVKKKQQRALVAPIMFSSSSSKKD
                     SVVSEKDQFVYTLTNKLLPYFGYFLADSNDLDYFDKIRFQEIDYKFSKTYF"
     gene            <535755..>536642
                     /locus_tag="KLLA0_E05985g"
                     /db_xref="GeneID:2894528"
     mRNA            <535755..>536642
                     /locus_tag="KLLA0_E05985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454216.1"
                     /db_xref="GeneID:2894528"
     CDS             535755..536642
                     /locus_tag="KLLA0_E05985g"
                     /note="some similarities with uniprot|P45976 Saccharomyces
                     cerevisiae YJR093C FIP1 Subunit of cleavage
                     polyadenylation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454216.1"
                     /db_xref="GeneID:2894528"
                     /db_xref="GOA:Q6CPC3"
                     /db_xref="InterPro:IPR007854"
                     /translation="MSSEDEDDKFLYSDEEDSNVVAKQEGPALKRQKVEETPKILAHD
                     VPEGNTNEVESEASNQDSSSDEDDSSDSDSDVEIIIGTGNDTSKIDSGKSQISAITDT
                     TPLGTADHAIAAVAGISDVVPVQEGSIPPEQQQQQQQTIDLNPDAQFDGKPIVQIDPE
                     ILKEKPWRQPGANISDYFNYGFNEQTWMEYLHRQEHLTKEYNPQKILMNLLALQQQGK
                     LNDPGSGQPVQNTIQPPPPPMGLPPMFGGFPGFPFPGMMNNMQNQNVSSMNNMNNMNN
                     MNNMNNINNNNNNNLNDKK"
     gene            complement(<536856..>540509)
                     /locus_tag="KLLA0_E06007g"
                     /db_xref="GeneID:2894529"
     mRNA            complement(<536856..>540509)
                     /locus_tag="KLLA0_E06007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454217.1"
                     /db_xref="GeneID:2894529"
     CDS             complement(536856..540509)
                     /locus_tag="KLLA0_E06007g"
                     /note="weakly similar to uniprot|P47136 Saccharomyces
                     cerevisiae YJR092W BUD4 Protein involved in bud-site
                     selection and required for axial budding pattern localizes
                     with septins to bud neck in mitosis and may constitute an
                     axial landmark for next round of budding potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454217.1"
                     /db_xref="GeneID:2894529"
                     /db_xref="GOA:Q6CPC2"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /translation="MQMEDKGEALNPDAMYSLLKEIDQEISHTDNISIDQLPEEDTLD
                     NEKKIDASENVIENTEEEALQLGDESANTTTEIKETSCTEDHDTVENTEDVISMAEGL
                     DKAPLETAWIKHNYQQTKPVVSKRLISNDGSDTSVEDINASTRIPSYTSEEITGLELK
                     DKMVTDVGERLSHFLDQKYAENPNLPALKGMLSMADEKAMEDDPKKDKPLVFTIEPTK
                     PLFPSKEVSSTMIQVEIHTPDEDDVDGAAADTKEATNLLLDSKIPVTPNVCINRFVNN
                     NGETRVSSGSSTEDAQELNTHRFQDRYHLLSGAQAVPQLPQLPALTLQDYKSSSVQSV
                     NASRIFSVATTNDNYQSAKEYDLSSTVGCEELSDDASVKDLEIPEPNELPCFPTFQLD
                     STSMKTSSSMETVQHDKAKFNSDVNIADDTMEQIEQEEAELISNPERSGSPTNDNMSQ
                     HSQNRQLLGVSEVSQAQQAPEHHVEMSVEFQDEGRRDITSSFSRESDRIELPPLPPMN
                     GLSTMFDQDLFNDHETSHESIDLTSSSHKENYLSIWHSQKTGGSFISPALSTNSQFST
                     QSRTSSVPTNHSGSSFKFKSRIISNSHVFKQEAFRQFSDEYVLSTQDDSKLDPLRRNT
                     IMSKRIQQELKTQAKMYPFANKFALDESSEPSIHNESIITGDISRTSDKAVDTTNILS
                     HKNLTLLPPQSTETVFSSFLDNFDKDDFEEKLAEESRLNSKKNLQTTWGHFRDVSSGN
                     VDIKATQQQIAEVLHNQNEDVVQVGSHIQDVKVLLGNEIEGYDVQKSVSDLSVETTKK
                     SPIKHVGSPFKVKARSETPPQSPVVYERDTTEVNEGLQRAPTTSLASVYLENSLQEFE
                     SSELQDHGKLYLKLKSINSLRLQQIKRHNAKYCIEFDNGKEVIETPWESIPEDGPIKM
                     SQEFEVNMESNNVTLFMTMKIRYTSPQNQLTEVVEKIPIKKRFAFGKTKYRLEKRFVT
                     KKLKYDDWDFKFAKDGSFARCQVNVNKNMLKQIKYKTNELHFEFLNEWEREFDEKIAQ
                     TYKEDELWKLPRKNPSKVCSLTVDVMYLPRTSSMERFPKNLKAVQKCCEKYLEQQRVN
                     NEGFLWQEGGDVEGMLKRRYMILKGTELIAHDEVTRKPQTLLNLLNVVDIYSDGKTAT
                     GKQMRNFTDMVLFSDCFKLLFANDEVINFNADSNLLKQQWVEILTSVVELNKFHQPWI
                     KRVFENEQYNITF"
     gene            <541992..>545276
                     /locus_tag="KLLA0_E06029g"
                     /db_xref="GeneID:2894475"
     mRNA            <541992..>545276
                     /locus_tag="KLLA0_E06029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454218.1"
                     /db_xref="GeneID:2894475"
     CDS             541992..545276
                     /locus_tag="KLLA0_E06029g"
                     /note="similar to uniprot|P47135 Saccharomyces cerevisiae
                     YJR091C JSN1 Member of the Puf family of RNA-binding
                     proteins and to uniprot|Q12221 Saccharomyces cerevisiae
                     YPR042C PUF2 mRNA binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454218.1"
                     /db_xref="GeneID:2894475"
                     /db_xref="GOA:Q6CPC1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC1"
                     /translation="MEKRKASGDSMSGLSNIPEVIDPGVTIPIYEDDFTLSGGNNIDQ
                     LPIQPQKLGSYRSKAGKFSNTLSNLLPSISAKLHHNKKGSKGSSAVGEGNHSGELSSD
                     DATANTSEQTSKSGSIAQINLSVPGHITPPLDVDYNQAIHLPDSSSLLVPSQPRLSGD
                     SFTFATNSVPLQPTASNTISRTRNNTVSSQITGPSNVNGLVPNVGNVWFPNDMSVNPM
                     SPPGIQTTTNPTNVNNNNNNNNSHLAPGTYSPYEATGNYFDLNTSSNNINNLGVPGAT
                     TAGAHQFQSQQIGGVWNSRPRSQSNASSIYTDAPTYDQMDTRSRASTFIIPPSMDPQL
                     KATAASTNPIVQDDMDSRSINWVTTDPSVPSINHISNLLPTNTISISNVFSLQQQQPH
                     LSNTVNLTSTSLATLCLKFGTVISARTLRGVNMAIVEFASVEAAIKAKEALNGKEVSL
                     VGAPSTVSFAKVLPMHQQLPQTQQTQQQNNHQSTAINPQSLLQEQLFSGAVQFQQQGN
                     VSVPSFTGNTHAQSSSQAFVSPTNPSSSNSEKEQCPFPLPPPSFKENITLLNDTINKF
                     GINYDTSQYQHIIANAIEYNGTSDTTDFGPLPEPLSTREFDAPRLRELRKSIDSGQMS
                     DLEIEQLVLAMLDEIPELSSDYLGNTIVQKLFEHASSVIKDIMLRKTSVYLTSMGVHK
                     NGTWACQKMITNADTPRQKMYVANGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIF
                     ENIVSNFWNIVQNRYGARAVRACLEAHDIITQEQLLLLSAMIVFFVKYLATNSNGALL
                     VTWFLDTCTLPKRHSILAEALLPNIFELGCHKLASLTILKILNYRGDEVAKRAILDTI
                     FGPMDNEISSKPPQLLYQLLSDTNYGPSFVYKVLSIPMLEGDVRHHVIEQVRYILTTE
                     SNITQHRRLLEEVGLNAINNQPSTAQTKPRMSISHVFGNDHPQHMRTVSVNSVRSASS
                     RPRASSNAQSQQQPIQSSQVQAQLPQQSQSQPQHQPQQASISGISGQASYYTYPGMFP
                     ASQPYQYSTSTSGLNDDLVSNFDMLTFNNGTQISLPQLTMNGQPLPHSQNRHHNGQFG
                     DGMFNH"
     gene            <545879..>549598
                     /locus_tag="KLLA0_E06051g"
                     /db_xref="GeneID:2894750"
     mRNA            <545879..>549598
                     /locus_tag="KLLA0_E06051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454219.1"
                     /db_xref="GeneID:2894750"
     CDS             545879..549598
                     /locus_tag="KLLA0_E06051g"
                     /note="similar to uniprot|P24814 Saccharomyces cerevisiae
                     YJR090C GRR1 F-box protein component of the SCF
                     ubiquitin-ligase complex required for Cln1p and Cln2p
                     degradation involved in carbon catabolite repression
                     glucose-dependent divalent cation transport high-affinity
                     glucose transport and morphogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454219.1"
                     /db_xref="GeneID:2894750"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:Q6CPC0"
                     /translation="MDPQQPASDNSEWQFQVSPGAAWNLRAQARRGQTGSRDAIPLRV
                     DELTDENELNWEALNNRNLSILGNDTLSDIFRSNQLINNGTNDNNSNNNIDGEILNTT
                     GTDEDNRRSTDIDNNTADHFEELTRGAAREANLSRESAHVSSGLPADWFTTMNPSKLS
                     LHQRPFLARERKSALSGIAQIEDDLRQLFENIEKEGWKLPPIEGDSEQLQEYFDKHKI
                     DMRARQNIENFVLKMQKEALDDSSNWTEKEALLDFLLKQVQLTPEDTTALSEIVELSR
                     YRFKFALGIIELRKNYLKESLQLGIQRLRDLNYSAFLAESNLSTEVVEHLKSTIMKQQ
                     RVILRAIEMELYSLHSYQEKYSEIIKRMARSIHDYYKRKNTNPNVPNPIYYYRDLFLK
                     YSPWTKRGLDLALYDMHVSEEEWKFMSNHVRSQLPQMLSMVSKDNALYTRIKTPKNTF
                     PLSDLPHEILAMVLEAKSQKANIVPLMAVSKAWAEVIAKLIYYRPHINKQQQLNSFLI
                     TMSKPKEETLFDYRSLIKRLNFSFVGDYMTDRKLEHFIGCPNLERLTLVFCKYITTKS
                     VAKVLKGCQYLQSVDITGIHHIRDDLFEVLASDCERIQGLYVPHSNDVSPNAISNFIT
                     HAPMLKRVKITFNQSIENDLVMKMVKCCPFLVEVDLTSTPNIDNHGLVTLFTSLPQLR
                     EIRVTHNTNITDEFMLAVSQETMGLPALRLVDFSGCENITDKTIDKLVTLAPKLRNLF
                     LGKCSRITDSALKSLARLGKNIQTMHFGHCFNISDEGVRVLVSNCPKIQYIDFACCTN
                     LTNKTLYELAELPKLKRIGMVKCSQITDEGLLTMISIRGRNDTLERVHLSYCTSLTIY
                     PIYELLMACPKLSHLSLTAVPSFLRPDITQFCRSPPSEFTANQRQIFCVFSGKGVHKL
                     RHHLMGIHEPTDGPSTKSDEIFISFLKNKNAIQSDTIEDEDLERLSHNADLDSAALFA
                     ASAVFNFANEPFNQIEFAHLDHVFSSMLITSEDEHVVSSADLTALEDFDRSFYDNPLD
                     PRFTDRYVTVAPPASSNINNELADVIRKFRKILNRVLDFEVNVASLCRIQFQYCGTLI
                     AEMSSIYITFVDLNRYISEIYQRIKASEEPKDLLGFVLWKKWWSPCFKDLMRNFKITA
                     LVLRIYVKESLTVLTRQRELVLQRARETWDREAANDLPDGEGDIDMGVNMLLPPGGTV
                     AEETDNNDNNIDLRLFLPPGNEQNRETPDDQIIEE"
     gene            complement(<549775..>552111)
                     /locus_tag="KLLA0_E06073g"
                     /db_xref="GeneID:2894521"
     mRNA            complement(<549775..>552111)
                     /locus_tag="KLLA0_E06073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454220.1"
                     /db_xref="GeneID:2894521"
     CDS             complement(549775..552111)
                     /locus_tag="KLLA0_E06073g"
                     /note="some similarities with uniprot|P47134 Saccharomyces
                     cerevisiae YJR089W BIR1 Protein involved in cell cycle
                     regulation and chromosome segregation contains BIR
                     (Baculovirus Inhibitor of apoptosis Repeat) domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454220.1"
                     /db_xref="GeneID:2894521"
                     /db_xref="GOA:Q6CPB9"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR020478"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB9"
                     /translation="MNDSNLSSAMDLSFLSEESSLQQIGSLNTPKLPKAEKRKRGRPR
                     TKPVVPVELDANGNPIKKQRGRPRKNPTTEARKSAKKEPILDENGLPVKKRRGRPRKS
                     LIDPTNISFTSESKKNTTTDNNNNIQDTSGGIPKASRAKHSHNVLPIPIQPKKRGRPK
                     KTESIVSVRTEQLHEDMNYSNDMKLKIEKILHKKDNYPNLISSRDTFDPKKSSHRSDV
                     SELESSPVKDNSQRKSIHCASSSIAGVTDSISAYSSKGSTSLSSDDSYKPEVDPLEKV
                     QSDHRADKGRIEFGDNTASDQLQRGTDSAIQTQAPRKRGRPKKLRDETAEPKIKRPRG
                     RPPKDKDNKDKNQSASNTEKLPENQWTLNDIISCRMQQKDQLEASPKKKIKLAKTAAQ
                     LGINDSKGSQVGETSFMQSVEKNKDVFLDFKKNKEKATKPNTILDDSYDVFSFDNNGT
                     SNFVIPEEAFPAQSSKKNKTEKSSPMKPLKEQLELIDTDIAFSDESENDSDYSPNDNQ
                     DGVHSSPVQSLPDRERDLLRPKQNPIDEPELANDVSRAQNRMEQGADISNELVESHAN
                     NLGADNTERRTSNRLSDEWSLSLTFQDVNGQGTPDVSPSNKPKVSFAPFPSSPDVDTK
                     AVINNSNHSTDHPHLDQKYQDAESITQTTPIESLPKWNVLHNSELTSLSEDVLTLNKY
                     FSDLLLYMNRIDASLASDLTGELTFFINSMPNEELALNFKNWIDQKGKEIFESFETTI
                     NTKIETLQRQFSTAKEFIQQIDDDSVLLEFANRFNIDF"
     gene            complement(<552686..>553882)
                     /locus_tag="KLLA0_E06095g"
                     /db_xref="GeneID:2894146"
     mRNA            complement(<552686..>553882)
                     /locus_tag="KLLA0_E06095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454221.1"
                     /db_xref="GeneID:2894146"
     CDS             complement(552686..553882)
                     /locus_tag="KLLA0_E06095g"
                     /note="similar to uniprot|P38431 Saccharomyces cerevisiae
                     YPR041W TIF5 eIF5 mediates hydrolysis of eIF2-GTP (SUI2
                     SUI3 GCD11) at start codons Translation initiation factor
                     eIF-5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454221.1"
                     /db_xref="GeneID:2894146"
                     /db_xref="GOA:Q6CPB8"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB8"
                     /translation="MSINICRDNNDPFYRYKMPPIQAKIEGRGNGIKTVVMNTMDVAR
                     ALNRPAPYIIKYFGFELGAQTAINVENDRYIVNGAHQPAKLQDVLDGFITKFVLCGSC
                     KNPETEIVITKDGDLVRDCKACGKRTPMDLRHKLSSFVLKNPPDSMNGSKKKKKAATA
                     SANVRGGGLSISDIAQGKSQAEAGDDAEENDSDDDELARQINAAASNLATIEVKDEDW
                     AVDMSEEAIRARAKELQGEADKETGEFSKLEEFGEWVLHEEELPTDIELYKKIAELEL
                     LEDPKVAAVLAQVLFDEDIVSDISEHTAFLQKLLKDEDFEKNFLGGIERFLGLDHQEL
                     IPLLPKILVQLYNNDIISEEEIISFGTKCSKKFVPKDVSKKVRRAAKPFITWLKTAEE
                     DDEDSE"
     gene            <554413..>555273
                     /locus_tag="KLLA0_E06117g"
                     /db_xref="GeneID:2894147"
     mRNA            <554413..>555273
                     /locus_tag="KLLA0_E06117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454222.1"
                     /db_xref="GeneID:2894147"
     CDS             554413..555273
                     /locus_tag="KLLA0_E06117g"
                     /note="similar to uniprot|P47133 Saccharomyces cerevisiae
                     YJR088C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454222.1"
                     /db_xref="GeneID:2894147"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB7"
                     /translation="MDLLKNKLLAIHKTGAWAILPPKEIDLAYKETKLLIDAGLNGLD
                     EISYFSMVELLFYLCLVRGEDTEAETLYKTVTDRLGDDSPRIHVMHSMLIQVTRSDDA
                     AKKYIEDLIKNQLEIATDSEDYVQMKKRLLAIERPSMSKEKWVKELLDLVEKFPLDAE
                     IWSLLSQEYQEAGDLRQAIYCMEEVIIGVPFSYEAFGQLAYLHYLKSQSDSDPEAALQ
                     SSLSNALRSVELAEAYVKGWGIVLKTSQKLNKKPELTQLAVRKLQELQQNNDNREITN
                     VSRYLLDSET"
     gene            complement(<555427..>556638)
                     /locus_tag="KLLA0_E06139g"
                     /db_xref="GeneID:2894561"
     mRNA            complement(<555427..>556638)
                     /locus_tag="KLLA0_E06139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454223.1"
                     /db_xref="GeneID:2894561"
     CDS             complement(555427..556638)
                     /locus_tag="KLLA0_E06139g"
                     /note="similar to uniprot|Q12199 Saccharomyces cerevisiae
                     YPR040W TIP41 Protein involved in regulation of the TOR
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454223.1"
                     /db_xref="GeneID:2894561"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB6"
                     /translation="MSDKSQPQNNARNRRSLGSGIPMIQVNQAREMFQATVRARHPGN
                     PQQPRETEIQSSMMRTTNTTVGGTTTNSSFQDTQSVTVATSMPKPSSKRSHEHDHKHT
                     HTHPHRSNNPNNPNCGHCGTVIVPSPVATIPAKDDPSVSVGDWTITTTKRPILSSDEI
                     DDWTEKLKFPIPEMIFGHSSVELKNTKTHWCIRFNPFHALSQVKLGDSGLRVSYSEKW
                     INSKLKNSQVTNTEEGLQFGKHWDWSYTTLYNGTVSEDSEYKFVVDNQYQLPIEKLTR
                     RDPILFYDDFILFEDELADNGISMLSIKLRVMAERLLLLCRFFLRVDEVLFKIIDTRI
                     YVEFNEDLVVREWKYMEDDYKTVLNKCRLNSNDPKKSLRDSNWVASVLPLKERVCEVL
                     RKKEDIEEVVE"
     gene            <557120..>557731
                     /locus_tag="KLLA0_E06161g"
                     /db_xref="GeneID:2894092"
     mRNA            <557120..>557731
                     /locus_tag="KLLA0_E06161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454224.1"
                     /db_xref="GeneID:2894092"
     CDS             557120..557731
                     /locus_tag="KLLA0_E06161g"
                     /note="similar to uniprot|Q12284 Saccharomyces cerevisiae
                     YPR037C ERV2 Flavin-linked sulfhydryl oxidase localized to
                     the endoplasmic reticulum lumen involved in disulfide bond
                     formation within the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454224.1"
                     /db_xref="GeneID:2894092"
                     /db_xref="GOA:Q6CPB5"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB5"
                     /translation="MSIKLKVGLHKQRIVTITTLLMIGLLWFTFSNSQLPIEGSPSLG
                     GTKSDLFGGLSANAKNDDASGTIMPKMPDQEAKKALGRASWKYFHTLLARFPDEPTEQ
                     EKTKLREFLYLYAELYPCGECSYHFVKMLKKYPPQVASRTTAALWGCHIHNLVNDHLE
                     KPRYDCNTILEDYDCGCTDENGNIDPSLKMNKVTLNKEEKQLG"
     gene            complement(<557869..>558141)
                     /locus_tag="KLLA0_E06183g"
                     /db_xref="GeneID:2894097"
     mRNA            complement(<557869..>558141)
                     /locus_tag="KLLA0_E06183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454225.1"
                     /db_xref="GeneID:2894097"
     CDS             complement(557869..558141)
                     /locus_tag="KLLA0_E06183g"
                     /note="similar to uniprot|P18852 Saccharomyces cerevisiae
                     YJR086W STE18 G protein gamma subunit forms a dimer with
                     Ste4p to activate the mating signaling pathway forms a
                     heterotrimer with Gpa1p and Ste4p to dampen signaling
                     C-terminus is palmitoylated and farnesylated which are
                     required for normal signaling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454225.1"
                     /db_xref="GeneID:2894097"
                     /db_xref="GOA:Q6CPB4"
                     /db_xref="InterPro:IPR015898"
                     /translation="MGELPYKIQELKLRRIEELNNKLRNELARERMTASNACLSIIDY
                     TSTHKDYAVPEVWGYPMVGENPYNNTMRKNNFARSHEETSACCTIM"
     gene            <558694..>559011
                     /locus_tag="KLLA0_E06205g"
                     /db_xref="GeneID:2894102"
     mRNA            <558694..>559011
                     /locus_tag="KLLA0_E06205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454227.1"
                     /db_xref="GeneID:2894102"
     CDS             558694..559011
                     /locus_tag="KLLA0_E06205g"
                     /note="similar to uniprot|P47131 Saccharomyces cerevisiae
                     YJR085C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454227.1"
                     /db_xref="GeneID:2894102"
                     /db_xref="GOA:Q6CPB2"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB2"
                     /translation="MDHPSFALAALATIGGTMGYIRKGSVPSLVAGLTFGGIYGYAGY
                     LLKNNADNGLEIALGASSVMLVTGIARGIPGRFKKPVPVVLTVLGGLGTWYYYKKYKE
                     FYP"
     gene            complement(<560535..>561809)
                     /locus_tag="KLLA0_E06227g"
                     /db_xref="GeneID:2894104"
     mRNA            complement(<560535..>561809)
                     /locus_tag="KLLA0_E06227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454228.1"
                     /db_xref="GeneID:2894104"
     CDS             complement(560535..561809)
                     /locus_tag="KLLA0_E06227g"
                     /note="weakly similar to uniprot|P47130 Saccharomyces
                     cerevisiae YJR084W CSN12 Subunit of the Cop9 signalosome
                     which is required for deneddylation or removal of the
                     ubiquitin-like protein Rub1p from Cdc53p (cullin) involved
                     in adaptation to pheromone signaling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454228.1"
                     /db_xref="GeneID:2894104"
                     /db_xref="GOA:Q6CPB1"
                     /db_xref="InterPro:IPR000717"
                     /translation="MAQLVYLCFRDNTLSEPFSNLIDMKYDHQIKVSKPSFKLPEFEK
                     VKQLIEICNELKRTYKKEPNGGSPQLFHLALEQLRVLNRIYENRTNWMTELLYQSGEQ
                     LYAIANKLDEIQNKLDGPEDTGDGDEEESYLIQAGRVMHMTLNICFKDRNERVDENRK
                     IGVFYIGTLLFKLYNRIKAYGLLNNMCKVFESHFNEIGPYLSRINNDLIVIRFKFYMG
                     LYYGYEKNNYALGFKWLQETFDICTLYESIPSTYKVRSQVLIYLIPMRILHLRHYPRL
                     APLRRTYPSVAKIYTMLVKSLCTGNLKLYEKFIEDNEFYLVKRNLYVTVLKMKELVEL
                     KLVKKAWILNGGNTKVPLDMLAKAFQISRGTPCHVTENVAPNHDQELDELECILATLI
                     SKNYIKGYLSHSHRVMMTSKTPFPGLAKPLER"
     gene            <562140..>562781
                     /locus_tag="KLLA0_E06249g"
                     /db_xref="GeneID:2894106"
     mRNA            <562140..>562781
                     /locus_tag="KLLA0_E06249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454229.1"
                     /db_xref="GeneID:2894106"
     CDS             562140..562781
                     /locus_tag="KLLA0_E06249g"
                     /note="some similarities with uniprot|P47129 Saccharomyces
                     cerevisiae YJR083C ACF4 Protein of unknown function
                     computational analysis of large-scale protein-protein
                     interaction data suggests a possible role in actin
                     cytoskeleton organization potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454229.1"
                     /db_xref="GeneID:2894106"
                     /db_xref="UniProtKB/TrEMBL:Q6CPB0"
                     /translation="MSKRVVSDSTGLYRLNIVNKERNNQDENTTEQKIHGNERDTEES
                     SPSKAGQPPSPRRTALKIDLSNTESNDQETEKEIMTKIAKVEDEILQCESKLVSLNQE
                     LKALQQKLRPVINQNAVDERSENTSLLSASPEKSLLGSPNSTWKLFKENGSNLLKKFK
                     DFTINDEQEQEYDDYLAKNRNNGIHHFTVKNGLNYEYDTGSEPDQDSNDSDQI"
     gene            complement(<562886..>564268)
                     /locus_tag="KLLA0_E06271g"
                     /db_xref="GeneID:2894108"
     mRNA            complement(<562886..>564268)
                     /locus_tag="KLLA0_E06271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454230.1"
                     /db_xref="GeneID:2894108"
     CDS             complement(562886..564268)
                     /locus_tag="KLLA0_E06271g"
                     /note="similar to uniprot|P41807 Saccharomyces cerevisiae
                     YPR036W VMA13 vacuolar ATPase V1 domain subunit H (54
                     kDa)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454230.1"
                     /db_xref="GeneID:2894108"
                     /db_xref="GOA:F2Z625"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:F2Z625"
                     /translation="MNSQFKHILLDSTHFQRIRHALNSRTIGWDALVRSSEISKFDGE
                     TTKSLESRLLKNQKLDLPLDTALTSLLHILETSNNLDVNKCVVNLFSQLLTLEPYNEQ
                     LVELLSKRGARDVLNQLYEHTLNKSFSDEQFNLISAFTLVSLLLQFNDTDLASKLLEN
                     KQFQSLFKSEHKDSLYLAIRLLQELTVTKAYKQLVWSQEAFYLPIVFQSIFSINENQP
                     QQTNTNNLQIQLQYYALMIIWLLTFDPKITEAFTKEHLAHYLQLLRLIRSTIKEKVVR
                     LSVAIILNGINESVKNHKSTVKNLILLGNAIPTLNQIMERKFLDDELKQDLTTLKESL
                     EAEYHELTSFDEYLAELNSKILLWSPVHQDDQFWLDNLDKFKENNWKLFLQLIDLLKE
                     FITEKRPSSVSLQILLNDIRKVMELDNDSIKILGKDKLIIMQLLQHSDSKVKYEALKT
                     TQVIVSNTFK"
     gene            complement(<564871..>565989)
                     /locus_tag="KLLA0_E06293g"
                     /db_xref="GeneID:2894685"
     mRNA            complement(<564871..>565989)
                     /locus_tag="KLLA0_E06293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454231.1"
                     /db_xref="GeneID:2894685"
     CDS             complement(564871..565989)
                     /locus_tag="KLLA0_E06293g"
                     /note="highly similar to uniprot|P32288 Saccharomyces
                     cerevisiae YPR035W GLN1 Glutamine synthetase (GS)
                     synthesizes glutamine from glutamate and ammonia with
                     Glt1p forms the secondary pathway for glutamate
                     biosynthesis from ammonia expression regulated by nitrogen
                     source and by amino acid limitation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454231.1"
                     /db_xref="GeneID:2894685"
                     /db_xref="GOA:Q874T6"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /translation="MAATSDIVEKTHILQKYLELDQRGAIIAEYVWIDSEGGLRSKGR
                     TLNKKVTSVDSLPEWNFDGSSTGQAPGHDSDIYLKPVAFYPDPFRRGDNIVVLAECWN
                     NDGTPNKFNHRHEAAKLFEAHKDAEMWFGLEQEYTLFDQYDQVYGWPKGGFPAPQGPY
                     YCGVGAGKVFARDVIEAHYRACLYAGVNISGINAEVMPSQWEFQVGPCEGIAMADQLW
                     IARYFLHRVAEEFGVKVSLHPKPLKGDWNGAGCHTNVSTKLMRAPGGMKYIEDAIEKL
                     SKRHNEHIKLYGADNEQRLTGRHETASMSTFSSGVANRGASIRIPRSVNKEGYGYFED
                     RRPASNIDPYLVTGIMCETVCGAIENANMTKEYERESL"
     gene            complement(<567309..>568625)
                     /locus_tag="KLLA0_E06315g"
                     /db_xref="GeneID:2894686"
     mRNA            complement(<567309..>568625)
                     /locus_tag="KLLA0_E06315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454232.1"
                     /db_xref="GeneID:2894686"
     CDS             complement(567309..568625)
                     /locus_tag="KLLA0_E06315g"
                     /note="similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
                     ACR184Cp and weakly similar to uniprot|Q12406
                     Saccharomyces cerevisiae YPR034W ARP7 Actin-related
                     protein involved in transcriptional regulation subunit of
                     the chromatin remodeling Snf/Swi complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454232.1"
                     /db_xref="GeneID:2894686"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q6CPA7"
                     /translation="MPTMKSVVIQISQTRVICGFSNQDLPQLIVPSQYLAYKRDGSDV
                     KVFGKWEMIEHCDDESAEIYQLYDKNGLPNDWDMMDAQWQYIFQSLGIQFEDYPVCVV
                     LPSDLNSARRKRFMEQLLGYGFPMVQLLNEAVCNTLSQGRSSGIVVDIGHSGVKVDVV
                     IDGVLFKQYRKENKIGGAFLNWQICDQYLKQDSGKSTKIWRDATEWLPNFKNSMLQVS
                     PIELDANYDVAPHYQHMVSPMDLTKNFLLDKKTLTFTNKQLYTIGELLFKPVIHVSNN
                     ANGDVEMADVNDIEKKPHPEKLIGVIGLIRACIQSLLNGVNAMSTAGSNTTGSSTTTG
                     NASSGNQSNNNEDTNIPTHSYTSEQLQSLLLTNILVTGSTSNIQGLEQRILNDVSVSL
                     NDLTTVRPKILFKQTKLDRNFQSWQSATTLCRLPLRESLHAWESIE"
     gene            <569076..>569423
                     /locus_tag="KLLA0_E06337g"
                     /db_xref="GeneID:2894485"
     mRNA            <569076..>569423
                     /locus_tag="KLLA0_E06337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454233.1"
                     /db_xref="GeneID:2894485"
     CDS             569076..569423
                     /locus_tag="KLLA0_E06337g"
                     /note="some similarities with uniprot|P47128 Saccharomyces
                     cerevisiae YJR082C EAF6 Esa1p-associated factor subunit of
                     the NuA4 acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454233.1"
                     /db_xref="GeneID:2894485"
                     /db_xref="GOA:Q6CPA6"
                     /db_xref="InterPro:IPR015418"
                     /translation="MDEQKKEYEKLKKKLRDALVQKKQLEAKWNSLEQEVYDKETEYL
                     SQKPSSRMGNILLGFQGFNKSSSAQQILSDHSHSSNAQPLDDNDRIFSLSSYLFAKQL
                     AASNHQEQTKSND"
     gene            <570159..>571193
                     /locus_tag="KLLA0_E06359g"
                     /db_xref="GeneID:2893754"
     mRNA            <570159..>571193
                     /locus_tag="KLLA0_E06359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454234.1"
                     /db_xref="GeneID:2893754"
     CDS             570159..571193
                     /locus_tag="KLLA0_E06359g"
                     /note="weakly similar to uniprot|P47127 Saccharomyces
                     cerevisiae YJR080C FMP26 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454234.1"
                     /db_xref="GeneID:2893754"
                     /db_xref="GOA:Q6CPA5"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /translation="MWRRSISILRPSPTTVIPSNVLSGSQLELKPLFDNHAETTREDG
                     SNVTTTQFQLLGDNPTLASIQVSPSIPLYVRHNSIVSIHDSDRLSNVNVSYNKWFTFW
                     PTLSLSRFDKLVGTNTFNCLVSSRKSSDTLSVLQLNGTQDWIVLNPKSVVSFEGNSSL
                     SIQWFHKWLNYFRWISNKVTVLRSYGKLSGRGNVLLNGNGSVYKLELKSEDDQIILQK
                     NRILAFNGLNKLDFKQAVTFEQTSKSLESDSQPETIHNNEDKIAFMKTVNTTLEFLKT
                     RWHTMSNTDFVRVKGPRTVLVQTDAKSSAQTWPTSTLSLKPAKNYLSFAKIDNGSVNF
                     KNTTSLLEKK"
     gene            <571704..>573293
                     /locus_tag="KLLA0_E06381g"
                     /db_xref="GeneID:2893788"
     mRNA            <571704..>573293
                     /locus_tag="KLLA0_E06381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454235.1"
                     /db_xref="GeneID:2893788"
     CDS             571704..573293
                     /locus_tag="KLLA0_E06381g"
                     /note="highly similar to uniprot|P07263 Saccharomyces
                     cerevisiae YPR033C HTS1 Cytoplasmic and mitochondrial
                     histidine tRNA synthetase encoded by a single nuclear gene
                     that specifies two messages efficient mitochondrial
                     localization requires both a presequence and an
                     amino-terminal sequence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454235.1"
                     /db_xref="GeneID:2893788"
                     /db_xref="GOA:Q6CPA4"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:Q6CPA4"
                     /translation="MIRSQLRIIRSITRTMSTPSEAVPKSGGKLQFTLKTPKGTKDWA
                     EKDMVIREAIFSQLSSLFKRHGGITLDTPVFELREILAGKYGEDSKLIYNLEDQGGEL
                     CSLRYDLTVPFARYVAMNNVQSIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDVAGTY
                     ESMVPDAEILSILVEGLTSLGIKDFKVKMNHRKILDGIFQIAGVKDEDVRKISSAVDK
                     LDKSPWEVVKKEITIEKGQTEETANIIGEYVKLNGSLETIHDILSKDKAFQANEKAVE
                     GLKEIETLISYVKAFGIQDYISFDLSLARGLDYYTGIIYEAVTAASAPPKNASELKEK
                     SKKQKKDDDDASEYVGVGSIAAGGRYDNLVNMFGEASGKKSTSIPCVGISFGVERIFS
                     LIKQRVEQSNNVRPTATQVFVMAFGGGKDWTGYLPERMKVAKMLWENGIEAEYVYKSK
                     ANPRKQFDAAEKSGCPLAVILGKEEYLENKLRVKRLGPEFANDDGELIDAADLISVVK
                     EKLSQVHENGVDEVTRLIKGL"
     gene            complement(<573381..>573974)
                     /locus_tag="KLLA0_E06403g"
                     /db_xref="GeneID:2893781"
     mRNA            complement(<573381..>573974)
                     /locus_tag="KLLA0_E06403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454236.1"
                     /db_xref="GeneID:2893781"
     CDS             complement(573381..573974)
                     /locus_tag="KLLA0_E06403g"
                     /note="similar to uniprot|P38162 Saccharomyces cerevisiae
                     YBL107C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454236.1"
                     /db_xref="GeneID:2893781"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:Q6CPA3"
                     /translation="MVVELVINTNLPELEDVSKEKLLRKGITFDPNEKLVLNRERCVN
                     PVLIDNFFRFLRHGSDDVLKQKLNNNKSEGSKDLNCNILLNQMLYPNWKVRSDVISFC
                     ESELKSMKTEVNDKFGSESDPKPLVTERIDPYAVKDIISERESHYKDCNSLETWINNQ
                     KDIERIIQIRTSSILSEQCGNDRDYIQDFQNFIKTKN"
     gene            complement(<574273..>577239)
                     /locus_tag="KLLA0_E06425g"
                     /db_xref="GeneID:2893782"
     mRNA            complement(<574273..>577239)
                     /locus_tag="KLLA0_E06425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454237.1"
                     /db_xref="GeneID:2893782"
     CDS             complement(574273..577239)
                     /locus_tag="KLLA0_E06425g"
                     /note="similar to uniprot|Q12038 Saccharomyces cerevisiae
                     YPR032W SRO7 Suppressor of rho3 yeast homolog of the
                     Drosphila tumor suppressor lethal giant larvae or similar
                     to YBL106C uniprot|P38163 Saccharomyces cerevisiae YBL106C
                     SRO77 Suppressor of defect in the small GTPase Rho3p yeast
                     homolog of the Drosphila tumor suppressor lethal giant
                     larvae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454237.1"
                     /db_xref="GeneID:2893782"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CPA2"
                     /translation="MFKSKKLKTVSNAIKSVASKDASNGISSKMFELSEVSRYGMNGK
                     VCTFAFDPVQSLLAIATDSGEIHVYGKQQVEVVFTLEVKAIKEMRFIKGIYLIVVDAK
                     DSLSVLSLHKKALLASFFPPGKITCIETDPSLNWVLIGLQSGATIVYDVDRDYLSPFK
                     IENLQKSRFFKREPLSPVVSLQWNPRDIGTVLIAYDKVTVLYSFVENDVKQQFIHEEG
                     ENVPKVLHSVFHPNGLNIMTVHDGNCLVFWDSNTGQKIVSRFLLDEDPLITSTVSTSI
                     FKVAWIQEKDENSTSLLFAGGSGDATTGDHSLTLINLGPTPIYTVTSYDKMATYYAQP
                     VSQKIIPVPNDASIINFLPLANGNPYYAGNFAPMVILVLLDDGEIETLLYPSGSITYK
                     ASLFPQSISWIRPAATTSYATSVPKKTWLGMMSATYNRDYILKGGYPAKKTLRVHDSR
                     SALSTGHTNGSVRIWDASHGELDESSVFDVNVSHSLNTSQSVAVDHISYAAETAELAV
                     SIESGDVVLYKFQVNQFFTSQKDVALEMNFRRFSLNDKPHEILVDIRDRAPNNIREGF
                     MPVTAVHARKGRVSSLCNSNVGFVAIAYEDGTIIVIDRRGPAMIYMDSISKISKVRSS
                     YVSQFEFTIMEYGEDGYSSILLLCGTDAGEVILLKIIPDPSGRFTVQPYDALKATDDG
                     PIVSLATFSKESGSSCRASIPRMQQLSKGLRVQAQIVISGRTDIRLITPGKSKDTHRI
                     FKYPIAVSGLSIVPFLNAKNEHSIATVLVTVLINGEIKVLSLPELKEIKSFAPLANVH
                     SKYVKESGVLVNGDIVYRVSKTEAFLLTVIKKSSTTSQSQNSEETDSLYNPNLRIKCR
                     PYYNSLQWVRGSIYCKPEDLDHLLGEGRPEQKYEEEKIAKGTISLSPEEKTHNTHELS
                     ANGRYQYQAPVRHSAKSGGYGPLRSISRAMQNGMDSIEDTFNDYATAANETMNDATDQ
                     IGKDLIKGAFNSKIGL"
     gene            complement(<577669..>581154)
                     /locus_tag="KLLA0_E06447g"
                     /db_xref="GeneID:2894083"
     mRNA            complement(<577669..>581154)
                     /locus_tag="KLLA0_E06447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454238.1"
                     /db_xref="GeneID:2894083"
     CDS             complement(577669..581154)
                     /locus_tag="KLLA0_E06447g"
                     /note="uniprot|Q8J213 Kluyveromyces lactis KLLA0E06413g
                     PKC1 Protein kinase C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454238.1"
                     /db_xref="GeneID:2894083"
                     /db_xref="GOA:F2Z642"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:F2Z642"
                     /translation="MDEDRKHTAFPVEQDIYKKIERERNIILGSNQLKKKTDNVMVIQ
                     KCNTNIREAQQNIEYLEQILAKLRVSQQPDNTPTSQNASNHPGFGQLSTISPDEFRYS
                     RLDLVKYDCPSLSQRIQYMLQQLEFKLQVEKQYQEANDKLTKLYQIDGDQRSSSAAQG
                     GSVESKHRIQLLTKSLKKYQAINVDIDPFNDHTEEATQPKFRRKQLSGTLTIGVTAIR
                     DVDHIQSPLFSRKPETFITIKVDDVVKAKTKPSRNDRWHEDFNIVIDKGNEVEVTIYD
                     KVNDRIVPVAVMWLLLADIAEEIRKKKVGQQQKQGKSHAEWMQASRLPPSQPANNTAV
                     ITKDLPQLPDAGIPTEDREANDTHTQSLTTNTWFILEPAGQILLTLGFNKSNTTQRKT
                     FMGGLHRHGAIVNRKEDIFEQHGHHFVQKSFYNVMCCAYCGEFLRYSGYQCQDCKFLC
                     HKKCYAHVVTKCIAKTSTDSDPDETKLNHRIPHRFEPVSNRGTKWCCHCGYILPWGRK
                     NVRKCTECGVMCHAQCAHLVPDFCGMSMEMANKVLLTIQDTKRTQQQRGFSGIKVNNK
                     PKPISKGFDGLNNRFETSFDHDDMHTSVIKPTTPSEARKDLVTDRLNNFITQHDSHYD
                     SFTSNVETSSPDHGNYQHSLDPGLSPDSMKKIQFDAAHISNLPQAHAQEHFAQEYEGN
                     YENKHPNKQDSGYVQDYGYEEELDDSEQSHYELRERLRKEEEERWYNEQNMLQQEQQQ
                     QTYSTGDVELATKKGDYDIIEETADVTDDQYSPPAQYEDLEYSLSTTETPELHAADIA
                     NITGKSSPSSPQKSYTSSTKHKKKSSKRRKVSLDDFILLKVLGKGNFGKVLLARSKNT
                     SNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENRIYFAM
                     EFIGGGDLMWHVQNRRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLTPEGH
                     IKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLC
                     QSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPKDALEIM
                     AEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEFTSAPPTLTPLPSVLSSVLQ
                     EEFRGFSFMPEDLQL"
     gene            complement(<581935..>584832)
                     /locus_tag="KLLA0_E06469g"
                     /db_xref="GeneID:2893916"
     mRNA            complement(<581935..>584832)
                     /locus_tag="KLLA0_E06469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454239.1"
                     /db_xref="GeneID:2893916"
     CDS             complement(581935..584832)
                     /locus_tag="KLLA0_E06469g"
                     /note="similar to uniprot|P38164 Saccharomyces cerevisiae
                     YBL104C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454239.1"
                     /db_xref="GeneID:2893916"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CPA0"
                     /translation="MGLIKRVPCWPNVEGLDFLSVNPTRDEVSHYRVKLDVETDESIV
                     KVNTVKDFGNITCLDYSNTDEGIVGVGEKSGVVRLFNILDTDDAYEPFDLRVRAKHQR
                     TINSLSINTNGLIAMGLDRNKHDASVQVWDVNYQSTESNVITPSFSYCLNESIVSLKF
                     VDDTSILAASSKLLKEIDLRAPNPIYQHPTRVSYDIKINPFNPWQFSTYADDGTLAFW
                     DRRKLASNSEDTEFLEAQPLLKFDKLVGHGAASRKYMNSCFRWSPLRSGEFSTLHAGT
                     TIKRWRLANVPDLESNNELNDSLFVSTVNDIKTTFDRVVTFDYIPKSTGRTSLLCMRQ
                     SGTIYRMNVEQGFSQSKINNYNSIMSISDQNNDVNELRITGEDEVSLLENLDTGLKNL
                     SFEDLDTGDDLKILTLDEKKSSGSMEDDGDYLSDSEDVKEFYIEAEKLLQNDISFIMR
                     KRASLGYGLDPMKTVEMMDKSDNFNNNIYIRNTWRWMAIAKASIADGTMVSGDLDLGY
                     EGVLGIWNGLEGLSNQNRYRSGGMLTEKQLNKELEKIIKMRSKSKNKIGNVSSLNSEM
                     SSKKAIQRRLCMIISGWDLSPSDYEEKYKSLIAQNHYEKAAAWAVFFGDVQKAISILG
                     SANKERLRLIAAAIAGYQAYSEKPGDNAWRQQCRKMAAELDDPYLRVIFAFIADNDWW
                     DILYESAISLRERLGVALRFLNDTDLTRFLEKTATTVIENGELEGLILTGITPNGIDL
                     LQSYVGKTSDIQTAALISVFGSPRYFMDPRVDEWVETYRHMLNSWEFFTMRAKFDVLK
                     TKLSRTSDGRITAKLKPRQMYLQCSKCKKNINRPIDVSSNASLPRHANQNLNAGKKFG
                     LNNTNGDVPQQKHSCPHCGTPFPRCAICLLPLGTSNLPIVINGTTNSCEVRIDDDAKI
                     NEVKERKRLKMNEWFSFCLKCNHGMHAGHAEEWFERHSICPVPGCSCLCHQ"
     gene            complement(<585024..>587207)
                     /locus_tag="KLLA0_E06491g"
                     /db_xref="GeneID:2893665"
     mRNA            complement(<585024..>587207)
                     /locus_tag="KLLA0_E06491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454240.1"
                     /db_xref="GeneID:2893665"
     CDS             complement(585024..587207)
                     /locus_tag="KLLA0_E06491g"
                     /note="similar to uniprot|Q12311 Saccharomyces cerevisiae
                     YPR031W NTO1 Component of the histone acetyltransferase
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454240.1"
                     /db_xref="GeneID:2893665"
                     /db_xref="GOA:Q6CP99"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6CP99"
                     /translation="MQTQEDGVRLREEVSFKHFYPDLDVNDLVLFGKNNHDELNDRHR
                     HDEEEVYPDDNLREHLKSWKQLIVNDSITIEMLGPQIKNAEFKRCKIRISQLNPHGKV
                     NKQLVKYGYRSHADRTCGLDQKSYCKKTDLLMKHSNEFFADVSPYQVNFKVEYDMDEQ
                     DDLFLRHLNTALTNSKHKLSHEVFEIVITILENEAFHLEKKIPPRVSPSATNNTHESH
                     AAWKHHELYGSDDGTGYPMDQPCAVCGGIECDNSNAIVFCDGCDIAVHQECYGVVFIP
                     EGQWLCRRCMISKNRKLECLFCPSTTGAFKQTDNGSWGHVLCGIWIPELYFGNLHYME
                     PIGGIENIPKSRWKLTCYICKQEVGACIQCSNKNCFAAYHTTCAKRAGLYMNFNGCTV
                     QEAASKNFSTGAFLESFCHKHSPNGWSSCEDGIRKTRDYFNHINHHKVLQDSAVEENK
                     QSAKKTIKNKWKTSRGTLIAPQAFADITMRVLNRFHVPNSEQISLDICKYWTMKRELK
                     RGAPLVRKFSPSSLNTLDTEELNDRIVFSEVLLRDLNSLEGLASSLVAKQECNVERVR
                     NQRIINDIAFHPIRYILKDVVWNNLTKTLSFKSFADLESSSNFKVIPYISSRLENDEY
                     LSVQEFKDEFVGNIVKITSNERSPRSLVIMGSKLINDLNKLLSKIDELDVHTLLHDDF
                     DIDERTHQVEEVNWKGRKILAREGLADVEDLSIKQERQLKGLLRD"
     gene            complement(<587745..>589223)
                     /locus_tag="KLLA0_E06513g"
                     /db_xref="GeneID:2893614"
     mRNA            complement(<587745..>589223)
                     /locus_tag="KLLA0_E06513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454241.1"
                     /db_xref="GeneID:2893614"
     CDS             complement(587745..589223)
                     /locus_tag="KLLA0_E06513g"
                     /note="weakly similar to uniprot|P38165 Saccharomyces
                     cerevisiae YBL103C RTG3 Basic helix-loop-helix-leucine
                     zipper (bHLH/Zip) transcription factor that forms a
                     complex with another bHLH/Zip protein Rtg1p to activate
                     the retrograde (RTG) and TOR pathways"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454241.1"
                     /db_xref="GeneID:2893614"
                     /db_xref="GOA:Q6CP98"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:Q6CP98"
                     /translation="MDFENDDLLDQFLQQNHNAHVGSSFGMRLSSSNTPVPMNIPGSH
                     GELSLEPGLGTSASTNHTAHTSKYVINELPDSQSSFTNANVHNNIHLPQSRQQSITGQ
                     QIETGTVATSFMDEYLSPASRGESDRNQKQDFDHINLDETTKNLFDEPMFREHLQGSQ
                     ATDDLVSNFTDDFVSSLGSSIHSDLMTPVSSYQPQPMNSFDSHSYNQLSSSLRSPSAS
                     YRGASQLSSSLRSNRGSQQFPTSSSLTSTPKDMNSSALTQDEKIRRRREFHNAVERRR
                     RELIKAKIKELGTLVPPTLLHFDDFGKKVKPNKGTILKRTIEYMDCLKQVLEIQDAKK
                     EELRKKIAELERKKSDLTNSSLLQSGAYPKTSQNYQHISKSESPITHHISSEQYQQQR
                     HQQQQQQQQQQQQQQQQQQQQQQAHINNEYINDDEQYPERIIDSRTYPMLVKETNAGA
                     NAIHDDLQQFLSGTLMENEDNSKLMFSGRAENPVDLLLDFEE"
     gene            <589706..>590347
                     /locus_tag="KLLA0_E06535g"
                     /db_xref="GeneID:2893615"
     mRNA            <589706..>590347
                     /locus_tag="KLLA0_E06535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454242.1"
                     /db_xref="GeneID:2893615"
     CDS             589706..590347
                     /locus_tag="KLLA0_E06535g"
                     /note="highly similar to uniprot|P38166 Saccharomyces
                     cerevisiae YBL102W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454242.1"
                     /db_xref="GeneID:2893615"
                     /db_xref="GOA:Q6CP97"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:Q6CP97"
                     /translation="MSENNPEVNNLRDSLNRWNESRNAHSQGFNEGAKTIFASWADSI
                     NERAQDVYQRLPLTQQDLTANPEPEWFSLSRTERLSLFVCFILGAVACFTICVFLFPV
                     LAVQPRKFGLLWSMGSLLFIFAFGVLQGPVAYMRHLTSRERLPFTVFFFVSCFLTIYF
                     AAFTKSTLLTIPCAILELIAVIYYAISYFPFGGTGLRMISSIGLNQARGVLRI"
     gene            complement(<590423..>593785)
                     /locus_tag="KLLA0_E06557g"
                     /db_xref="GeneID:2893667"
     mRNA            complement(<590423..>593785)
                     /locus_tag="KLLA0_E06557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454244.1"
                     /db_xref="GeneID:2893667"
     CDS             complement(590423..593785)
                     /locus_tag="KLLA0_E06557g"
                     /note="some similarities with uniprot|P38167 Saccharomyces
                     cerevisiae YBL101C ECM21 Non-essential protein of unknown
                     function promoter contains several Gcn4p binding elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454244.1"
                     /db_xref="GeneID:2893667"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6CP95"
                     /translation="MSFFSSHLGSSSGKQKDGNRKRSSSIKQAFASILGASGSKSSGS
                     TLSRSNSNGRSASVPSSNSARRASSRRPSGAYGTSAMPAGFSPMMAFGTPYSIYGYQD
                     YGAPQNELAMSSEEGTDNEIDEDQGDSSLLDYSLGGNDSDGDLGNDIYTSSLQPSRFQ
                     SQPNRRMSNDDERGGPFSVVSDDEDDDEYDGPDNENDGDDEGDDDDFEENCLGRRITR
                     VSTAFSATGSQISNTVVNRKKTAKTCLLNYLADRGLLRPRLLSSKNGVTFHVATSGDN
                     IFLPTISPTDDEYLNHLSRLNDDDDDGAFGDALERLATRDPSEFSRSDVVPTGSHSTI
                     FANRENESLATGNSEFASSNPVQSSLTEETGNGNTTNIEPTDSYTAMDDDSPAADSEN
                     IPYNIAVIMSLKKQMELSSVKAELYSRVRVYWSNGLPPDKMETEEYYTGGHLDWEFNT
                     DNYNLYVGFSAADQELVIIENTQNLCRRKNFKNIQDFGDRPYLKKQKTKDNFLKDINE
                     ASDTNSCTFQPGDYIFIVPVVFANNIPETICLPSARVNYHFRCAAKVINSDNTDSANN
                     DSTKSNDNDSGLSNNGTGSTLAFQSNSNDDSNPPSSAGDGTTSHFKFGGGKLFKKMKN
                     HLHLPSYHGISKTDYQKMVYSHMALNLVRTPPLRSISTADKPIYINRIWTDSLSYEIS
                     FGQKYVPLDVEIPLKLKLVPLVKHLSVKRIRICVVEKITYVSKNLQYEFDQVELVAND
                     PYSPYYPEFSSRRKPERILPLLEIRTRDKGGRAMKEEIVENCKSDNLLCYSTVRDENT
                     NSNVEMVEALTIDTKLKFPKYKLLNKKSARSVPPYGIDEFTQLENIKSNSTSRRGSTT
                     SGVIDFLSGRKSRKNSSISNNLDLPKPTTKFRTNSNLPIVNHTRLNEPKRGLYASSVN
                     FSHINVKHKLEIMLRISKPDATDPTKQRHFEVLIDTPVHVVSELCTSDNLELPTYAMA
                     TMSHPDKDTTISFHEPLPSFEEAISVPNSPRVSPIGTPQLRATYDPDDLSIQQLMLSR
                     ASTQNVDDLQSASSVARRYSNIDEMMGQSGLTTARSPNPGPTVTFKESFMKQGMKAES
                     SLEESLDSDSEDAEAILSDDEPPTYEEITPLM"
     gene            <594361..>596763
                     /locus_tag="KLLA0_E06579g"
                     /db_xref="GeneID:2893871"
     mRNA            <594361..>596763
                     /locus_tag="KLLA0_E06579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454245.1"
                     /db_xref="GeneID:2893871"
     CDS             594361..596763
                     /locus_tag="KLLA0_E06579g"
                     /note="similar to uniprot|Q12028 Saccharomyces cerevisiae
                     YPR029C APL4 Gamma-adaptin large subunit of the
                     clathrin-associated protein (AP) complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454245.1"
                     /db_xref="GeneID:2893871"
                     /db_xref="GOA:Q6CP94"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:Q6CP94"
                     /translation="MGSLRTFIKEVRAAKTLAEERSIVTKESARIRTKLKDDHISLER
                     RRKYINKLLYLYILGEKTHFAQVECINLIASEDFADKRVGYLAAVLLLDENQELLTLL
                     TNLLNNDLNHPSRYVVSLAINALGALTSPELARDLYTDIKNILEHSRDSFLIKKALAC
                     SGKLIARDPSLLEIFAPYANKMLSSKESTSHGVLIGTNKLIQAIIINTKSYEFDNLPE
                     IIDKLSSLIPDLLGKLHHLNLGSSNPEYNVGGCLDPFLQVELMTTLRLFLQYFPEQTK
                     PYKNNYLDTLTRVATYTPTTSNSCTSVLYEAVRTIFSFQAERSLRVLGVNVLGNLVAD
                     KDYNTKYVSLNALLDVVSVEPQAVQRHRKFISRCIFDSDISIKKRALEMTFAILNQTN
                     MRELIAEILTFLEKAGENDKGLILYCVDQLIMVFDLQDEIDDSWKLDVIVKILKFVGQ
                     YISVEKTTDALIMINNNSNLEHKKQVVSNIINVALDNDSSQVSDENLAWRVVSIWCIG
                     EYADLILGNGRCTETNLTGYLYESDSLYCDNPMVTSYVLLAALKLSVKIDTKVLSNRL
                     RQLIKGHTENTNVMIQTKAVQYGILFNESTSVKAALLEPMPIFHKKVSETAALRTFSQ
                     KVPAPAIKKVKKKENDLLLDLLGDLSTPETTAPTKPSNDLLSNLSNTPAPQSSNQNGS
                     TLSSSFQQRIEIPPNSINIHSSDIVEVYGKVESSIPGCTEIDLFLKAKTNINTLQILI
                     AVPKSQKAEFGSLSSHKVATGEVAKQGLKILGSGKIKLRVKLNINSTEDQFDYKFENI
                     PH"
     gene            complement(<596942..>597586)
                     /locus_tag="KLLA0_E06601g"
                     /db_xref="GeneID:2893873"
     mRNA            complement(join(<596942..597433,597536..>597586))
                     /locus_tag="KLLA0_E06601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454246.1"
                     /db_xref="GeneID:2893873"
     CDS             complement(join(596942..597433,597536..597586))
                     /locus_tag="KLLA0_E06601g"
                     /note="similar to uniprot|Q12402 Saccharomyces cerevisiae
                     YPR028W YOP1 Protein that regulates vesicular traffic in
                     stressed cells either to facilitate membrane turnover or
                     to decrease unnecessary secretion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454246.1"
                     /db_xref="GeneID:2893873"
                     /db_xref="GOA:Q6CP93"
                     /db_xref="InterPro:IPR004345"
                     /translation="MADYLKLFQDSLKGLDTKFAGNQILSRIEAQTKLPRSYVIVGLV
                     AVYFLLIFINVGGIGEILSNFVGFCIPTYYSLKALKTATSTDDTQLLTYWIVFSFLSV
                     IEFWSKAILYWVPFYWFFKTVFLLYIAIPSFGGAQLVYTRLISPFSDKYLPIVEGKSG
                     ELAQKVEAAANNAKASGYSR"
     gene            597877..597949
                     /locus_tag="KLLA0_E06623r"
                     /db_xref="GeneID:9487338"
     tRNA            597877..597949
                     /locus_tag="KLLA0_E06623r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:9487338"
     gene            complement(<598212..>601655)
                     /locus_tag="KLLA0_E06645g"
                     /db_xref="GeneID:2893876"
     mRNA            complement(<598212..>601655)
                     /locus_tag="KLLA0_E06645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454247.1"
                     /db_xref="GeneID:2893876"
     CDS             complement(598212..601655)
                     /locus_tag="KLLA0_E06645g"
                     /note="similar to uniprot|P48016 Saccharomyces cerevisiae
                     YPR026W ATH1 Vacuolar acid trehalase required for
                     trehalose utilization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454247.1"
                     /db_xref="GeneID:2893876"
                     /db_xref="GOA:Q6CP92"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:Q6CP92"
                     /translation="MLIVPFILFSVAILAPIYFYLTKPLPLQHTHFGSFVCAEDTLFC
                     PESQRKASEKMYSLLKDHENTFYDEEQQILGNLLLSENTFSRQPYVANGYIGSRIPNL
                     GFGYALDTINVWVNDSSIPGALDNGWPLRNQRFAGAFISDFYCLQEKLNSTNFPELDD
                     DGYSTVISTIPQWTDLSILKHTTTGQIEYINPTDVKLDKITNYMQNLSLQDGIVTTTF
                     VYDKQLLVTTKVVAHRKIYPLGVVTLELSLFDNNSDTSADNENEYVELEICDSLNFST
                     SHRTVLNDYGYDQNNEGIFMVVEPENVPYSNASLFSYFDIPSRDTLTLSKYSDSISQC
                     TTQILKANSTFVAHKYIGIISSEYDNKQPDDNSNGTSNEALKMSNLERATSIVLDNKG
                     NYDSLIQSHKNAWKRIYKDASIEIPSDGLLEMTAKSSIYHLLANTRSHNVSEDRGLPI
                     GVSGLSSDSYGGMVFWDSDLWILPALLPFFPNAARQINNYRNASLHQAKLNAEKYGYD
                     GALYPWTSGRYANCTSTGPCVDYEYHINVDIALSSFAIYMNGDEDDERSEEYLRYTTW
                     PFVENAAKMFAQYVKWNDTMQQYTTHNLTDPDEYANFVDNAAFTNAGIQSVMVWAHDI
                     ARHLGIDPDPQWLEIADNIHIPISETNITLEYSGMNSSVEIKQADVVLMIYPLSYITD
                     QSILNNAIKNLYYYSERQSASGPAMTYPVFVAGAASLLNYGSSSQSYLYKSVVPYLRS
                     PFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILFGLTGLRYSYEVDEDTGKIHR
                     LLKFNPIQLPLLPGGIRINNFKYMGQVLDVLITDTEGIIIHKNGTKEIRIKVPDRTLI
                     PDVDVKYSEETDPIKQILHGRRSVPTGKNYFTIQPGDVFKTPLYIPKKNLEGNLVEAK
                     QITNLTAGVPGDVAVSVIDGNNFTHWQPAYKNLPARLLIDMGNNFTQEIKSGKIIWGS
                     RPAKTFSLSILPQTEEVFKNLTHILSNVNQYCNKTGDECVRDLERTEKGFDAAIEDVF
                     DWYGIDPDSIISTHPELKDMKTKFVKILDHYKVTPSEPYPWRVYNESQIVLLPGNETD
                     FDIDYSKVAEMNPENVDIDFRGNQTDWRKGRFIVLTVHDTYDDDDDEKGATIKEFALF
                     P"
     gene            <603277..>604923
                     /locus_tag="KLLA0_E06667g"
                     /db_xref="GeneID:2894293"
     mRNA            <603277..>604923
                     /locus_tag="KLLA0_E06667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454248.1"
                     /db_xref="GeneID:2894293"
     CDS             603277..604923
                     /locus_tag="KLLA0_E06667g"
                     /note="highly similar to uniprot|P07251 Saccharomyces
                     cerevisiae YBL099W ATP1 Alpha subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454248.1"
                     /db_xref="GeneID:2894293"
                     /db_xref="GOA:P49375"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLSRSAIRSASRSVVAANLVRSMNRVARPALVVAGRRFASAKAQ
                     PTEVSSILEERIRGVSEESNLNETGRVLAVGDGIARVFGLNNVQAEELVEFSSGVKGM
                     ALNLEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVGVGPELLGRVVDALGNPIDGKGP
                     INASGRSRAQVKAPGILPRRSVHEPVQTGLKSVDALVPIGRGQRELIIGDRQTGKTAV
                     ALDTILNQKRWNNGTDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDALKYSIIVAATA
                     SEAAPLQYIAPFTAAAIGEWFRDNGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAY
                     PGDVFYLHSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFL
                     EAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDL
                     DASTKQTLARGERLTQLLKQNQYSPLAAEEQVPLIYAGVNGYLDNIDISRIAEFETKF
                     LAYLKANHDEIVSAIREKGELSKELLATLKSATESFVATF"
     gene            <605566..>606762
                     /locus_tag="KLLA0_E06689g"
                     /db_xref="GeneID:2893669"
     mRNA            <605566..>606762
                     /locus_tag="KLLA0_E06689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454249.1"
                     /db_xref="GeneID:2893669"
     CDS             605566..606762
                     /locus_tag="KLLA0_E06689g"
                     /note="similar to uniprot|P37366 Saccharomyces cerevisiae
                     YPR025C CCL1 Cyclin associated with protein kinase Kin28p
                     which is the TFIIH-associated carboxy-terminal domain
                     (CTD) kinase involved in transcription initiation at RNA
                     polymerase II promoters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454249.1"
                     /db_xref="GeneID:2893669"
                     /db_xref="GOA:Q6CP90"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR027081"
                     /db_xref="UniProtKB/TrEMBL:Q6CP90"
                     /translation="MLKGSDYSSAVGSSITESRMPNMSAENSTVEPTPVPEPTPTTET
                     KKAESKRITDDDLYRHSSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDIISKHND
                     LSQEELNAINEKAVPVTMEEELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFL
                     VNSTMEIHPKHILLASIFLACKSENYFIGIEAFAKKTKSQPTTILKYEFDVLESLQFT
                     LLNHHPYRPLHGFFLDIQYILHGKVDLNYMGQIYTNCKRRITETLLTDVVYHYTPPQI
                     TLACLLIDDEALTLKYLEVKFGSPPEEQKDSETEGLKTEETPSDTKLPSNLKLQTLTA
                     LIRECQAMILNVETLSKEEATKIDAKLHYCQNPMLLVDRMRRQKQQRDSSAELTTEPD
                     SKKLKV"
     gene            complement(<607187..>609496)
                     /locus_tag="KLLA0_E06711g"
                     /db_xref="GeneID:2893671"
     mRNA            complement(<607187..>609496)
                     /locus_tag="KLLA0_E06711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454250.1"
                     /db_xref="GeneID:2893671"
     CDS             complement(607187..609496)
                     /locus_tag="KLLA0_E06711g"
                     /note="highly similar to uniprot|P32795 Saccharomyces
                     cerevisiae YPR024W YME1 Mitochondrial inner membrane
                     protease of the AAA family responsible for degradation of
                     unfolded or misfolded mitochondrial gene products mutation
                     causes an elevated rate of mitochondrial turnover"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454250.1"
                     /db_xref="GeneID:2893671"
                     /db_xref="GOA:Q6CP89"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CP89"
                     /translation="MTLPVLIGVSGLCAKNASRVLIRQAPVLTGPILRTLHRKHFLTG
                     SVLQNRLYSDKNQTGKDHNGVTGSQHSEDSKNTVNGATSGAENVQQPKQLNGINSSDI
                     DPANGPVSHAVLATKEQQANKDLSNPSAQAEFYKLLLKSNYPQYVVSRFETPGITSSP
                     ECMALYMEALQRIGRHADAESVRQTLLTTAPAGSIPPAVASSGASSAASANGAAAQVT
                     GGVSSGYSGIYNPYMGSKKEPLHVVVTESTFSIVSRWLKWLIVFGAVTYGLTEGFKYI
                     TEHSTLFKTNEVADKSVDVAKTNVRFDDVRGCDEARAELEEIVDFLKDPTKYESLGGK
                     LPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQAR
                     ARAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPES
                     LDKALTRPGRFDKVVNVDLPDVRGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAE
                     LMNLVNQAAVYACQKNAIAVDMQHFEWAKDKILMGAERKTMVLTEATKRATAYHEAGH
                     ALMALYTAGATPLYKATILPRGRALGITFQLPEMDKVDITKKECLARLDVCMGGKIAE
                     ELIYGKENTTSGCGSDLQNATNTARAMVTQYGMSEQVGPVNLADKWDSWSGKIRDVAD
                     NEVLELLKASEDRTRALLAEREKELHRLAQGLMEYETLDSTEIQKVCKGEPINKMKMA
                     TTTVVEGPDSDDRKEIGGDKSKIPVLIKA"
     gene            complement(<609924..>612242)
                     /locus_tag="KLLA0_E06733g"
                     /db_xref="GeneID:2893674"
     mRNA            complement(<609924..>612242)
                     /locus_tag="KLLA0_E06733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454252.1"
                     /db_xref="GeneID:2893674"
     CDS             complement(609924..612242)
                     /locus_tag="KLLA0_E06733g"
                     /note="similar to uniprot|P38170 Saccharomyces cerevisiae
                     YBL097W BRN1 Essential protein required for chromosome
                     condensation likely to function as an intrinsic component
                     of the condensation machinery may influence multiple
                     aspects of chromosome transmission and dynamics"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454252.1"
                     /db_xref="GeneID:2893674"
                     /db_xref="GOA:Q6CP87"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:Q6CP87"
                     /translation="MTTQLPYDDDDNGLFTNKSTMMANFEEWIKMATDNKINSRNSWN
                     FALIDYFHDLNVLKDEEDNINFQKASATLDGCVKIYSHRVDSVATETGKLLSGLAERK
                     GRQIRSNTNGENDDGDEEDDDSLEVDPLTGLPIARDDPETLAKKKRTYNRVLETTLVD
                     FESIRLKDLAQNLSIDPLFKKALADFDEGGAKSLLINTLHVDEKLRVVFDATTTEPEQ
                     EQPQPLASTESQVQEENNEVSESAKETSEVFGLDSEKGSANEENVESTPDTSVTLLED
                     DILDLGVKFLDFNTIETSILCPSMDQLQSAVADIGKAKSFVEGVNGQSDKFLTEKDLE
                     TLPELDAEAEFNYEMPPEDGEDVAVDAGSMDYVEPADNIHEPEEQLALSNQQNMSQID
                     DKSYGDASVLDQELLSYFDAAIGQNWRGREHWKVRNIKDKLSKESVAKPQQPTEADGN
                     HEPAVEKKVPKKQFEIDFLDLNDNIEEEIFANKKGFIDLSVKQRTNDSHFLLPDDYKF
                     TTDKITRLFIKPEQKMSFFSHRRISKARLPGSLKFDDTEIKEVSNIPEIADERFWAEN
                     YQLHEREEEHKQDDTQIERSTNPSFEEDNGIDFNQAFEDEDLDMDTKEDFVNTQGLVA
                     NNKMTYSRTSKKVDVRKLKNNVWKSIWQRLHVLKTDEQNGETTRNEETTQNDIESEAH
                     LTEEKQGKQDISAEISTKAEGYDLKFTDIAHDIVNMYTSSAKKDLSTSFCFICLLHLA
                     NEYGFTINDTTNYQDLDIRFPEKIADAIIGKE"
     gene            complement(<612941..>614944)
                     /locus_tag="KLLA0_E06755g"
                     /db_xref="GeneID:2893676"
     mRNA            complement(<612941..>614944)
                     /locus_tag="KLLA0_E06755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454253.1"
                     /db_xref="GeneID:2893676"
     CDS             complement(612941..614944)
                     /locus_tag="KLLA0_E06755g"
                     /note="weakly similar to uniprot|P30606 Saccharomyces
                     cerevisiae YOL103W ITR2 Myo-inositol transporter with
                     strong similarity to the major myo-inositol transporter
                     Itr1p, member of the sugar transporter superfamily;
                     expressed constitutively"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454253.1"
                     /db_xref="GeneID:2893676"
                     /db_xref="GOA:Q6CP86"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CP86"
                     /translation="MDNKEVKSSPSVEDVNSSTKKSADLSNAEVTSFHEAKRKSAGGG
                     VFVAMNDDSSISSIGEDPEGRDPNSVQEENILAEYSEEQVMNMGRAFAKKYELPNDDD
                     IFARGAALARKPNEYDRLNVLKEDERIACYDEIHHPWRVPPKLIAIIAASAMGAAVQG
                     MDETVINGANLFYPKELGLGSGSKRDDWLEGLVNGAPYLCCAGVSCWATDWLNNMFGR
                     KKVIFITCAISAITCFLQAFGPAGTPGWHYLFAMRFLLGFGIGPKSATTSVYLAECST
                     KKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAILVL
                     VQIPFCPESPRWLMGKGRYKEAYESTLQIRNHKILACRDLFYQHVLLMEENSLEMSYW
                     TRLREIFTVRRNRNALICAFICAFMQQFCAINVIAYYSSAIFLQSGFTEISSLCASLG
                     FGLINFFFAIPAFFMIDRFGRRFLLLNTFPWLAVFLLITGFSFWIDDTEKRIGVVSMG
                     IYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFTIVLWGFNFILSLTWPSMLRAF
                     EPQGAFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVFDVPLRVRAKYQLLELWPNI
                     QENLLRRKNVKRQPPLDKHHRMAIKAAEWNEKAEAEELEVTEI"
     gene            <616703..>617452
                     /locus_tag="KLLA0_E06777g"
                     /db_xref="GeneID:2893845"
     mRNA            <616703..>617452
                     /locus_tag="KLLA0_E06777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454254.1"
                     /db_xref="GeneID:2893845"
     CDS             616703..617452
                     /locus_tag="KLLA0_E06777g"
                     /note="similar to uniprot|P38172 Saccharomyces cerevisiae
                     YBL095W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454254.1"
                     /db_xref="GeneID:2893845"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6CP85"
                     /translation="MSGKISRYVILPLTGFTLGFGYFVKPWHLDESALQTLHRPLQDQ
                     RTDVLDKLRATEWVKKLKESSDYMMHRQSEKIPVPHRDYHVGQGLLYGPTKLEIDPVV
                     FTDNAQNKIHVIYHLGHNLGNEKNAVHKGVLSLLLDEALCFCGFPTLPSKRGVTASLD
                     ISFQKDVPVNSTIVLNAQVIETKGRKCIITGTLESPPLDPSTKLGSVKSLVAKSVPNW
                     IYNPKPTVYATATCILVEPKWFKYVSWINIF"
     gene            <618131..>619678
                     /locus_tag="KLLA0_E06799g"
                     /db_xref="GeneID:2893847"
     mRNA            <618131..>619678
                     /locus_tag="KLLA0_E06799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454255.1"
                     /db_xref="GeneID:2893847"
     CDS             618131..619678
                     /locus_tag="KLLA0_E06799g"
                     /note="similar to uniprot|P38682 Saccharomyces cerevisiae
                     YER122C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454255.1"
                     /db_xref="GeneID:2893847"
                     /db_xref="GOA:Q6CP84"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q6CP84"
                     /translation="MASIDESGEVYCDKEVVTKVFARLTTKSENRACFDCGAKNPTWT
                     SVPFGVLLCIDCSGEHRNMGTHITFVKSSNLDKWTVNNLRRFKLGGNDKAKDFFLKNN
                     GKQYLGSSSNRMAKYTSQVAKKWQSHLNQKVARDAEQHPGEIVFSAEDEQEFTGGSSG
                     SSKSNSVDDFFSNWEKPVNQSNISLTSSPRNLTPTNTGNRNGSSILSGSGSANKTSNG
                     ARSTTTKRTTLTGSAGSSQAKKHSILSSSRKSKKPVAAKKVDADLFDQFEKEAKEEEE
                     LASSLATTSLNSNNLSNSIYDATPAPFQQKSGFSSSSKITKPSTNVEDAEDDEWSNRY
                     NDGITFDQINASNVGLTGSKDAAKPKLAKLGFGMTSNNAEKEQNKTNESRRAASGPKY
                     TGKIAQKFGEQKGISSDQVFSRGSYDDEASKEAQEKLRQNFSNATSISSASYFGEGQS
                     EDQFDEFGRPLNPQNGTRTNRSGSLGGRNFMEFTSGADDEFDLLKNAVEQGAQKLGNY
                     LRDYMRN"
     gene            complement(<620417..>621037)
                     /locus_tag="KLLA0_E06821g"
                     /db_xref="GeneID:2893848"
     mRNA            complement(<620417..>621037)
                     /locus_tag="KLLA0_E06821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454256.1"
                     /db_xref="GeneID:2893848"
     CDS             complement(620417..621037)
                     /locus_tag="KLLA0_E06821g"
                     /note="similar to uniprot|P25046 Saccharomyces cerevisiae
                     YBL093C ROX3 RNA polymerase II holoenzyme component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454256.1"
                     /db_xref="GeneID:2893848"
                     /db_xref="GOA:Q6CP83"
                     /db_xref="InterPro:IPR013942"
                     /translation="MATSHEDGSATHPNYYYYVDPSLPVYESQQPNPVDDLITIYGLE
                     EVARQVARTNADGTKAVKLRKSYKNQIQDLSGRFITIPSRENGKGGEISDVIFQNNPD
                     MMNQAKLVEGMSEEEYRDAMMKRDTGLFEPPQMDWDMCSTVIGQLMKSHPSEFKNSGF
                     DVDDLAFDLNGTGTKTKKRKYKSNGSSMASPNTELQPDDMKRRRLE"
     gene            <622701..>623093
                     /locus_tag="KLLA0_E06843g"
                     /db_xref="GeneID:2893851"
     mRNA            <622701..>623093
                     /locus_tag="KLLA0_E06843g"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_454257.1"
                     /db_xref="GeneID:2893851"
     CDS             622701..623093
                     /locus_tag="KLLA0_E06843g"
                     /note="highly similar to uniprot|P38061 Saccharomyces
                     cerevisiae YBL092W RPL32 Protein component of the large
                     (60S) ribosomal subunit has similarity to rat L32
                     ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_454257.1"
                     /db_xref="GeneID:2893851"
                     /db_xref="GOA:Q6CP82"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="InterPro:IPR018263"
                     /db_xref="UniProtKB/TrEMBL:Q6CP82"
                     /translation="MAASLHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRR
                     RFRGNISEPTIGYGSNKKTKFMGPDGRKVVLVSNVKGLTPLLMHTKTFAAEIAHNVSS
                     KNRIAILAEAKKNGIKVTNAKARLALEA"
     gene            complement(<624007..>624831)
                     /locus_tag="KLLA0_E06865g"
                     /db_xref="GeneID:2893613"
     mRNA            complement(<624007..>624831)
                     /locus_tag="KLLA0_E06865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454258.1"
                     /db_xref="GeneID:2893613"
     CDS             complement(624007..624831)
                     /locus_tag="KLLA0_E06865g"
                     /note="similar to uniprot|P40075 Saccharomyces cerevisiae
                     YER120W SCS2 Protein likely to be involved in regulating
                     INO1 expression suppressor of a dominant nuclear mutation
                     that is inositol-dependent in the presence of choline
                     involved in inositol metabolism regulator of INO1
                     expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454258.1"
                     /db_xref="GeneID:2893613"
                     /db_xref="GOA:Q6CP81"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:Q6CP81"
                     /translation="MLRYSILCFCYYAFDILTSFQIIISMFNGIIFAIPLFNVIYLSV
                     FVIAPFTSQAAEHITIKNDSEQTIAFKVKTTAPKVYCVRPNAALVPAGESVDVQVILL
                     GLKEEPTPDFKCKDKFLVIALPAPYDLGELSVAEAWPQLEAEFKNKGLSKKIKVNYQL
                     DAEPRVVENLETDNVQTETVIPSAKETIASGSKATEESASEPVQKKSVPVASANTDLD
                     TEKPKVVESEPKLDEKVKSDTSANTEIIAEPASTSNIAPAVVIWIVIGFLLWYWLS"
     gene            complement(<625608..>626864)
                     /locus_tag="KLLA0_E06887g"
                     /db_xref="GeneID:2893912"
     mRNA            complement(<625608..>626864)
                     /locus_tag="KLLA0_E06887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454259.1"
                     /db_xref="GeneID:2893912"
     CDS             complement(625608..626864)
                     /locus_tag="KLLA0_E06887g"
                     /note="similar to uniprot|P38174 Saccharomyces cerevisiae
                     YBL091C MAP2 Methionine aminopeptidase catalyzes the
                     cotranslational removal of N-terminal methionine from
                     nascent polypeptides function is partially redundant with
                     that of Map1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454259.1"
                     /db_xref="GeneID:2893912"
                     /db_xref="GOA:Q6CP80"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /translation="MVADTDVKEIVVDALPEVSEPAAVDDSEVTEDATVQDKKKKKKK
                     KKKKGNNMKNIALIYPDEKYPEGQWMEYHQDFNLKRVTDEERRYLERSEEYEQRCNDM
                     RKGAEIHRRVRESVRNKIKPGMTLTEIANLVEDGTRKFTGTDANGDHVDRPKSQGIAF
                     PTGLSLNHCAAHFTPNAGDKTVLKFEDVMKVDFGVHVNGYIIDSAFTIAFDPQYDNLL
                     AAVKDATNTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGETHQVKPCRNLCGHNINP
                     YSIHGGKSVPIVKNGDNTKMEENEHFAIETFGSTGRGYVIQEGECSHYAKKPGSHPTP
                     SLSSAKNLLKVIDENFGTIPFCRRYLDRLGEDKHVYALNTLVRQGIVEDYPPLNDIKG
                     SYTAQFEHTLILHPHKKEIVSRGDDY"
     gene            <627257..>627721
                     /locus_tag="KLLA0_E06909g"
                     /db_xref="GeneID:2893809"
     mRNA            <627257..>627721
                     /locus_tag="KLLA0_E06909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454260.1"
                     /db_xref="GeneID:2893809"
     CDS             627257..627721
                     /locus_tag="KLLA0_E06909g"
                     /note="similar to gnl|GLV|CAGL0H04565g Candida glabrata
                     CAGL0H04565g and some similarites with YBL090W
                     uniprot|P38175 Saccharomyces cerevisiae YBL090W MRP21
                     Mitochondrial ribosomal protein of the large subunit MRP21
                     exhibits genetic interactions with mutations in the COX2
                     and COX3 mRNA 5'-untranslated leader sequences"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454260.1"
                     /db_xref="GeneID:2893809"
                     /db_xref="GOA:Q6CP79"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:Q6CP79"
                     /translation="MLTARGFQLGASRTSTLLSRQFTQCTIRRQEIIDYTRLTPLSKS
                     AKESSNGSRKDMSFSAMMQSPREDTLSSKLTGIQAGRTIDVFSGNTMAAFQRLGSIVR
                     SNSIQKDKRAQRFYLKPGKARELRKSQKHRKEFMKSFKNLIEVVKDAKRKGY"
     gene            <628083..>629453
                     /locus_tag="KLLA0_E06931g"
                     /db_xref="GeneID:2893810"
     mRNA            <628083..>629453
                     /locus_tag="KLLA0_E06931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454261.1"
                     /db_xref="GeneID:2893810"
     CDS             628083..629453
                     /locus_tag="KLLA0_E06931g"
                     /note="similar to uniprot|P40074 Saccharomyces cerevisiae
                     YER119C AVT6 Vacuolar transporter exports aspartate and
                     glutamate from the vacuole and to YBL089W uniprot|P38176
                     Saccharomyces cerevisiae YBL089W AVT5 Putative
                     transporter, members of a family of seven S. cerevisiae
                     genes (AVT1-7) related to vesicular GABA-glycine
                     transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454261.1"
                     /db_xref="GeneID:2893810"
                     /db_xref="GOA:Q6CP78"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CP78"
                     /translation="MSSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCG
                     LCSSTGLYLQSYVSKYVPPGHASFFTLCRLTRPELSVVFDAAIAVKCFGVGVSYLVVV
                     GDLLPQIMSTFTTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYL
                     CVLVVFHFAVPNSEIDHLRGHVSIWKPSDVDSSMLSSFPIFVFAYTCHHNMFSIINEQ
                     SDKSLDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIITLYPNSISSTIGRIA
                     IALLVILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQL
                     TYECEDELIEENSANQPPVVTLEGPRFIFITSGILLFSYILAMSVTSLANVLSIVGAT
                     GSTSISFILPGIFGYKLIASEYAKSVVPPAKERILRIISLLLAIWGFIVMITSLSATI
                     FLHATH"
     gene            <629777..>630850
                     /locus_tag="KLLA0_E06953g"
                     /db_xref="GeneID:2893914"
     mRNA            <629777..>630850
                     /locus_tag="KLLA0_E06953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454262.1"
                     /db_xref="GeneID:2893914"
     CDS             629777..630850
                     /locus_tag="KLLA0_E06953g"
                     /note="uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
                     membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454262.1"
                     /db_xref="GeneID:2893914"
                     /db_xref="GOA:Q6CP77"
                     /db_xref="InterPro:IPR001452"
                     /translation="MALIKASQARAVRENPHVSHQFNISSFLGDPFAIGTLSIALISW
                     IIALAGSIAVAASTSPFPRFSWWTIVYEILLMITLFIVYCLDLVDYYRMFITCAVGIA
                     FVYTSNSTNSIVYYEGSKSGAAAAGFILLSMINLVWVIYFGGDNASPTNRWIDSFSLR
                     GIRPSVLETSMAIARSQRLPVKPSYPYQYQEDLRSASLPDVHHDDEGEGHSGNMYAPE
                     LQSSTKYVSSTVLNGFENTDHSSSKPNLDVNAQNTATLNTQATGTFITDTTNANTDTT
                     MGDTLGLYSDIGEELNSFPYTAEALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKA
                     KKSNGETGIIPSNYVKLLDGKSH"
     gene            complement(<631154..>639439)
                     /locus_tag="KLLA0_E06975g"
                     /db_xref="GeneID:2893812"
     mRNA            complement(<631154..>639439)
                     /locus_tag="KLLA0_E06975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454263.1"
                     /db_xref="GeneID:2893812"
     CDS             complement(631154..639439)
                     /locus_tag="KLLA0_E06975g"
                     /note="similar to uniprot|P38110 Saccharomyces cerevisiae
                     YBL088C TEL1 Protein kinase primarily involved in telomere
                     length regulation contributes to cell cycle checkpoint
                     control in response to DNA damage functionally redundant
                     with Mec1p homolog of human ataxia telangiectasia (ATM)
                     gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454263.1"
                     /db_xref="GeneID:2893812"
                     /db_xref="GOA:Q6CP76"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /translation="MSFSFEVSVIVTGLSSLKLKTRNDSLDNLNLLLKTSPTEVPVKA
                     FSPILDAIITIIESEKTRYEKTRLENGKDARIELYENRLGSAAYTLRLFVERNCERFK
                     PKHIKLLSMTLFELMTRPRSRSLITSVADHLTYSLVALCGSPVFQCNFELHQWISLSH
                     DISDAVTYHLDVSYNDKIIANLLQTLLELFQIDTIGIEDIATPVVRMTIKYLTLITKE
                     NTNTRTILTLVNSAILRLHLIRFQDVINLSYYTIKHLLRIKLTNENNIGEIARFNLMI
                     SEVLYNKTPIIVGEDKDQSYVNKEKLLPALQDYLIHSLKQYDHTKFTLDCVTFIDGPA
                     SSKFNWYSFSDICQNEKNCLEDIWLYALSLTMMLKANYQFLEYKESSLAGGSLLFKRR
                     KVKDTFAHMLKDSLTYDDFLCNCIDSDSIKIKTTGLHIGLLYLSIFDCSNIELSHLKE
                     ELFRCSQDVRFMLLCLSCFIPMCSQSKNSFSPEEEIRLFKMCVPLLKTSNGCKTACSL
                     LYKLIEFQLEPIKDKSVLQQMSDLYLLSDVNGPALVCNESFKFWMHLHYYAKTFQTVK
                     SPITYVFSWLYARWDQLFTLVVSETHFYVFASWLCGCTHTTFPTFEYSRPSLFHDTWM
                     GLSEERASITGFSLTIRTIELRKQKFAPVFCEEAERVRFMYKLFDLIDESAISATFID
                     RAIQVLRTIESLVGQRNYTDYLSRFKEIFLLSSSVIDFGQNAQIFSVMEGMISLKDSL
                     LRHIIMDILPTEKVLSTFMQRLAEHTQQTSHQDEFLSHHAKPEAGSIPISEMIEIGFE
                     FALQVHSVSKAFDPLSSFILYSKKLSLPMLNRTLPNLITYLENNENEIPTASLERLTQ
                     FLGSSLLAPSFDTSSTSMKLLTRYLEGISKYWVMEDRSQVLTADCNDIFDWIVTQYDE
                     SSFSGVEALYELARFMTLLLEKYNLSNSSISGGKQRVFKILSGCITRLPKYLTNRVVS
                     LLGTYVKRVGVTNQRILFKELLQRFNPPQESVETAAFFSLTCTKLSLINEFYLLNSIL
                     HLLDNTNFSHLLLYVEKSLDTISTFYGLCSKQDLFHQCRYFIIDQWFTKSAKSKIYEP
                     SIWKVELFEFEFDEFCIRYQMELTSFFFAKSSTYYYIIDHLKKLLNLKQEALLTKYIA
                     PTIALSYVDSGVKDLIFDIAADLLGRKFPNVLTINLDDVIYYFIKLSDLSNLATSLTF
                     WCKIFNSSRFTNMLHYNSSNCMQLNDNVAIAFPIVYKVLKKNVFTDIDDGRSFEYVIQ
                     RLVMDLQNCVLIDQKIRVLRQIKLLVLFFEHKLTLFKDIDFFLLELSKFLFNADIFSE
                     VYGFILDLLEFSANNKMDVARSLTELMRFCFTVTDSNVKKTLFPKVNPVLFNFCVSDG
                     KQLYATCYALLTLETNSFGWNDIAQVFKFQEVDRTSVSLLSDLFDNFDYDGSFDANLI
                     SPTTIQNLISIPRDNARVSDKFRRWLGNILGEIVYTRPYDHIIPHHCSTLDLESGISG
                     LLQILWVQYQKADDISLRFLLDHIQSIILQDESVLAEISSDSYSSLVNLKNLTDISWE
                     KFENCHGMLNIKLGETFLTLTFTDRSCHYQKWISAFICNILLVIVEKFPSFRILALLC
                     DNTAFLHSAIISQLIKILLVSFPKQRSSFLSDILNRADEIFKTEDRTLKMEVITKVFS
                     IIRGMALNGVQNALYVYDKIKLQPVIPIMLSLGSEIWSLMIYEEFYGEYCTGKMLDYE
                     LLYQIYSKIDEKDLFYGLPLSSSLASSLTLISKTKFNSYTNFALSNGRFEEGLRNKDS
                     SCLHEFASVTSSNGFTGLATMLDSNFENPLLSANQYSWALKLNKWDLPIPEARDSFAK
                     SAFSILKDVKEIPDFFSFDDHILKVMDGGSLLKNSQLNLETMESLGLLVSLKKLGSAD
                     MNTLTTLNNLRVHDTLNADYLPENVFDILHWSRHFFIESKINNTSVIEHAPGSNFTLQ
                     LAKILNLVHASTFCRDQGRFQDLINIVMTLEAAVDDITNNPAIGPSDTITLFCKRIST
                     VESARMLWANKESAMAINMLEDLLQTNLTAVNVENVSLADVQDILMPDAVVDSQLVEW
                     SSFSRHRSPDVIFNDHILYYERDVLNINEPNLRSSICYTYAEFCYKQSQKVDEGELLY
                     LKQKIAKASNQLQEISSIYKNPKLRDAERKEAKRHHNRLSLQNHHDKDRYNKISSSRI
                     AFVSQALHFFLTTLVHSNSRDAEVVDKFCSLWFSYSTDDIINSKLQKEIGTVPSFKFL
                     PWVSQMASKLADSVSPFQDTLQLTLKRMLYKLPYETLYPLISMSLQDSESKVIDPVTK
                     SRVEVVNKIIAALDMYDSGRYGSQFTRPVQAFCSMSVALACHKIPPKMKFLQLDTLNI
                     GKYWLETLPKVHLPLPTLPVKITCSQDGRREGRSYISSIDPKVLISSSGLSLPKIATF
                     TVSDGTRHRVLLKGSNDDLRQDAIMEQVFKQVNKILKANKTTRKQNLSVRTYEVIPLG
                     PRAGLIEFVANSMSLHDILLNLHCNDEISFDKARKTMKAAQNHSVEERVLTFSRITEK
                     IKPQLRRFFFQSFVHAHDWYESRNRYTKSVVTSSIVGYLLGLGDRHLNNILIDIKTGE
                     PIHIDLGVAFDQGKLLPIPELVPFRLTRDIVDGFGVAGIEGLFRNNCERVFKVLQDEK
                     ERLLCVLNVLKWDPLYSWKMTPLKKQRLQAKFTGDYDEEEISVSDADFSELLEEDNNN
                     DESIRALKGVESKLYGDGLSVEAIVQELLSSATDKQNLATIYMGWSPFY"
     gene            complement(<639749..>640671)
                     /locus_tag="KLLA0_E06997g"
                     /db_xref="GeneID:2893815"
     mRNA            complement(join(<639749..640120,640630..>640671))
                     /locus_tag="KLLA0_E06997g"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_454264.1"
                     /db_xref="GeneID:2893815"
     CDS             complement(join(639749..640120,640630..640671))
                     /locus_tag="KLLA0_E06997g"
                     /note="highly similar to uniprot|P04451 Saccharomyces
                     cerevisiae YER117W RPL23B Protein and highly similar to
                     uniprot|P04451 Saccharomyces cerevisiae YBL087C RPL23A
                     Protein, components of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_454264.1"
                     /db_xref="GeneID:2893815"
                     /db_xref="GOA:Q6CP75"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:Q6CP75"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGS
                     RLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKAWRRKDGVFLYFEDNAGVI
                     ANPKGEMKGSAVTGPVGKECADLWPRIASNSGVVV"
     gene            <641391..>642230
                     /locus_tag="KLLA0_E07019g"
                     /db_xref="GeneID:2893817"
     mRNA            <641391..>642230
                     /locus_tag="KLLA0_E07019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454265.1"
                     /db_xref="GeneID:2893817"
     CDS             641391..642230
                     /locus_tag="KLLA0_E07019g"
                     /note="some similarities with uniprot|P40072 Saccharomyces
                     cerevisiae YER116C SLX8 Protein containing a RING finger
                     domain that forms a complex with Hex3p mutant phenotypes
                     and genetic interactions suggest a possible role in
                     resolving recombination intermediates during DNA
                     replication or repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454265.1"
                     /db_xref="GeneID:2893817"
                     /db_xref="GOA:Q6CP74"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q6CP74"
                     /translation="MVNEDDSLRVVSSSDTTDQLQLVPGLSMGQSTVRTGEDEDERIV
                     TGRRRHELQESETDIEEEEEELRRKSRRISRTSIVSIDDADILSETQHVTEIGDTTEQ
                     SNLATAPPQEVSDNEEPAIISTADYGVAYQNVQDQSAEAQDQEEEEEEEELHEAVGEG
                     DDDDIKVLTEEEQIKAQQVIEIDDEDETEGHKSGKDMSETPLETKKAADYVCPICMEP
                     PEAALVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQDLRLIVMRKNRIR
                     KPN"
     gene            <642499..>643074
                     /locus_tag="KLLA0_E07041g"
                     /db_xref="GeneID:2893818"
     mRNA            <642499..>643074
                     /locus_tag="KLLA0_E07041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454266.1"
                     /db_xref="GeneID:2893818"
     CDS             642499..643074
                     /locus_tag="KLLA0_E07041g"
                     /note="some similarities with YER115c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454266.1"
                     /db_xref="GeneID:2893818"
                     /db_xref="UniProtKB/TrEMBL:Q6CP73"
                     /translation="MIFRISLPISKTLMTYNYTATSNDSKCRSNENKTENQIPVNTEE
                     TGLKTKQKQHYNHLQEYENYCYKKKPASYYLWSKSYRVRHKPLRLDRFPKNELKKIRC
                     GIFIGHQDHRCAYCPFHGIKHGYTLQPTLNCICRFKSVAPSPLKHDITKYMIMKRHPV
                     FDNKHVYWNTGSKQIDRIINHMCMNSTNKRN"
     gene            <643888..>645369
                     /locus_tag="KLLA0_E07063g"
                     /db_xref="GeneID:2893822"
     mRNA            <643888..>645369
                     /locus_tag="KLLA0_E07063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454267.1"
                     /db_xref="GeneID:2893822"
     CDS             643888..645369
                     /locus_tag="KLLA0_E07063g"
                     /note="similar to uniprot|Q6B229 Saccharomyces cerevisiae
                     YOL137W BSC6 Protein of unknown function containing 8
                     putative transmembrane seqments ORF exhibits genomic
                     organization compatible with a translational
                     readthrough-dependent mode of expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454267.1"
                     /db_xref="GeneID:2893822"
                     /db_xref="GOA:Q6CP72"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CP72"
                     /translation="MKGEDDYAQTTRKSVQVEDFELNDFDDSTAFPLINSTLPKGGDD
                     IHTEQAFEIDESGSELLRKTWYEGEEVVLYPANYEKVSVVRLQIATCLVLFVMFGMTD
                     QVNGSLMPVITKYYNVTELQMSIVFFLQLMGYVSASVLNDILHKKWGSRGVMTASCIL
                     AAFTYLVLALKPYSLYLYAICFFPLGMCVGFVDSTGNFYFGNLETRKNEWMGLLHGIY
                     GLAAGVTPPLVTTFDHYLDWSYIFWVPLVFALVGLALCMGAFKYETATKYRYICVGVP
                     DESGGIENEEEIKWYQLSKYPPMIFLYAFFLFLYLGTEIGVGTWLFTYLLNYKKGEKF
                     LMSFVTASFWSGITIGRLGLGFVTKRFKNEYRSSVWYGLTCSLFFFLFVIINLINSTS
                     TFYFFVLSLMIFGAGIFIGPLFPNASVVAIQILPKHQQVSGIGTAIAFGGCGGALITY
                     SFGFANKIFGFQYYPFLCFLGSLAFNIVWMLYPKIIKGHREYL"
     gene            <645766..>647124
                     /locus_tag="KLLA0_E07085g"
                     /db_xref="GeneID:2893820"
     mRNA            <645766..>647124
                     /locus_tag="KLLA0_E07085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454268.1"
                     /db_xref="GeneID:2893820"
     CDS             645766..647124
                     /locus_tag="KLLA0_E07085g"
                     /note="similar to uniprot|P42841 Saccharomyces cerevisiae
                     YNL317W PFS2 Integral subunit of the pre-mRNA cleavage and
                     polyadenylation factor (CPF) complex plays an essential
                     role in mRNA 3'-end formation by bridging different
                     processing factors and thereby promoting the assembly of
                     the processing complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454268.1"
                     /db_xref="GeneID:2893820"
                     /db_xref="GOA:Q6CP71"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /translation="MDPNTEGTTTKKYTSQRRTIDISASYDRLYFLKKHGQENSSYIE
                     AETSYNAHILPPDAYGFHGHAINTATKFTHLSSNKVKHVIPALTWTPEGRRLVVATYN
                     GEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQPNFNMVKVM
                     DQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPK
                     MGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKV
                     YDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHN
                     IPYAHEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVDPNAFDDPTYNNEKVNAWY
                     FGINNNINAVRNKTEHGVALPPSEDSNNNENGDGSRSVEPERPSVSTLPGLGSGLPGL
                     SF"
     gene            complement(<647517..>648884)
                     /locus_tag="KLLA0_E07107g"
                     /db_xref="GeneID:2893824"
     mRNA            complement(<647517..>648884)
                     /locus_tag="KLLA0_E07107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454269.1"
                     /db_xref="GeneID:2893824"
     CDS             complement(647517..648884)
                     /locus_tag="KLLA0_E07107g"
                     /note="similar to uniprot|Q75AV3 Ashbya gossypii ADL183C
                     ADL183Cp and weakly similar to YOL136C uniprot|Q12471
                     Saccharomyces cerevisiae YOL136C PFK27
                     6-phosphofructo-2-kinase has negligible fructose-2
                     6-bisphosphatase activity inhibited by phosphoenolpyruvate
                     and sn-glycerol 3-phosphate expression induced by glucose
                     and sucrose transcriptional regulation involves protein
                     kinase A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454269.1"
                     /db_xref="GeneID:2893824"
                     /db_xref="GOA:Q6CP70"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR014379"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CP70"
                     /translation="MSRPNENLRPELLRSLESRKHLNSRTVSTNTSTNSLFSLHGSSS
                     SSIYPTISHTETEIDVSNHTDGYFAGLQGSSSANHAANNSYLSQGSSLTIQFGNKRQN
                     LNHKFCVILIGLPATGKSTISRHLINFLHSSRSTAHLRCSIFNAGNVRRKLSTRRQVS
                     PFMAPELNKSEEDVFNPKNSHKKEEYARIALSKLLNDLKQDRCDLAIFDATNSTLQRR
                     NYVLQEIRSFNKAQYDKHNARRSNNKNRARGDDIDEDEYEDEADDRADAIHITPIFLQ
                     VSCTDPNFIKYNIHNKTFNQDYYDKPYEFAVKDFAKRLQQYHSQFVQFSRSEFDHYCK
                     ENARVNEGSHNPNFGLFFFHIMNAGQFSADDSNMYYFPSQYCSDTAELINTMEYFMEN
                     YSKMYGYGYIEKANEFLKYGTSSPTSPQPSSSRDRSDAIDENVRKSNIMTLHESINDT
                     YLQTL"
     gene            complement(<650256..>650897)
                     /locus_tag="KLLA0_E07129g"
                     /db_xref="GeneID:2893835"
     mRNA            complement(<650256..>650897)
                     /locus_tag="KLLA0_E07129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454270.1"
                     /db_xref="GeneID:2893835"
     CDS             complement(650256..650897)
                     /locus_tag="KLLA0_E07129g"
                     /note="similar to uniprot|Q08278 Saccharomyces cerevisiae
                     YOL135C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454270.1"
                     /db_xref="GeneID:2893835"
                     /db_xref="GOA:Q6CP69"
                     /db_xref="InterPro:IPR009244"
                     /translation="MSDKNEVSSLYPPPPPFIQFFTEENSKLFRECGKDEEKLAKCTT
                     KQREQLKYFVKPELPRDGSYRAFGNVWKIKDELPELSQMGIEQLYRKRESVTELENGT
                     TTEVEPSPQDSQSGTNYENKIQESKKLMKSLLLNFLELIGILGVDSSRYEKKLDEIRV
                     IAINIHHLLNEYRPHQSRESLIMLFEEQLEHKRKEMEHINKVCDEVESKLAQL"
     gene            <651474..>651806
                     /locus_tag="KLLA0_E07151g"
                     /db_xref="GeneID:2893836"
     mRNA            <651474..>651806
                     /locus_tag="KLLA0_E07151g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454271.1"
                     /db_xref="GeneID:2893836"
     CDS             651474..651806
                     /locus_tag="KLLA0_E07151g"
                     /note="similar to uniprot|Q08273 Saccharomyces cerevisiae
                     YOL133W HRT1 RING finger containing subunit of
                     Skp1-Cullin-F-box ubiquitin protein ligases (SCF) required
                     for Gic2p Far1p Sic1p and Cln2p degradation may tether
                     Cdc34p (a ubiquitin conjugating enzyme or E2) and Cdc53p
                     (a cullin) subunits of SCF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454271.1"
                     /db_xref="GeneID:2893836"
                     /db_xref="GOA:Q6CP68"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q6CP68"
                     /translation="MATDLGPIEAQSGTEGATESKPNFEITKWTAVAFWSWDIDVDNC
                     AICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLDNKP
                     WKLARCGK"
     gene            complement(<652155..>653090)
                     /locus_tag="KLLA0_E07173g"
                     /db_xref="GeneID:2893838"
     mRNA            complement(<652155..>653090)
                     /locus_tag="KLLA0_E07173g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454272.1"
                     /db_xref="GeneID:2893838"
     CDS             complement(652155..653090)
                     /locus_tag="KLLA0_E07173g"
                     /note="similar to uniprot|P32452 Saccharomyces cerevisiae
                     YNL316C PHA2 Prephenate dehydratase catalyzes the
                     conversion of prephanate to phenylpyruvate which is a step
                     in the phenylalanine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454272.1"
                     /db_xref="GeneID:2893838"
                     /db_xref="GOA:Q6CP67"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="UniProtKB/TrEMBL:Q6CP67"
                     /translation="MAKVLFLGPVGTYSHQAALQQFPNEELIPVTSIPACFEKLISDI
                     DMDYGVVPLENSTNGQVVFTYDLFRDFMQADLSPSVEVVGEQYVDIAHCLISPVPLSE
                     EQLRKVDVIYSHPQVWGQVKDYLSDLETKYGKTAKIDCSSTAGAVERCIAEYATDRKI
                     TLAIGSRASASLNKATIVEGGINDVNGNTTRFLILKRRDESSEIGSQALPPKGDEMKV
                     NFVTFVINQDDPGSLIDVLNVLREYKLNMCSISSRPFHNQVQSERKWQYCFFIEFYGN
                     YGTDYELLAKRFDENCAKWIHWGKFYRNALYYQIP"
     gene            complement(<653477..>654433)
                     /locus_tag="KLLA0_E07195g"
                     /db_xref="GeneID:2893634"
     mRNA            complement(<653477..>654433)
                     /locus_tag="KLLA0_E07195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454273.1"
                     /db_xref="GeneID:2893634"
     CDS             complement(653477..654433)
                     /locus_tag="KLLA0_E07195g"
                     /note="similar to uniprot|P32453 Saccharomyces cerevisiae
                     YNL315C ATP11 Molecular chaperone required for the
                     assembly of alpha and beta subunits into the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454273.1"
                     /db_xref="GeneID:2893634"
                     /db_xref="GOA:Q6CP66"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:Q6CP66"
                     /translation="MIKSWTRVVKRSASQLSATQFKRIIGASSIQSNSSYSTDSLEQQ
                     YKDKLLDKAREQGFNSIEELKNSLKEEIEKKKLELNRIDPLKELEDYEQRTKMSSNIA
                     KSRGPIDPSMPKQPFKTLDSFLDVEKVKNLSKQECEFLWRARWANKDNVLNAVVPIDI
                     WEKISALAKENPFFVIPLPRERAVEETAAESAEKQEPAMEMHYIQWQFVGPKTVHCIM
                     TTLAEYKLHKEFARPHTTLQFHLDLAKEKNIVLMNGQVESDSNVSLPESQLLLLNVQR
                     FYGAMGQDSGFAQKRVQLLKDFTNGSPNFNVDLLVALSQVME"
     gene            <654790..>655617
                     /locus_tag="KLLA0_E07217g"
                     /db_xref="GeneID:2893700"
     mRNA            <654790..>655617
                     /locus_tag="KLLA0_E07217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454274.1"
                     /db_xref="GeneID:2893700"
     CDS             654790..655617
                     /locus_tag="KLLA0_E07217g"
                     /note="some similarities with uniprot|P21705 Saccharomyces
                     cerevisiae YNL314W DAL82 Positive regulator of allophanate
                     inducible genes; binds a dodecanucleotide sequence
                     upstream of all genes that are induced by allophanate;
                     contains an UISALL DNA-binding, a transcriptional
                     activation, and a coiled-coil domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454274.1"
                     /db_xref="GeneID:2893700"
                     /db_xref="UniProtKB/TrEMBL:Q6CP65"
                     /translation="MSHIYSHSNLDELLVSLLGEYKPHLQTHSHRMKSWNTLLKEFNR
                     RSGLNYRQTRTLKRRFDKLCSVYLKYGSVKVTNFETFKQLVFEFEHERQKSDSTATES
                     SNALSMLARRLAETGELVNSNSDIGDDDVLEDDLEEERRYGDEADVDNGPQPISVPST
                     ANLEPAEIILDDNDDDRTPLDSITILPHTQMNRLRHQQLQESQQLSETIRDNVSNSGS
                     AQFANTPNLVERNNTELSLQQQIFDLKNSFDEYKRREQETTRQLMYKLDYIVSLLKK"
     gene            complement(<655635..>658325)
                     /locus_tag="KLLA0_E07239g"
                     /db_xref="GeneID:2893621"
     mRNA            complement(<655635..>658325)
                     /locus_tag="KLLA0_E07239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454275.1"
                     /db_xref="GeneID:2893621"
     CDS             complement(655635..658325)
                     /locus_tag="KLLA0_E07239g"
                     /note="similar to uniprot|P42842 Saccharomyces cerevisiae
                     YNL313C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454275.1"
                     /db_xref="GeneID:2893621"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CP64"
                     /translation="MDVLLHSHLLLASEPSVVESLSDHPLCWAASQILSGNSHEVINK
                     SIKKGIDSKLIEKSSDIDVLKQWAHENVLSSHSSSESLVVAIAFLQCFIQNNFTGQAT
                     PTSSYATLFNQGQIDESKNSIFSELLNVSGQTAYELCDDPVYLILALILLEELTDGKT
                     LFGLDSYDDGQVAISKDMDPTTALAYWWRSRAILVQLSLVAEPNGHHPIIASSILTSI
                     DLAHAITQALPSEIDETFRKQLYIIYYLENCRCLLAVQTEHLCLPSLTKVKKLTDFEF
                     VLTGAKAKRTKFQQIAHSGLIILAKSHSNNERFTEAESPDTFELDSDLLLEKPHFEAI
                     GDEHIDEQIVKKQKLNDTNGFLEDKILPVAIRQEFIPQSLQELDPNNQPALSQYDNIQ
                     LLLRLYTIRQTSPANNPLTEEELSALIARVLYQDGAKNWTVFSRALWERSIVETKRAK
                     TVERGLLQMQSLVEELGLRITTKMIPDRASDVESTKQRLKYIHQLPLIPRWSLDATLA
                     EKYMSLGILRSAVEIYERLHMACEAALCYAAVGDEKQAEQILVNCIERNPKDARAYSI
                     LGDIRQDPSLWEKSWEIGKYVNAKNSLGRYYYNPPKGSGLERDYTAALKHLNDSLRIS
                     PLSFDTWYFYGCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAH
                     SCLKRAISSDARKNWRIWDNYMIVSMKLGEWEDVLLAFRNLVDLRKDKNGEMSIELPI
                     LEKLIEILVATDYPTDSSQRLTHYQQSCLEFVCDILPSLVTTSVRLWKLVAKVELWRR
                     RPWMALACHEKAFRAISHNPDLTIDEKVWNESVDVCDDLVAAYESLGEMEGKHGAGDV
                     VCQNWRYKARSSIKTLMSRGKNYWEDSDGWDRLMDLKSTL"
     gene            complement(<658638..>660974)
                     /locus_tag="KLLA0_E07261g"
                     /db_xref="GeneID:2893622"
     mRNA            complement(<658638..>660974)
                     /locus_tag="KLLA0_E07261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454276.1"
                     /db_xref="GeneID:2893622"
     CDS             complement(658638..660974)
                     /locus_tag="KLLA0_E07261g"
                     /note="similar to uniprot|Q08269 Saccharomyces cerevisiae
                     YOL130W ALR1 Plasma membrane Mg(2+) transporter expression
                     and turnover are regulated by Mg(2+) concentration
                     overexpression confers increased tolerance to Al(3+) and
                     Ga(3+) ions and similar to YFL050C uniprot|P43553
                     Saccharomyces cerevisiae YFL050C ALR2 Probable
                     Mg(2+)transporter; overexpression confers increased
                     tolerance to Al(3+) and Ga(3+) ions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454276.1"
                     /db_xref="GeneID:2893622"
                     /db_xref="GOA:Q6CP63"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:Q6CP63"
                     /translation="MSDDKSVDSGEHEISRTTSAAHSLASLKTEEHTKLYDHRQQHDY
                     VSHNPGPAAPAAAARNPMQGPNLGSYSNSLGVTGSGSREGAAGLTGVSGINFDGDSDD
                     DLSLPNPGSNTYVPIGPSNSSKLGKLKVPGSHSAAHYSKSYSDGSQPHSRRGSHSLGI
                     PLIKKKSRSSSNTSIKGNPLTRTVSSKSQSSQKSRELRRRLTRNASIDSDNSQVSHLS
                     QETEEDVCFPIQKREHTRINGIDFDELEEFTAQEKAINNSHLYSHPAVTTQNTFGQHS
                     GKPPSSTDSSTSSSSAALKYTPRPEAVAQGISFGNNKVEPDEYDEDDIKKMNSNYTST
                     VPPIPEQTTPFDAPNRFAYFSSDVSETLHAPDLSSLVKPYQSFRQLFNDGAPTWWLDC
                     SCPTDEEMRCLTKTFGIHPLTSEDIRMQETREKVELFKNYYFICFHTFENDMESEDFL
                     EPINVYMVVFANGILTFHFNPISHCANVRRRVRQLRDYVGVNSDWICYALVDDITDSF
                     APVIQSIEYEADAIEDSVFMTRDMNFAVMLQRIGEGRRKTMTLMRLLSGKADVIKMFA
                     KRCQDDINGIGPALTSQVNIANLQFKMPPDSAPSIEKRQQPRADIAMYLGDIQDHIVT
                     MFQNLSSYEKIFSRSHANYLAQLQVESFNSNNKVTEMLGKVTMIGTMLVPLNVITGLF
                     GMNVRVPGQPDGEGTFGWFFGILGFIFLFAAGSLVFSSYWLSRINPPTTLNEAATSGT
                     KSIINFKSRSLKNPQFNQPTKSNKSMLSFSTNKMGRYE"
     gene            complement(<661677..>662738)
                     /locus_tag="KLLA0_E07283g"
                     /db_xref="GeneID:2893626"
     mRNA            complement(<661677..>662738)
                     /locus_tag="KLLA0_E07283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454277.1"
                     /db_xref="GeneID:2893626"
     CDS             complement(661677..662738)
                     /locus_tag="KLLA0_E07283g"
                     /note="weakly similar to uniprot|P42845 Saccharomyces
                     cerevisiae YNL309W STB1 Protein with a role in regulation
                     of MBF-specific transcription at Start phosphorylated by
                     Cln-Cdc28p kinases in vitro unphosphorylated form binds
                     Swi6p and binding is required for Stb1p function
                     expression is cell-cycle regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454277.1"
                     /db_xref="GeneID:2893626"
                     /db_xref="UniProtKB/TrEMBL:Q6CP62"
                     /translation="MSSLSPKKQQELADKILERAELAQMARKLKLGLSKVASPKKSNP
                     SNVALGNRNKKGNSSGPDSVNIPTSAGRSRARSVSKPNHISESPTRRSAMKPPSRNNA
                     VDGSTAGNTFTSSFNATERKTKNLDTRMDHLTVLNGEKSADDSSEPAVPSTPKASSSQ
                     LGSDSKVLNEEGADLLMYLATSPYASANHPSSSGRRPSASSNYGNSMINHGIPSTPSS
                     NAYINQTTVGPESQLNDIVRLSHMKERASSSSPQSTFKQPVMIPTNSMHDLMQSPSTS
                     MFTSPRRRLTTDDQQLLVPGTPSRIGLSASSMTSDQFNDSQSKIGSLLKTPNFNMGDY
                     VHTLFSPSPRIDTSSQPKE"
     gene            <663162..>663737
                     /locus_tag="KLLA0_E07305g"
                     /db_xref="GeneID:2893624"
     mRNA            <663162..>663737
                     /locus_tag="KLLA0_E07305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454278.1"
                     /db_xref="GeneID:2893624"
     CDS             663162..663737
                     /locus_tag="KLLA0_E07305g"
                     /note="similar to uniprot|P42844 Saccharomyces cerevisiae
                     YNL310C ZIM17 Essential component of the mitochondrial
                     import system zinc finger protein that may act with Pam18p
                     to facilitate recognition and folding of imported proteins
                     by Ssc1p (mtHSP70) in the mitochondrial matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454278.1"
                     /db_xref="GeneID:2893624"
                     /db_xref="GOA:Q6CP61"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:Q6CP61"
                     /translation="MMNRFGLVVRNAAKNGIRIIRPVTKSSPEIYRPLFSHLVRTTYN
                     TRGFHASVRKLDEAEDAAAKFKNLGSMKVDKPMLMIAFTCKKCNTRSSHTMSKQAYTK
                     GTVLIKCPGCDNRHLIADHLKIFNDNHITIEDIMKAEGESVSLTTDDLAFEDIPDSLK
                     NVIGHYAKDAPEEMKKKLDNEKVHHLPSTEK"
     gene            <664145..>666142
                     /locus_tag="KLLA0_E07327g"
                     /db_xref="GeneID:2894069"
     mRNA            <664145..>666142
                     /locus_tag="KLLA0_E07327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454279.1"
                     /db_xref="GeneID:2894069"
     CDS             664145..666142
                     /locus_tag="KLLA0_E07327g"
                     /note="similar to uniprot|P42843 Saccharomyces cerevisiae
                     YNL311C F-box protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454279.1"
                     /db_xref="GeneID:2894069"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6CP60"
                     /translation="MRGLQLFGGGSRRSVESERPLLNTKESVLVPTGPHLLKLPDKLL
                     ERILENLDIPTYLSLIQVNKKLYQLICERFLFKHVVLMNKNALLKFNALIECKSLTLR
                     NDISYLVKTVEFVDPEYHDSLFKYSKYYNTGFADTVIGGSYSFSERQGRSTDIRTSSR
                     SASVSSTRSRTKQGASEVYHQLSKLESKFLDYTYIELMLNIIDSLPNVSHVILSQVEK
                     NFKIPLWYSVLNDGSKDFFKKIIKGQGSMTVEDLRTFRVSSDWIKQYEETFHSLSRFK
                     RLSIKAKTNLVLKPNLLCCFGVFDELMLENITITPESIDTPLEYLPLYMRIGHDKCLD
                     LHLPVQTLELKSCVIKAGNGLMRLLYSFFFRVRKLSLFDLQSKYDLLLINCFGSLTHL
                     TIDCNSTCFVNVKPTDESYYFPEEPMQDDMDDLKTLIDPQKGVKLTAPPPTTPVVVVM
                     SNGKLINTEASTPRKPALLTTEQAHYFGSSSISPFHSYFHHFKRLWERIPNSGVHLTI
                     VNIPFTNVFPLVPELVWERFLTSDQDTLYDNSDDENNHELDEYWWDPKIKENLERATH
                     FNNDIDISEEDFSPRKWNDFHRINSFKDIPNVNVWYFLKLLSKFQSVEIRMLRQWLFC
                     TPRTRYDWELLLRPVLNGRVPVTVKDNAGYLLYSYGNSKKT"
     gene            complement(<666129..>667541)
                     /locus_tag="KLLA0_E07349g"
                     /db_xref="GeneID:2894064"
     mRNA            complement(<666129..>667541)
                     /locus_tag="KLLA0_E07349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454280.1"
                     /db_xref="GeneID:2894064"
     CDS             complement(666129..667541)
                     /locus_tag="KLLA0_E07349g"
                     /note="similar to uniprot|Q08271 Saccharomyces cerevisiae
                     YOL132W GAS4 Putative 1,3-beta-glucanosyltransferase has
                     similarity to Gas1p localizes to the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454280.1"
                     /db_xref="GeneID:2894064"
                     /db_xref="GOA:Q6CP59"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CP59"
                     /translation="MHRLIIGVLFFVSSVLADIHPIEIRGKHFYDSVTDEPFFIRGID
                     YQPGGSSDVTDEKDPLSDVSVCARDIPLFQDLGINAVRVYSLNPDLNHDKCMTMLASA
                     GIYLILDVNSPLINQHLNRYEPWTTYNPIYLEHVFKLIAQFIPYNNTLGFIAGNEIIN
                     DKRSAQRSPPYIKQLVGDMKGYIKAHSPRAIPVGYSAADDLKYRVSLSKYLECEDKGT
                     HDSSVDFYGVNSYQWCGDQDFQSSGYDKLVDAYKDYSKPVFFSEFGCNEVTPRKFGEI
                     PTLYSDRMYHTFSGGLVYEFTQEVNNYGLVSVNEETGDVYLLEDFEALKNQYKQTPHP
                     TSTDLKISQDKSTSRIVNNSPACTNKYTNLDITAKVVPKLATEFIRKGVKCDKGKYVN
                     LDKSDLTCNSKYYDANGNQLSRSPKFSIVNEVGSVKLTGPEKKASNSGNGLRLSRTNL
                     ILGCSMVLGFILDIVSIMFF"
     gene            complement(<667907..>668590)
                     /locus_tag="KLLA0_E07371g"
                     /db_xref="GeneID:9487284"
     mRNA            complement(<667907..>668590)
                     /locus_tag="KLLA0_E07371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999352.1"
                     /db_xref="GeneID:9487284"
     CDS             complement(667907..668590)
                     /locus_tag="KLLA0_E07371g"
                     /note="similar to uniprot|P26754 Saccharomyces cerevisiae
                     YNL312W RFA2 Subunit of heterotrimeric Replication Factor
                     A (RF-A) which is a highly conserved single-stranded DNA
                     binding protein involved in DNA replication repair and
                     recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999398.1"
                     /db_xref="GeneID:9487284"
                     /db_xref="GOA:B4UN92"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:B4UN92"
                     /translation="MQSAKQQIQDGPYVIMGQELHHVSFVGVIRNVADNTSNVTLTVE
                     DGTGQIEFRKWTNDSNDMSHASQEDQNGDYNSQVAQDYSVGKYIKVYASLREFSGKMN
                     VQYAVVKHIDSFNEILAHHLEVIKAFAVANGNLSVDSTVAVNGANTETNSLFVQDNEP
                     PKSATEKVLDFIRAQCAGKDSNSFSVQTKLISQSLNMIEDDVRMYCQTLTEQGYIYPT
                     FDEFTFFIL"
     gene            complement(<669201..>670967)
                     /locus_tag="KLLA0_E07393g"
                     /db_xref="GeneID:2894071"
     mRNA            complement(<669201..>670967)
                     /locus_tag="KLLA0_E07393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454282.1"
                     /db_xref="GeneID:2894071"
     CDS             complement(669201..670967)
                     /locus_tag="KLLA0_E07393g"
                     /note="similar to uniprot|P42846 Saccharomyces cerevisiae
                     YNL308C KRI1 Essential nucleolar protein required for 40S
                     ribosome biogenesis physically and functionally interacts
                     with Krr1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454282.1"
                     /db_xref="GeneID:2894071"
                     /db_xref="InterPro:IPR018034"
                     /db_xref="InterPro:IPR024626"
                     /db_xref="UniProtKB/TrEMBL:Q6CP57"
                     /translation="MPRKKSAAKKAREAIKKQESVAVKGSSTKVPTTDVEGKNTEVIS
                     VKTGSKHDVTASKEVPAEVDDDDEDSSTSEEEDDYGELITEEVEEGIQKVLDAIKNNE
                     TDKLLNPGVKFFEEPEKAVEKLAKTEKHKPVYLKDYHRMNLLNGNVNADDDEDLEFET
                     VDGKQSFASHQREERNQLLSEIKDAFNGDDDAEEGDEEEDGFLKKKEPQNKRESEVKL
                     PNPKVDDEKFLEEFVNQQAWIPKKGDKVINLDRRGTDIEEDEDFDDAVEQFENAYNFR
                     YEDPNAAEIVSYARTQATLRRSATSSRRRKRDEEKAIKDKEEEEKQKAVQKKKKEKVN
                     QLTDVLEQVKKEYGADIKEEHVKALTDTLINGNFEDGKWDEVIGTIFNDEFYNQEDKP
                     TWDENDDIMGEFYAEQETEDHAEDDETLASDSGEPKKKKSKKDKIQEKRDKKKDKKQL
                     HEMVEKAVDERKVDIIEQVEEERGRSTEKNSEVKFRYREVSPESFGLTTREIFTADDA
                     DLNEFIGLKKFAPYRPKELTSKDRRKVTKSRRLREWRKKVFNTEEGLTGDELAIPLND
                     GEAHQTSKEKERLKNKKRKRRD"
     gene            <671600..>672130
                     /locus_tag="KLLA0_E07415g"
                     /db_xref="GeneID:2894073"
     mRNA            <671600..>672130
                     /locus_tag="KLLA0_E07415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454283.1"
                     /db_xref="GeneID:2894073"
     CDS             671600..672130
                     /locus_tag="KLLA0_E07415g"
                     /note="similar to uniprot|Q12016 Saccharomyces cerevisiae
                     YOL129W VPS68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454283.1"
                     /db_xref="GeneID:2894073"
                     /db_xref="InterPro:IPR007919"
                     /db_xref="UniProtKB/TrEMBL:Q6CP56"
                     /translation="MDTSHERLFRLPFKLPTSVSAKKVCVYVAGALYGAGLWSFLDCV
                     LYSKHANGSDLHISFIDWVPMLCSVLGMAIVSSIEKNRLLQDALSSGTFTGSQSTAWQ
                     ARVVLFLGFSLLASGISGSLVVLIVKFLLKDYTSYPTLGMGINNVLANLAILLSCTML
                     WIGQNVEDEYNYSLTL"
     gene            complement(<672690..>673787)
                     /locus_tag="KLLA0_E07437g"
                     /db_xref="GeneID:2894075"
     mRNA            complement(<672690..>673787)
                     /locus_tag="KLLA0_E07437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454284.1"
                     /db_xref="GeneID:2894075"
     CDS             complement(672690..673787)
                     /locus_tag="KLLA0_E07437g"
                     /note="highly similar to uniprot|P21965 Saccharomyces
                     cerevisiae YNL307C MCK1 Protein serine/threonine/tyrosine
                     (dual-specificity) kinase involved in control of
                     chromosome segregation and in regulating entry into
                     meiosis related to mammalian glycogen synthase kinases of
                     the GSK-3 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454284.1"
                     /db_xref="GeneID:2894075"
                     /db_xref="GOA:Q6CP55"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CP55"
                     /translation="MSMQRLDEYVAHDVISNKSNVKREMLVKEYKRIGQGAFGTVVQA
                     YLTPDNQKWLGPFAIKKVPAQTEYKSRELEILRIADHPNVVKLEYFYTHISPTDHKLY
                     QHLAMECLPEMLQNEILRYKKNNLELPLKHVKLYAYQIARGMLYLHALGICHRDIKPS
                     NVLVDPQTGILKICDFGSAKKLESNQPSISYICSRYYRAPELIVGCTQYTTKIDIWGL
                     GCVLGEMLLGKAVFQGHQPLLQLHEITKLLGPPDKRFIFFSNPSYNGPLFSKPLFEGA
                     PKARFEKYFGYAGPDGVDLLMSVLVYEPERRASPRRILAHPFFDDLRNERYFFPSGSS
                     QPKHLPPLYDFSDFELQVIGDLFPKIQPKQD"
     gene            <675010..>675627
                     /locus_tag="KLLA0_E07459g"
                     /db_xref="GeneID:2894077"
     mRNA            <675010..>675627
                     /locus_tag="KLLA0_E07459g"
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /transcript_id="XM_454285.1"
                     /db_xref="GeneID:2894077"
     CDS             675010..675627
                     /locus_tag="KLLA0_E07459g"
                     /note="similar to uniprot|P42847 Saccharomyces cerevisiae
                     YNL306W MRPS18 Mitochondrial ribosomal protein of the
                     small subunit essential for viability unlike most other
                     mitoribosomal proteins"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /protein_id="XP_454285.1"
                     /db_xref="GeneID:2894077"
                     /db_xref="GOA:Q6CP54"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:Q6CP54"
                     /translation="MLRTLVRLFSSTARTNQDVASILFSSVKGSEKAPVMEDTNVVQP
                     NTLRGSNKKGRVDEAVIKYILNCRFTKNNTHFTYSAVMEDRNFLANNPQLSYNEKYLY
                     YLKLPQQVKFHLSTGHLGFRKAARGEYEASFQTATKLFETLYQKKLLDKNIEIVMRDF
                     GKGRDAFISALNGKEGNLIRRHISRVADATELKFGGVKAPRPRRL"
     gene            <676406..>677449
                     /locus_tag="KLLA0_E07481g"
                     /db_xref="GeneID:2894080"
     mRNA            join(<676406..676418,677034..>677449)
                     /locus_tag="KLLA0_E07481g"
                     /product="60S ribosomal protein L25"
                     /transcript_id="XM_454286.1"
                     /db_xref="GeneID:2894080"
     CDS             join(676406..676418,677034..677449)
                     /locus_tag="KLLA0_E07481g"
                     /note="highly similar to uniprot|P04456 Saccharomyces
                     cerevisiae YOL127W Primary rRNA-binding ribosomal protein
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L25"
                     /protein_id="XP_454286.1"
                     /db_xref="GeneID:2894080"
                     /db_xref="GOA:P48045"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /translation="MAPSTKATAAKKAVVKGTNGKKALKVRTSASFRLPKTLKLARSP
                     KYATKAVPHYNRLDSYKVIEQPITSETAMKKVEDGNTLVFKVSLKANKYQIKKAVKEL
                     YEVDVLSVNTLVRPNGTKKAYVRLTADFDALDIANRIGYI"
     gene            complement(<677690..>678442)
                     /locus_tag="KLLA0_E07503g"
                     /db_xref="GeneID:2894081"
     mRNA            complement(<677690..>678442)
                     /locus_tag="KLLA0_E07503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454287.1"
                     /db_xref="GeneID:2894081"
     CDS             complement(677690..678442)
                     /locus_tag="KLLA0_E07503g"
                     /note="similar to uniprot|P48558 Saccharomyces cerevisiae
                     YNL305C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454287.1"
                     /db_xref="GeneID:2894081"
                     /db_xref="GOA:Q6CP52"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="UniProtKB/TrEMBL:Q6CP52"
                     /translation="MSETTPFVPEDFKYSTSVSSCENEIRLGFLKNVYSILLFQLTLT
                     FAFGLYVYNTPGLQLFIITKPWLSFIAIFIGLVTCIWLSFAPSSTDEENEPWYVLSFP
                     QQLALLILFTMAEAYSLSIVVVIYKGEVILNAVMMTLFVVIGITSTLLSTNYFQIYDF
                     QKWYYWLNMFLWVMIGFSISSIFFHFDTNTDLLMSWVGVILFTVYIFVDTQLILRKVL
                     VGEEIKCAMMLYLDIINLFLYILRIMSRNQDD"
     gene            complement(<678882..>680096)
                     /locus_tag="KLLA0_E07525g"
                     /db_xref="GeneID:2894086"
     mRNA            complement(<678882..>680096)
                     /locus_tag="KLLA0_E07525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454288.1"
                     /db_xref="GeneID:2894086"
     CDS             complement(678882..680096)
                     /locus_tag="KLLA0_E07525g"
                     /note="similar to uniprot|P22133 Saccharomyces cerevisiae
                     YOL126C MDH2 Cytoplasmic malate dehydrogenase catalyzes
                     interconversion of malate and oxaloacetate involved in
                     gluconeogenesis and glyoxylate cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454288.1"
                     /db_xref="GeneID:2894086"
                     /db_xref="GOA:Q6CP51"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q6CP51"
                     /translation="MSFSFDSVCNRQVLRLILTALIIKTIINFNFFHKEMPAVNAQEK
                     EILKISVLGAAGGIGQSLSLLLKSNAGFLLPHETSTHIRLSLYDVNKDAIVGTAADLS
                     HIDTPITTTAHYPDDSNGGIGQCLSNASVVIIPAGVPRKPGMSRDDLIGVNAKIIKSL
                     GEDIAKYCDLNKVHVLVISNPINSLVPLLTNTLIRSDANGNSNIESRVYGITQLDLVR
                     SSTFVQQLNGFKSNTSPVIPVIGGHSGDTIIPVFSTLERDPEYANLLDNGMRLKMVHR
                     VQYGGDEIVKAKNGNGSATLSMAYAGFKIAAKFIDLLVGNTDTIDDIVMYVPLTNRNH
                     QEIAPGSNELRSRYINDLLYFSIPLSINRNGIKKIHYEILENLDSYERDTLLPICLKT
                     LEGNIETGLKLV"
     gene            <681586..>682890
                     /locus_tag="KLLA0_E07547g"
                     /db_xref="GeneID:2894089"
     mRNA            <681586..>682890
                     /locus_tag="KLLA0_E07547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454289.1"
                     /db_xref="GeneID:2894089"
     CDS             681586..682890
                     /locus_tag="KLLA0_E07547g"
                     /note="similar to uniprot|Q12383 Saccharomyces cerevisiae
                     YOL125W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454289.1"
                     /db_xref="GeneID:2894089"
                     /db_xref="GOA:Q6CP50"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /translation="MMAVTVSGNTGQSTAERLQCEFFLVKKKRQCGMTRRAGSQFCSE
                     HSTDSDRVPCPLDPSHTVCLSKMRVHMRKCNKFRHDVSYQAKQREIPWFKEGLNSISN
                     GKSDSKPADETLVKSVSLIQKIFQNEFGDEPPLPLIEKQNELLERTERYKTLVNRKHA
                     RQQSSLIQHLKESKLWPSLESCAVNKTLEYIELGCGRAEFSRYVNIATNLDQKEHSHE
                     KPEYKAVAPSFTLIDRASQRLRFDNKFSSDIGTEVQIRREKIDIKDLRLDAVLHDASQ
                     YVAISKHLCGVATDLSLRCLLNSDKCKANLRGILIAMCCRHVCQSSEYVNQEYIKGLL
                     KRQTDGSMAYSEFFQCLKKFCSYCTCGLRPDMDPNSGSEDHITKLTHNERQRIGHMAR
                     RIIDEGRAQFLQSKGFETVLFKYTDSAVTLEDTALLALRKHD"
     gene            <684098..>685183
                     /locus_tag="KLLA0_E07569g"
                     /db_xref="GeneID:2894094"
     mRNA            <684098..>685183
                     /locus_tag="KLLA0_E07569g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454290.1"
                     /db_xref="GeneID:2894094"
     CDS             684098..685183
                     /locus_tag="KLLA0_E07569g"
                     /note="highly similar to uniprot|P14540 Saccharomyces
                     cerevisiae YKL060C FBA1 Fructose 1 6-bisphosphate aldolase
                     required for glycolysis and gluconeogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454290.1"
                     /db_xref="GeneID:2894094"
                     /db_xref="GOA:Q9C2U0"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /translation="MPAQDVLTRKTGVIVGDDVKALFDYAKEHKFAIPAINVTSSSTV
                     VAALEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIRGSIAAAHYIRSIAPAYG
                     IPVVLHTDHCAKKLLPWFDGMLKADEEYFAKHGEPLFSSHMLDLSEETDEENIGLCVK
                     YFTRMAKIHQWLEMEIGITGGEEDGVNNEGTSNDKLYTTPETVFSVHEALSKISPNFS
                     IASAFGNVHGVYKIAAALKPELLGTFQDYAAKQLNKKAEDKPLYLVFHGGSGSSTKDF
                     HTAIDFGVVKVNLDTDCQFAYLSGIRDYVLNKKDYLMTPVGNPTGEDSPNKKYYDPRV
                     WVREGEKTMSKRITQALEIFRTKGALE"
     gene            <685564..>686559
                     /locus_tag="KLLA0_E07591g"
                     /db_xref="GeneID:2894095"
     mRNA            <685564..>686559
                     /locus_tag="KLLA0_E07591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454291.1"
                     /db_xref="GeneID:2894095"
     CDS             685564..686559
                     /locus_tag="KLLA0_E07591g"
                     /note="similar to uniprot|Q75DF9 Ashbya gossypii ABR067C
                     ABR067Cp and weakly similar to YMR026C uniprot|Q04370
                     Saccharomyces cerevisiae YMR026C PEX12 RING-finger
                     peroxisomal membrane peroxin that plays an essential role
                     in peroxisome biogenesis and peroxisomal matrix protein
                     import forms translocation subcomplex with Pex2p and
                     Pex10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454291.1"
                     /db_xref="GeneID:2894095"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6CP48"
                     /translation="MDFYSNLPVNLQQPTLFEILSVNEVKKLIKPTLRYIFSIYLQYR
                     GPTRWLLKIFNKFDFIILVIKSLVEYRHYKTTGATILDKFYGLKRFSRFPKLTFLGIW
                     LNDCLFEYVSDICEQYHELLQSRKLTSPELSSWQQWFDAYYPKLQKTIKVINFCFKLK
                     YLRHSKDTDMIHFITQIRYQRYQEPEEGIASRKNTLTLSERRRKRTNLPRILAMTKDA
                     VESTSTMFLDKLFPSFLVMIRILQIINQRPELFKKEIRVKRPKPPVLPGVASEVDNND
                     TTDVCPLCGEEITEPAMISSGYVANLECAKKWVSTENTCFATGVPIDKRIRKLLI"
     gene            complement(<686610..>687218)
                     /locus_tag="KLLA0_E07613g"
                     /db_xref="GeneID:2894096"
     mRNA            complement(<686610..>687218)
                     /locus_tag="KLLA0_E07613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454292.1"
                     /db_xref="GeneID:2894096"
     CDS             complement(686610..687218)
                     /locus_tag="KLLA0_E07613g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454292.1"
                     /db_xref="GeneID:2894096"
                     /db_xref="UniProtKB/TrEMBL:Q6CP47"
                     /translation="MDLKEEVLLQVNSTIIESKGGPLLFILVLENEIASQCFLCDGVG
                     NVDTKLSLFSWKSSDPIGILMVDPDIYDYDDMLQSLNSKQYIIKSKFHYFPETSNLIQ
                     WHESVRYPYKLINCGVEIQDDHSDLKLLKRDLKDHLDRMIQYLEDNDRPSDEILKEIW
                     LLKLRYSRTSAPDLDSEISRLESDIMMMQTMFNQMETNAELF"
     gene            complement(<687442..>688389)
                     /locus_tag="KLLA0_E07635g"
                     /db_xref="GeneID:2894100"
     mRNA            complement(<687442..>688389)
                     /locus_tag="KLLA0_E07635g"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="XM_454293.1"
                     /db_xref="GeneID:2894100"
     CDS             complement(687442..688389)
                     /locus_tag="KLLA0_E07635g"
                     /note="similar to uniprot|P36516 Saccharomyces cerevisiae
                     YMR024W MRPL3 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="XP_454293.1"
                     /db_xref="GeneID:2894100"
                     /db_xref="GOA:Q6CP46"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6CP46"
                     /translation="MSVLKLLNPVRVRGFASCARLYQSELSSLKEYKNTISTLLKNPA
                     HELTSPNLVALHSRLRLPQGLSYSLLSRCLTCRSSGEVNYDNVSLNIFGKSLLTLAVT
                     SELMKKYPRLPGVVLNAAVDAYINDHVLSNVGRSWGIEPETQSVVDRYAKKENVTITL
                     GKLRYFQNSVDELHNFTENNAMAVAVRSIFAAVYSVDKDFNQTHKFIADHILSRKLDV
                     KDLFAFEQPTRELAALCRRQGLERPVSKLLAENGRLSKSPLFIVGVFSGEEKLGEGYG
                     SSLKEAKARAATDALLKWYCYEPVHGQQNVVIDQGEVLV"
     gene            <688734..>690239
                     /locus_tag="KLLA0_E07657g"
                     /db_xref="GeneID:2894111"
     mRNA            <688734..>690239
                     /locus_tag="KLLA0_E07657g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454294.1"
                     /db_xref="GeneID:2894111"
     CDS             688734..690239
                     /locus_tag="KLLA0_E07657g"
                     /note="similar to uniprot|P32559 Saccharomyces cerevisiae
                     YMR023C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454294.1"
                     /db_xref="GeneID:2894111"
                     /db_xref="GOA:Q6CP45"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CP45"
                     /translation="MVVYKDPTLIWFNFSQKVMFSPMLRRFYSVPATFFHPTVYALST
                     PSNQHSAIAIIRISGTHSKYILKKLSPKKPLRQRKPMIRSLYDPKASTLIDEALVLYF
                     PQPRTFTGEDLVELHLHGGKAIIKAALNSIQGLRDSERDIRMAMPGEFSRRAFQNGKM
                     DLLKLESINNMIHSDTELQRLSALHGNQTVDIFHEWRQEIIEQIAKLTAIIDFGEDIE
                     TEDIDSIVNGANDKLLQLYKKVTRFMVKLDRMAVLNDGIKLTLLGEPNSGKSSLVNEI
                     SQDDVAIVSDIPGTTRDSIDVMMDINGFKCILTDTAGIRQGTSDSIEIKGIDRSKKKS
                     LQSDLVVLVIDVSNPNISKHFEEFIKDNLSDKPLIVVLNKSDLATETQLKYLIEKFDA
                     EFKALKIHTVSCLTKIGLEPLVKTLTLSFRRISATENEDPVTVSNRVKEILSTDILFG
                     LDQFFQHKNDDILIACESLRIASDGIGKITGDNVDLEEVLDVVFSKFCIGK"
     gene            complement(<690201..>690515)
                     /locus_tag="KLLA0_E07679g"
                     /db_xref="GeneID:2893833"
     mRNA            complement(<690201..>690515)
                     /locus_tag="KLLA0_E07679g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454295.1"
                     /db_xref="GeneID:2893833"
     CDS             complement(690201..690515)
                     /locus_tag="KLLA0_E07679g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454295.1"
                     /db_xref="GeneID:2893833"
                     /db_xref="GOA:Q6CP44"
                     /translation="MRGKALKSKLEELVDGIQQRIDFVTATGVSSFEQETEQNYGKLE
                     YLQSKIKKDDGISDWVDEKQRLSGRLNKLEKQVQELEELADEWENYLQLLADTKLRKD
                     NV"
     gene            <690760..>691908
                     /locus_tag="KLLA0_E07701g"
                     /db_xref="GeneID:2894054"
     mRNA            <690760..>691908
                     /locus_tag="KLLA0_E07701g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454296.1"
                     /db_xref="GeneID:2894054"
     CDS             690760..691908
                     /locus_tag="KLLA0_E07701g"
                     /note="weakly similar to uniprot|P36090 Saccharomyces
                     cerevisiae YKL047W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454296.1"
                     /db_xref="GeneID:2894054"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="UniProtKB/TrEMBL:Q6CP43"
                     /translation="MVIFVHEFDVLKGNTLVWTNGDAKTLEGLEYTVLPSGIHLRNTD
                     TVYFKLDGKPGLAVFKQNTMELEASQHHIDRSKVRMFSFGTIFDHPMDYEQLSLYEGG
                     MKDALERWWKDQDYSVLEEWDEKQNGDDTSNFDFNGTCLTIGPIVLQLWRCALLQERI
                     LILNKGVEVKKCNQLCHLLTKMASLEGGTYCNAMTITMLNADQFKSFEAWCATTSDEI
                     LIYDTDLFDKLVIWDPNGIHLRDSMKEIKCNEVDFTVFKSLTSDDLSTFNYQYESSII
                     WSKLIIDGLFMLFTGNLYKPWYHLELAPIEHPDFVQYFSERTHDIYQRLKAIVELFPT
                     QDSIYQNANILIDLRLDYFNDTDFIRQLSQHWFEKPVIPSYIDLSFLF"
     gene            complement(<691980..>693332)
                     /locus_tag="KLLA0_E07723g"
                     /db_xref="GeneID:2894055"
     mRNA            complement(<691980..>693332)
                     /locus_tag="KLLA0_E07723g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454297.1"
                     /db_xref="GeneID:2894055"
     CDS             complement(691980..693332)
                     /locus_tag="KLLA0_E07723g"
                     /note="similar to uniprot|P36091 Saccharomyces cerevisiae
                     YKL046C DCW1 Mannosidase GPI-anchored membrane protein
                     required for cell wall biosynthesis homologous to Dfg5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454297.1"
                     /db_xref="GeneID:2894055"
                     /db_xref="GOA:Q6CP42"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:Q6CP42"
                     /translation="MRVFKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMD
                     YYTGLQYGKTIGMFASPSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNH
                     DYMPLNQTVTEGNDDQAFWGFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDM
                     DSCGGGLRWQIFTWNSGYDYKNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQD
                     IQLLVDEEPTQYYVYDGASIEENCTDTVKYQWTYNQGLMLSGSAYLYNFTESETWHER
                     TKNFLNSSGIFFNNSIMYEAACQGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVL
                     ALLQASAQGAADSCSGGTDGHTCGLNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPA
                     PYTADDGGTSAGNPAAGTEQSPTNLAPLTIGKGDQAGAGIITAVIGITIIGSVVWLII
                     "
     gene            complement(<693694..>694191)
                     /locus_tag="KLLA0_E07745g"
                     /db_xref="GeneID:2893908"
     mRNA            complement(<693694..>694191)
                     /locus_tag="KLLA0_E07745g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454298.1"
                     /db_xref="GeneID:2893908"
     CDS             complement(693694..694191)
                     /locus_tag="KLLA0_E07745g"
                     /note="highly similar to uniprot|Q02159 Saccharomyces
                     cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
                     involved in the ER-associated protein degradation pathway
                     requires Cue1p for recruitment to the ER membrane proposed
                     to be involved in chromatin assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454298.1"
                     /db_xref="GeneID:2893908"
                     /db_xref="GOA:Q6CP41"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6CP41"
                     /translation="MSKTAQKRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGP
                     PDSCYEGGVFNARLDFPKDYPLNPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNM
                     YEHECERWSPVQSVEMILLSVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNLL
                     KSLGF"
     gene            <694992..>696401
                     /locus_tag="KLLA0_E07767g"
                     /db_xref="GeneID:2894189"
     mRNA            <694992..>696401
                     /locus_tag="KLLA0_E07767g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454299.1"
                     /db_xref="GeneID:2894189"
     CDS             694992..696401
                     /locus_tag="KLLA0_E07767g"
                     /note="similar to uniprot|P35192 Saccharomyces cerevisiae
                     YMR021C MAC1 Copper-sensing transcription factor involved
                     in regulation of genes required for high affinity copper
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454299.1"
                     /db_xref="GeneID:2894189"
                     /db_xref="GOA:Q6CP40"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:Q6CP40"
                     /translation="MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDI
                     RKVILVDRASRVEEVDGSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLK
                     IMVTSESGTPDYEVARKVSDDNKFVTEHEFLLNHVSPPPCKSCNSTVKRENESHSLDA
                     TNTTENYAKRVKFERQDMTNLSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYL
                     STTCSCNENCQCNNCLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSKDFF
                     HGETDDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRN
                     KVIHSKYWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEANDLVHFTDSRG
                     NAHHGNQNDNTKNHININKSIQDDMKRLMPNFGNNNVTLKKDTHSPKGDNRTLLTGTT
                     TADTHMNIHDPLKFNNLIL"
     gene            complement(<696382..>697887)
                     /locus_tag="KLLA0_E07789g"
                     /db_xref="GeneID:9487447"
     mRNA            complement(<696382..>697887)
                     /locus_tag="KLLA0_E07789g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999353.1"
                     /db_xref="GeneID:9487447"
     CDS             complement(696382..697887)
                     /locus_tag="KLLA0_E07789g"
                     /note="similar to uniprot|P50264 Saccharomyces cerevisiae
                     YMR020W FMS1 Polyamine oxidase converts spermine to
                     spermidine which is required for the essential
                     hypusination modification of translation factor eIF-5A
                     also involved in pantothenic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999399.1"
                     /db_xref="GeneID:9487447"
                     /db_xref="GOA:B4UN93"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:B4UN93"
                     /translation="MTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLN
                     TRQGRNGKYDIGGSWHHDTLSNGLFMEEMSLPESERAGFVFDDEDRACLVDKKLGVLE
                     VDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLR
                     YMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPVKDKIHLSESVNLIKK
                     LSNGKYQVNTDKGKYLCDYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDI
                     FEAITTKASFGSLGKVIFEFDSIKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKD
                     IEQKLPRSHEDSWKNPTCFLNLAKHTDTASFVALIQQPVTEYIETLTTEEVEEFFRPV
                     LNKLLNSLGSSDYISDLNDEVKESKTPILKNILTSNWSSDPFSLGAYSACQPGDDPMD
                     LVIALNVGQGNLRFAGEHTIMDGAGCAYGAWESGKREANYIIEKLFTGSDY"
     gene            <699154..>700626
                     /locus_tag="KLLA0_E07811g"
                     /db_xref="GeneID:2894225"
     mRNA            <699154..>700626
                     /locus_tag="KLLA0_E07811g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454301.1"
                     /db_xref="GeneID:2894225"
     CDS             699154..700626
                     /locus_tag="KLLA0_E07811g"
                     /note="some similarities with uniprot|P40463 Saccharomyces
                     cerevisiae YIL135C VHS2 Gene whose overexpression
                     suppresses the synthetic lethality of the hal3 sit4 double
                     mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454301.1"
                     /db_xref="GeneID:2894225"
                     /db_xref="UniProtKB/TrEMBL:Q6CP38"
                     /translation="MNHQDLSLSGDEGHSSSQRDSVYDDAGSIHSESSMIFERNVEDP
                     YSQVFSNPRLASLSRSASNANLAPYDSHDSLHDNGSGLSLSKSSSRKQSNAGSFIPHH
                     TLENLVAPALDEGVTIVNDDSTDLESVEMIYSRRPSTIGLDMALGRTRTNSSSDAATL
                     SGNNSSTTRLMRTNSASQGSGLETRPRVLRFYSYADMISDENSSYPRRPSITQSLSST
                     LLRQQGAGTPTGFDSHRAGNSPSNQLGSPDFSNPFLNNQAIAAAVAANGGNSGQGVSP
                     LESHRKLSNVSIPPLAVATRHYSGNLACRSPNTNTTNGHRLSTSPLMIPHNPNSALLR
                     KSNFQIESSGSECSDDEDPDQHRSNSNSSNSNNNNNNNNNNNNNNNNNNNRNTQHRGL
                     DHDVSSAGTLNTPPVNPQGLRLSRTSTQGSGFNKKFSPPAYKTRAYSNASGVSPYANN
                     FSRSSVSSANTHILDDVFYDEQLQSNTASEVVKKKLTNEI"
     gene            complement(<701193..>702044)
                     /locus_tag="KLLA0_E07833g"
                     /db_xref="GeneID:2894226"
     mRNA            complement(<701193..>702044)
                     /locus_tag="KLLA0_E07833g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454302.1"
                     /db_xref="GeneID:2894226"
     CDS             complement(701193..702044)
                     /locus_tag="KLLA0_E07833g"
                     /note="highly similar to uniprot|P53941 Saccharomyces
                     cerevisiae YNL075W IMP4 Component of the SSU processome
                     which is required for pre-18S rRNA processing interacts
                     with Mpp10p member of a superfamily of proteins that
                     contain a sigma(70)-like motif and associate with RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454302.1"
                     /db_xref="GeneID:2894226"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q6CP37"
                     /translation="MLRRQARERREYLYRKAQELQESQLQQKRQIIKQALAQGKPLPK
                     EIAEDEQLQKDFQYDESAQEQIDDEYSATSGIAEPKIIVTTSRDPSTRLSQFAKEIKL
                     LFPTAVRLNRGNYIMPNLVDACQTSGTSDLVVLHEHRGVPTSLTVSHFPHGPTAFFTL
                     HNVVLRHDILNSGNQSEVNPHLIFDNFTTPLGKRVETILKHLFPPGPKKDAARVITFA
                     NRGDFISVRQHVYVKTREGVELAEVGPRFEMRLFELKLGTLENKDADVEWQLRRFVRT
                     ASRKDYL"
     gene            complement(<702486..>704480)
                     /locus_tag="KLLA0_E07855g"
                     /db_xref="GeneID:2894142"
     mRNA            complement(<702486..>704480)
                     /locus_tag="KLLA0_E07855g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454303.1"
                     /db_xref="GeneID:2894142"
     CDS             complement(702486..704480)
                     /locus_tag="KLLA0_E07855g"
                     /note="weakly similar to uniprot|P34072 Saccharomyces
                     cerevisiae YNL076W MKS1 Pleiotropic regulatory factor
                     involved in Ras-CAMP and lysine biosynthetic pathways and
                     nitrogen regulation involved in retrograde (RTG)
                     mitochondria-to-nucleus signaling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454303.1"
                     /db_xref="GeneID:2894142"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6CP36"
                     /translation="MDQRISIRRREMDPKMLNCTDKNRFQMLHASSDVEHEQNHTFLK
                     VSPALFTQDKLPLFDSLDLYTSLIKCSKFMEQGERLHNLSWRIINKSLLKDQNINKSK
                     RRDGVRNLYHVINPIKQTHLFPQLQQQLQKPKAVTPASPKTPTTMVTAASTSATSSGS
                     SSALLTPISSGASIPKSTANTHITSTRPHISISKKLISPVCSSPEPLPTKMEVPSRSQ
                     ANTPDLRKDLAKKKFAISPELVNVPKNHQQQLPLPPSSSEPPVSNHVPLSETKSNAHS
                     QTSLFSRNPSSKSLFAKNQPTPFTPANGSTNSSANGSAENLKSNEMNHSSRTSSVANN
                     IAHTSSNGTKSGTSGTISNAAHVHAGQDHKNMFFSSEDEESDWDSLSDDSEIYDEEED
                     NDQYYENQWDKLMFSKTHQNNNVHQVPSKESGEKKSLLSGLFMQEKQTKSQVDPEDKA
                     YTTTNEDLLKRPLYVSEATSSAKAVEKPVLKSLDKQSEKPLRKKTDQNCILHQNPTGI
                     QIPPQPVAPETTEIVAVGSVTPSSSWQNKPLLDHQKPIPVAFERSRRLGSFSSIVSDT
                     TRERYYHESNAPPAAQTILPTALSTHMFLPNNVHQQRMALRGGSLQSDFDTEIAKKVA
                     SRRESMDIPSKNRNNFFLKTRMEISEEESFARAYGRCVKK"
     gene            complement(<705849..>707534)
                     /locus_tag="KLLA0_E07877g"
                     /db_xref="GeneID:2893991"
     mRNA            complement(<705849..>707534)
                     /locus_tag="KLLA0_E07877g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454305.1"
                     /db_xref="GeneID:2893991"
     CDS             complement(705849..707534)
                     /locus_tag="KLLA0_E07877g"
                     /note="weakly similar to uniprot|P16547 Saccharomyces
                     cerevisiae YIL136W OM45 Protein of unknown function major
                     constituent of the mitochondrial outer membrane located on
                     the outer (cytosolic) face of the outer membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454305.1"
                     /db_xref="GeneID:2893991"
                     /db_xref="UniProtKB/TrEMBL:Q6CP34"
                     /translation="MSNRVIIGGVAVAAAGYLLYERQVQLKQQQNGAVPVSPVVHDQS
                     TFERKGAKTGAKLDDLTTDVKDKMSQYKNEADYKFQDIASQVEGKKAGIADWTVEKLD
                     QAKNTIEDSRDKYRDNKHTLRENVQEYENKDKPNAVVQVYKDTKGAISTDLGNIKEGF
                     IDDLKSVKSAIVGTGNQVQDTVHQNVNEIADRSSQKIDDTKESVSKAAASSKQTVNEA
                     AQNAKDTSVSILNWGYNKAEKARAQAINNYDNASKKYQELEERFNESKKGLFGKGDPE
                     LQRQVDQAKAYVEDAKRRVDEATREFSEKTTNDFNKLANQVHDNEEELRRKGFLSWLR
                     GKADAEVVDPDSIASHSVSGWGETAELLAKEEMEEKVRNRQIGPSEAQRRLDRFKKIK
                     EDGWFTYKGKDEEFLAQKAAKALEGWGETASTMAQEEYEDLVRWREAGKKRYQASAST
                     ARDDAQRAADAAKKSLEDARAELNKHTKHWWQFGAEKNEELQKAAKAKYEDAEKNYQS
                     AVNTVNDWADKATGKFWSSTDDALHTAKQAAAGVHESTQKGLDKAQNYVQEKK"
     gene            complement(<709306..>710793)
                     /locus_tag="KLLA0_E07899g"
                     /db_xref="GeneID:2894036"
     mRNA            complement(<709306..>710793)
                     /locus_tag="KLLA0_E07899g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454306.1"
                     /db_xref="GeneID:2894036"
     CDS             complement(709306..710793)
                     /locus_tag="KLLA0_E07899g"
                     /note="similar to gnl|GLV|CAGL0J10296g Candida glabrata
                     CAGL0J10296g and weakly similar to YNL077W uniprot|P53940
                     Saccharomyces cerevisiae YNL077W APJ1 Putative chaperone
                     of the HSP40 (DNAJ) family overexpression interferes with
                     propagation of the [Psi ] prion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454306.1"
                     /db_xref="GeneID:2894036"
                     /db_xref="GOA:Q6CP33"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CP33"
                     /translation="MAKNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAES
                     IKLFQDISHAYETLSNSNKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAH
                     TAGDLFAQFFGGRGSSGTGASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMA
                     SGPGIRHNLKCNLYDLFHGKRAKLALNRTRLCQRCQGYGGKKATQCRGCQGTGLFTTT
                     KRMGPMVQTWQTTCKECSGTGKYIRSKDACTECSGNGFIKERKFFDVEVLPGMRNGNE
                     IILPGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVD
                     LKTSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGNFGNLYIR
                     FRVKFPEQLKSDTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTFTT
                     EDLQSKFKNAKRDSPNKRKHADRDGPHYNTTYDYDYNPTESCHMN"
     gene            <712370..>715057
                     /locus_tag="KLLA0_E07921g"
                     /db_xref="GeneID:2894037"
     mRNA            <712370..>715057
                     /locus_tag="KLLA0_E07921g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454307.1"
                     /db_xref="GeneID:2894037"
     CDS             712370..715057
                     /locus_tag="KLLA0_E07921g"
                     /note="similar to uniprot|P40462 Saccharomyces cerevisiae
                     YIL137C RBF108 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454307.1"
                     /db_xref="GeneID:2894037"
                     /db_xref="GOA:Q6CP32"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:Q6CP32"
                     /translation="MILSLTEPVVPLEYTLDLNVDHKQPNFKGQLTVQLKQRQPGQSF
                     NKFKFHCKQLIVTKVLLSDKPLSISYDANEQTVSFSSDDPLNIADDTAELRISYIGKV
                     NTIKTHRELTTGLFKTNFMSDTTGISDSYILATHTQPVFARSIFPCFDEPNSKCKYQL
                     TLTADDKFKVISNTSVENRSVTDDRKQIVKFSKTPLMNTSYFGFCIGDLEFLRTDVKL
                     KNKTIPVQLFAPQSISHATYSFDTIVELLPIVEKRLGVDYPLEKLDVVLLPFLSDMAM
                     ENWGLLTFQMNHLLLTPQALSDPSVIQQVRQLIVHELCHQWMGNYISFDSWDHLWFNE
                     AFATWFACDLLDEHDNDGYWSSDVYLTQMENVISTDAEVTTKSITQGSVIDVKSLQST
                     SDAFEPHIYHKGISLLRSLQQSVGKENFNRALAQIFSESSTFHETCIKPMDIFRRMGE
                     ILKSENIANFYSSWTRTPGIPIISVNTDTERTTLEQHRFLLEKTDVEDIPYHIPLFAV
                     QSSGEDDTKNGLFTDRTLKLSEPELIVNSGARGLYRVSYETDKCYELINEALKNSKIS
                     DLDLFKIFIDLRSLIGSEYQKKIHIDGVLMILRCLASHVDLTEELYRGLSIGLDILQT
                     IENALRTYTGKSEKAFITDIYVPLWDKFSWNDFHVSSYQLKVMSKVMFGIKHLDSTLT
                     VANQLMKKILSGPNKSIPLELCGSVFATVSCHQKNVKQWKKLYELVKSAKGVESHVDG
                     GSSIDIQNMALENLAFNTNEELIKKTLNFILTNITSTSVENALFGLNYNFREPLDGKK
                     NKLVRDVCWEWFELNYDLWGRKSLREGAESSERMKKTLVHISYVIFQMWMDNPEKVDE
                     FVTKKNATYGQTLGTAQIWTAVKASESSKMNIYKGILGF"
     gene            complement(<715185..>716660)
                     /locus_tag="KLLA0_E07943g"
                     /db_xref="GeneID:2894234"
     mRNA            complement(<715185..>716660)
                     /locus_tag="KLLA0_E07943g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454308.1"
                     /db_xref="GeneID:2894234"
     CDS             complement(715185..716660)
                     /locus_tag="KLLA0_E07943g"
                     /note="weakly similar to uniprot|P53939 Saccharomyces
                     cerevisiae YNL078W NIS1 Protein localized in the bud neck
                     at G2/M phase physically interacts with septins possibly
                     involved in a mitotic signaling network"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454308.1"
                     /db_xref="GeneID:2894234"
                     /db_xref="UniProtKB/TrEMBL:Q6CP31"
                     /translation="MSSYSSENNDTRRVIDLSSNNIGSRLHESLVDSNRAIYTSGMQE
                     RSLNEQNIHLVNTLEERSPNDKLLLSPYEEELYRRSLRLSPVTSIAAPIPTVTLLGED
                     APPEAGKTALPYMTDFDKFQVEQEKNNKNRRQGLEQNNDSLLSLFTKWPIYSSKKIKQ
                     KMNRHNSLKRTHSSVRRKDFSVQSEYAKYNKDKKFIFHKGFSQRHNSVNSLRRNYTKK
                     THFRKRSRFQNEQELMSYMRYINASQMDITEVITADNIRMYLYSKNSLRSLLRVNPTL
                     HPIKVPLMQFNELLNKKKNSPQGSNVVKRPSISRNLSRKAKHVRRSNTLPANKTSFAE
                     RLNPELYRTWNSYLKAIIAKRVELRISCLLGEDMSSFASSVRNSAIVYRESITPPLEL
                     GSPGNPIVISDNEDAPPVRGSQDNSSNTDGYGTIEKLYHENDTDDLSTRPSTSIFSVR
                     QSLTSADQNRRSFFFPPDNPGMHKIDEERSIRSVTSRNTLS"
     gene            <717476..>718648
                     /locus_tag="KLLA0_E07965g"
                     /db_xref="GeneID:2893679"
     mRNA            <717476..>718648
                     /locus_tag="KLLA0_E07965g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454309.1"
                     /db_xref="GeneID:2893679"
     CDS             717476..718648
                     /locus_tag="KLLA0_E07965g"
                     /note="similar to uniprot|P20484 Saccharomyces cerevisiae
                     YKL021C MAK11 Protein essential for cell growth and
                     replication of M dsRNA virus contains four beta-transducin
                     repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454309.1"
                     /db_xref="GeneID:2893679"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CP30"
                     /translation="MPDNQFRIIVGSYEHNLLCLSLNLSLTQPLFTPIFHFQAHSLSV
                     KCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQDIQL
                     NKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLW
                     NLMTVKKAGVLKLRKYNQNGQFVRWCGENGSYIAVGLLNKLLIFKTETAKVHREIDFS
                     RNTLMHLEREIIDGEEYIVVGLNSGAVQFWKASKLYEEVPDEEEESPKLEAEFSLLGH
                     SNRVKDFQFYHNKFGHYLVTIGSDGRIVVWDMKTRDQVAVYDCGERLNCVAVCDESIE
                     KYDTVKKRAPEEVEVGEPSDVEADPEELKKIMLGKKAKKSKKKGGNKKRKVEVQLE"
     gene            complement(<718820..>719938)
                     /locus_tag="KLLA0_E07987g"
                     /db_xref="GeneID:2893882"
     mRNA            complement(<718820..>719938)
                     /locus_tag="KLLA0_E07987g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454310.1"
                     /db_xref="GeneID:2893882"
     CDS             complement(718820..719938)
                     /locus_tag="KLLA0_E07987g"
                     /note="similar to uniprot|P38998 Saccharomyces cerevisiae
                     YIR034C LYS1 Saccharopine dehydrogenase (NAD
                     L-lysine-forming) catalyzes the conversion of saccharopine
                     to L-lysine which is the final step in the lysine
                     biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454310.1"
                     /db_xref="GeneID:2893882"
                     /db_xref="GOA:Q6CP29"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR027281"
                     /db_xref="UniProtKB/TrEMBL:Q6CP29"
                     /translation="MSVTLHLRAETKPLEARTALTPTTTKKLLDKGFKIFVEESSQSA
                     FDIEEYKKVGATIVPEGSWKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKNQAG
                     WEDVLSRFKRGNGVLYDLEFLENDQGRRVAAFGFYAGFAGAAVGIRDWAFKQTHSDSE
                     NLGAIEPYENEEAMIKDVRRDYQLALKRGARKPKVLIIGALGRCGSGAADLLRKCGLP
                     EENIIKWDMKETARGGPFQEIADADVFINCIYLSKPIPPFINNELLNKPTRRLRTVVD
                     VSADTTNPHNPVPIYTINTTFDAPTVQVPTTVGPKLSVCSIDHLPSLLPKEASESFSR
                     DLLPSLEQLPQRATASVWVKARNLYEKFAAKVGRTSKL"
     gene            <720700..>722865
                     /locus_tag="KLLA0_E08009g"
                     /db_xref="GeneID:2893899"
     mRNA            <720700..>722865
                     /locus_tag="KLLA0_E08009g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454311.1"
                     /db_xref="GeneID:2893899"
     CDS             720700..722865
                     /locus_tag="KLLA0_E08009g"
                     /note="similar to uniprot|P09798 Saccharomyces cerevisiae
                     YKL022C CDC16 Subunit of the anaphase-promoting
                     complex/cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454311.1"
                     /db_xref="GeneID:2893899"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CP28"
                     /translation="MSSSHDTPSHVQSTLAISPLVQRTGANRGSMNRNDPIGNSQGRN
                     VEGGRSNIPQIAQTPHQDRSPLVQKIRDVSHLATPAVMRHNGTAGSSLLASMTKNGLF
                     GPALPSTLRKTSTSTDTVELNNSTNDEDIDHASDNVFDVSDLSSVEKLRLWRHDALMQ
                     HHYKTAEHIGDLIYSMTKDPNDAFWLAQVYYNQGSYVRAVELIFTDQLDSESIMCRYL
                     AALCLFKLNKLEEALDIIGDTNPFQSEPSSPGNADGGVKLESSMCLLRGRIYVSLSNM
                     EQAKECFKEAVQVDVKNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLY
                     ISRLSKYQHQTEIEHARKVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLE
                     VDEYNLEVLPIYIQCLHSFAAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSE
                     ARKYFSRSSIMDPSFGYSWLGFAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGM
                     QYNRMDDLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKN
                     MKSESKAWISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKK
                     IEKAIDSFHKALALDQGNQASNKLLKTALEINAHMIIDENHPMVISSNIQNIPTSHVS
                     KNDKKRTSLGITSFDPVTEAKRLKQGISDHEGDSMDIEQ"
     gene            complement(<722953..>724179)
                     /locus_tag="KLLA0_E08031g"
                     /db_xref="GeneID:2893900"
     mRNA            complement(<722953..>724179)
                     /locus_tag="KLLA0_E08031g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454312.1"
                     /db_xref="GeneID:2893900"
     CDS             complement(722953..724179)
                     /locus_tag="KLLA0_E08031g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454312.1"
                     /db_xref="GeneID:2893900"
                     /db_xref="UniProtKB/TrEMBL:Q6CP27"
                     /translation="MDLFTESSLLDFLLEENTVSEVGLVEEVPHCLVHLPTFSNVGPK
                     TTTANTCKVPSAKKSKALKKELQFGELWEDDIARILESSLSIGGKNKTPAKVVPEKAS
                     KQETKSKKRGKSKAKEKSDRKLRSNEPLPNLRAGIAQSTGLLESGIFSSSTISESHYT
                     RNADSLAIDESEHNSTRSSKLARKQKSNLRTMQSSTTDEDENNVKNDLRSTINQRKKQ
                     RKEKREQRRVAKEASGETKAGSEETDENFPETPGSSGKLSPKDSKNQGSKRMKELIKK
                     ELQINKSKESLKELQRAINDHPTTEANTSDFTKTLCNKTEKEGFELLRGSEKVVVPKA
                     NSKSKSKSKDKLKNKPKASHQDSDLAAPENAIESGKSLDSKEPERKGRSTGGKKRKSK
                     SHRKNIESKDPVGTQA"
     gene            complement(<724562..>725470)
                     /locus_tag="KLLA0_E08053g"
                     /db_xref="GeneID:2893662"
     mRNA            complement(<724562..>725470)
                     /locus_tag="KLLA0_E08053g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454313.1"
                     /db_xref="GeneID:2893662"
     CDS             complement(724562..725470)
                     /locus_tag="KLLA0_E08053g"
                     /note="highly similar to uniprot|P15700 Saccharomyces
                     cerevisiae YKL024C URA6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454313.1"
                     /db_xref="GeneID:2893662"
                     /db_xref="GOA:Q6CP26"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006266"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CP26"
                     /translation="MLRSFIPTSRSVLLRYSPVQNYVLRSSVCRGLINAGQIQSYSQK
                     ASATATSASDSKGGNNGGKGKLLLILGLLALGSSVVSLSYQKNPPVAFEEGPVSDDKK
                     KTPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGE
                     LIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPS
                     TMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKV
                     VKVSCNQPVDEVYQHVTEAIKDKISK"
     gene            complement(<725895..>726792)
                     /locus_tag="KLLA0_E08075g"
                     /db_xref="GeneID:9487345"
     mRNA            complement(join(<725895..726251,726361..>726792))
                     /locus_tag="KLLA0_E08075g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999354.1"
                     /db_xref="GeneID:9487345"
     CDS             complement(join(725895..726251,726361..726792))
                     /locus_tag="KLLA0_E08075g"
                     /note="similar to uniprot|P40580 Saccharomyces cerevisiae
                     YIR036C IRC24 and to uniprot|P40579 Saccharomyces
                     cerevisiae YIR035C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999400.1"
                     /db_xref="GeneID:9487345"
                     /db_xref="GOA:B4UN94"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:B4UN94"
                     /translation="MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVIGIARSKDKLEEL
                     KTQYSGKFDYICGDVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISK
                     WKQLFDINFFSVVSLVGHALPLLKQSNGNIVLVSSGASTKSYVMWKIYDQYGWGAYGA
                     SKAALNHFAATIAAEEPAVKAISVAPGVVKTKMQEDIRETFGPSGMTKEALQRFVDLH
                     DNDQLLPPSVPGTIYANLASKGIPSELDGAYLRYNDEKLRSFSE"
     gene            <727056..>729026
                     /locus_tag="KLLA0_E08097g"
                     /db_xref="GeneID:2894263"
     mRNA            <727056..>729026
                     /locus_tag="KLLA0_E08097g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454316.1"
                     /db_xref="GeneID:2894263"
     CDS             727056..729026
                     /locus_tag="KLLA0_E08097g"
                     /note="similar to uniprot|P36102 Saccharomyces cerevisiae
                     YKL025C PAN3 Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex which acts to control poly(A)
                     tail length and regulate the stoichiometry and activity of
                     postreplication repair complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454316.1"
                     /db_xref="GeneID:2894263"
                     /db_xref="GOA:Q6CP23"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /translation="MISSASGTNWNRPDSFKGTQCRNIIIHGYCKFENEGCQFNHGNS
                     KETEGQTTDEVPTQRSMTPLNVKFNAKTSSSFTPGKSPAVRSPDFSSLPAFQPGAPVN
                     DQPMLADGPQISGTMSPSLMNSNATAFAPSFNPYASESFTPSVSAGGIPSSQELAGTL
                     HGSNPSIPSPVPSNPYVNSAGLPSGGMLGVGHPMQGLPPPPPPGALPVNPITQFPTVY
                     PPTHSVLQYHLYAPDPPPHLKIPLKPNERTPETLFINNHLRDRLVKNNQTALQVFPRG
                     SLPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITD
                     SAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGLANS
                     VNELNQEYLWAFLVQLTIALQEVHSNGLALNDLDWKKVIVTGEPGRIKVTDIGVYDTL
                     NYHQEGRMLHTEQQQNYLSLAELLLNLVQRLCGASGPLDDVKSYHIDPLFKKCIQYLQ
                     DTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQLSRELENARLFRLMCKLNAIY
                     GRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVMDLTHVLRCLNKLDAGVSER
                     LMLVTPDEMNCIIISYKELKDLIDSTFRALTQ"
     gene            <730334..>735823
                     /locus_tag="KLLA0_E08119g"
                     /db_xref="GeneID:2894264"
     mRNA            <730334..>735823
                     /locus_tag="KLLA0_E08119g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454317.1"
                     /db_xref="GeneID:2894264"
     CDS             730334..735823
                     /locus_tag="KLLA0_E08119g"
                     /note="highly similar to uniprot|P32528 Saccharomyces
                     cerevisiae YBR208C DUR1 2 Urea amidolyase contains both
                     urea carboxylase and allophanate hydrolase activities
                     degrades urea to CO2 and NH3 expression sensitive to
                     nitrogen catabolite repression and induced by allophanate
                     an intermediate in allantoin degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454317.1"
                     /db_xref="GeneID:2894264"
                     /db_xref="GOA:Q6CP22"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014084"
                     /db_xref="InterPro:IPR014085"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="PDB:3VA7"
                     /db_xref="PDB:4ISS"
                     /db_xref="PDB:4IST"
                     /db_xref="UniProtKB/TrEMBL:Q6CP22"
                     /translation="MESTLGWSVQDWLSFHSKSTPTKSLELLENLLKSQKPAPEDPAW
                     ISLIPVEDLHHQWNILQSKSNKEELPLYGVPIAVKDNIDYKGLPTTAACPSYLYQPTR
                     DSYVVELLRDAGAVVIGKTNLDQFATGLVGTRSPYGKTPCVFNDKYVSGGSSAGSASV
                     VGRGIVPLSLGTDTAGSGRVPAALNNLIGLKPTKGAFSCRGVVPACKSLDCVSVFALN
                     LSDAEIAFKVMNKPDLLEDEYSREFPKNPISQYPKDLTIAIPKEVPWFGETENPKLYT
                     KAVASLKNTGAKIVVVDFEPLLELARCLYEGAWVAERYCATRDFLATNPPESSLDETV
                     VNIIKGAVKFDAADAFKFEYKRQGILQKVNLLLKDIDVLCVPTCPLNPKLEEVAQEPV
                     LVNSRQGTWTNFVNLADLAALAVPSGFRSDGLPNGITLIGKKFSDYALLDLAKRFFSV
                     AFPNNSRTYGKFVDRRITVEDELDGPSKDTLNGVKLAVVGAHLKGLPLHWQLQKCNAT
                     YLSSPKTSNNYKLYALPKVGPVLKPGLRRVNDGTGSQIQLEVYSVPYDRFGDFIAMVP
                     EPLGIGSVELESGEWVKSFICEEFGYTQQGTVDITKFGGFKPYIEHIQVTEAQKKKPF
                     ETVLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDADFSVALHGRTAAETY
                     LDIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHS
                     AREIAERAKVPLVPGSGLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDI
                     ERVFETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRN
                     QKVIEETPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNAR
                     LQVEHPITEMVTGLDLVEWMLRIAANDSPDFDNTKIEVSGASIEARLYAENPVKDFRP
                     SPGQLTSVSFPSWARVDTWVKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNET
                     AVYGCITNIDYLRSIASSKMFKEAKVATKVLDSFDYKPCAFEVLAPGANTSVQDYPGR
                     TGYWRIGVPPSGPMDSYSFRLANRVVGNNSKSPALEITLNGPKLLFHTETVIAVSGGT
                     VSCTLNDAQIAQNEPIEVKRGDILSVGKVTVGCRAYLSIRGGIDVPEYLGSRSTFAMG
                     NMGGYNGRILKLGDVLFLNQPELSVSSLPAPDFEPQAAPKSLLPTLSTNKDWKIGVTC
                     GPHGSIDLFKEEYIEQFFNDKWKVHYNSNRFGVRLIGPKPKWARSDGGEAGLHPSNAH
                     DYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVAEAELWKVGQLTPGDTIQFVPLS
                     YGVARQLKESQDKSIDNFEEGSLLELSDDKILPKYENPILAVLPKKSDLSPKVTYRQA
                     GDRYILVEYGELEFDLNICYRINRLIHQVERHQTVGIVEMSQGVRSVLIEFDGSKINQ
                     KALLKCLIAYESEIQFDKNWNVKSKIFKLPMAFEDSKTLDCVTRYRETIRSEAPWLPN
                     NVDFIADVNDIDRNDVKNMLYSAKFMVLGLGDVFLGSPCAVPLDPRHRYLGTKYNPSR
                     TYTARGVVGIGGMYMCIYNAEGSPGGYQLVGRTITAWDKLVIGDHPIDHPWLLTPFDQ
                     VEFYPVTEEELEVIIEDNDNGKFKIDVEESIFDHKEYLAWINENIDSIVAFQEAQGGE
                     KADEFARLIQVANAELKKSGDDKPQDVEEYPDDAELLYSEYTGRFWKPVAAVGDHVEA
                     GDGVIIIEAMKTEMVVGATKSGKVYKILHKNGDMVEAGDLVAVIV"
     gene            complement(<736008..>737117)
                     /locus_tag="KLLA0_E08141g"
                     /db_xref="GeneID:2894267"
     mRNA            complement(<736008..>737117)
                     /locus_tag="KLLA0_E08141g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454318.1"
                     /db_xref="GeneID:2894267"
     CDS             complement(736008..737117)
                     /locus_tag="KLLA0_E08141g"
                     /note="weakly similar to uniprot|P28496 Saccharomyces
                     cerevisiae YKL008C LAC1 Ceramide synthase component
                     involved in synthesis of ceramide from C26(acyl)-coenzyme
                     A and dihydrosphingosine or phytosphingosine functionally
                     equivalent to Lag1p and similar to YHL003C uniprot|P38703
                     Saccharomyces cerevisiae YHL003C LAG1 Ceramide synthase
                     component involved in synthesis of ceramide from
                     C26(acyl)-coenzyme A and dihydrosphingosine or
                     phytosphingosine functionally equivalent to Lac1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454318.1"
                     /db_xref="GeneID:2894267"
                     /db_xref="GOA:Q6CP21"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:Q6CP21"
                     /translation="MSSELRQRHSSGSAAPSLTEHRFDEKKQARSRSRTGSSSKHHFK
                     PVSKVDRYSVLLSSILLSLLFVGNSFYPEYTKKFVNLQYEYPDNPGKYDIGIDDGYVI
                     LTFIVVFCLVRSFLLEFVLKPVGRNRFHMRSVKSLQRFGEQGWSMIYYLFSWIFGFYL
                     YYHSPYYFNIDHIYSGWPHDQLSGLFKTYYLFQIASWFHQIIVLNVEERRKDFWQMFA
                     HHIITVALTTGSYYYYFTRIGNVILILMDIVDVLLSFAKMLKYCGYSTLCDYMFVVFL
                     FWWVMLRHVVYNYLTYQTWLRAKNLMADGECIAGLAQKRCWTPTVVNIFLALLGGLQV
                     ITCIWMYLILKVLVKVIKGIGAEDVRSDEEDENSD"
     gene            complement(<737811..>738725)
                     /locus_tag="KLLA0_E08163g"
                     /db_xref="GeneID:2894296"
     mRNA            complement(<737811..>738725)
                     /locus_tag="KLLA0_E08163g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454319.1"
                     /db_xref="GeneID:2894296"
     CDS             complement(737811..738725)
                     /locus_tag="KLLA0_E08163g"
                     /note="similar to uniprot|P47821 Saccharomyces cerevisiae
                     YNL025C SSN8 Component of RNA polymerase II holoenzyme
                     involved in RNA pol II carboxy-terminal domain
                     phosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454319.1"
                     /db_xref="GeneID:2894296"
                     /db_xref="GOA:Q6CP20"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /translation="MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTI
                     HDSKANKQVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLS
                     RFLLRASVREVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTE
                     FEFYLIEELQSYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDV
                     HLLYSPHVIAISCLFAVSCIIHKPEDSTKRANINMFIAETQVNLEQVMFILQELISLY
                     DHWDKYNELRIRALLHELYLRQQTPAIQ"
     gene            739698..739798
                     /gene="SNR66"
                     /locus_tag="KLLA0_E08185r"
                     /db_xref="GeneID:9487298"
     ncRNA           739698..739798
                     /ncRNA_class="snoRNA"
                     /gene="SNR66"
                     /locus_tag="KLLA0_E08185r"
                     /product="snR66"
                     /note="C/D snoRNA monocistronic SNR66"
                     /transcript_id="XR_002633599.1"
                     /db_xref="GeneID:9487298"
     gene            complement(<740213..>741673)
                     /locus_tag="KLLA0_E08207g"
                     /db_xref="GeneID:2894728"
     mRNA            complement(<740213..>741673)
                     /locus_tag="KLLA0_E08207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454320.1"
                     /db_xref="GeneID:2894728"
     CDS             complement(740213..741673)
                     /locus_tag="KLLA0_E08207g"
                     /note="similar to uniprot|P40499 Saccharomyces cerevisiae
                     YIL090W ICE2 Integral ER membrane protein with type-III
                     transmembrane domains mutations cause defects in cortical
                     ER morphology in both the mother and daughter cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454320.1"
                     /db_xref="GeneID:2894728"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:Q6CP19"
                     /translation="MLHRITMEIFKQTRRRRSQERRLEPSTIARHCAKFNVSKMPLIK
                     KSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLD
                     RGSALSTLIYYLQHLLIPSILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIH
                     STPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVILSLLISGGIITLSLFYFYRI
                     YVTPMWELSTPSASLLGFTFSIVCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKM
                     AMNAMDEIFDIVKETWKIHQANLPKKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMM
                     DQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSA
                     TRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFP
                     YETEPKIVVDSWSFWNWCNIYSTMLIYALELMGSNK"
     gene            <742066..>744180
                     /locus_tag="KLLA0_E08229g"
                     /db_xref="GeneID:2894532"
     mRNA            <742066..>744180
                     /locus_tag="KLLA0_E08229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454321.1"
                     /db_xref="GeneID:2894532"
     CDS             742066..744180
                     /locus_tag="KLLA0_E08229g"
                     /note="similar to uniprot|P40498 Saccharomyces cerevisiae
                     YIL091C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454321.1"
                     /db_xref="GeneID:2894532"
                     /db_xref="GOA:Q6CP18"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESD
                     SDNAEPSVAAEREDVEQHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPE
                     NDGINSEDEQQNIENALDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESR
                     LYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKL
                     KLANDFQNNGLPLTEIQKELVDPMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKT
                     RDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKK
                     SKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIIC
                     SPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQ
                     READFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPE
                     QSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYI
                     PDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFR
                     RYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLE
                     RVVGSKRAAVLAHGQNEVYEFK"
     gene            complement(<744523..>744741)
                     /locus_tag="KLLA0_E08251g"
                     /db_xref="GeneID:2894533"
     mRNA            complement(<744523..>744741)
                     /locus_tag="KLLA0_E08251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454322.1"
                     /db_xref="GeneID:2894533"
     CDS             complement(744523..744741)
                     /locus_tag="KLLA0_E08251g"
                     /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
                     cerevisiae YNL024C-A Identified by gene-trapping
                     microarray-based expression analysis and genome-wide
                     homology searching"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454322.1"
                     /db_xref="GeneID:2894533"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:Q6CP17"
                     /translation="MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVF
                     WKFARIGERASPYVSLACIAMAVSQFNS"
     gene            <745145..>745930
                     /locus_tag="KLLA0_E08273g"
                     /db_xref="GeneID:2893987"
     mRNA            <745145..>745930
                     /locus_tag="KLLA0_E08273g"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_454323.1"
                     /db_xref="GeneID:2893987"
     CDS             745145..745930
                     /locus_tag="KLLA0_E08273g"
                     /note="similar to uniprot|P40496 Saccharomyces cerevisiae
                     YIL093C RSM25 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_454323.1"
                     /db_xref="GeneID:2893987"
                     /db_xref="GOA:Q6CP16"
                     /db_xref="InterPro:IPR016939"
                     /translation="MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFAR
                     TPQLTHPMNGKSRTALPDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDK
                     LRKLFFQQHPWELSRPKILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGE
                     KKELIDAYDQARFEFYRLRIQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDT
                     WKRKALQQAELMAARASSPSASWTNETEEEQKPIDQDVEEIQL"
     gene            complement(<746166..>746966)
                     /locus_tag="KLLA0_E08295g"
                     /db_xref="GeneID:2894119"
     mRNA            complement(<746166..>746966)
                     /locus_tag="KLLA0_E08295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454324.1"
                     /db_xref="GeneID:2894119"
     CDS             complement(746166..746966)
                     /locus_tag="KLLA0_E08295g"
                     /note="similar to uniprot|P53970 Saccharomyces cerevisiae
                     YNL024C Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454324.1"
                     /db_xref="GeneID:2894119"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CP15"
                     /translation="MSLLEVLTRDRKERTVLETCKAFIMGDVPFSSCFEELVPARPIE
                     HLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFP
                     DGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDD
                     KVHAEVLWWGNPLPDVFVKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILM
                     AYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMREK"
     gene            complement(<747272..>750037)
                     /locus_tag="KLLA0_E08317g"
                     /db_xref="GeneID:2893958"
     mRNA            complement(<747272..>750037)
                     /locus_tag="KLLA0_E08317g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454325.1"
                     /db_xref="GeneID:2893958"
     CDS             complement(747272..750037)
                     /locus_tag="KLLA0_E08317g"
                     /note="similar to uniprot|P53971 Saccharomyces cerevisiae
                     YNL023C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454325.1"
                     /db_xref="GeneID:2893958"
                     /db_xref="GOA:Q6CP14"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6CP14"
                     /translation="MTAEELIYPESEPRLYSSDSDFDSDNDEDTNIPYYEQTVKEIKD
                     GDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKI
                     NHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIP
                     VQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESI
                     IKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYV
                     EQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLS
                     CGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRR
                     HKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKC
                     HPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGP
                     HKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQ
                     KKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTK
                     QVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVA
                     KKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIK
                     ELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEH
                     YSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT
                     PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDEN
                     LSLVSQA"
     gene            <750670..>751779
                     /locus_tag="KLLA0_E08339g"
                     /db_xref="GeneID:2894444"
     mRNA            <750670..>751779
                     /locus_tag="KLLA0_E08339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454326.1"
                     /db_xref="GeneID:2894444"
     CDS             750670..751779
                     /locus_tag="KLLA0_E08339g"
                     /note="highly similar to uniprot|P40495 Saccharomyces
                     cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an
                     NAD-linked mitochondrial enzyme required for the fourth
                     step in the biosynthesis of lysine in which
                     homo-isocitrate is oxidatively decarboxylated to
                     alpha-ketoadipate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454326.1"
                     /db_xref="GeneID:2894444"
                     /db_xref="GOA:Q6CP13"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6CP13"
                     /translation="MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILE
                     SLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEG
                     YSSPIVALRKNLGLFANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATG
                     TRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVC
                     RETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS
                     LGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIH
                     KAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKLD"
     gene            complement(<751889..>753364)
                     /locus_tag="KLLA0_E08361g"
                     /db_xref="GeneID:2894445"
     mRNA            complement(<751889..>753364)
                     /locus_tag="KLLA0_E08361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454327.1"
                     /db_xref="GeneID:2894445"
     CDS             complement(751889..753364)
                     /locus_tag="KLLA0_E08361g"
                     /note="similar to uniprot|P53972 Saccharomyces cerevisiae
                     YNL022C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454327.1"
                     /db_xref="GeneID:2894445"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CP12"
                     /translation="MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTN
                     PRHIYAIVSSTWQYREYLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSK
                     RIQMGKHPIKTFILKHQTRLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINP
                     ILVKERYDDVLAELNKKFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYK
                     RGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIH
                     AFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI
                     FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVK
                     HAMSFPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGW
                     TSEFEEVFPKEEAKELAEGCIRALPKEDGGIGFFAVCFERD"
     gene            <754048..>756162
                     /locus_tag="KLLA0_E08383g"
                     /db_xref="GeneID:2893681"
     mRNA            <754048..>756162
                     /locus_tag="KLLA0_E08383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454328.1"
                     /db_xref="GeneID:2893681"
     CDS             754048..756162
                     /locus_tag="KLLA0_E08383g"
                     /note="highly similar to uniprot|P53973 Saccharomyces
                     cerevisiae YNL021W HDA1 Putative catalytic subunit of a
                     class II histone deacetylase complex that also contains
                     Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
                     subcomplex to form an active tetramer deletion increases
                     histone H2B H3 and H4 acetylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454328.1"
                     /db_xref="GeneID:2893681"
                     /db_xref="GOA:Q6CP11"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6CP11"
                     /translation="MESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTK
                     PKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP
                     TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSV
                     YFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVA
                     VAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI
                     HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD
                     AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVG
                     EPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRN
                     FPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEI
                     WSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQ
                     EILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLK
                     VMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIF
                     DERFEEATDFILDSFEEWSESE"
     gene            complement(<756205..>758538)
                     /locus_tag="KLLA0_E08405g"
                     /db_xref="GeneID:2893708"
     mRNA            complement(<756205..>758538)
                     /locus_tag="KLLA0_E08405g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454329.1"
                     /db_xref="GeneID:2893708"
     CDS             complement(756205..758538)
                     /locus_tag="KLLA0_E08405g"
                     /note="similar to uniprot|P40494 Saccharomyces cerevisiae
                     YIL095W PRK1 Protein serine/threonine kinase regulates the
                     organization and function of the actin cytoskeleton
                     through the phosphorylation of the Pan1p-Sla1p-End3p
                     protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454329.1"
                     /db_xref="GeneID:2893708"
                     /db_xref="GOA:Q6CP10"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CP10"
                     /translation="MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPP
                     DPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM
                     YEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDI
                     KIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLY
                     RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLIS
                     VMLRVDPLKRPNICQVVEEVSRIQGIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTV
                     PATVPTSVSTQHLPPQVVSNVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAG
                     KTVPQTVSNYTSSDPFSKIDRSALLSTSATMESLPRAMRIPQLEYQQPHLLTRSQSVV
                     PRASVSPVRNGRGAISSILASNRTSLDRPKYVDSETQTSDHPSELGLSRSLSRKSVAS
                     SLSSAESLEATSTGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRK
                     GISSMQFTGDSSSRKSSLEARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDY
                     ELIEDIQKEKPKSSLRRSSSLKTSSSIQKRVKDLINADDIPNRSSATGYGKYTDIGRK
                     TDISDHHKSNANRKSSTVITPVHEAPKSKPAPPPKPAHLKPNLPPKPKHLKAKSFRTS
                     PAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL"
     gene            759480..759553
                     /locus_tag="KLLA0_E08427r"
                     /db_xref="GeneID:9487400"
     tRNA            759480..759553
                     /locus_tag="KLLA0_E08427r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:9487400"
     gene            <759718..>760986
                     /locus_tag="KLLA0_E08449g"
                     /db_xref="GeneID:2894052"
     mRNA            <759718..>760986
                     /locus_tag="KLLA0_E08449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454330.1"
                     /db_xref="GeneID:2894052"
     CDS             759718..760986
                     /locus_tag="KLLA0_E08449g"
                     /note="similar to uniprot|P53962 Saccharomyces cerevisiae
                     YNL035C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454330.1"
                     /db_xref="GeneID:2894052"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CP09"
                     /translation="MSFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGN
                     LKTISSIQCHTTSINDMKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKAS
                     PFFSLDSRHNMLACGTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDS
                     NLLMSGSTDGYVNIYDLTQDDEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIH
                     ELNDKSDEMIEPKPLEFGDVRDKWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQ
                     VDVSSALVIPDAHGNEVIRDVLIPKNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWD
                     YTLPFTAFENSVREIEMDMGQETMQHESSSTSEQDSTSTGSDDEHKEKKDKKEKKHSK
                     KNKHGKKDRKSDKKSKSKSKKEKEHRYKPY"
     gene            <761242..>762957
                     /locus_tag="KLLA0_E08471g"
                     /db_xref="GeneID:2893992"
     mRNA            <761242..>762957
                     /locus_tag="KLLA0_E08471g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454331.1"
                     /db_xref="GeneID:2893992"
     CDS             761242..762957
                     /locus_tag="KLLA0_E08471g"
                     /note="similar to uniprot|P46678 Saccharomyces cerevisiae
                     YNL039W BDP1 Essential subunit of RNA polymerase III
                     transcription factor (TFIIIB) which is involved in
                     transcription of genes encoding tRNAs 5S rRNA U6 snRNA and
                     other small RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454331.1"
                     /db_xref="GeneID:2893992"
                     /db_xref="GOA:Q6CP08"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6CP08"
                     /translation="MSSVVNKSAKRFVPKLRERRILNSTPAPTVVPPVSDDITKSTAE
                     DSHENEADNEDGLNESSTDNTEPKRSDEESKINETVDEDDPLSQTTLVKNLNPSRTST
                     QIPVVTVSSATNRRRSSRLDSLSGTKPTFKSGFMGPGSLNTGNVPERSRRLSSISTGS
                     LRKKSLTVNSENDSSLQAIKRRRMSSRSSTGKGPGKVQRISIVSRMSSPDDDSLTAKP
                     AGDSENCDDIFQRTDDLYQKYTITNLKMIPKKIADKDSSKYLIDEENFTMADLCKPTL
                     PIGEISENFSRAKEAAKLKIERRRKRRELREMARKEFKSLNELVTEEEKQLKEERKKA
                     AQDLFDTEVPDEKPHQGIQLKMAADGSMVVDEESMVVDRHKNASLENSSKEKIQNNPF
                     ENLYNSATYGRQQFTDPWTIEEMIKFYQALSMWGTDFNLISQLFPYRSRRQIKSKFVN
                     EEKKHPVMIELALRSKLPPNFEQYCKETRKNIGTVTEFNKRLDQLQVEHEEHLKQIEV
                     ERQNAREQDIKQQTVKEHERSQKGKHGGRYDQLKGYRKSEIVLGSIDDLKKKRAEEAA
                     IEAQT"
     gene            <763184..>763639
                     /locus_tag="KLLA0_E08493g"
                     /db_xref="GeneID:2894171"
     mRNA            <763184..>763639
                     /locus_tag="KLLA0_E08493g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454332.1"
                     /db_xref="GeneID:2894171"
     CDS             763184..763639
                     /locus_tag="KLLA0_E08493g"
                     /note="weakly similar to uniprot|P53961 Saccharomyces
                     cerevisiae YNL038W GPI15 Protein involved in the synthesis
                     of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI)
                     the first intermediate in the synthesis of
                     glycosylphosphatidylinositol (GPI) anchors homologous to
                     the human PIG-H protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454332.1"
                     /db_xref="GeneID:2894171"
                     /db_xref="GOA:Q6CP07"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:Q6CP07"
                     /translation="MTVTTIEHNNNVAIKFVSTNRSVSRIISRQQSIIFLYVILSIIR
                     LSYADTWPALKYVNPICLLLFIRVPIIDSVQSIANQGIQISCSGGLLLFPRDWNYALF
                     TSIKFIPQDEIEDIFINEAFRGLQVIYYLAVLVKNQKKLQVLFEVCHVI"
     gene            <764002..>764973
                     /locus_tag="KLLA0_E08515g"
                     /db_xref="GeneID:2893636"
     mRNA            <764002..>764973
                     /locus_tag="KLLA0_E08515g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454333.1"
                     /db_xref="GeneID:2893636"
     CDS             764002..764973
                     /locus_tag="KLLA0_E08515g"
                     /note="similar to uniprot|P40493 Saccharomyces cerevisiae
                     YIL096C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454333.1"
                     /db_xref="GeneID:2893636"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:Q6CP06"
                     /translation="MARKLKGKISSKGLKGALLNHQAREERAKKIQQREKHVAAKGKP
                     TKQPLRQKEQQQVRGSGFLPFSSDSTLFLVGEGDFSFAKSIIEQQYIQPENLIITSFD
                     SGIKELKLKYPHSFEENYNFLKENEVVMLFGIDATNLKKSLKITKKTPWQKVVGNSWT
                     TKKLDFILFNFPHTGRGIKDQGRNIHEHQQLVYKYFDSCKQLFRLVNSSQIMLNSSIS
                     MGGYSLNNETRVDDEGYGKVVLSLFSGEPYDSWQIKILAKDNGWKVDRSGKFDWSKFP
                     GYHHKRTNSEMDTTKPAEERDARMYVFEMFNKRKHSKKPLKDDSDDE"
     gene            complement(<764998..>766404)
                     /locus_tag="KLLA0_E08537g"
                     /db_xref="GeneID:2893637"
     mRNA            complement(<764998..>766404)
                     /locus_tag="KLLA0_E08537g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454334.1"
                     /db_xref="GeneID:2893637"
     CDS             complement(764998..766404)
                     /locus_tag="KLLA0_E08537g"
                     /note="similar to uniprot|P40492 Saccharomyces cerevisiae
                     YIL097W FYV10 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin involved in
                     proteasome-dependent catabolite inactivation of fructose-1
                     6-bisphosphatase contains CTLH domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454334.1"
                     /db_xref="GeneID:2893637"
                     /db_xref="GOA:Q6CP05"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /translation="MTSLNEPNVDFHLKLNQQQFNIPSELLKRNWDKFNNLYTSYSVE
                     LQGQFATLNTLLEDPNKDEQSIEKLNDIINTVNILQKRLSQLHDNELTILERIEKRVE
                     YFKQFERFKYDSNTDKLLKWYRSYTDLLIADYLVRHGSNSIDHKNKIASNSGIEFIKT
                     RGLEDLIDYEVLIEANQISMELIENKNLRPLLEWIENNSAHLTEKGSHLQFQALLQEY
                     IELVRCSDYKAAIRCFQTHLAHFANIYPKELKLAAGILAFFKSCLNNGRDDEVTNEQK
                     LFHAYFRKQMYRPHPLSSISSSNVVHNAELCRYGPLLDHERWESLNKMFLHEFYSLYK
                     ISYHDPLLIYISLGISSLKTKDCGHTISAQLIPHENPEVNEYIKSNVVNTDCPVCNHD
                     IFPLSENLPFAHHIQSSLFENPVMLPNGNIYDSEKLISLSRKLNKMGYTKLKENQVMD
                     PIDKSIYATTDFIKMYPT"
     gene            complement(<766878..>768260)
                     /locus_tag="KLLA0_E08559g"
                     /db_xref="GeneID:2893906"
     mRNA            complement(<766878..>768260)
                     /locus_tag="KLLA0_E08559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454335.1"
                     /db_xref="GeneID:2893906"
     CDS             complement(766878..768260)
                     /locus_tag="KLLA0_E08559g"
                     /note="similar to uniprot|P40501 Saccharomyces cerevisiae
                     YIL088C AVT7 Putative transporter member of a family of
                     seven S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454335.1"
                     /db_xref="GeneID:2893906"
                     /db_xref="GOA:Q6CP04"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CP04"
                     /translation="MSATGTVASSTINLIKTIVGAGLLAIPYAFRCDGVFFAVSLILM
                     AAFTSGYGLFILAKCSKTLLNPRHSSFFTLCSITYPNLSLLFDFAMFIQCFGVALSYL
                     ILIGDLFPALFGGTRTNWILLSAIIIVPLSLLRHFDSLKYTSVIGLLALGYIGLLIIG
                     SYSFGNYPKPKVDWFSISDRSGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKI
                     INNSIVVSSACFIILGLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFP
                     LLFHPCRISANNMVHWLQLNYGTKSEIDETIGPITLEIEDDTDREYLEQELGSSHDTS
                     FVHTYQSLPRATDDDNDDQVDERTEAVPFPDSRFLTVTFFLLAVLYVLALNVESFALV
                     LALVGATGSTAISFTLPGLFGWKLIGTESLMNGERIGGWDKAHRYGSLALVWYGLIIM
                     VSCVYITLFV"
     gene            <768795..>769619
                     /locus_tag="KLLA0_E08581g"
                     /db_xref="GeneID:2893722"
     mRNA            <768795..>769619
                     /locus_tag="KLLA0_E08581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454336.1"
                     /db_xref="GeneID:2893722"
     CDS             768795..769619
                     /locus_tag="KLLA0_E08581g"
                     /note="similar to uniprot|P53965 Saccharomyces cerevisiae
                     YNL032W SIW14 Tyrosine phosphatase that plays a role in
                     actin filament organization and endocytosis localized to
                     the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454336.1"
                     /db_xref="GeneID:2893722"
                     /db_xref="GOA:Q6CP03"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CP03"
                     /translation="MSNENGRPKAHRLRKHGGDETDADLDSELEMMDKLNMASRLAEN
                     NLAKLLDNDKDLLNRVEEIKAQFQDRAKTPFSAEEDVDDIYDADEHGARSRQIMSARS
                     GTGNKEVIPPENFSHVCGEIYRSSFPRPENFEFLRDRLKLKSILVLIPEEYPAENMKF
                     MEETGIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENHPILIHCNRGKHRTGCLV
                     GCIRKLQNWSLTMIFDEYRRFAFPKVRALDQQFIELYDDTGIIKLATENNWLSVEW"
     gene            complement(<769789..>770283)
                     /locus_tag="KLLA0_E08603g"
                     /db_xref="GeneID:2893688"
     mRNA            complement(<769789..>770283)
                     /locus_tag="KLLA0_E08603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454337.1"
                     /db_xref="GeneID:2893688"
     CDS             complement(769789..770283)
                     /locus_tag="KLLA0_E08603g"
                     /note="similar to uniprot|P40502 Saccharomyces cerevisiae
                     YIL087C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454337.1"
                     /db_xref="GeneID:2893688"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:Q6CP02"
                     /translation="MSGTELSDIYQWSQTPYLAWLNGAMLITTPVVSPATQTPVSVMA
                     QKQSMFSAFTRPRYFGPTKTLSLMFGLANAIGGFMIYDGDLESGTGFLAAWNSLYLLV
                     GGRGSVKALRYGKVWPLLLTTVSASSAALYGRKVCCIGIPIDGIRHIKKRTMTLFFLR
                     MRIF"
     gene            complement(<770773..>771303)
                     /locus_tag="KLLA0_E08625g"
                     /db_xref="GeneID:2893884"
     mRNA            complement(<770773..>771303)
                     /locus_tag="KLLA0_E08625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454338.1"
                     /db_xref="GeneID:2893884"
     CDS             complement(770773..771303)
                     /locus_tag="KLLA0_E08625g"
                     /note="highly similar to uniprot|P02303 Saccharomyces
                     cerevisiae YNL031C HHT2 and highly similar to
                     uniprot|P02303 Saccharomyces cerevisiae YBR010W HHT1
                     histone H3 proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454338.1"
                     /db_xref="GeneID:2893884"
                     /db_xref="GOA:P61831"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="PDB:1PEG"
                     /translation="MKFVKNKSYIQSAIFVVNYLIHYIVSYYSCCTHNQHKPNTMART
                     KQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELL
                     IRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI
                     QKKDIKLARRLRGERS"
     gene            <772323..>772634
                     /locus_tag="KLLA0_E08647g"
                     /db_xref="GeneID:2894115"
     mRNA            <772323..>772634
                     /locus_tag="KLLA0_E08647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454743.2"
                     /db_xref="GeneID:2894115"
     CDS             772323..772634
                     /locus_tag="KLLA0_E08647g"
                     /note="highly similar to uniprot|P02309 YBR009C and to
                     uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
                     HHF2, two identical histone H4 proteins; core histone
                     required for chromatin assembly and chromosome function;
                     contributes to telomeric silencing; N-terminal domain
                     involved in maintaining genomic integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454743.1"
                     /db_xref="GeneID:2894115"
                     /db_xref="GOA:Q6CMU6"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="PDB:2YFV"
                     /db_xref="PDB:2YFW"
                     /db_xref="UniProtKB/TrEMBL:Q6CMU6"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<773082..>774650)
                     /locus_tag="KLLA0_E08669g"
                     /db_xref="GeneID:2893638"
     mRNA            complement(<773082..>774650)
                     /locus_tag="KLLA0_E08669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454340.1"
                     /db_xref="GeneID:2893638"
     CDS             complement(773082..774650)
                     /locus_tag="KLLA0_E08669g"
                     /note="similar to uniprot|P53966 Saccharomyces cerevisiae
                     YNL029C KTR5 Putative mannosyltransferase involved in
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454340.1"
                     /db_xref="GeneID:2893638"
                     /db_xref="GOA:Q6CNZ9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ9"
                     /translation="MRNRTRKLLIVITIALLICVGVHHIVRTEEAAIWEDAVVYSSAD
                     RASKKEHPFFEGCVDTAEYLNHKKYERQNATFVMLTRNEELDGVIHTMRSVERRFNQW
                     FQYPYVFMNNEPFTDEFQERVRSLTTANITFALVDESSWNFPKENTPLFQHYVESQGD
                     RGIMYGNMVSYHKMCRFYSGLFYKHPAVRQYEWYWRIEPDVEFFCDLTYDPFFEMKKA
                     GKKYGFTIFIKEIYWTVPNLFRATRSFIKQNDIKLGSLWKAFIKNRNVLLGDDYLNSF
                     VNELEELNEEMTHEFLIDYLKKNWAREKVIDDELIQEIAHRVRRKVPVVEDKFDQEEY
                     NLCHFWSNFEIARVDVFDNEVYNKYFEYLESWGGFWQERWGDAPVHSLGLALTLNAED
                     IHYFRDIGYQHTTIVHCPNNKEGKQLPYVESSKYTEIFERESSRMSVKEKALQYFKTG
                     KIDDGWDTGSGCRCQCPDIIDVEDTSHQCLMQWFDLVSDSPSREESLLPFNAAELKVA
                     LANDYKRHFAKNNN"
     gene            complement(<775085..>776044)
                     /locus_tag="KLLA0_E08691g"
                     /db_xref="GeneID:2894058"
     mRNA            complement(<775085..>776044)
                     /locus_tag="KLLA0_E08691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454341.1"
                     /db_xref="GeneID:2894058"
     CDS             complement(775085..776044)
                     /locus_tag="KLLA0_E08691g"
                     /note="similar to uniprot|P40505 Saccharomyces cerevisiae
                     YIL084C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454341.1"
                     /db_xref="GeneID:2894058"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ8"
                     /translation="MDEVQYSMMSSGVKKGQGAKQNGGAIPAGVGQDLSRKDKKRLQF
                     EGKVGKIRTSFAKDKDVHYRDRLTLLQTDLTTLHQGNNPEFLRKLRDLEEDRDLELVR
                     LRLFEEYRIYRSKVEFQEDIEKAKQEHERMIKLCKEMLYESLQKTIKKLQEERLLLDV
                     ANTQSYSMDYSRGKFQKQTRSSTQNSANFSAWDSSPNDVSQTESGNETGNTTDRRSLR
                     RRAATNQNRAQTPANITPANGSGKSSNTNSDAESMQYLSDSSELQALLFGKEKEKEKK
                     MGRGHQRLSTKSAPILQSLTPDEVTDDISLIRKLTGQVPAPFK"
     gene            <777005..>778795
                     /locus_tag="KLLA0_E08713g"
                     /db_xref="GeneID:2894688"
     mRNA            <777005..>778795
                     /locus_tag="KLLA0_E08713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454342.1"
                     /db_xref="GeneID:2894688"
     CDS             777005..778795
                     /locus_tag="KLLA0_E08713g"
                     /note="some similarities with uniprot|P53968 Saccharomyces
                     cerevisiae YNL027W CRZ1 Transcription factor that
                     activates transcription of genes involved in stress
                     response nuclear localization is positively regulated by
                     calcineurin-mediated dephosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454342.1"
                     /db_xref="GeneID:2894688"
                     /db_xref="GOA:Q6CNZ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ7"
                     /translation="MDIDDYLNVDSPSDIGANVLLNPEDSDNSRGSKVAPGFNAMNNS
                     RKCGVKLSDFGGDILSGFKEFGFSVANSFSKETGDNNKNAPSIPSLSINGVLAHDMLN
                     RSVKSNAQLQQPPSVNRNNGRNANKYVSHELNIPNTDPSFLFPALSTNETDNLDTVSS
                     ASNSPYIYPSDAISPSTGYLALDSDVDELLSVHSDLSDVSKEYQYISNLSELQELTGN
                     VNDPLPDYVDSQFSQLQELTNLAGQSNHNTQVEDLPMPRIRVDNTNVTPPRIKIEQFE
                     SASNSSRPVPTVGTVTSTFDTTHSELSTPSTASFGFNNSHQMFLDATKNNDSHNNNAQ
                     DTQSTLDMSEQVSLQNALSLQHDLLSVTTLQGRLPLENDNISDTFDKMLEGRRNRNRS
                     HSRSHSRSRSTSRKSISTRSLSPDERARSLSRDREHLLKLGGKVPNTEDKPKDNGEST
                     LNLIGTTKKKQAQKHPAVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFAR
                     MHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKTELGKKCILPLY
                     EEAELEKKANEASQTADAGGSGKSRTDGSI"
     gene            <779165..>780643
                     /locus_tag="KLLA0_E08735g"
                     /db_xref="GeneID:2894155"
     mRNA            <779165..>780643
                     /locus_tag="KLLA0_E08735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454343.1"
                     /db_xref="GeneID:2894155"
     CDS             779165..780643
                     /locus_tag="KLLA0_E08735g"
                     /note="similar to uniprot|P53969 Saccharomyces cerevisiae
                     YNL026W SAM50 Essential component of the Sorting and
                     Assembly Machinery (SAM complex) of the mitochondrial
                     outer membrane the authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454343.1"
                     /db_xref="GeneID:2894155"
                     /db_xref="GOA:Q6CNZ6"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ6"
                     /translation="MENLIHEPSGLEDRVHNGDNGKDLITAEEQFLQNQQENYLLDLF
                     QKNKHTPIHVSQVVLNGAEQVRDDVIQSYLSETINKADTFEQLCKYSDWFHYKMVGNG
                     MVESVSQSLDSRGSYPVQISQRDYGNLNFPSSGPETLSVIDVVPIIQLHPIKRFSAKT
                     GTNIGNGEGDGYIQFQLRNMFNAGEKLTFDATKGTKTHSSYLLNYFQPLQSPWWVSDT
                     TVFKNARQLGHCELFLRGIASGIKSGYLHDGAVNHEWRWESLLRSCDVRSDFASSHLL
                     FSAGDDVKHSVVHSITRDTRDNIIAPSSGQMWKFINEVSLGKFWKTNLEYNFTKSWFN
                     RNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDIYDYVGG
                     DTSLSYGLSLFSRLPFKRFYDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQHSLST
                     GFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISFL"
     gene            complement(<780776..>781831)
                     /locus_tag="KLLA0_E08757g"
                     /db_xref="GeneID:2894156"
     mRNA            complement(<780776..>781831)
                     /locus_tag="KLLA0_E08757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454344.1"
                     /db_xref="GeneID:2894156"
     CDS             complement(780776..781831)
                     /locus_tag="KLLA0_E08757g"
                     /note="highly similar to uniprot|P40506 Saccharomyces
                     cerevisiae YIL083C Homolog to human PPCS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454344.1"
                     /db_xref="GeneID:2894156"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ5"
                     /translation="MTGRRIHTSITEVSKAIDRTVDETALPIAHLSDEDNYFRTNPRP
                     VYMDDLLTEATQFIEYQKSQGREKIVLVTSGGTTVPLENNTVRFIDNFSAGTRGASSA
                     EQFLFNGYSVIFLHREFSLTPFNRPFIHNTETCFLDYFDEDGSISPKYKDLILQNKRD
                     YDQFIYKEKKLLMLPFTTVNQYLWSLKTIAALMNNSGCLFYLAAAVSDFFVPYSRLPQ
                     HKIQSQEANQSLNDGNQSSTTVGGKLIVNLDPVPKFLRRLVESWATQAMIISFKLETD
                     NNLLIHKAHQALDRYNHQLVIGNLLQTRNKEVVFVSEQNRDGDWIRITDDHKNIEKLI
                     VQEIVKRHDAWRKTGKQ"
     gene            <782800..>784227
                     /locus_tag="KLLA0_E08779g"
                     /db_xref="GeneID:2894255"
     mRNA            <782800..>784227
                     /locus_tag="KLLA0_E08779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454345.1"
                     /db_xref="GeneID:2894255"
     CDS             782800..784227
                     /locus_tag="KLLA0_E08779g"
                     /note="similar to uniprot|P32588 Saccharomyces cerevisiae
                     YNL016W PUB1 Poly(A) RNA-binding protein abundant
                     mRNP-component protein hypothesized to bind a pool of
                     non-translatable mRNAs not reported to associate with
                     polyribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454345.1"
                     /db_xref="GeneID:2894255"
                     /db_xref="GOA:Q6CNZ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ4"
                     /translation="MSAEESQQAQTETAAPVPVPAPAVEQDHSNEATTTVEEKSPGAA
                     TTAPATEEAPASEKPASQDNNGDGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVG
                     NLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGK
                     EVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD
                     MQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN
                     GPASGRGGFRNNNNQNQNHHNHNGINRHAGPPPHHQMQSHLPPQLQQQPPIGIPPIHQ
                     APLVPPPVDPEAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYP
                     EKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPTFIRPQQQMGPIPGQLP
                     LEEQQQQFENAPQQHDQQQPQQQEQ"
     gene            <784991..>787306
                     /locus_tag="KLLA0_E08801g"
                     /db_xref="GeneID:2894228"
     mRNA            <784991..>787306
                     /locus_tag="KLLA0_E08801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454346.1"
                     /db_xref="GeneID:2894228"
     CDS             784991..787306
                     /locus_tag="KLLA0_E08801g"
                     /note="similar to uniprot|P25037 Saccharomyces cerevisiae
                     YDL122W UBP1 Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins cleaves at the C
                     terminus of ubiquitin fusions irrespective of their size
                     capable of cleaving polyubiquitin chains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454346.1"
                     /db_xref="GeneID:2894228"
                     /db_xref="GOA:Q6CNZ3"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ3"
                     /translation="MLTTILEKLGFEEKRVLKAVLIGLIASLYFLYKNEFDITRVAVS
                     VVSTTKEITQAVRDKIMLGRWAPRNAEQEETIVRRGGYVGGLVNDGNTCFMNSVLQCL
                     ASSKELHKFMDTIILDSNDDSQNTIDENGEESDLPNEQSTVEKKPKATKNKTYGKRKK
                     IAVRQADNELLKNSTEPNMHFTLALQDLFSKLNAKHYRNRPWFKTNKLLKTMSKAPNR
                     NIILGYDQEDAQEFFQTILSELEKNVESIYGKPEKDPKPVPQDDLPEDAIVGQEHLGE
                     IGDVYIPTEQIDPNSVLASGRKFYSPYKIVTPLDGITAERIGCLQCGENGGIRYSVFS
                     GLSLNLPSDNIGSPIKLSQLLDEWSKPEIIEGVDCNRCALNAVLEHLVEQLNTIQSQP
                     DVNQKLVTLMEDRINEVKSVLSKLAIDDDDYKRMHTENMVRKSSKSKQILISRPPPLL
                     SVHINRSVFDPRTYMIRKNNSRVIFKSKLNLSPWCCNYDKINLDARLPMSKKQENWHE
                     SSEDDNNGTEYYNKLHRRFEKEFEDSDEEEDGSDNGQGMFNGSSRMVEEHDVLNGELS
                     SASLSSSEDDIAEVEEVELDALGNTIVKKTAKKPLLGGNQDVSISRGNLDIVDAEGNS
                     EQEDDPEDDDEDEAYEEDEAEEDEENSEEESDDSLPTPPLPPTQPIVSSVPAGPLTYV
                     LRSVIVHYGTHNYGHYIAFRRFRGCWWRISDESVYIVDEQEVLSTPGVFMLFYEYDYD
                     TETGKMKDDTEYENEFNVEIEGEPAVDQVTH"
     gene            complement(<787451..>787882)
                     /locus_tag="KLLA0_E08823g"
                     /db_xref="GeneID:2894203"
     mRNA            complement(<787451..>787882)
                     /locus_tag="KLLA0_E08823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454347.1"
                     /db_xref="GeneID:2894203"
     CDS             complement(787451..787882)
                     /locus_tag="KLLA0_E08823g"
                     /note="similar to uniprot|Q07541 Saccharomyces cerevisiae
                     YDL121C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454347.1"
                     /db_xref="GeneID:2894203"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ2"
                     /translation="MNPFVYLIVFLLVVAFVVLLPLIGGIGSYSVDKKTTRRSGDAKD
                     SEKAGSLAKYAKLKKEDAPVKFKVSSSQEGEGFGTRKFEIDGKTGLKKRVIGKYNEDE
                     AEFDYDVDELIAEDLREQQQEEAARYAQYLGKENETQENLV"
     gene            <788296..>788868
                     /locus_tag="KLLA0_E08845g"
                     /db_xref="GeneID:2894481"
     mRNA            <788296..>788868
                     /locus_tag="KLLA0_E08845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454348.1"
                     /db_xref="GeneID:2894481"
     CDS             788296..788868
                     /locus_tag="KLLA0_E08845g"
                     /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
                     YDL120W YFH1 Yeast Frataxin Homologue mitochondrial
                     protein that regulates mitochondrial iron accumulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454348.1"
                     /db_xref="GeneID:2894481"
                     /db_xref="GOA:Q6CNZ1"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ1"
                     /translation="MLVKNSSRVIRSVISRRSIVTKAIPSIGLARTAPTRAPVLSKLG
                     ILNQHNLPFVTVQRMHNSIAASTDGKTIPEEILDMPIEVYHEISDEFMDSLLDQLEIL
                     CDYHPEVVQDVEMSQGVMSIEVPSVGTYVINKQPPNKQIWLASPVSGPNRFDYYQKEW
                     VSLRDGTKLLDILNKELSDRLEGDEIDLHY"
     gene            <789275..>789505
                     /locus_tag="KLLA0_E08867g"
                     /db_xref="GeneID:2894482"
     mRNA            <789275..>789505
                     /locus_tag="KLLA0_E08867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454349.1"
                     /db_xref="GeneID:2894482"
     CDS             789275..789505
                     /locus_tag="KLLA0_E08867g"
                     /note="similar to uniprot|P01095 Saccharomyces cerevisiae
                     YNL015W PBI2 Cytosolic inhibitor of vacuolar proteinase B
                     required for efficient vacuole inheritance with
                     thioredoxin forms protein complex LMA1 which assists in
                     priming SNARE molecules and promotes vacuole fusion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454349.1"
                     /db_xref="GeneID:2894482"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="UniProtKB/TrEMBL:Q6CNZ0"
                     /translation="MTFKSFIITFKDSVPEADASKIKNSISSLGGTIVHDYSLIKGFA
                     VKLPESLKIDKLKDLHGDAFETIEEDKEVKAL"
     gene            <789922..>791007
                     /locus_tag="KLLA0_E08889g"
                     /db_xref="GeneID:2894689"
     mRNA            <789922..>791007
                     /locus_tag="KLLA0_E08889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454350.1"
                     /db_xref="GeneID:2894689"
     CDS             789922..791007
                     /locus_tag="KLLA0_E08889g"
                     /note="similar to uniprot|P18898 Saccharomyces cerevisiae
                     YGL155W CDC43 Beta subunit of geranylgeranyltransferase
                     type I catalyzes geranylgeranylation to the cysteine
                     residue in proteins containing a C-terminal CaaX sequence
                     ending in Leu or Phe has substrates important for
                     morphogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454350.1"
                     /db_xref="GeneID:2894689"
                     /db_xref="GOA:Q6CNY9"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY9"
                     /translation="MQGVMDDKNVAKHIKFCQRHLQLLPSHRLDIDPNRLAIAFYSLT
                     AIELLGKPVRKDFQYSLDWIRSCYIELADYSGFAIPSFRHAKQLTTINLPNTLFGLIC
                     LMLLGDHEFFDEKLNRDTLGKFISSCQLPDGSFTSFLDNAGYPSKFDSHDLRFCYIAV
                     SILYLIGCRSESDFSRYINVSKLLQYIMSRQCTMGGFGDWNEPHGGYTSCALSALSLL
                     NQLQNIPASFRQDTLHWLVNRQVSAIGVFVEQDLNDDYDPDDSGGFNGRENKLADTCY
                     AFWCLNSLRILEPQRWSQLIDVPLIRDYLLNQTQNKMVGGFAKNDQDDPDIYHSMMGI
                     SALKLIDDEINGVLCIPKLIMDNFNLR"
     gene            complement(<791157..>792041)
                     /locus_tag="KLLA0_E08911g"
                     /db_xref="GeneID:2894220"
     mRNA            complement(<791157..>792041)
                     /locus_tag="KLLA0_E08911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454351.1"
                     /db_xref="GeneID:2894220"
     CDS             complement(791157..792041)
                     /locus_tag="KLLA0_E08911g"
                     /note="similar to uniprot|Q07534 Saccharomyces cerevisiae
                     YDL119C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454351.1"
                     /db_xref="GeneID:2894220"
                     /db_xref="GOA:Q6CNY8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /translation="MSEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLW
                     KTLKSIETPSQLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQL
                     NMYENMFSGAVTRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFR
                     GFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAF
                     SAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKA
                     FSAGIAWGIYEEIVKKFV"
     gene            complement(<792276..>793067)
                     /locus_tag="KLLA0_E08933g"
                     /db_xref="GeneID:2893692"
     mRNA            complement(<792276..>793067)
                     /locus_tag="KLLA0_E08933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454352.1"
                     /db_xref="GeneID:2893692"
     CDS             complement(792276..793067)
                     /locus_tag="KLLA0_E08933g"
                     /note="weakly similar to uniprot|P50113 Saccharomyces
                     cerevisiae YGL154C LYS5 Phosphopantetheinyl transferase
                     involved in lysine biosynthesis converts inactive apo-form
                     of Lys2p (alpha-aminoadipate reductase) into catalytically
                     active holo-form by posttranslational addition of
                     phosphopantetheine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454352.1"
                     /db_xref="GeneID:2893692"
                     /db_xref="GOA:Q6CNY7"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY7"
                     /translation="MPGDKHDQHMSHIFICDFEDGYLKDSFNFEMAMRLLPFEAQDKV
                     LRKRSDKLQRMALTNRLLQLYGCSIVTGENFNHLIFGNGPFGKPMLLGHNGIEFSMSN
                     GEQSCVMAVQETEVGIDIASTIDCNHWDAEYLDTFQDIFTDQEFKTLKESSSHRDELF
                     TLYWSMKESYMKLIGTGLNTNIKAIDIGEIPEPLQELEVRSVEKKINGRHIMFISRWI
                     NKHEIVTTSTFLLPQTPFDSYNAESVDTKQLIEYLSLRQDDHPHQ"
     gene            <793287..>794315
                     /locus_tag="KLLA0_E08955g"
                     /db_xref="GeneID:2893801"
     mRNA            <793287..>794315
                     /locus_tag="KLLA0_E08955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454353.1"
                     /db_xref="GeneID:2893801"
     CDS             793287..794315
                     /locus_tag="KLLA0_E08955g"
                     /note="similar to uniprot|P53112 Saccharomyces cerevisiae
                     YGL153W PEX14 Peroxisomal membrane protein that is a
                     central component of the peroxisomal protein import
                     machinery interacts with PTS1 (Pex5p) and PTS2 (Pex7p)
                     peroxisomal matrix protein signal recognition factors and
                     membrane receptor Pex13p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454353.1"
                     /db_xref="GeneID:2893801"
                     /db_xref="GOA:Q6CNY6"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY6"
                     /translation="MSGEIPQDRRELYDSAISFLKDPNVVSAPLTQKIEFLQGKGLTQ
                     DEIQLALKDATGGSKDESKPVVNSDNTVSRESSNSHFHYEAVPPAIPNRDWKDYFIMA
                     TASVGLFYGVYQLTKRYIVPQLLPEPKSKLEKDKELILEQFDKVEKLLSQIEQEHEEF
                     KTKEENKLEELDRTIIQLQSTLDDTTKLKQHMESEFSSIKTEFNNMQNSIDSFTKKAG
                     NEKELEKVQEELQSLKSLIKSSFNPASAMNNGNTGGNSLISPNSTGMIPGADSIPSAA
                     DILANMDLQKKSASPPAGSLTNGTDTKAVPAWKKAREENGSKSATPTSSIPEWQKTMN
                     TGNSYESN"
     gene            <794616..>797819
                     /locus_tag="KLLA0_E08977g"
                     /db_xref="GeneID:2893802"
     mRNA            <794616..>797819
                     /locus_tag="KLLA0_E08977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454354.1"
                     /db_xref="GeneID:2893802"
     CDS             794616..797819
                     /locus_tag="KLLA0_E08977g"
                     /note="similar to uniprot|P53114 Saccharomyces cerevisiae
                     YGL151W NUT1 Component of the RNA polymerase II mediator
                     complex which is required for transcriptional activation
                     and also has a role in basal transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454354.1"
                     /db_xref="GeneID:2893802"
                     /db_xref="GOA:Q6CNY5"
                     /db_xref="InterPro:IPR014801"
                     /translation="MESVSQLVSNCASRGIPAQQFLNFYHELINEKYGASLNAGNEER
                     ESESRKQVFEDVSRELVQAFHSSEDAILLAEYMVHLLFINYDTYLSSALLPQVYSIQS
                     ETLLMHFHSLAASFIGKLEDKLIKEQMRQDLSTFILSSCLQCDMSTFNNQLFISIVKY
                     LQALLTLIDDSIDIEMDKDNLKLAVTSLLTRTTKLNRILGKRIGREFETKLNLSLSAK
                     LAMVNSPQIFSPSSGATRFAGTPGSTKPMDLALSATSSTSNKIQDLKLIRFYKNLWLN
                     NKIHHFNTSDSQLLEKFSSINSRLSSSLAEEHLIQEQITDLIETTYTSFAQLVNNKLY
                     HQTNTNFNLLERKYVHFITKRLPLIIKDFLPQNPSVIVNSLQNIDEKVKKAIKSYYSN
                     KNDSPERNEDLFDDYSGNNFDIRHDFLKNLIMLNLRPPSVLNEFLREDQMVDVKTLKT
                     DDSLVIVNSQGVQEKVSDVQEALKSLIADLDIENQYVANGNNYRFSPDNALLKLLMSF
                     DTIAPTKQVEIANAFLQILQKATDTSDLKTLGKVLWILTSNVGHSTTSMLCCISPGPF
                     INAVVKFLEKQQRNSTVSSSDEPDFDSLHSYVTYGMALSFVVFLKTTYDFDIEPFIQN
                     FEESYTLKFLSSIEDISDIFVLQNESAEGSKLYLQNWLRDLFINGSISDSQMKNTNVK
                     DLINLIPFIFKQSVIAVQAGVVSNILNLTSGFEYFLQPFLMPGLIKIMFWLEYYLHSL
                     KNNNPPSQILSSCWELINILICPPSLDDDAKGLHFMILKLNCVRLLNVLYLFRNDESN
                     SSQYGVYAAHESIDPKLEAVISKLEYIASISNIYDVDTKCYETTKEVYSHGTLFSNKI
                     PVTNEHPIDIIMTNQLNSFWNLHSSTYYNYDYLLELIKLITPEKFLVDSIRTLTYKVA
                     AYGIPGVQGKLNTSAIEQVANFLAYFMILHDVQTEEQRLALLNYIESGVIVSKETETK
                     QEPETKLDDDFDMLFGEPFNNTLDETSLVFSQNEQPKSYSSSVFPVLHDTFGVVIAEM
                     KKRYDTSKNNGLLSEAAYENATTFIRKYVENLKNSVV"
     gene            complement(<797861..>802330)
                     /locus_tag="KLLA0_E08999g"
                     /db_xref="GeneID:2893796"
     mRNA            complement(<797861..>802330)
                     /locus_tag="KLLA0_E08999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454355.1"
                     /db_xref="GeneID:2893796"
     CDS             complement(797861..802330)
                     /locus_tag="KLLA0_E08999g"
                     /note="similar to uniprot|P53115 Saccharomyces cerevisiae
                     YGL150C ATPase that forms a large complex, containing
                     actin and several actin-related proteins, that has
                     chromatin remodeling activity and 3' to 5' DNA helicase
                     activity in vitro; shows similarity to the Snf2p family of
                     ATPases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454355.1"
                     /db_xref="GeneID:2893796"
                     /db_xref="GOA:Q6CNY4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSLEKLLNREENDSSKRTDFMGRWYLKMSKICERDDREMDYQNW
                     KFLSYQEFELINEWNQQGKELTKDNCERLLVNMDKTHKEWVEYQKFKEQKDAIIAELK
                     ESIQIIKQEPSIPSGADANSVVSSDTEQIQDSETTANSKKSPAINGIKTSGKSPTKSP
                     ATNGRRRGAGGNRRVKRPSNLSKTVRSRNATDGDENGNENIENGGTTPKRRSRPKKIL
                     VSNVSKDVDAEEEDDIHTEKDASGSAADLDKDIVDESINDSENAPRKRPVSSTSLLSR
                     NKSNKPTKSSPLTPDSAREKENVNGVTEGNEDMDHDSVLDADDSAIGSDDNPNDEQEE
                     ADDENVDEEAEDENDEAEVEDDIDDLGAPEDDGDDDFAPSYSAISKVKVNKKVNIDSP
                     MPAIQKELRKMAIKSSVAKAMKRKFTNCKVISYSPESQLEIKITLKQLHIRKYKRHLA
                     EEERKRKAEEALIKAEEEAKKRKLAPPPPPPPQQVRRVEHDLPTYGMKITLKEARAIQ
                     RHYDQTYITIWKDMARRDSGRISRQLQQIQSIRGQNFRKTSSLCAKEARRWQMRNFRQ
                     VKDFQTRARRGIREMSSFWKKNEREEREMKKKAEKEAIEQAKKEEEQRENLRAAKKLN
                     FLLTQTELYSHFIGSKIKTNELEGTMTDDSLTSMSNNKNKVVDLTKTAASKTNVESID
                     FATEDDEKLRLMAAQNASNALKETQDKARKFDEEDEEDGELNFQNPTSLGEITIDQPK
                     MLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLADRYNIWGPF
                     IVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRKFWDRKHLRYGRDAPFHVM
                     VTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQ
                     NNMQELWALLHFIMPSLFDSHDEFSDWFSKDIESHAESNTELNQEQLRRLHMVLKPFM
                     LRRIKKNVQSELGDKIEIDVLCDLTFRQAKLYQVLKSQVSGGYDAIENAAGNDDVTSD
                     QKLVNLVMEFRKVCNHPDLFERADVMSPFSFVSFGESASLSREGDFVEVNYSAKNLIN
                     YNLPRLIYDELVVPNYNNDVDVRAKLLYHTMNIFHPANSFQLCFILSKLTDTSPNKFA
                     TLLEQNVINRAIDLQNDGYFNTAKYSIAYDEGEKIFSSNLLINDKLKYLHLLKNSTSG
                     SVLKNLLEIPSSVYENEYFNSISPAYHPAASAPPINIDVLASNNFVQKKQYEMFNPSI
                     SSALSSIPSSVQHKLIVEKGIPIEELPVTEMAPKAFNNSFTSYIEMPSMDRFITESAK
                     LKKLDELLVKLKEEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLV
                     HDWQTKPDIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ
                     VTVYRLLIRGTIEERMRDRAKQKEHVQQVVMEGKAKENKQKIIEVEKEHSESA"
     gene            <804915..>806615
                     /locus_tag="KLLA0_E09021g"
                     /db_xref="GeneID:2893840"
     mRNA            <804915..>806615
                     /locus_tag="KLLA0_E09021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454356.1"
                     /db_xref="GeneID:2893840"
     CDS             804915..806615
                     /locus_tag="KLLA0_E09021g"
                     /note="uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g
                     frt1 Hexose transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454356.1"
                     /db_xref="GeneID:2893840"
                     /db_xref="GOA:F2Z6G6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:F2Z6G6"
                     /translation="MSSNLSEKAVDQQKEFGLLKSTSSVDSVHEVEAGVKVGEDDDNY
                     FFSEDQILTQIKVYEDEIANTPVTKTLRQRMRRMEFCEVNFSNKTYMVIMLGFFASFA
                     GILSGVDQSTISGASYGMKASLKLTSDEDSLISSLMPLGAVGGSILLTPLSEYFGRKV
                     ALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESVPSTVRGS
                     LVSLYQFNIALGELVGYVIGVIFFDVKGGWRYMLGSSLVFSTILFVGLFFLPESPRWL
                     IHKGYDVEAYKVWRRLRDTSDLGNKREFLEMKHAAEQDRQLKEQESRFKSMFDLILIP
                     RNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVAMSMVGGAALLIGTI
                     PAILYMDKFGRRPWSMTIIGFSVGLVLVGVGYQIDLNTNLAAAEGVYLTGQILYNIFF
                     GTYATLTWVVPSESFSLATRSIGMTICSAFLYLWAFTVTYNFNKMKDAFTYTGLTLGF
                     YGGIAIVIGIPYQLLFMPETKDKTLEEIDDIFEMPTRQLVKQNLKNLKDYVSGNRKSI
                     "
     gene            complement(<807159..>809603)
                     /locus_tag="KLLA0_E09043g"
                     /db_xref="GeneID:2894222"
     mRNA            complement(<807159..>809603)
                     /locus_tag="KLLA0_E09043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454357.1"
                     /db_xref="GeneID:2894222"
     CDS             complement(807159..809603)
                     /locus_tag="KLLA0_E09043g"
                     /note="similar to uniprot|Q07533 Saccharomyces cerevisiae
                     YDL117W CYK3 SH3-domain protein located in the mother-bud
                     neck and the cytokinetic actin ring mutant phenotype and
                     genetic interactions suggest a role in cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454357.1"
                     /db_xref="GeneID:2894222"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY2"
                     /translation="MSQSGPVTFKVKTNFAWSGEKKDDLGFLEGDFIEVTRVTGDWYF
                     GKLIRNKKQGYFPSNYVSILEEQYNTYLPTKHQSNLPRSPQRYKEHATSSPEFRKRDQ
                     FSLRKNHTNEELAGYSQGKQYSRSFGSKDKYTIPQSHSASNIAKRTGKFQDKYSSSRE
                     IPNQPPLPPIPKSPSTPLFNHISQTGGYTNGMNQPLKSTDSFGRFSHTRYMEDSLASS
                     EESFAIMSDFSATSAGSFARHNFARSFKDSTDRSMVAEQKDTTSKLGSQSMKESKFDI
                     FKKWLPGNTKEYNPGANDYPKLPNIESLNISADNHDANSWMEAEAQLRRALTISSNER
                     RERGMRATAKNVDLLLYPHSVVNKDLYSNEVLHTRQPGIVDEFLYSADFKRVDKSARQ
                     LFFEKLPVQLSVESFAQYSFPSQYFTPLEQLRGLFIFCTELFRLIDDNGKTDFNRSPE
                     NLEKALERRYCTPYELTWLFKRMSTALNIKSEIVFGFLKTPNADNSTFKLNHCWLQVC
                     FYEEWRFVDVILGNITNPIHEYLNNKPAKKCEPFYFLASPMTLINTHVPREYSKQHIV
                     PELDLNIVLSLPVVFPSFFKNRLRLYRFSNGLCDLEDNEIFECTLRIPNDIEVFSNVV
                     VDEENSLQYKTMNLSLVQVLSQNKRNAVIKAVLPPGASKGTLYIHSGIKGTQCSIENI
                     HPISMILPLTASGNPGNFEFVSRIPSEAVQRVEVYIKEPQNKFLSNKRKYKFEMIQNP
                     TDGIIHQSMDRNLSRAMLILSPTGKRYKVIKNDPHLPFGTWSASIEINETGRWNAMII
                     SDAGSGWCEFAQWESR"
     gene            complement(<810338..>811468)
                     /locus_tag="KLLA0_E09065g"
                     /db_xref="GeneID:2894237"
     mRNA            complement(<810338..>811468)
                     /locus_tag="KLLA0_E09065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454358.1"
                     /db_xref="GeneID:2894237"
     CDS             complement(810338..811468)
                     /locus_tag="KLLA0_E09065g"
                     /note="highly similar to uniprot|P28777 Saccharomyces
                     cerevisiae YGL148W ARO2 Bifunctional chorismate synthase
                     and flavin reductase catalyzes the conversion of
                     5-enolpyruvylshikimate 3-phosphate (EPSP) to form
                     chorismate which is a precursor to aromatic amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454358.1"
                     /db_xref="GeneID:2894237"
                     /db_xref="GOA:Q6CNY1"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY1"
                     /translation="MSTFGQIFRVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQLT
                     RRRPGQSKLSTPRNEKDRVEIQSGTEFGKTLGTPIGMLVKNEDQRPHDYSDMDNYPRP
                     SHADFTYSSKYGIKASSGGGRSSARETIGRVAAGAIAEKFLKQLSNVEIVAFVTQIGA
                     VKMNRDPQDPKFQQVLNTITREKVDAAGPIRCPDSSVADAMVKEIERYRGEKDSIGGV
                     VTCVIRNLPAGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFDGVCLPGSKHNDPFY
                     FDEDTGRLRTKTNNSGGIQGGISNGENIYFSVPFKSAATISQEQATATYDGKSGILAA
                     KGRHDPSVTPRATPIVEAMAALVLADAVLIQKSREAAISIVS"
     gene            <812175..>814343
                     /locus_tag="KLLA0_E09087g"
                     /db_xref="GeneID:2894238"
     mRNA            <812175..>814343
                     /locus_tag="KLLA0_E09087g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454359.1"
                     /db_xref="GeneID:2894238"
     CDS             812175..814343
                     /locus_tag="KLLA0_E09087g"
                     /note="similar to uniprot|P52891 Saccharomyces cerevisiae
                     YDL116W NUP84 Subunit of the nuclear pore complex (NPC)
                     forms a subcomplex with Nup85p Nup120p Nup145p-C Sec13p
                     and Seh1p that plays a role in nuclear mRNA export and NPC
                     biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454359.1"
                     /db_xref="GeneID:2894238"
                     /db_xref="GOA:Q6CNY0"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:Q6CNY0"
                     /translation="MDVDFNRSQETHLKFGQILKEYQARVLSDEASLDPFSIVQDFRS
                     IAGEEALEIAESGEENDNEQFQNWELEAKFWDLVGLLVEYRTSETVDKDINVHSYNSN
                     VVFQKQLLQSNKGIYEIWLIKSWLEANIGIPERPSSLCTTKWSSSMIAGTVKSMDSDS
                     ILRDPTTNLQPDDRQNDHAFFVYAFRLLLAGQFEKLTEECEFTDNLTLNLILRGMESY
                     VDPNVDTDMTDEYASQQGIKKHALWRRSVYALSQDPLLDPYEAAIYTYLSGDSPTNLR
                     IDGLDWETELLIYVNQIWNVTMENYLIEHGRVDNDELITDMDTACPSLSQVLNILAAK
                     YPDESEHPIRVLTASVLLNTIEPVMKSSTDMLLDVIKGRDEDNALFNESYLLRILTNL
                     TIFLDIVSPDTIDISNKSKLLTSYISLLSYYGLYDVIPVFVSFLSQEEIVETYSFFLT
                     NLIDPNLRQKQMEISKYLGLPIANILRRTAQRIFEETDQYYIVDSDIELTNEVSEVDQ
                     RLMNGVEWLIENGLYTDSIDTIIALSRRFLINGKVKALELFVDNHDVPNLLKEYQLER
                     LSSQEEDHDLKTTELLQYTSLLSTFKKQEEWVKSSQLFNTESNLRSLIKQFKGFSNTI
                     IKLVTTFLVDLIDNEEVNDSDVLYEIRALYTPFLIMELHNNLISASENLKVSTFVQEA
                     IDLSILVANETDKIYLLFQSNGKLTTYLQMVAKASALFGR"
     gene            complement(<814476..>815051)
                     /locus_tag="KLLA0_E09109g"
                     /db_xref="GeneID:2894230"
     mRNA            complement(<814476..>815051)
                     /locus_tag="KLLA0_E09109g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_454360.1"
                     /db_xref="GeneID:2894230"
     CDS             complement(814476..815051)
                     /locus_tag="KLLA0_E09109g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_454360.1"
                     /db_xref="GeneID:2894230"
                     /db_xref="GOA:Q6CNX9"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX9"
                     /translation="MKYIQTDQVLDVPEGVTVQIRSRNIKVTGPRGVLTKNLKHIDVT
                     FTKVSNRQIKITVHNGDRKHVAALRTVKSLISNLITGVTKGYKYKLRYVYAHFPINVN
                     VIEKDGAKFIEIRNFLGDKKVREVPVRDGVSVDFSTNQKDEIVLSGNSVENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSEKGLIEEEE"
     gene            complement(<815506..>816633)
                     /locus_tag="KLLA0_E09131g"
                     /db_xref="GeneID:2894530"
     mRNA            complement(<815506..>816633)
                     /locus_tag="KLLA0_E09131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454361.1"
                     /db_xref="GeneID:2894530"
     CDS             complement(815506..816633)
                     /locus_tag="KLLA0_E09131g"
                     /note="similar to uniprot|A2TBP4 Saccharomyces cerevisiae
                     YDL115C IWR1 Protein of unknown function deletion causes
                     hypersensitivity to the K1 killer toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454361.1"
                     /db_xref="GeneID:2894530"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX8"
                     /translation="MRESHSRNDSVLPTEANISDMSKSISGVEYIRVKRRRDEDSVQA
                     LLLEEERNAKKGKFVFKLSKTVELETPDVNSPLLKLSNENNDKKMVYVLERERERQAA
                     SELQEELPDSIAEMLNDYLKIKEKDSPEHKKRKASRKHSKSYTAPILPPTDYVYDVYV
                     KQTIPEDEEEFVFDKSTIGYIRIVEHNGDMIPEEEVDPEKTMLTDDEDSNEEDYYQND
                     YPEDEDDDRSIFIGSDEDRTDSEDIVYLDELNDELDQNYNVDGEQANETTNDNGDEFD
                     ALFQNYGESSNLLSSLNANNYVDFDYDDDDHADSDNDNGKYDGDFVNLKPEADDDHDT
                     GMDVDDQTFKRNYFFPTDKDDEDAIHRDRIFGKLQKMIDKV"
     gene            <816861..>817703
                     /locus_tag="KLLA0_E09153g"
                     /db_xref="GeneID:2894512"
     mRNA            <816861..>817703
                     /locus_tag="KLLA0_E09153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454362.1"
                     /db_xref="GeneID:2894512"
     CDS             816861..817703
                     /locus_tag="KLLA0_E09153g"
                     /note="weakly similar to uniprot|Q07530 Saccharomyces
                     cerevisiae YDL114W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454362.1"
                     /db_xref="GeneID:2894512"
                     /db_xref="GOA:Q6CNX7"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX7"
                     /translation="MFWNSLNYFALDQKGTQYVRVLEDLVTSFVGIPLCPQKDIVVVA
                     GGSRGIGSHLVTMFDSLGYKTILIDKRYPLNLIEPHRVSFYKCDISDFEYTRLILDDI
                     SVRFGQITVFINAVSLKSFTDAEVGKGVSLRKLMRTVYAGSMHIIQHILPKMIAYDRG
                     YIIDIASTEGLYTTENKSSYGAIQATKFQLLQLIEQTLKEQYKKNFLISNGRVRCLLL
                     IFGKALNSKPHQDMTTAKTVFSAIFHNRQGVQGYSMRTNFKLALRELDWQWYQMFKYL
                     SPFL"
     gene            complement(<817829..>819739)
                     /locus_tag="KLLA0_E09175g"
                     /db_xref="GeneID:2894747"
     mRNA            complement(<817829..>819739)
                     /locus_tag="KLLA0_E09175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454363.1"
                     /db_xref="GeneID:2894747"
     CDS             complement(817829..819739)
                     /locus_tag="KLLA0_E09175g"
                     /note="similar to uniprot|Q07528 Saccharomyces cerevisiae
                     YDL113C ATG20 Protein required for transport of
                     aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole
                     targeting pathway binds phosphatidylinositol-3-phosphate
                     involved in localization of membranes to the
                     preautophagosome potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454363.1"
                     /db_xref="GeneID:2894747"
                     /db_xref="GOA:Q6CNX6"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /translation="MQINFEPMPNSVTHLENNSPSRLKNNKTVEEHKEHEPDLQTQSE
                     MRRESNGSPKDTAVTNQNGDQPHENVIHTQIIKKDNPFFNYMQDNVDGSDENGKNDDD
                     DENAKNAGSDDNEDQLLQPNRRKNSKERRRSSVATSKDSSPDVPYNTLNHNASGMTKE
                     GKKRAQILEASKVSEGQGRTYIAYAIKYGDSIVKRRYSDFESLRKVLVKLFPISLIPP
                     IPEKQSLKSYGKAMTYSKSSYLLPTESGDSVDLSLSVINGPVTTNDEKLIRHRIRMLT
                     SFLNRLLKNQEITKTSIVYDFLDPNNKNWNDLITSSLTISSLPKSVLQCNPIDPTNTT
                     KAHSYLPVPSSSTQLLASKDNHSASDADEFTKIEAEFKNYEQLIHSGLYKYSRATTKE
                     VNYLREDLKGISSEFAQLSTDETKNESGLAELLSHSSDAYGTLQEILETLVGNLHYNI
                     NEPLSECAHMATAVRDLIHYRRLKLIQKDILERTILYKRGQLIKFQQQENDHKQIDNM
                     VKEELGTNGAVNLENPAGPQSYSGKFINKFTQLAIIIKDSVSYQEQDPAAAARSLEKE
                     LIQLDETLKVATSDLVVISETLKNTELPNFIKERDEELTQIFKNYAKYMKENATRNLE
                     IWKELHNRIQEA"
     gene            <820095..>824288
                     /locus_tag="KLLA0_E09197g"
                     /db_xref="GeneID:2894748"
     mRNA            <820095..>824288
                     /locus_tag="KLLA0_E09197g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454364.1"
                     /db_xref="GeneID:2894748"
     CDS             820095..824288
                     /locus_tag="KLLA0_E09197g"
                     /note="similar to uniprot|Q7LGS3 Saccharomyces cerevisiae
                     YDL112W TRM3 2'-O-ribose methyltransferase catalyzes the
                     ribose methylation of the guanosine nucleotide at position
                     18 of tRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454364.1"
                     /db_xref="GeneID:2894748"
                     /db_xref="GOA:Q6CNX5"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX5"
                     /translation="MSHSRQILGRYISPSVQEEILSSLIETEDYEGISSVLSSVELTE
                     DVSINTGNRLSITLGEVIAKHVNDDDGLRVEKDQQLIALLKLCPKLKQSNKFMHDFLS
                     SHLSSFILSHITMLFDVECQQLIRISGFIQVNSLDDGLILDGTKLLDILEVLVQGSAS
                     GSYNDLIANSVNIGKLLFLLSLSKDEKLSNAATSLFKWWIPSFATACKEDEKLDITVW
                     SLLRNLLTESAPITVAKNGYIFCLRMLMEDGFSTTSQSFAQSKDYWNLIQSGLNQEVH
                     EIKKIVLSIMKLSLQLLAQNNLPILTDIIQFSGSRSEIESWKKFTTLYEIVGIDTALN
                     QCEAAAPDILDIFGDPNVHASWGLIILSTGLRATMESVRKFTLRLMLQIKHKAVFNAN
                     TRLLCDVFLPATMQASFFNVADEHCEYGESVANFVAEILLTSDDKGTILELLLNALYD
                     FRNMFDAGRIYIAYGVLCGVEKLKERVFETRHIEIIRMLFLCRCEENILQTTIQSIYL
                     KYMLFSNLSAPEFLQTLAMHVKSDNGYEYISRTIGSFRDFCIVNYNQSLEGYEVPQDA
                     LYQVLAYELFDCEPYEISDQFLIEIVKADCNYSDLSEEYYAFLTELVTMESNNYKEAK
                     VILDLPQFTPAVYGAINPLPIFKSLFSEFLPDKFDFFVSLFDKVMQSPSQITISFENL
                     LNLYRIIGEYIRSENNLPFKLKDEIYANFFKLLRICIKSSPLTEEQLNTLLDLLQENA
                     ERDNGNYLGNLEISYLCQSILDVYILPTLHELTDMEKHVLNSAMGLQCRIWDSLIEER
                     LVLNQQPLHLALIRGIFHYTTFLSALNDQAIFKIMLHYATAILDQSFSRRTLKPVLSQ
                     QILGFMEVYGSSLPNQQYSDFARLLSDVFTHESMNLNIYNLKPAIAKLFDSKLGLYID
                     GGLYKFVYGATEVVTKSRIIKALLYSSKEFRRQFLQVMLQEDPNMLKAKKKTDGPEEI
                     QRLQKWQLCLLSIKSVDKDVLTGLCSDYIIPSLVEESSPLVRVYSEWFIAYDLWVTAT
                     DNHKNPNEDFLFKLLEDTSRPVLQASVERLLFLSLKAAKETGHFFRPMERFVAQLITN
                     CSSNKPLIRHFSNSLILLFWPTFEDDIKDNILRSIISKLYSDAKKIQVQGQFRAGDAN
                     TWSINNDLKLTSIFGGVLLKIMDHKVPYINSKIFKAINIDDGEFEIGSEESELWLTKR
                     SSNLVNSTELAKNSPLQTKSGAWEAVLDFDNQKSIESVARSELIVVASLVDKAPNLGG
                     ICRLCDVLGVGTMTIHDIRVKQHPQFKNVAVTADRWMPIEEVPVDGIISYMNAKKLEG
                     YTLIGLEQTDSSIQLNSEFKFPSKSVILLGTEAHGIPGHLLKELDLCLEIKQSGVIRS
                     MNIQTATAVIVHSYSIQHL"
     gene            complement(<824344..>825138)
                     /locus_tag="KLLA0_E09219g"
                     /db_xref="GeneID:2893806"
     mRNA            complement(<824344..>825138)
                     /locus_tag="KLLA0_E09219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454365.1"
                     /db_xref="GeneID:2893806"
     CDS             complement(824344..825138)
                     /locus_tag="KLLA0_E09219g"
                     /note="similar to uniprot|Q12277 Saccharomyces cerevisiae
                     YDL111C RRP42 Ribosomal RNA Processing Component of the
                     exosome 3->5 exoribonuclease complex with Rrp4p Rrp41p
                     Rrp43p and Dis3p (Rrp44p)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454365.1"
                     /db_xref="GeneID:2893806"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX4"
                     /translation="MGLSLTEKSFLYDSLTLDPPLRPDGRGPHQFRPLEVSTDFLPNS
                     NGSSRVILSGGSECIVSVKTKVVDHTVEQELLVADVDIQGHRDDSPLVTSMSSLLSKL
                     LKQTIDQKKLMLTKRYSFKLYIDVLVLASKSYPISMISFAIFSALKNTWLPKLISNDD
                     DLEVEELPTFHDYDMVKLEADAPLLFTFAIVGDGVFVDPTFEESIVSNNGLLITWYKD
                     KVTSPIRSVGLNNDNIKGFSQHHLEQAFKLIRQYAPHIEKALDASD"
     gene            complement(<825533..>826306)
                     /locus_tag="KLLA0_E09241g"
                     /db_xref="GeneID:2894040"
     mRNA            complement(<825533..>826306)
                     /locus_tag="KLLA0_E09241g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454366.1"
                     /db_xref="GeneID:2894040"
     CDS             complement(825533..826306)
                     /locus_tag="KLLA0_E09241g"
                     /note="weakly similar to uniprot|P53117 Saccharomyces
                     cerevisiae YGL146C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454366.1"
                     /db_xref="GeneID:2894040"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX3"
                     /translation="MVISLIYVLLLICSVVSETLKLPINPNRLEFDLWPYKKWEVDGS
                     SDASSYQTCFEMNTNIKAKDLQFLIEIEEFTKWKVNVDRFGPTTSSKGKQVVNMDIYD
                     EDQNLVQSRHGLENGETVLYVSVYEHQNFQICLINFSLDSSWNAIDSVKQVAISITSN
                     DLIQKQKWDLITDDDLNLLSQGRDDLFSLVSADSGQELHALDVDHRNLNESTFSYLLA
                     KVTILFCIIGVCHLLVFPILLYRIVSKGQPTKNKNKIKR"
     gene            complement(<827035..>827517)
                     /locus_tag="KLLA0_E09263g"
                     /db_xref="GeneID:2894205"
     mRNA            complement(<827035..>827517)
                     /locus_tag="KLLA0_E09263g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454367.1"
                     /db_xref="GeneID:2894205"
     CDS             complement(827035..827517)
                     /locus_tag="KLLA0_E09263g"
                     /note="similar to uniprot|Q12513 Saccharomyces cerevisiae
                     YDL110C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454367.1"
                     /db_xref="GeneID:2894205"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX2"
                     /translation="MAHSSGIRRPIQIQEFVIAIRESSEHELQEIRKEINNAVKHLQR
                     SNRRLEAYVAKLKGEEVLNRQELDAEGNFSDDDIDEKDLQVFQDSLAENGKVLDNYNE
                     RLQALDLEEQHRASTVSSGDIQSASTKLKRSLQSQGRRTVGVDSDNTADATGSNSINL
                     "
     gene            <828244..>829518
                     /locus_tag="KLLA0_E09285g"
                     /db_xref="GeneID:2894247"
     mRNA            <828244..>829518
                     /locus_tag="KLLA0_E09285g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454368.1"
                     /db_xref="GeneID:2894247"
     CDS             828244..829518
                     /locus_tag="KLLA0_E09285g"
                     /note="similar to uniprot|Q03338 Saccharomyces cerevisiae
                     YDR473C PRP3 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454368.1"
                     /db_xref="GeneID:2894247"
                     /db_xref="GOA:Q6CNX1"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX1"
                     /translation="MGNDNNTNRGLNRKLHSALSVENVNLLRFQGRRCGNPYLQDVQA
                     HGFEPKARVSSHWYEPGEVVQHAAKLRQENREKSEEERIRWEAELEKQQEIERKIEIG
                     ELPDKHEEVYFTDLSDVPDVEWWDVPYIKDGSIHEKYSLDYSTLNSDDESDDEEEEEE
                     EGAQDKFPSIRYIQHPVPIERPRAAVPVAEIFLTKNERKKARRNTRKLVRQEKEEKIK
                     LGIEPKPEPKVKLSNMMNVYENDANIADPTQWESIVRRQVAERKRKHFEENEIRHQES
                     LKRRKESQLQAHSNDSPLEYTCVVYMFDEIQNPSIRYKIKTNGKQLKLKGCCLHIQNG
                     KGIIVAFGDEKSIRFFDKLVTKRINWSEPYKDRDTEETVPCDGKITKVWQGLIGDCRF
                     KGWFMLDCKDKNQLNNILEQHDALTFVPLGKF"
     gene            complement(<829846..>830163)
                     /locus_tag="KLLA0_E09307g"
                     /db_xref="GeneID:2894248"
     mRNA            complement(<829846..>830163)
                     /locus_tag="KLLA0_E09307g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454370.1"
                     /db_xref="GeneID:2894248"
     CDS             complement(829846..830163)
                     /locus_tag="KLLA0_E09307g"
                     /note="highly similar to uniprot|P38910 Saccharomyces
                     cerevisiae YOR020C HSP10 Mitochondrial matrix
                     co-chaperonin that inhibits the ATPase activity of Hsp60p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454370.1"
                     /db_xref="GeneID:2894248"
                     /db_xref="GOA:Q6CNX0"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:Q6CNX0"
                     /translation="MSTLLKSAKSIVPLLDRVLVQRIKAEAKTASGLYLPEKNVEKLN
                     QATVLAAGPGFTDSNGNKITPSVQPGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAK
                     VVE"
     gene            <830886..>831113
                     /locus_tag="KLLA0_E09329g"
                     /db_xref="GeneID:2894252"
     mRNA            <830886..>831113
                     /locus_tag="KLLA0_E09329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454371.1"
                     /db_xref="GeneID:2894252"
     CDS             830886..831113
                     /locus_tag="KLLA0_E09329g"
                     /note="similar to uniprot|Q3E824 Saccharomyces cerevisiae
                     YOR020W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454371.1"
                     /db_xref="GeneID:2894252"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW8"
                     /translation="MGAAYKIFGMTVQPHILAIATLGSVFGGAAYAMSGSKDAEKAKP
                     AVATPAAPAAGGSDEFDVEKLLGDFLKEESK"
     gene            complement(<831306..>831944)
                     /locus_tag="KLLA0_E09351g"
                     /db_xref="GeneID:2894258"
     mRNA            complement(<831306..>831944)
                     /locus_tag="KLLA0_E09351g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454372.1"
                     /db_xref="GeneID:2894258"
     CDS             complement(831306..831944)
                     /locus_tag="KLLA0_E09351g"
                     /note="highly similar to uniprot|Q12314 Saccharomyces
                     cerevisiae YOR021C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454372.1"
                     /db_xref="GeneID:2894258"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW7"
                     /translation="MKYIIEHMEQGFSEWVTLEYAQIIRDIGKDNLILSSLPEDTVES
                     DIPKKLREMGLQWTTANLDKINEAFPELPELKSQRVCLLDPRAKTDLIPSDAQNYDYF
                     VFGGILGDHPPRDRTRELMEQYPNLLVGKRLGDKQMTTDTAIRTTQIIIEKQTKFEDV
                     KFIDYPEFRFNKNEATEMPFRYVFNSDGQPILPEGMLQLIKKDSEQSLDDLF"
     gene            complement(<832187..>834076)
                     /locus_tag="KLLA0_E09373g"
                     /db_xref="GeneID:2893798"
     mRNA            complement(<832187..>834076)
                     /locus_tag="KLLA0_E09373g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454373.1"
                     /db_xref="GeneID:2893798"
     CDS             complement(832187..834076)
                     /locus_tag="KLLA0_E09373g"
                     /note="similar to uniprot|Q12204 Saccharomyces cerevisiae
                     YOR022C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454373.1"
                     /db_xref="GeneID:2893798"
                     /db_xref="GOA:Q6CNW6"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW6"
                     /translation="MKVRAMWKENRRYFSSRWFYAIDIPKTKPFESEYVPKTAPLKFQ
                     PFSKVDSKRIEDLYTQKNFSRKLDVNEDHLFEVDLEKFSMNPIYWDGPSYEIRRGIWF
                     DDQNRPLSHDLTKAIEELHQQWLSRDKEKSKTTELRDIFRLPKDSKWKYVMFFEDDRT
                     AFLLPDIYGGHLQLTILRSSVAQLIQLGASKLTKGYEEPSSLTERAKEIEGQVIEHAM
                     GLGKISDMISWEFSDLVKFPNEENNSKQEEDMMKDEMSKDYDNGDSSEKSHYRPTNHL
                     VLCVHGIGQNLGKKYQYVNFAHTVNLLRNNIKYLYKSNPSLQEFNSARKFPDYKTNSG
                     TQVLPITWRHAIGFNTDETNTNRDNEDLPTLADLTVDGIRPLRKLLGDVGLDILLYGD
                     DFYLDRILKHVTNELNDVYEKYREHNPEFDGKVSLLGHSLGSVILFDILSQQSKFPLN
                     FEVDNFFAIGSPIGVFKLIQRTKIGESDSSTRQQTPACNNFYNLFHPCDPISYRVEPL
                     IDKVTANYEAEWIPHATGYDFIADTVKNLMSDKNLKEKELMTQRLLSNLLRFNSNGRV
                     DYSFQPNLLDVDVWSAIKSHVSYFEDMDTAGFLLKEILKKHVKPKTHEITKLKSTKVE
                     TKKTK"
     gene            complement(<834365..>835711)
                     /locus_tag="KLLA0_E09395g"
                     /db_xref="GeneID:2893799"
     mRNA            complement(<834365..>835711)
                     /locus_tag="KLLA0_E09395g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454374.1"
                     /db_xref="GeneID:2893799"
     CDS             complement(834365..835711)
                     /locus_tag="KLLA0_E09395g"
                     /note="weakly similar to uniprot|Q12433 Saccharomyces
                     cerevisiae YOR023C AHC1 Ada Histone acetyltransferase
                     complex component protein of the Ada histone
                     acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454374.1"
                     /db_xref="GeneID:2893799"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW5"
                     /translation="MHSVDHRNSHQVLFMDEDDVDSISRSNHTISYYQVATPKSPHEL
                     SSIADNEDNDSIHSSHPHEDAERLKFMSTRREILDQLNLQIMLTHKEMEHIIEENDKV
                     SGQLEVLKIMHDDPELTDKISKYQETRTKEVEESIKAGCSNVETREGIYYYHTRSKGG
                     SKVSGLRLANENVIDIRMRGIKTVPQQTSATEVQKSEAIISKMPHHNHQRNFSSTCAT
                     SNSGMIGTTDLGQPIFRRPDGILIIITCSQCGREGFTSAQGIVNHMRLKHFLHYQSQP
                     LAVLSNQVILPDEKQDPEILAKFKELKKTPKDSYLASPIPLQHNDKKITKDTPKATSV
                     AEESALTKSTTHLQKMYGKDDFKDIINYVKDAKNDLETIMKYEDEEGLGTASEEEAKP
                     KPRKRSMLNERNKPAEKKARPDVIHVTENHIPEEEKRSRHYNLRAKSKLRSFNRDD"
     gene            <836226..>836648
                     /locus_tag="KLLA0_E09417g"
                     /db_xref="GeneID:2894694"
     mRNA            <836226..>836648
                     /locus_tag="KLLA0_E09417g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454375.1"
                     /db_xref="GeneID:2894694"
     CDS             836226..836648
                     /locus_tag="KLLA0_E09417g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454375.1"
                     /db_xref="GeneID:2894694"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW4"
                     /translation="MSKIITDLDTIAGKIEEYAGDTLLRLRIFAQFQDISHSHERTDG
                     IYLHFSNVPDFNAETNRERSYYFLIDETIYDEAFINTKSGERPHKGDILDMRCCYRKY
                     DKVVEIMHLKVISIADLDSLREFLAKADDDSEIRSFLR"
     gene            complement(<836948..>837544)
                     /locus_tag="KLLA0_E09439g"
                     /db_xref="GeneID:2894765"
     mRNA            complement(<836948..>837544)
                     /locus_tag="KLLA0_E09439g"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_454376.1"
                     /db_xref="GeneID:2894765"
     CDS             complement(836948..837544)
                     /locus_tag="KLLA0_E09439g"
                     /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
                     YLR009W RLP24 Ribosomal Like Protein 24"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_454376.1"
                     /db_xref="GeneID:2894765"
                     /db_xref="GOA:Q6CNW3"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR024546"
                     /translation="MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLRWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQR
                     RERAFYKNRMKGNNERDFLRDKALVESNPELLRLREVELARQAAKEEAIEQASDEEMD
                     IESEAESEVESESEAEEQLQKQKILLKNKRKNSKRIAF"
     gene            <838259..>838750
                     /locus_tag="KLLA0_E09461g"
                     /db_xref="GeneID:2893862"
     mRNA            <838259..>838750
                     /locus_tag="KLLA0_E09461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454377.1"
                     /db_xref="GeneID:2893862"
     CDS             838259..838750
                     /locus_tag="KLLA0_E09461g"
                     /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
                     YLR008C PAM18 Constituent of the mitochondrial import
                     motor associated with the presequence translocase along
                     with Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
                     activity of Ssc1p to drive mitochondrial import contains a
                     J domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454377.1"
                     /db_xref="GeneID:2893862"
                     /db_xref="GOA:Q6CNW2"
                     /db_xref="InterPro:IPR001623"
                     /translation="MAQQNIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQQKSG
                     MDLYFDQALDYMGDHPVLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPK
                     MNAKEALAILNLNETNLSKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKV
                     VRK"
     gene            complement(<838945..>839916)
                     /locus_tag="KLLA0_E09483g"
                     /db_xref="GeneID:2894034"
     mRNA            complement(<838945..>839916)
                     /locus_tag="KLLA0_E09483g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454378.1"
                     /db_xref="GeneID:2894034"
     CDS             complement(838945..839916)
                     /locus_tag="KLLA0_E09483g"
                     /note="weakly similar to uniprot|Q07913 Saccharomyces
                     cerevisiae YLR007W NSE1 Essential nuclear protein required
                     for DNA repair forms a complex with Smc5p and Rhc18p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454378.1"
                     /db_xref="GeneID:2894034"
                     /db_xref="GOA:Q6CNW1"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW1"
                     /translation="MTDTGSDETGTDRVVEASPYLTDLDVRRYLLQFILQCKGIVSEN
                     SLLSCYLTLENDAGRFLKDEPLSLTAWRLKLTDHVSKLNLQLSPLNYRITMVNHPMGK
                     SYVSRRFENFITDLVDANWPPNARFYVYTNLKYDSQMKMATSFSAADIGFLKWSIEKI
                     LTESSYVQQFEREEESSDVIDEVDNILREKYGDEHYAGLKHFVSYRIGSGELMQTNEI
                     TQTRAEELLFELSERKWLYRSPEGKIGLDVRFLIEMKDYLVENFDVPLCVHCNEVVLQ
                     GIICLEAREEHNYGLHVGCLEHYVKHVSDKCPGSDKTFQEAGAYAIG"
     gene            <840647..>842554
                     /locus_tag="KLLA0_E09505g"
                     /db_xref="GeneID:2894035"
     mRNA            <840647..>842554
                     /locus_tag="KLLA0_E09505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454379.1"
                     /db_xref="GeneID:2894035"
     CDS             840647..842554
                     /locus_tag="KLLA0_E09505g"
                     /note="weakly similar to uniprot|Q07084 Saccharomyces
                     cerevisiae YLR006C SSK1 Cytoplasmic response regulator
                     part of a two-component signal transducer that mediates
                     osmosensing via a phosphorelay mechanism dephosphorylated
                     form is degraded by the ubiquitin-proteasome system
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454379.1"
                     /db_xref="GeneID:2894035"
                     /db_xref="GOA:Q6CNW0"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:Q6CNW0"
                     /translation="MQEPMNRIRPSSPLSGQRTVTSGSTRRIWLQLDTPCDSFRGENP
                     IEDTLYNQPTSVDIEVRDMIDDVKSKVLNKLSNTRWFRFKDNTNISLGFYYYSAELLE
                     PSHSHSVGPEKANSNTFVITYSEYQNLIKRNQIRVGRWSQLHNSFNRLLHRSTSQSPS
                     LDTAFNDDNGLRMLSSQHTRQQSQSPDDNLKYAYKVIIEPDTPVMTVYRELYGGLQKS
                     EDALTVFYPPMSSSSPTSPEVLTPAELLDPIRIFTKDAIGQEKEILLSDISQGTEIDS
                     VVERPDQRRPSLFGSFSSSRNNTGILLLPKGVSPEDIEGSNDSPYEEANISLDNIETS
                     PPHPESYALTAQKPLTEEEVGISLTKTISSPELPRPLSRRTTPSLDKQGNLPKYKVFP
                     RINVLIVEDNAINQAILALFLRKNGISYKVAKDGVEAIEKWKEGDSHLILMDLQLPLL
                     SGLEATKKIRELERINNIGNFSQKSVSKKPNLKKNANSKEEGGTTAAKTSDQQNEVEK
                     SNQQNMVLDKSKFRSPVIIVALTASYSQIDRTEALLAGCNDYLTKPVNLDWLSKKITE
                     WGCMQALIDFDGWTEGQRRMTDDVLLRPQIVTARKSQATSTRSVPRVSSVSTTLECDD
                     SKYTKSNDCCP"
     gene            <843133..>845223
                     /locus_tag="KLLA0_E09527g"
                     /db_xref="GeneID:2894764"
     mRNA            <843133..>845223
                     /locus_tag="KLLA0_E09527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454380.1"
                     /db_xref="GeneID:2894764"
     CDS             843133..845223
                     /locus_tag="KLLA0_E09527g"
                     /note="similar to uniprot|P27351 Saccharomyces cerevisiae
                     YJR005W APL1 beta-adaptin large subunit of the
                     clathrin-associated protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454380.1"
                     /db_xref="GeneID:2894764"
                     /db_xref="GOA:Q6CNV9"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV9"
                     /translation="MSESKIFYKYKAHEIRGELVSDSGKARGSSKRKLCLRKIIANLI
                     MGNYHEMAQLFVDVLQIWNSENDLEIKRMCHQYFCTLTPSKPDQLRMALPIILQDLLS
                     NSEELCILSLRTITSIDEPEYIQEGFQHVKKLIMTTSKISIPLRKAAIHSLIKMDQLD
                     HTKVLELYYFLMDMLDYGKEEPTILVAAVTVLHEIHVSNPDMNPLQLTQNICFNLLEV
                     LGKINEWDIAILFDILTTAYLPKTHSEAHHLIDLSVPKLHNLNSSVVLNALKFIIYLT
                     NYVDYIEERLVRKFSSSLTSLLNKPPEIQFLVLRNVILLLLSRDSPLIHLEPNNFFIE
                     YSDPTYIKDTKLEILYLLANEENTSQILDELKGQATDIDIQMSKKSIRAIGNLAVKYP
                     HSARYSVDVLLELLEFGVDYIVQEVVSMLKNVLRKYPNQFDFVVPLLPQYSDSIQDSE
                     SKCAMIWIVTNHSNQLEDPIGVFRKYSDNFNTEGLEVQLLLLNSAVKFFCRAQSKETE
                     QLCLKLLSGATEINDNPDLRDNAYMYWRLLSLAGNSSEPLFNNDVVRDMIDGELPVIE
                     INTKLDPIVREELELNIGSILSVYLKPVSQVFRGVSPKKLPESPALNHEKSSLSIIND
                     SISNNSTGSFHGSDTTRRSSSPIKKMTDFDRPAETVNQLKDKRKSSISLSATKLARKP
                     SMLARKLSMRKPFQ"
     gene            complement(<845298..>846224)
                     /locus_tag="KLLA0_E09549g"
                     /db_xref="GeneID:2893893"
     mRNA            complement(<845298..>846224)
                     /locus_tag="KLLA0_E09549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454381.1"
                     /db_xref="GeneID:2893893"
     CDS             complement(845298..846224)
                     /locus_tag="KLLA0_E09549g"
                     /note="similar to uniprot|Q07897 Saccharomyces cerevisiae
                     YLR003C CMS1 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454381.1"
                     /db_xref="GeneID:2893893"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV8"
                     /translation="MVHADDLDDGLVYEVNDAQDDDVVSDGELVELDKDNDSNTADEV
                     SENKRALDTEDNGNTLSTEESEKPLSKRQKKLANSSLHQKKLERMAYEKAQKENLPKA
                     SVDKIIEYLATSIRDKNPDLSALELDELYFKKQDFLSTEKYEKDRSLNNFQDFIHTFS
                     KSPRSIILSQSNIRVADVYRSVNGHQTAVKLFSKNKLKDDITKVEELLGSKKESKPEK
                     KNKKSNKKMKGKNFSSETVKYFISTPTRIQKIIESTDLFFQGKEKLDIFIDASYLDPK
                     NNTIFTSDDSAVLYKVLKEFLKNKSSVKILLF"
     gene            complement(<846600..>848135)
                     /locus_tag="KLLA0_E09571g"
                     /db_xref="GeneID:2893710"
     mRNA            complement(<846600..>848135)
                     /locus_tag="KLLA0_E09571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454382.1"
                     /db_xref="GeneID:2893710"
     CDS             complement(846600..848135)
                     /locus_tag="KLLA0_E09571g"
                     /note="similar to uniprot|Q07904 Saccharomyces cerevisiae
                     YLR004C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454382.1"
                     /db_xref="GeneID:2893710"
                     /db_xref="GOA:Q6CNV7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV7"
                     /translation="MPDKEDLSESVYSVSDEEDVARKFLLSSAAAELKDDKSIEQEDI
                     TEKTTFFGNHVLDKKVLRKLDIFVLPFLCCTYLLMFLDKALLNYAASMGIKDNLVGDE
                     FSNLGTIFSASYIFAEPFAVYLLQRFPVSRVLGSFIICWGVVVVCHCVCKTYASLMIV
                     RVLLGLFESCSAVGCITVNGMYYTKSEQTQRIGYWAAQAGTGYIIGGLMSFGFLHYHG
                     TEFTSWQIMFLVVGLVTVGFGIVTYFYLPDNVPKAWFLNEKEKVQVIEHIRSNQTGLE
                     TKKIKMHQVKELLLKDKLTWPMLLLTGCSQISTGSIGTFSVTITGTFGFDSYQTSLLQ
                     LPIGCVTIMIILITTQLIGRFSQFTLITTSMYIPAIIGCIVMICLPLTNKIGNLLSLY
                     LLYSGSCTITNIYIWNTCNTSGYTKRLARNGLTMIVYNIACIVAPQMFRAYSYPRYIP
                     AKIALLVTQCVCVPLQLYIGYTSYTENRRRDKEQAESETKPEQYQFLDKTDIENRNFR
                     YIY"
     gene            <848785..>851295
                     /locus_tag="KLLA0_E09593g"
                     /db_xref="GeneID:2893686"
     mRNA            <848785..>851295
                     /locus_tag="KLLA0_E09593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454383.1"
                     /db_xref="GeneID:2893686"
     CDS             848785..851295
                     /locus_tag="KLLA0_E09593g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454383.1"
                     /db_xref="GeneID:2893686"
                     /db_xref="GOA:Q6CNV6"
                     /db_xref="InterPro:IPR005887"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012939"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV6"
                     /translation="MWKLTLFLAIWVPISFCFVILEDEFLYLHKNGICNKPQFHYEAD
                     NSEEEFAVFYNNWDGLQLPETRFGDQFTSKYSFLKWVDVFYGTLGGHMFSGTAVPFGM
                     CKMGVDVINSKKGDAYSGFQPDGEVVGVSLLHESGTGGAPTYGVVSQLPMIASSASSV
                     DVTRQISFKRKSPDVAHIGYYKVELDNGVDIEFSSKDRSGLYEYTFPELKDNGKPIIM
                     VNVSQHLHSFGRPWWTQNFRSGQIKVSSDLKSYQGKVTINGGWTDPGEWTVSFFGKFD
                     KPARKVATFRNGRTLPFLRRMQSYSGESDIGVLFEFDEDTTVLKSHVGISFNKNEGVK
                     VAAQNLLDDYPEDSQFDLTWSVASALESWNDKLFKKFEMNVNEEDPLIISKLYNSLYG
                     THLMPTNKSGAEAPWDNGEPYYDDWFTLWDTFRCLHPLINIISQDHGAEMVRSLIDIW
                     EVEGFMPDGRSGDRSGRTQGGSNSDIMLADAFIKNVHQGIDWEKGFQAMYTNAEVEPP
                     YIEDPMANDSTNKFGRGALKEWLELGYITRNYSRSVTRTMEYSYNDFALYIVAKGLGK
                     KDLAKTYLERSKNWRNIWNPNAKSVNIHYDYTGFVQPRNSDGTFAQHRYDPFTCFGCY
                     WRDDEYEGKPVEYGWTVPFDMKTLLEYIGSKAMFEKRLDDMYAFCGHENVVDIGNEPS
                     FLTPYLYAYINRQDKTSALVDWIINTKFKTGPRGLPGNSDAGAMQAWLTFALLGFYPV
                     AGTDIYLLTSPKVNYLKLKSMPNVPDIEIFAHNLYSEFGVRNNFIEKVVINDKELDKN
                     WFRHSELFEHGGTIEYYMSEKPLDWDSDKECPPQEFSV"
     gene            <851587..>853053
                     /locus_tag="KLLA0_E09615g"
                     /db_xref="GeneID:2893687"
     mRNA            <851587..>853053
                     /locus_tag="KLLA0_E09615g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454384.1"
                     /db_xref="GeneID:2893687"
     CDS             851587..853053
                     /locus_tag="KLLA0_E09615g"
                     /note="similar to uniprot|Q04673 YLR005W Saccharomyces
                     cerevisiae SSL1 Component of RNA polymerase transcription
                     factor TFIIH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454384.1"
                     /db_xref="GeneID:2893687"
                     /db_xref="GOA:Q6CNV5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV5"
                     /translation="MPPIIDSESDDERIIGITNKRHRQDGQTKVLKNKVKKHVRTKET
                     ADSDGAGNGNSSDDEEDERVHSQLSKRSRDPRKMKKKKKKKLSNKNLQGVNGGYAWED
                     DIQRSWDLVKVDDEGNIAAIVASIVEARKKRAAEKTVTPYQRGIIRTLILVLDCSEAM
                     MEKDLRPNRYAMTVQYAVDFIHEYFDQNPISQIGVVVMRDGLAQLISQVSGNPQEHID
                     ALKMLRRQEPKGNASLQNALEMARGLLLHVPAHCTREVLIVFGALSTTDPGDIHQTIG
                     SLVHENIRAKVIGLSAQVSVCKELCKQTNYGDNSYYGIILNDHHFKELFTSAVTPLPV
                     SKVNKGFTLVKMGFPTRVFEDTPSFCACHSTLVHGGYVCPNCKTKVCSLPTVCPSCDL
                     MLILSTHLARSYHHLMPLKTFQEVPVSDSFPTDYCFGCQKRFPTLRNNKTGELLTSSR
                     YRCEECDQDFCIDCDVFIHETLHNCPGCESKPINVNIK"
     gene            <853845..>855602
                     /locus_tag="KLLA0_E09637g"
                     /db_xref="GeneID:2893800"
     mRNA            <853845..>855602
                     /locus_tag="KLLA0_E09637g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454385.1"
                     /db_xref="GeneID:2893800"
     CDS             853845..855602
                     /locus_tag="KLLA0_E09637g"
                     /note="highly similar to uniprot|P53389 Saccharomyces
                     cerevisiae YNR055C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454385.1"
                     /db_xref="GeneID:2893800"
                     /db_xref="GOA:Q6CNV4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV4"
                     /translation="MDKYTNRHHPDFIPGTFNIYHSKLLENGLIHGSRLKKDSNGVIL
                     IPQPSDSPNDPLNWSVIRKLAHFALMAFITAFTAATSNDAGAAQDSLNEIYGISYDAM
                     NTGAGVLFLGIGWATLFLAPFANLYGRKITYLICITLGLLGALWFALASSTKDTIWSQ
                     LFVGISESCAEAQVQLSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIAGYIASLTSF
                     RWVGWCAVIISGGLLVWIVFGCEETYFDRKQYRTPLTSQKGYSGVEDGSSYQNSSNLL
                     EKKTMLIEQFADSKNNDSKMNEDSNEVTNRYADYPEAYENVEELIDGSKEKMKPYYKR
                     IQLITKSGNLRGYGFKQYFKYIGFNLRMFLFPPVWLSGMFWGIQDVFLSFYLTTEDTV
                     FYEAPWNYSDYGVAIMNVPTLIGAVIGCFYAGVISDYFVLWMARKNNGILEAEYRLYF
                     AAATAIICPAGLLMFGIGTDRNLPWQVIYVGLGFIGFGWGCSGDIAMSYLMDCYPEMV
                     LEGMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFAVTLLALPMYIYGKR
                     IRMWTKKWYNASIDLRDGI"
     gene            856274..856346
                     /locus_tag="KLLA0_E09659r"
                     /db_xref="GeneID:9487288"
     tRNA            856274..856346
                     /locus_tag="KLLA0_E09659r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:9487288"
     gene            <857611..>859959
                     /locus_tag="KLLA0_E09681g"
                     /db_xref="GeneID:2894182"
     mRNA            <857611..>859959
                     /locus_tag="KLLA0_E09681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454386.1"
                     /db_xref="GeneID:2894182"
     CDS             857611..859959
                     /locus_tag="KLLA0_E09681g"
                     /note="some similarities with uniprot|P20840 Saccharomyces
                     cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
                     binds to Aga1p during agglutination N-terminal half is
                     homologous to the immunoglobulin superfamily and contains
                     binding site for a-agglutinin C-terminal half is highly
                     glycosylated and contains GPI anchor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454386.1"
                     /db_xref="GeneID:2894182"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV3"
                     /translation="MFTFAYIPIIVFSALISTSLGKELTTVKLSNPSVVAASGSNSFP
                     HQGWIASLDWAFEDTSNAKTGDYFTITMPHVYKVKFNEGDTSFKVNLDDNTEVFECYA
                     PQQAAYKYEDTILKCYAVTDISAYESISGSLTATLVLSNGGSAYPPELSNANYFSSGE
                     NTLYFNDIEASFQANAKSETNDFYFSGRSTAYQSLESYFLGFNCPNGYITGASQQIIY
                     DVSNEGYGIDCSAIQVYQSKNFNDWIFPIDYETLDGSVSCGENSVEITVEELKPDYRI
                     WVNALQNLDSEVATVRNSIFFDYTCTNTVENSTYRTTTHYEPVYVITEAIYSGVAFTT
                     VDAEGQETTLTSTISCSRCEETSSTESTSEVSSESTTESTTESTTEITTEPSSESSSE
                     ITTEPTSEVTTDRTTLTSTVNCSECEETSTTETPSVVTSESTIESTTHSITDSTVEST
                     TDTTPESSTEVSFESTPVSTNELTTETSFEYTTESTIESSSESTSDFTTESSTELSSE
                     SSTESSTESSSVPSTVPTTSPYTESSSESTTESDISTEITSEQPSETSSETFSEFSST
                     TDVESSPGTTTTATSTEISSSVSTVCTECSEDTTSLDISTETFDSSTEGSTTLETSST
                     ETTLETRLFSSDVETSELVVETDSSEITIETETLVSDSTTAVNTTESSSVPPTHSTDT
                     SITTDTIEETEGTSAEVLTSAPIFSGTIEPKGSTDTPQGTASITSNTFPAIRTFSIPS
                     NFQKPPPSSSTTSLLTFQGHGNHVGRSTLAGLLPILISYIFL"
     gene            complement(<860245..>861168)
                     /locus_tag="KLLA0_E09703g"
                     /db_xref="GeneID:2893620"
     mRNA            complement(<860245..>861168)
                     /locus_tag="KLLA0_E09703g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454387.1"
                     /db_xref="GeneID:2893620"
     CDS             complement(860245..861168)
                     /locus_tag="KLLA0_E09703g"
                     /note="weakly similar to uniprot|P38087 Saccharomyces
                     cerevisiae YBR104W Mitochondrial protein, putative inner
                     membrane transporter with a role in oleate metabolism and
                     glutamate biosynthesis; member of the mitochondrial
                     carrier (MCF) family; has similarity with Ymc1p member
                     vGLC.1420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454387.1"
                     /db_xref="GeneID:2893620"
                     /db_xref="GOA:Q6CNV2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV2"
                     /translation="MSKSSNAITEPVNSLISNETYSRIMGFVAGVFSGVAKNAVGHPF
                     DTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH
                     NYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRY
                     KGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAI
                     NFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFK
                     GFVPSFLRSFPANAAALAAFEFVLRTSGAKS"
     gene            <861812..>862447
                     /locus_tag="KLLA0_E09725g"
                     /db_xref="GeneID:2894030"
     mRNA            <861812..>862447
                     /locus_tag="KLLA0_E09725g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454388.1"
                     /db_xref="GeneID:2894030"
     CDS             861812..862447
                     /locus_tag="KLLA0_E09725g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454388.1"
                     /db_xref="GeneID:2894030"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV1"
                     /translation="MARQTRPAVTRELCEQCIGNTKNAQRMVLLMAQMAAAYEKLGNL
                     RHSDEDKKQSEIIISNLESHVIVTTLTLRKLSQRSEQEDLQLLVLYNSTKNAWTRTQY
                     YEIYQLKQFLEEAIISNQDYDILPQAENVLNGFLFNEDYVKNLPALNEDVKLSQWEIF
                     AREVTQINKTYRIQLDHFGNSVQRVMNRAKLNTNYPHIEALNIMLNDLNSY"
     gene            <862612..>862887
                     /locus_tag="KLLA0_E09747g"
                     /db_xref="GeneID:2893839"
     mRNA            <862612..>862887
                     /locus_tag="KLLA0_E09747g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454389.1"
                     /db_xref="GeneID:2893839"
     CDS             862612..862887
                     /locus_tag="KLLA0_E09747g"
                     /note="similar to uniprot|P46965 Saccharomyces cerevisiae
                     YJR010C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454389.1"
                     /db_xref="GeneID:2893839"
                     /db_xref="GOA:Q6CNV0"
                     /db_xref="InterPro:IPR009542"
                     /db_xref="UniProtKB/TrEMBL:Q6CNV0"
                     /translation="MEVLQDLGRQLVFPIDFESQSYTESISNKALYLITFFSFISGYL
                     TESIKVSGIVFVLGLIVVLVIVLPPYSAYNKHRPQWANSGPTVVEPK"
     gene            <863295..>865037
                     /locus_tag="KLLA0_E09769g"
                     /db_xref="GeneID:2893660"
     mRNA            <863295..>865037
                     /locus_tag="KLLA0_E09769g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454390.1"
                     /db_xref="GeneID:2893660"
     CDS             863295..865037
                     /locus_tag="KLLA0_E09769g"
                     /note="similar to uniprot|P42826 Saccharomyces cerevisiae
                     YGR194C XKS1 third enzyme in the xylose pathway,
                     Xylulokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454390.1"
                     /db_xref="GeneID:2893660"
                     /db_xref="GOA:Q6CNU9"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU9"
                     /translation="MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYN
                     TRKGVYIKDEGVIDAPVAMWLEAIDLCFERLGKCIDLKKVKSMSGSCQQHGTVFWNCD
                     HLPKDLQPSSNLVKQLASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSS
                     HYRFSGSQIAKVHETEPEVYANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIE
                     KHEFNEDLLSVVDEDIASIKRKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPF
                     TGDNLATICSLPLQKNDVLISLGTSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMIC
                     YCNGSLAREKIRDDINGESQTHDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAV
                     TKRCYFKYIDNKVVLTNVNMFPDKRLDAKNIVESQALSCRVRISPLLSEEANAINETQ
                     VLKSELKVKFDYDFFPLASYAKRPNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLET
                     ANSCALGGCYKALWSLLKEQNPETPSFDRWLNAFFNWERDCEFVCNSDAAKWENYNNK
                     IRTLSEIEREASSH"
     gene            <865604..>866821
                     /locus_tag="KLLA0_E09791g"
                     /db_xref="GeneID:2893661"
     mRNA            <865604..>866821
                     /locus_tag="KLLA0_E09791g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454391.1"
                     /db_xref="GeneID:2893661"
     CDS             865604..866821
                     /locus_tag="KLLA0_E09791g"
                     /note="similar to uniprot|P16451 Saccharomyces cerevisiae
                     YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
                     protein (E3BP) of the mitochondrial pyruvate dehydrogenase
                     (PDH) complex plays a structural role in the complex by
                     binding and positioning E3 to the dihydrolipoamide
                     acetyltransferase (E2) core"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454391.1"
                     /db_xref="GeneID:2893661"
                     /db_xref="GOA:Q6CNU8"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU8"
                     /translation="MFRLAIKNRACLRQLHQCRTMLKAQAFGMPAMSPTMERGGVVDW
                     KFKAGDTFSAGDVLLEVETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADV
                     DDDLATLEFPKPVEAKKESKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSVQANAS
                     QTLFPSVLSLLEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYI
                     KSHEKLDLTNIELRPARETAAAAAAAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSA
                     AIASYVKECSFLAHDEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRH
                     RTSSPQPDIFDLLSGTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAE
                     NFVAQLSNLELFQ"
     gene            <867899..>870139
                     /locus_tag="KLLA0_E09813g"
                     /db_xref="GeneID:2894144"
     mRNA            <867899..>870139
                     /locus_tag="KLLA0_E09813g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454392.1"
                     /db_xref="GeneID:2894144"
     CDS             867899..870139
                     /locus_tag="KLLA0_E09813g"
                     /note="similar to uniprot|P39106 Saccharomyces cerevisiae
                     YER001W MNN1 Alpha-1 3-mannosyltransferase integral
                     membrane glycoprotein of the Golgi complex required for
                     addition of alpha1 3-mannose linkages to N-linked and
                     O-linked oligosaccharides one of five S. cerevisiae
                     proteins of the MNN1 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454392.1"
                     /db_xref="GeneID:2894144"
                     /db_xref="GOA:Q6CNU7"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU7"
                     /translation="MMVVRRFLSASRYNMPSFRSRPVLLAIFGVCATVIWYLFFFQSN
                     LKMADLKKVATSRYLSQEPSLSELMSNVKIKPIEETPVSPLELIPDIEISTRKKYDAS
                     WDLLFRGRKYKSFNDYDLHTKCEFYFQNLYNLNEDWTNNIRTFTFDINDVDTSTKIDA
                     LKDSDGVQLVDEKAIRLYKRTHNVALATERLRLYDKCFVNSPGSNPLKMDHLFRSNKK
                     SKTTALDDEVTGNRDTFTKTKKTSFLSDMDTSSFQKYDQWDFEHRMFPMIPYFEEHNF
                     TNVMPIFTGSNGGEPLPQGKFPVLDPKSGELLRVETFRYDKSKSLWKNWNDMSSASGK
                     RGIILAAGDGQVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSS
                     GRAQSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYF
                     NFKEYKSTGTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQC
                     MGMLTPEEKVYKRFFEVGHQHNLESGLLAINKNEHIMGLVTATVLNIAPKVGGCGWGD
                     KEFFWLGLLVAGQRYSIYDIDASAIGVPQQKQSIANGDEFDEYRICSLQVAHTSYDGH
                     LLWINGGSQYCKKPETFEGDWTNIKELRESYSDDKEKALKAYSDTVKVEAAIVPDSRS
                     NGWGRDDQRCKGYFWCGKFTSKLKPYTYNTVVTKGDLIRFGDEEIESISKINKIWNDA
                     IIPDGA"
     gene            complement(<870664..>872172)
                     /locus_tag="KLLA0_E09835g"
                     /db_xref="GeneID:2894185"
     mRNA            complement(<870664..>872172)
                     /locus_tag="KLLA0_E09835g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454393.1"
                     /db_xref="GeneID:2894185"
     CDS             complement(870664..872172)
                     /locus_tag="KLLA0_E09835g"
                     /note="highly similar to uniprot|P08536 Saccharomyces
                     cerevisiae YJR010W MET3 ATP sulfurylase catalyzes the
                     primary step of intracellular sulfate activation essential
                     for assimilatory reduction of sulfate to sulfide involved
                     in methionine metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454393.1"
                     /db_xref="GeneID:2894185"
                     /db_xref="GOA:Q6CNU6"
                     /db_xref="InterPro:IPR002650"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR024951"
                     /db_xref="InterPro:IPR025980"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027535"
                     /translation="MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICD
                     LELILNGGFSPLDGFLNQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRI
                     VLLQDNEFPLAILTVSDVYQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEA
                     IQLPVHYDYPGWRKTPAQLRLEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSK
                     ILIHPVVGLTKPGDIDHHTRVRVYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAI
                     IRKNYGASHFIVGRDHAGPGKNSKGVDFYGPYDAQELVESYKNELDIEVVPFRMVTYL
                     PDEDRYAPIDEIDTDKTRTLNISGTELRNRLRDGGEIPAWFSYPEVVKILRESNPSRP
                     KQGFALVLSETLPAQLKTALLSTFLQYGGGRHYKVLEHGNNEEILALVPDFVRSGTGL
                     ILQNASSLKGTNVFKIGEESGSDIPLETEDKNILHIVQRVVLFLEDQGFFQF"
     gene            complement(<872888..>873694)
                     /locus_tag="KLLA0_E09857g"
                     /db_xref="GeneID:2894536"
     mRNA            complement(<872888..>873694)
                     /locus_tag="KLLA0_E09857g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454394.1"
                     /db_xref="GeneID:2894536"
     CDS             complement(872888..873694)
                     /locus_tag="KLLA0_E09857g"
                     /note="weakly similar to uniprot|Q05016 Saccharomyces
                     cerevisiae YMR226C NADP()-dependent dehydrogenase acts on
                     serine L-allo-threonine and other 3-hydroxy acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454394.1"
                     /db_xref="GeneID:2894536"
                     /db_xref="GOA:Q6CNU5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU5"
                     /translation="MKKQVILITGASTGIGLSIAETLRSAGYEVFGTSRKGSIPGKEY
                     SFKMIKLDITDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFE
                     TNFFGVHRMTRAVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLD
                     YEVKKFGIHVSTIDPHIIKTGMANSNSPADEEMAVYDSIKGKVSERMLKQSLENSDEP
                     EVIAKEVLKVIKTENPKSRYTPGKAKLYAYFSYYTPSWIFRRILDTVFSE"
     gene            complement(<874102..>875994)
                     /locus_tag="KLLA0_E09879g"
                     /db_xref="GeneID:2894691"
     mRNA            complement(<874102..>875994)
                     /locus_tag="KLLA0_E09879g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454395.1"
                     /db_xref="GeneID:2894691"
     CDS             complement(874102..875994)
                     /locus_tag="KLLA0_E09879g"
                     /note="similar to uniprot|P36172 Saccharomyces cerevisiae
                     YKR105C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454395.1"
                     /db_xref="GeneID:2894691"
                     /db_xref="GOA:Q6CNU4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU4"
                     /translation="MSSLAKQVSSTSLDKNSTVNIIFSLVKRESEPVSKKYEDKKAGE
                     DAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCLFALVLAQLIVALDVFIVNTVIDVV
                     SKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATA
                     TSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFI
                     GGAFTTHATWRWCFWISLPVGGSAAFLFFFTYNPERLSITARLVRCLKLVKAIPLKQF
                     QYVETYKTIVRNLVFRFDLIGFTLNCTGICLFLLGLTFGSEDNSWKRAFVVCFLVIGG
                     LLVVCSVVYDFYIFDRINPEPANASYRPLMVRTLIGHKYFLLANTVTCAAAVVFAGYM
                     VYSVQFFQLVLGYTAWNAGLHLIPLVIASLLSAIFCGGFTKKTGHVKYVMIANIALLL
                     IGSGVCTLLDNYSNNSMQIGVWILPGFGLGATLQCALISSQLQIDKNSPDAKTELVEI
                     TAFNSFCKSLGSSIGAVLSTTTFISALWRKINKAKLEGYYGKKINELVKYRLQNFDGK
                     STEAAEIFSAAVTYVFWMCYAFSALAFFCACLSSNRRVETEKKVAQEEHDGLPSIPEF
                     KQGTTV"
     gene            complement(<877366..>879048)
                     /locus_tag="KLLA0_E09901g"
                     /db_xref="GeneID:2894692"
     mRNA            complement(<877366..>879048)
                     /locus_tag="KLLA0_E09901g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454396.1"
                     /db_xref="GeneID:2894692"
     CDS             complement(877366..879048)
                     /locus_tag="KLLA0_E09901g"
                     /note="some similarities with uniprot|P53729 Saccharomyces
                     cerevisiae YNR029C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454396.1"
                     /db_xref="GeneID:2894692"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU3"
                     /translation="MPSITKKSAPFKAHSGPIPVTILSGFLGSGKTTLLERILTSNHG
                     MKVAVIINDMSELNVDAALIKDHKVANKEEKLIQLQNGCICCTLRGDLLEELINLHQN
                     NEFDYILIESTGIAEPMQVAETFSSEFSQTLLDTPDSVTSDERVLLQKVLDLGGLEKL
                     TKIDTTVTVIDAMNFLANIETTDFLANRWGDSGQGEADRTVTDLMIDQIEFADVIIIN
                     KTDRIKKKRLTKIQKIIKSLNLVAKIIKTSYCKVPMSEILNTGLYNFEKAASSAGWLK
                     SINEMTLKEGYGDKTKSVLSPTPETVEYGVNSFVYKSRKPFHPKRLYDALKDKFYIIE
                     QQALAEQEHVDLYEVDEEEKEEERSLAATPDTSKVHELLQSEDEAESESEGDDDDEEE
                     LSERELIRNKKNSPFGPLLRSKGFFWLATRYLLRGEWSSAGPMLTLKGGIPWFHVAGL
                     DKQEDIPPEALTLIKRDFQGPFGDRRNELVFIGTGIDSVKLKQILDDCLLTEDEYKQF
                     VDCSLKEHNLLKVERRLSELFQDGFEDWLLYDDDDDDEDDDEEKEEEGEEED"
     gene            <881665..>883236
                     /locus_tag="KLLA0_E09923g"
                     /db_xref="GeneID:2893861"
     mRNA            <881665..>883236
                     /locus_tag="KLLA0_E09923g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454397.1"
                     /db_xref="GeneID:2893861"
     CDS             881665..883236
                     /locus_tag="KLLA0_E09923g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454397.1"
                     /db_xref="GeneID:2893861"
                     /db_xref="GOA:Q6CNU2"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU2"
                     /translation="MLYVFGISMTNIPKSLNITTTADSFISPGSSKSFIPSSVSSSEL
                     PHSRPAATHCIFYNVIQDYLPVDESQWTPSNVPAPLNVRKGEVVQFVCTHENNTVVVK
                     SRNKLGHGLVPLRCLSINLELTSISNMPSPKTSHSPIFESQISQRLSSEDLAQDPPSK
                     SYSLSNSRLSSESSISNVSDSTNPMPKSFLANDCKVVSVAIKDNRMWYRVETTTSSQH
                     KRFLCRYYQDFYQLHCQLLDEFRRLSLDRKHLPNLPKPMANSKSNESVHSRLNSFTAY
                     LEVLLSSEHIPTDFKQSIFYDQWLCPKSGDLVQTPRGSLYKSIIIDEKGVSWNKILIT
                     DKNDSQDLVTELLHPDSTVNRSISRSSTPLGLSISTPSSPNISQPLQYTFSSKSMSQP
                     SSPLLNKISSYSQINNIIKMKINFGSDCYAMKCQISDIETWDKFERIIRTRLIKDLPD
                     PLCPFTVKVKDSTAEDKLIGLDAANFDIDNVMFMTQNQSNSNTNSYTQYNTTIPFANA
                     DSRRQFLKLNLEVSI"
     gene            complement(<883778..>884119)
                     /locus_tag="KLLA0_E09945g"
                     /db_xref="GeneID:2893627"
     mRNA            complement(<883778..>884119)
                     /locus_tag="KLLA0_E09945g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454398.1"
                     /db_xref="GeneID:2893627"
     CDS             complement(883778..884119)
                     /locus_tag="KLLA0_E09945g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454398.1"
                     /db_xref="GeneID:2893627"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU1"
                     /translation="MSYESDDSSDGEPITHPTQVYQRIYEKEADSHLQERFALEREAD
                     AAEKEYLKVADEWKKKPTPNLEQRMNDLSDRCEEINENLNDANESWINSYSVAMYYKD
                     KERRELEEDSD"
     gene            <884414..>885151
                     /locus_tag="KLLA0_E09967g"
                     /db_xref="GeneID:2893995"
     mRNA            <884414..>885151
                     /locus_tag="KLLA0_E09967g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454399.1"
                     /db_xref="GeneID:2893995"
     CDS             884414..885151
                     /locus_tag="KLLA0_E09967g"
                     /note="similar to uniprot|P35127 Saccharomyces cerevisiae
                     YJR099W YUH1 Ubiquitin C-terminal hydrolase that cleaves
                     ubiquitin-protein fusions to generate monomeric ubiquitin
                     hydrolyzes the peptide bond at the C-terminus of ubiquitin
                     also the major processing enzyme for the ubiquitin-like
                     protein Rub1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454399.1"
                     /db_xref="GeneID:2893995"
                     /db_xref="GOA:Q6CNU0"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:Q6CNU0"
                     /translation="MSQGKKEQKVRSVVPLESNPQVFTNFANSLGLSSDWALMDIYSL
                     TDPDLLAFIPRPVKAVILLFPLNETIDSLTDSFKSDVPESKNGSSAPIWFKQNVRNAC
                     GLYALLHSLSNNANLLTDGSILKQFLTENPASDGQYSDDDAVDDFLVSISEIYNENSQ
                     QGDTAAPSAEEDVELHFITFIEKDGLLYELDGRSKTGPRCLGKISPDSDLLTEPLVKQ
                     RFEWYHGNASESMKLQFSLLGLGPSLD"
     gene            complement(<885282..>887150)
                     /locus_tag="KLLA0_E09989g"
                     /db_xref="GeneID:2894020"
     mRNA            complement(<885282..>887150)
                     /locus_tag="KLLA0_E09989g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454400.1"
                     /db_xref="GeneID:2894020"
     CDS             complement(885282..887150)
                     /locus_tag="KLLA0_E09989g"
                     /note="weakly similar to uniprot|Q07109 Saccharomyces
                     cerevisiae YPR045C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454400.1"
                     /db_xref="GeneID:2894020"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT9"
                     /translation="MNTYNQVNPITLGKRPSSNKYNKSGSGGQSSLPPEQHNTGNVTS
                     SFGNSIPEIRARLKSERKKAMINESLSKEAKTNKEEADYIPQFDHILEPISHLINEPL
                     PPSFYRFVEKEYKAAKTLRLPNKRLKLVSREIRLLLKAAIAKGALHKNDWDQQHLTRV
                     FSAKTNGNPINSQERLCCFLSPEEKRIIIDGIPYEQLGIERPNVSTSKDNTNNYQVID
                     PTSIVTVETQSKVPPPPPPIDSRPTPPWAQNVRTADPLLNQQMNPKESPVPSVSLESR
                     ISNLNAPSPSPVPKKIAAQDEKSRRLERLKRFASPEPLTSTSKRVKIDDDDSYSDLNA
                     ITNKAYKFDKNKPIVGQCQVLEKKYLRLTSEPDPAKVRPLSILIKALDWIVTKFHSGS
                     CSYQYFCDQLKSIRQDLKVQMIENDFTVTVYKTHARAALENGDVGEYNQCQSSLKPLF
                     EKDNIDKSDLPEFISYRILYHMMTSDHSSINQLHFQLLTTLSHMYDNEMIQRALKMSE
                     AQIENNYHTFMRIYQQTKGPERHLVNQFIKKERLNALNCMCKAYARLPLQFLAPELHF
                     NDATEAFEFLTELELIQFMVVPESDPNEIYLDCKSCRSTIIKHFGDARRIDIKGQI"
     gene            complement(<887535..>888464)
                     /locus_tag="KLLA0_E10011g"
                     /db_xref="GeneID:2894021"
     mRNA            complement(<887535..>888464)
                     /locus_tag="KLLA0_E10011g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454401.1"
                     /db_xref="GeneID:2894021"
     CDS             complement(887535..888464)
                     /locus_tag="KLLA0_E10011g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454401.1"
                     /db_xref="GeneID:2894021"
                     /db_xref="GOA:Q6CNT8"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="InterPro:IPR017390"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT8"
                     /translation="MSGWNTIESDAGVFTRLITDLGVEGLQFEDIPYLQYLEEESVSS
                     LLKGVVFLFPYEVSLYQGSEPVQGTYETDSDKLFFSQQTIQNACATQAVINILFNLAK
                     EDEESVTLGPELSQFYEFVKDFHQAELIGETINNSELIRNVHNSFTPPNLFVMDEDPY
                     RNRGKPEEVFHFVGFIPYRSRIYELDGLRPYPIDHGPFTDFAKDVQNILQERMNILVQ
                     LGVHKFNIIGVIKDKLEFLQNQLQKEDINDSEEFILAEQLQEELNKREKWNEEITFRR
                     HNLTGLVLELAKQTCSSMSQQEFQDALVHASDK"
     gene            complement(<888721..>889626)
                     /locus_tag="KLLA0_E10033g"
                     /db_xref="GeneID:2894224"
     mRNA            complement(<888721..>889626)
                     /locus_tag="KLLA0_E10033g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454402.1"
                     /db_xref="GeneID:2894224"
     CDS             complement(888721..889626)
                     /locus_tag="KLLA0_E10033g"
                     /note="similar to uniprot|P47140 Saccharomyces cerevisiae
                     YJR100C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454402.1"
                     /db_xref="GeneID:2894224"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="InterPro:IPR025659"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT7"
                     /translation="MWRYNLALTRRIFSSQPAALVRQYSAFRRLPRVATPVKDVSRLG
                     FNGVPNMNNVTIQQYDPIATTILNEPTIIIERQIEMMNVVLGFEQANKYAIMDVMGNR
                     IGYMQERDFGFFKAITRQIYRLHRPFTVDVFDNYGNVLMTIERPFSFINSHIKAILPD
                     ENRTLVGESVQNWHLWRRRYELFQRECENPSEFTQFGNIDAPFLSFEFPVMDENNKII
                     AGCDRNWVGIGRELFTDTGVYIVRFDSQQSFDGVYPQEMLSDKVLNYDQRAVMLSNAV
                     SIDFDYFSRHSRYGGGLLSFGTYDE"
     gene            complement(<890157..>891083)
                     /locus_tag="KLLA0_E10055g"
                     /db_xref="GeneID:2893827"
     mRNA            complement(<890157..>891083)
                     /locus_tag="KLLA0_E10055g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454403.1"
                     /db_xref="GeneID:2893827"
     CDS             complement(890157..891083)
                     /locus_tag="KLLA0_E10055g"
                     /note="highly similar to uniprot|P32345 Saccharomyces
                     cerevisiae YDR075W PPH3 Catalytic subunit of protein
                     phosphatase involved in activation of Gln3p which is a
                     transcription factor with a role in nitrogen utilization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454403.1"
                     /db_xref="GeneID:2893827"
                     /db_xref="GOA:Q6CNT6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /translation="MMKLDEIIETLRQGKHVDEDSIYSLCVMAQELLMNESNVTHVDT
                     PVTICGDIHGQLHDLLTLFAKSGGIEKNRYIFLGDFVDRGFYSLESFLLLVCYKLRYP
                     DRIVLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLPLGAIVNNKVFCV
                     HGGLSPDVLSINEIRTIDRKKEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGQNE
                     VDKFLHTNSVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLRIDDDM
                     TKDYTIFEAVQARDSGGNVILPTKKPQMDYFL"
     gene            <891885..>892901
                     /locus_tag="KLLA0_E10077g"
                     /db_xref="GeneID:2893795"
     mRNA            <891885..>892901
                     /locus_tag="KLLA0_E10077g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454404.1"
                     /db_xref="GeneID:2893795"
     CDS             891885..892901
                     /locus_tag="KLLA0_E10077g"
                     /note="weakly similar to uniprot|Q70DD8 Saccharomyces
                     cerevisiae YER149C PEA2 Coiled-coil polarisome protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454404.1"
                     /db_xref="GeneID:2893795"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT5"
                     /translation="MLRNNLDQWYEYNTSFVEKLHGKYPNEQLNEYLQTTSTNSLISN
                     RQNSEWDELPMDLDSQLKLEFALYLINESANGSLSTKGTTFLQKLGSVDVDTLKELVQ
                     LVLENDKSLANKSTDEDEGKVEQITSYLISSSISKGINLASIDNSSNEEGVHDPISFC
                     KKNIDILLDAYPQNSSSSLQHAPLSTSELELNDISKQQDLQTAITDLQLAYKFLKSKY
                     ENDRDEYQATIETLNKTNKELSEELLHYHSKLKEREEKSKVTSQMQSIPMDIDRSFSQ
                     AISESSDIKSSTSASNHQSFSMMKQEFKRILADTQLRYEKELEQERLLRQQLENKLEN
                     KGYR"
     gene            complement(<893271..>893972)
                     /locus_tag="KLLA0_E10099g"
                     /db_xref="GeneID:2893858"
     mRNA            complement(<893271..>893972)
                     /locus_tag="KLLA0_E10099g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454405.1"
                     /db_xref="GeneID:2893858"
     CDS             complement(893271..893972)
                     /locus_tag="KLLA0_E10099g"
                     /note="highly similar to uniprot|P13393 Saccharomyces
                     cerevisiae YER148W SPT15 TATA-binding protein general
                     transcription factor that interacts with other factors to
                     form the preinitiation complex at promoters essential for
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454405.1"
                     /db_xref="GeneID:2893858"
                     /db_xref="GOA:Q6CNT4"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT4"
                     /translation="MSEENRMKQFQEENKIVFDPSTRSVWETQEKQEHESLPGTDANA
                     EDADKGSATSGIIPTLQNIVATVNLDCRLDLKTVALHARNAEYNPKRFAAVIMRIREP
                     KTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFSAKFTDFKIQNIVGSCDVK
                     FPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQ
                     AFEAIYPVLSEFRKL"
     gene            <894620..>896509
                     /locus_tag="KLLA0_E10121g"
                     /db_xref="GeneID:2893859"
     mRNA            <894620..>896509
                     /locus_tag="KLLA0_E10121g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454406.1"
                     /db_xref="GeneID:2893859"
     CDS             894620..896509
                     /locus_tag="KLLA0_E10121g"
                     /note="similar to uniprot|P40090 Saccharomyces cerevisiae
                     YER147C SCC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454406.1"
                     /db_xref="GeneID:2893859"
                     /db_xref="InterPro:IPR019440"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT3"
                     /translation="MDTFKDELLNVPISFDQKSLSRKAQQLDLIYHLSKQYTLTAHDV
                     VTEIETELELRQYYTLINQAIRCLRYLKDGGFQLSLEQDFQITNDLVTLLIEETHRID
                     LAEQYFSALRERLQSTTWVNEKMYVDYVLLCKIPLYKNDPSHNKIALRNLSKLISKLD
                     TSLWKVLFQYFRLQLIPGNERKLADYRDILFVIKNHEQFHFVVMCSFINYCLDEGISI
                     PADMWVYFSEMDTAHVKLKIWKILLELLVLIFKDINITDKLTELKSFFDNNKDKIDSP
                     LESIHLFDTVSLKLDFPVFGYKDVKNLLLFFQSVSYLPNCFDKRSNFSVKFLPKTIST
                     TGKLLSSLDEKCSLSKLNSLHKFYHTLLDLVKFYQTCESIILHGMVADDNTTSPYQDL
                     LQAWNAQLRGQVKTASAIYYSILHNDLGNRELKLLSLLHLYAITLAEISECDTGNDDL
                     HTLTTKANQLVSQLDLLLNTSVFSASTVWRSTKLLLVIMGRFEPFTKNPQASNQNTLL
                     LNELEQYFAGNSLLPADDLPTSKAPVKIKKSLLLHIWLNYIAGSMSINELDQRCVLSS
                     TCFKLAKQQYLPYLRYLVGIWNLMNNTIAMNSKEVALTKARLDQIVKDLKANSDTETT
                     ANSTS"
     gene            complement(<896599..>899229)
                     /locus_tag="KLLA0_E10143g"
                     /db_xref="GeneID:2894138"
     mRNA            complement(<896599..>899229)
                     /locus_tag="KLLA0_E10143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454407.1"
                     /db_xref="GeneID:2894138"
     CDS             complement(896599..899229)
                     /locus_tag="KLLA0_E10143g"
                     /note="similar to uniprot|P31688 Saccharomyces cerevisiae
                     YDR074W TPS2 Trehalose-6-phosphate phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454407.1"
                     /db_xref="GeneID:2894138"
                     /db_xref="GOA:Q6CNT2"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT2"
                     /translation="MTGEKKLSNKVINCITQLPYKIEKISDDDTEANDPSCWSIEPIS
                     GNSALQSSLKYLNESPNWEHHIVAWTGEILNSDENPDRSMYLTQAEKEVIATMLQGKE
                     AEGCTHTVHPVWLLRKDQYRWRKFAENVIWPALHYILNAPDDGTLENVWWYDYVKFNE
                     AYAMKVAQIYQPGDIIWVHDYYLMLLPQLLRMRFNNATIAYFHDTPWPSNEYFRCLSR
                     RKPVLDGLLGSNRICFQNDGFARHFVSSCQRLLGCTATKSSNSNANNSDEYRITSYGG
                     DVLVDSLPIGVDTEQIQRDAFSPDVDEKVNAIKKAYEGKKIIIGRDRLDTVKGVLQKL
                     QAYQVFLAMYPEWRGKVVLIQVSGPTAKTDANIKLESQVNELVSSINGEYGNLNYSPV
                     QHYYLRIPQDVYYSLLRVADVCLITSVRDGMNTTALEFVTVKSQLSKYNCYASPLILS
                     EFSGTSTILTDAIIINPWDAVAVSKAINKALKLTPEQKETLELKLRKEVPTIQDWTDK
                     FLGKVVDLVEHKIGNQKITPALNRPLLLKTYKKAKRRLFLFDYDGTLTPIVQDPAAAI
                     PSARLYSIITKLAQDPKNKIWLISGRDQQFLNRYFGTKIPQVGLSAEHGCFMKDVSSE
                     EWINLTSKFDMSWQKEVGQIMEEYTKKTPGSFIERKKVALTWHYRRSDPQLGEFNADA
                     LKTSLEKITDGLGVEVMEGKANIEVRPSFVNKGEIVKRLVWTPHGAKQLIEDNFSIDE
                     NVLRDELPEFVLCLGDDVTDEDMFKQLNHIEEQWDEKYPNFESSDGFGIYPVTVGSAS
                     KKTVAKAYLTDPQQVLDTLGLLVGDVSLFQSAGTVDLDDRGHLKDSESSLRSEQASAA
                     YAMKRSTSSNNGLKKSSKNN"
     gene            complement(<899751..>900149)
                     /locus_tag="KLLA0_E10165g"
                     /db_xref="GeneID:2894139"
     mRNA            complement(<899751..>900149)
                     /locus_tag="KLLA0_E10165g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454408.1"
                     /db_xref="GeneID:2894139"
     CDS             complement(899751..900149)
                     /locus_tag="KLLA0_E10165g"
                     /note="similar to gnl|GLV|CAGL0G05329g Candida glabrata
                     CAGL0G05329g and some similarites with YDR073W
                     uniprot|P38956 Saccharomyces cerevisiae YDR073W SNF11
                     component of SWI/SNF global transcription activator
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454408.1"
                     /db_xref="GeneID:2894139"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT1"
                     /translation="MTDLNPAIDLKSDSGVSPKQKLQWKIQVLLHINSMLIKKSQETR
                     TMYESRQVPTLASLSKEQMEQILIQYTKRIHCNLHTISQINQGNLAAKPPIMDPPPNP
                     FLSNTASAQERQQDMLVKMYLLMNRMFQLW"
     gene            <901353..>902957
                     /locus_tag="KLLA0_E10187g"
                     /db_xref="GeneID:2894132"
     mRNA            <901353..>902957
                     /locus_tag="KLLA0_E10187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454409.1"
                     /db_xref="GeneID:2894132"
     CDS             901353..902957
                     /locus_tag="KLLA0_E10187g"
                     /note="similar to uniprot|P38954 Saccharomyces cerevisiae
                     YDR072C IPT1 Inositolphosphotransferase 1 involved in
                     synthesis of mannose-(inositol-P)2-ceramide (M(IP)2C)
                     which is the most abundant sphingolipid in cells mutation
                     confers resistance to the antifungals syringomycin E and
                     DmAMP1 in some growth media"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454409.1"
                     /db_xref="GeneID:2894132"
                     /db_xref="UniProtKB/TrEMBL:Q6CNT0"
                     /translation="MECLLWIPWFIKRVYLGGVNQRNVFTLALNFCLNFSPIFIWLFM
                     FKNAGVIPTNWRPPIWGSVAYYCDAYIFGDYWHSLDTRLEFVVSLVSSSIIGILFAVV
                     PLFIWYYVYYTKKLRHNLFDETDVLLQYPLNYIGSSQFRPSRMRNVLPFLFLFFTFVM
                     LNFDHLLSSQDPSNFTKFKDLLAWVMYVILHLTGPILTGVYLYVFHIPGTLKCFSFAL
                     GLQNIVGLFTHFLLPMAPPWFIHMYGAHDTAHLNYSQPGYAAGLTRVDMHLGTHLNSN
                     GFHLSPIVFGAVPSLHSAMAVQCFFFLLFRSTQTKSVPESIATDAAPVILQKDEDDDY
                     EMDEEQDEEEQGYTNVKVQPNKSIIPFEFEDDDFADDSDSVESKLVSHINSITLQTTN
                     GGDDDLEARATTSDSDSELNTLAVAKILAKQQVLPVHILESKWLYIFHKGLLPKFLGT
                     IFVCLQWWSTQYLDHHFRYDLFVGAVYAVISYILINKYVLQPKVIKPWLITRADPTLD
                     KMKESKTMGMRVFENTKIEWFFDPLA"
     gene            complement(<903201..>903455)
                     /locus_tag="KLLA0_E10209g"
                     /db_xref="GeneID:2894133"
     mRNA            complement(<903201..>903455)
                     /locus_tag="KLLA0_E10209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454410.1"
                     /db_xref="GeneID:2894133"
     CDS             complement(903201..903455)
                     /locus_tag="KLLA0_E10209g"
                     /note="similar to uniprot|P40089 Saccharomyces cerevisiae
                     YER146W LSM5 Component of small nuclear ribonucleoprotein
                     complexes involved in RNA processing splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454410.1"
                     /db_xref="GeneID:2894133"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS9"
                     /translation="MSSVSEILPLEVIDKTIGQEVTILLKDYREFFGTLVGFDDYVNV
                     VIENAVEYLEDQEIKRFQGKMLLTGNNIAMLIPGGKPASN"
     gene            <904368..>904949
                     /locus_tag="KLLA0_E10231g"
                     /db_xref="GeneID:2894134"
     mRNA            <904368..>904949
                     /locus_tag="KLLA0_E10231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454411.1"
                     /db_xref="GeneID:2894134"
     CDS             904368..904949
                     /locus_tag="KLLA0_E10231g"
                     /note="similar to uniprot|Q12447 Saccharomyces cerevisiae
                     YDR071C PAA1 Polyamine acetyltransferase acetylates
                     polyamines such as putrescine spermidine and spermine may
                     be involved in transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454411.1"
                     /db_xref="GeneID:2894134"
                     /db_xref="GOA:Q6CNS8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS8"
                     /translation="MSSSLPLHVYIRPLTIEDCQASVELEAQGFPPEERAGKEKIEFR
                     LKMCPELSSGLFIRDVKGTEILGEKLIGHIFGTKIPIPKNGTKELTFITNESMSFTQD
                     DSSPVIGVHSVVIAPQHQKKNLATLLLTDYIQKMSNQEIGDRIVIIAHNELVPFYERI
                     GFRSVGDNKDVISSNGKVWCNMVRELVKEEYET"
     gene            <905780..>906052
                     /locus_tag="KLLA0_E10253g"
                     /db_xref="GeneID:2894135"
     mRNA            <905780..>906052
                     /locus_tag="KLLA0_E10253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454412.1"
                     /db_xref="GeneID:2894135"
     CDS             905780..906052
                     /locus_tag="KLLA0_E10253g"
                     /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
                     YDR070C FMP16 The authentic, non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454412.1"
                     /db_xref="GeneID:2894135"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS7"
                     /translation="MIQLTRVIKSSPVATQCLRRNFSASVMAGTTQKSKDPDQRMFDR
                     NKKKLEELEHDSKTDDPNYKRPNLKSLKQKGKDAPIKQHRADDGVY"
     gene            <906675..>909065
                     /locus_tag="KLLA0_E10275g"
                     /db_xref="GeneID:2894137"
     mRNA            <906675..>909065
                     /locus_tag="KLLA0_E10275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454413.1"
                     /db_xref="GeneID:2894137"
     CDS             906675..909065
                     /locus_tag="KLLA0_E10275g"
                     /note="similar to uniprot|P39944 Saccharomyces cerevisiae
                     YER144C UBP5 Putative ubiquitin-specific protease that
                     does not associate with the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454413.1"
                     /db_xref="GeneID:2894137"
                     /db_xref="GOA:Q9HFS7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /translation="MLEHNSKLFCKSLSQLSAVASKVVAEDVEGEHFKQLLAKCIDTL
                     SIYKSELRKLSCASKDTPPSQIYQLNETLYVYYKIVSQIASQVIPGLAEFQQIKMNSK
                     KDSKDKELLEIYSRLVSALANDKQIGEVKRFIKNHSEEAAHDGTQHSYENGEFVSISQ
                     LHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRKSLI
                     TASDREVDLFKNRDKFRLIVLYTDTDEHTKYYWQQLEVLQDILCNRSFDKPLHHTKVI
                     VLQNGVNAWKEKYPMELKKIMESAISDIRTKPVEHNFHPMALSNNNNIEKANSPSHSQ
                     TTSFTHYPDAPFLTNGASIKTAGLVPNQLLPSTSNLTKALQQNDEGNSEPYKLQPNGI
                     KNHRQESNNHANGTNCIVSSNGNNSVAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCL
                     LGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKMYQQGKLQAYNNTNMES
                     TAVHPTQFKLACGSINSLFKGKQQQDCQEFCQFLLDGLHEDLNQCGTNPPLKELSPEA
                     EKMRETMPMRIASAIEWERYLTTDFSVIVDLFQGQYASQLRCKICAHTSTTYQAFSVL
                     SVPVPRARSCTIYDCFKEFTKLETLEKDELWYCPYCKQRQPSTKQIIITRLPNNLIIH
                     LKRFDNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLPLRGQKPPFNYRLFA
                     VASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDEYITPNAYVLFYRRVNM"
     gene            complement(<909140..>910015)
                     /locus_tag="KLLA0_E10297g"
                     /db_xref="GeneID:2894136"
     mRNA            complement(<909140..>910015)
                     /locus_tag="KLLA0_E10297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454414.1"
                     /db_xref="GeneID:2894136"
     CDS             complement(909140..910015)
                     /locus_tag="KLLA0_E10297g"
                     /note="weakly similar to uniprot|P54858 Saccharomyces
                     cerevisiae YDR068W DOS2 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454414.1"
                     /db_xref="GeneID:2894136"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS5"
                     /translation="MDFLYEETATETADAVKVTKHDDKTDEAFQKFEDQVDEQLQKTS
                     KAILGFVKEKDSLNFQIPENLGGTVTNKAQEMLGKLDDNLEKVEELTQGYWNTVSKKS
                     FWSSMANTISTQFQEVLDFDAKEAEGSNKDTAFSSITDTKLKQLAIDKSIYLKYNAAS
                     LPKDFVIKEHFEEIQELLNKDSDLKSLHEDVVPAPLDDATFWNIYFTKKAEILNLASK
                     KRDLLSAKEDLGKEQAIGWDDEEEDSEEEIIPSKTAKAKQDSNTGKETISSAKTESKA
                     IKQEENDDEEDDDWE"
     gene            <910343..>911050
                     /locus_tag="KLLA0_E10319g"
                     /db_xref="GeneID:2893896"
     mRNA            <910343..>911050
                     /locus_tag="KLLA0_E10319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454415.1"
                     /db_xref="GeneID:2893896"
     CDS             910343..911050
                     /locus_tag="KLLA0_E10319g"
                     /note="similar to uniprot|Q6Q559 Saccharomyces cerevisiae
                     YDR067C which is a model system for studying replication
                     of positive-strand RNA viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454415.1"
                     /db_xref="GeneID:2893896"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS4"
                     /translation="MSLVTPLQFSCVQPRFYRGSYPAEINLPFLRTLRLNYIISLVPE
                     PITNDPILAEFCEVEGIETVFIQCADDKKQKTKTKNKDEPKVKRKKKPVPIEYDVVIE
                     CIKFLIDKNHYPCYIHCSNSNTEVTSLVIACLRKLSYWSTVSIFNEYMTYTSSINIHE
                     RNFIENFNLEIDIQGVKPSDKVSWIIVRSKHNGATGSKQDKGAKHQNGKSDENLDLTP
                     QLSASKDPLPTLRFHDD"
     gene            complement(<911148..>912392)
                     /locus_tag="KLLA0_E10341g"
                     /db_xref="GeneID:2893897"
     mRNA            complement(<911148..>912392)
                     /locus_tag="KLLA0_E10341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454416.1"
                     /db_xref="GeneID:2893897"
     CDS             complement(911148..912392)
                     /locus_tag="KLLA0_E10341g"
                     /note="similar to uniprot|P40087 Saccharomyces cerevisiae
                     YER143W DDI1 DNA damage-inducible v-SNARE binding protein
                     contains a ubiquitin-associated (UBA) domain may act as a
                     negative regulator of constitutive exocytosis may play a
                     role in S-phase checkpoint control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454416.1"
                     /db_xref="GeneID:2893897"
                     /db_xref="GOA:Q6CNS3"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /translation="MNITVTYEHSDDVLGPFELSEDMSLIDLFALIDFKEESQIIFHN
                     MKQLDTKNTNITLKEAGLQNHDMLLIKPKNPASSQAAFGQPQEIDLTDEQYIEQFRTF
                     LLENPSMAQEMGLPNLEHMINNKTQFHQLLGPVLLSRRGERSNNPFGIPNSEYSRLMS
                     NPDDPVNQARISELTNQHEIDEQLRYAMEYTPESFTQVSMLYIKLEINGHPVKAFVDS
                     GAQQTIMSTKLAERTGLTSLIDKRFSGIAQGVGTGKILGRIHTTQIKIHDVFLPCSFT
                     VLDTPMEMLLGLDMLRRHQASIDLKNNVLRISDVETPFLPESEIPKDSLHALTTPAAD
                     EVRKAALKRDSSSGKNAMTGDANKVKQPKIPSSTTNQTVPSFAESDIKKLVDLGFSRK
                     EAINALNKTGGNVDYAASLLFQ"
     gene            <912583..>913413
                     /locus_tag="KLLA0_E10363g"
                     /db_xref="GeneID:2894695"
     mRNA            <912583..>913413
                     /locus_tag="KLLA0_E10363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454417.1"
                     /db_xref="GeneID:2894695"
     CDS             912583..913413
                     /locus_tag="KLLA0_E10363g"
                     /note="similar to uniprot|P22134 Saccharomyces cerevisiae
                     YER142C MAG1 3-methyl-adenine DNA glycosylase involved in
                     protecting DNA against alkylating agents initiates base
                     excision repair by removing damaged bases to create abasic
                     sites that are subsequently repaired"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454417.1"
                     /db_xref="GeneID:2894695"
                     /db_xref="GOA:Q6CNS2"
                     /db_xref="InterPro:IPR000035"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS2"
                     /translation="MKRTRDDILKVDVDQEYLDQHIDSFRDGIEHILTIDPTLKEIIE
                     HSPFTMFLKENVAKDSMDLYFNKLAGSIISQQISGAAAKNIRGRIVDMFDGTFPNYQT
                     LHETFQDSKKKQAFKECGLSQRKLMYIESLVGYFFNNEDSIKDLFAFADDDKIIEELV
                     ANIKGIGPWSAKMFLVTGLHRLNVFAAEDLGIARGCSRYLEQRPEILKKLHSKRTLIK
                     KSKIKHKSFKWKIHDEDVVELCGDLFSPHRTLFMFVLWRMSDTNMEVVINNEKRFMSK
                     "
     gene            complement(<913611..>915095)
                     /locus_tag="KLLA0_E10385g"
                     /db_xref="GeneID:2894188"
     mRNA            complement(<913611..>915095)
                     /locus_tag="KLLA0_E10385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454418.1"
                     /db_xref="GeneID:2894188"
     CDS             complement(913611..915095)
                     /locus_tag="KLLA0_E10385g"
                     /note="similar to uniprot|P40086 Saccharomyces cerevisiae
                     YER141W COX15 Protein required for the hydroxylation of
                     heme O to form heme A which is an essential prosthetic
                     group for cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454418.1"
                     /db_xref="GeneID:2894188"
                     /db_xref="GOA:Q6CNS1"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:Q6CNS1"
                     /translation="MFRTLVLGGRGLSGIRISSRGLMTRSISNLVKTKNVIPTVALKR
                     ALPTVSMAYFHTRSIVREAVQVSQTTGNGITTATASTAKQAKSKPLLNSSKVVGYWLV
                     GTSILVFGIVVLGGLTRLTESGLSITEWRPVAGTLPPLNQQEWENEFTKYKSSPEFKQ
                     LNSHITLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVARKTSPHVNKRLFGLSAL
                     LGLQGFIGWWMVKSGLDETQLKERKSKPTVSQYRLTTHLGTAFMLYMGMLWTGFEILR
                     EAKWVKNPSEALVLFSKLDNPALAPLRRSALGLLALTFVTAMSGGLVAGLDAGLIYNT
                     FPHMGDDWVPSKRELIDENFARKEDKSDMFWRNMLENPTTVQLNHRILATTTFFAVFA
                     FHMYCNRNKAIIPKQVLRTAHGMMGLATLQVTLGIFTLLYLVPIPLASAHQAGALALL
                     TGSLLFASQLRKPRAAIRILTGGLYTQQQKASSKILTEASKLAK"
     gene            complement(<915551..>918886)
                     /locus_tag="KLLA0_E10407g"
                     /db_xref="GeneID:2894249"
     mRNA            complement(<915551..>918886)
                     /locus_tag="KLLA0_E10407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454420.1"
                     /db_xref="GeneID:2894249"
     CDS             complement(915551..918886)
                     /locus_tag="KLLA0_E10407g"
                     /note="similar to uniprot|P36775 Saccharomyces cerevisiae
                     YBL022C PIM1 Mitochondrial ATP-dependent protease involved
                     in intramitochondrial proteolysis involved in degradation
                     of misfolded proteins in mitochondria required for
                     bigenesis and maintenance of mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454420.1"
                     /db_xref="GeneID:2894249"
                     /db_xref="GOA:Q6CNR9"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /translation="MLRSSRSRLVTRNILLRQFKNGNNVRLMNATRFQHNGIVGNEKL
                     ASDSQKFVDESYHWMQYRKQMNDPVSRQRLEQLESQWVKSIQLKQDDKGKDIDQPESE
                     NRKKEEEQVPTEEKDNDTAKESETSQQRDSVAETQGPASTSGGASGNGESSGNGSGDD
                     GNNGSGNGKPSKNAKQPFPEVYPQVMALPISRRPLFPGFYKAVVISDERVMKAIKDMS
                     DRQQPYIGAFLLKDSTVDTDVIHKADEVYNVGVFAQVTSAFPSKDEKTGAETMTALLY
                     PHRRIKLDELIPPTSEQNLKDESDVSKSEGVENNEQEVVKASLQKMENMKDVEEDDDE
                     NLTGFLKDYDVSLVNVSNLADKEFNPNSPVINALTSEILKVFKEISQLNTMFREQIAT
                     FSASIQSATTNIFEEPARLADFAAAVSAGEEEELQEILESLDIEQRLEKALTVLKKEL
                     MNAELQNKISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGRDKLIESFKDRVSKLQ
                     LPETVQKVFDDEITKLATLETSQSEFGVIRNYLDWITSLPWGIISKEQYSIPKAKKIL
                     DEDHYGMKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSIARSLNRQFF
                     RFSVGGMTDVAEIKGHRRTYIGALPGRVIQALKKCQTQNPLILIDEIDKIGHGGIHGD
                     PAAALLELLDPEQNNSFLDNYMDIPIDLSKVLFVCTANSLETIPRPLLDRMEVIELTG
                     YVAEEKVKIAENYLSPSAKKSAGLDNANVNITENAIVSLMKHYCRESGVRSLKKHIEK
                     IYRKAALNVVKQLSIDDKPMENEEVKDQKDIKVKQSENKSSAEASTVESTTEENELIK
                     TQKSHDNKGSLEVPETVSVTVDENNLKDYVGPPIFTTDRLYESTPPGVVMGLAWTSMG
                     GCAMYVESVLEQPLTHSTQPTLERTGQLGDVMKESSRLAYSFSKMYLAKKFPENRFFE
                     VAKIHLHCPEGATPKDGPSAGVTMASSFLSLALNKGLDPTVAMTGELTLTGKVLRIGG
                     LREKAVAAKRSGAKTIIFPKDNLSDWAELPENVKEGLEPLAADWYEDVFQRLFGDVDT
                     NKGNTVWSEDFKKIDEKRNKETK"
     gene            complement(<919489..>920106)
                     /locus_tag="KLLA0_E10429g"
                     /db_xref="GeneID:2894288"
     mRNA            complement(<919489..>920106)
                     /locus_tag="KLLA0_E10429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454421.1"
                     /db_xref="GeneID:2894288"
     CDS             complement(919489..920106)
                     /locus_tag="KLLA0_E10429g"
                     /note="uniprot|P40914 Kluyveromyces lactis HAP3
                     Transcriptional activator HAP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454421.1"
                     /db_xref="GeneID:2894288"
                     /db_xref="GOA:P40914"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /translation="MDTETEAEKQERHNNYLNELAEQDRWLPINNVARLMKNTLPATT
                     KVSKDAKECMQECVSEFISFVTSEACDRCTSGKRKTINGEDILLSLHALGFENYAEVL
                     KIYLAKYRQQQAIKNQMMYPKEDVEGSYTEEESRAEDADHVTQERQQPLHPVPSSAST
                     TTSTEVSASEHVQSSSKSTHNPAQAQPRIVVQQPLGSRHSTADHL"
     gene            <920415..>922085
                     /locus_tag="KLLA0_E10451g"
                     /db_xref="GeneID:2894284"
     mRNA            <920415..>922085
                     /locus_tag="KLLA0_E10451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454422.1"
                     /db_xref="GeneID:2894284"
     CDS             920415..922085
                     /locus_tag="KLLA0_E10451g"
                     /note="similar to uniprot|P38206 Saccharomyces cerevisiae
                     YBL020W RFT1 Flippase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454422.1"
                     /db_xref="GeneID:2894284"
                     /db_xref="GOA:P40913"
                     /db_xref="InterPro:IPR007594"
                     /translation="MNVKNEHMNKFANGVLFLMLGQTLSKGVNFLLNTLLVRYLSPRI
                     FGITSFLEFLLSTVLFFSRESIRISTLRIKSTTDSGKLEKVEDGEDTRTLQSLINFGY
                     IPFVIGLPLSIILISWQYSNLNSYFIDLPYFKASIFLIWLSILIELVSEPFYLVHQYL
                     LNHFIRSKYESLGVTFACVANFIIVVWFEKMVNGVGLELHDDYKQEGIAIFAFAVGKL
                     VHAMTLLACYSYNYYSEVYTTGERYSYKLTKIRPETRQESYYFQNDTVQHFKKVYFQL
                     CFKHLLTEGDKLIINSLCTVEEQGIYSLLSNYGSLITRLLFAPIEEALRLFLARLLSV
                     SSKKNLWLSMKVLIDLTKFYLYLSLFIIIFGPINSSYLLKFVIGSKWSSTSFLETIRT
                     YCFYIPFLSLNGIFEAFFQSVASGDQIFKHSYVMMLFSGIFLFNCWLFIEYFDLSLEG
                     LIVSNILNMALRIAYCGNFIHKFYHYLLKESSTETTQSILPNISTFKNVALIAAIIGA
                     LDWYFIGYVENMRELLINVILALLLLILVIYKEKSLISELLAAKTYAA"
     gene            <922357..>923856
                     /locus_tag="KLLA0_E10473g"
                     /db_xref="GeneID:2894250"
     mRNA            <922357..>923856
                     /locus_tag="KLLA0_E10473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454423.1"
                     /db_xref="GeneID:2894250"
     CDS             922357..923856
                     /locus_tag="KLLA0_E10473g"
                     /note="similar to uniprot|P38207 Saccharomyces cerevisiae
                     YBL019W APN2 Class II abasic (AP) endonuclease involved in
                     repair of DNA damage homolog of human HAP1 and E. coli
                     exoIII"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454423.1"
                     /db_xref="GeneID:2894250"
                     /db_xref="GOA:Q6CNR6"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="UniProtKB/TrEMBL:Q6CNR6"
                     /translation="MDEVKDKTGVRFVTFNVNGVRTLFQHYPFSRMNNSLKLAFELFQ
                     ADIVTLQELKIDAKSISKWGKVEGYQSYITISQKRKGYSGVGCWIRTPSEDDPLRHHL
                     KVIKAEEGITGLLRVQANGISYRESSEGIGGYTGLDFADENDLLDIDSEGRCIIIELA
                     CNVVIFSTYCPANSSQTEEGELSRLTFLKLLFKRIRNLHGLGKHVVLMGDINVCRDLK
                     DHATALDESSISLSQQKTGSEIEEKFNEKCVQFIMDPSRIGRRLLNTMLCDSIISKYA
                     QEGILVDSTRKIQGRDRLKMYTVWNTLLNTRPVNYGSRVDYIFVSKGLKDNITDGDIL
                     TTIMGSDHCPVFADIKVDNLELKHESFNKPKFEAATRYFLNHGNILDMFRKANRKSTS
                     PSTTSTGKVVKPLNVKQYNGMNALASATVSKDQNKNVSIQPQSRVKSAHMKAFEEMLG
                     KAPVCEHGEEAVLRVSKTDKSFGKKFWVCNRSKGEKDDPEASCGFFQWK"
     gene            complement(<923922..>924338)
                     /locus_tag="KLLA0_E10495g"
                     /db_xref="GeneID:2894253"
     mRNA            complement(<923922..>924338)
                     /locus_tag="KLLA0_E10495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454424.1"
                     /db_xref="GeneID:2894253"
     CDS             complement(923922..924338)
                     /locus_tag="KLLA0_E10495g"
                     /note="similar to uniprot|P38208 Saccharomyces cerevisiae
                     YBL018C POP8 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454424.1"
                     /db_xref="GeneID:2894253"
                     /db_xref="InterPro:IPR020347"
                     /db_xref="UniProtKB/TrEMBL:Q6CNR5"
                     /translation="MAKFKPEWFYFKLKVTSHDSEKDNEIQVDKVTWLQMLNTALKRS
                     HGVFGEAIEYELLYVDNLDTIAKVSVNDTDIFTTAISTYIASDELVGTSLIINVLEQS
                     NNLSGLTVHEDDRIWFKKLVESEAEIEAESKEKERL"
     gene            complement(<924701..>929401)
                     /locus_tag="KLLA0_E10517g"
                     /db_xref="GeneID:2894257"
     mRNA            complement(<924701..>929401)
                     /locus_tag="KLLA0_E10517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454425.1"
                     /db_xref="GeneID:2894257"
     CDS             complement(924701..929401)
                     /locus_tag="KLLA0_E10517g"
                     /note="similar to uniprot|P32319 Saccharomyces cerevisiae
                     YBL017C PEP1 Type I transmembrane sorting receptor for
                     multiple vacuolar hydrolases cycles between the late-Golgi
                     and prevacuolar endosome-like compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454425.1"
                     /db_xref="GeneID:2894257"
                     /db_xref="GOA:Q6CNR4"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="InterPro:IPR015943"
                     /translation="MFWWNILIWLGLWNFLPVLAQDFKPKVSFHSDVDTHGRLSILGF
                     DDSRVVLKLLRGVELYRSEDNGVTWDSVGLPLSSDNKPQEWNHLVLDRIYKADVAYLS
                     GENGVLATGDKGKSWKQLTFLDADNHKIDFSDYSNVGDENRKPIINVEIESHPTNKNA
                     RIINIYELGKLDGKFTLRQISFYSKDGNNFKLASSGSKSNDDSNPLNMFCSFVQKSSK
                     SKLYKLKDKVICQESTVLSPFGDVSSKLYITDVNFKSLSPFAEQLQDLSPASTFISDN
                     HLFILTLSDRFNENSAANLWRLEDDSTDKFEQISLGTQIRKSLMDVNEIDGRAIITIY
                     HRERNKDGDNNDDEDKSPFEDIFSGSIEALISDSYGKNFRHLSFDEQKASSLTLSTSI
                     FVKKTMFATWTNTMRDFGFFDFRSKVSFDLGNTWSKLKVSDPEGKWNYNCDINSDSND
                     CGFQMFIVYGGGVEGDSDIFSPGIIAAIGDVYEENPSGDFLKMGTFISRDDGSTWEKV
                     LDFPSRVVMGDYGNIILAVPFDPESDKDPQSEFYFSLDQGKTFQEYQLDKSFYPTELL
                     PSALDGSGNSFMLVGTIMSEDYQNLESVSYVVDFSDAFKGASCKTSDMEDWYYSNGQC
                     VDGTILKFRRRKQDAQCLIKTTYKDLTFEEELCGCSELDYECADDFSIDSAGKCVPDF
                     SKASLMEKCESKKSIQLEPKKISKTTKCKRPQNIIKEEISCAAVPAPSNVKVTENKFS
                     SIFKSYQYFDTFVRESILFRTDKSEAYVSHDGGQNIKQIQTGGEDILEINFNPFFNSS
                     AYLFGKNKNLFATHDYGLSFKVTELPAGRQLGFPLSFHAKDIQTFIYYGGESCESFFD
                     PNCHAVAYITRDGGASFEKLLEGASNCEFLESAVESPRVENGIVCMVKDKSTGARSYV
                     SSTDYFKTQTVLYSDILGFMSTGGYIVVAVSHGERQLRAYLTIDGVEYSEAVLPADLD
                     SYEQKAFTVLGSQEGAIFMHMTTNLDKNEEFGALLKSNTEGTSFVILERAVNRNSFGF
                     VDFEKIQGLEGIILINTVANAKEIVESKDKTSQKKLKTKITFNDGADWTYIKPPSVDS
                     EGKKYNCNPKNLEKCSLNLHGFTERKDVRDTYSSGSAIGYMFALGNVGEYLTPVSEAS
                     TFMTNDGGISWSEVKKGSYQWEYGDHGSVLVLVKDNEPTDTVSYSINGGKTWKDYQFA
                     SEKINVYDLVTVPRDSAMRFLVIGSSVNVRGEETRTYTLDFVDMFSRQCQYSKDDLKD
                     FEYISLSHPNTKECLFGHKAKYLRKKSDDCYVGMAPLEDKFRIFANCSCTRNDYECDY
                     NFMRVSDGTCKLIDGLKPADPKDICSKDNSLIEYFEPTGYRKIALSTCNGGLMLANSD
                     SPHPCPGKEKEFKEKYKVNHTSFLAIWIFAVLIFTGMLSFIYYRGIKRNGGFARFGEI
                     RLGDDDLIEENNTDRAVNTVLRNGVFLFSNVYTGLQYFGHQVGNFFKRGLSRFGNTTG
                     PSYQSLLHDQFLDDADDLLVGHDEDADDLASFIENEGNFEIGNDEEVDLSSDTPTHAP
                     YSDNPEEANPHEST"
     gene            <929989..>931104
                     /locus_tag="KLLA0_E10539g"
                     /db_xref="GeneID:2894206"
     mRNA            <929989..>931104
                     /locus_tag="KLLA0_E10539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454426.1"
                     /db_xref="GeneID:2894206"
     CDS             929989..931104
                     /locus_tag="KLLA0_E10539g"
                     /note="highly similar to uniprot|P16892 Saccharomyces
                     cerevisiae YBL016W FUS3 Mitogen-activated protein kinase
                     involved in mating pheromone response activated by
                     phosphorylation by Ste7p provides specificity during the
                     mating vs. filamentous growth response by phosphorylating
                     transcriptional and cytoplasmic targets"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454426.1"
                     /db_xref="GeneID:2894206"
                     /db_xref="GOA:Q6CNR3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CNR3"
                     /translation="MGKRIVFNISSEFQLQSLLGEGAYGVVCSAKHKPSGEIVAIKKI
                     EPFEKPLFSIRTLREIKILKHFQHENIISIFDVQKPSSFEQFNEVYIIQELMQTDLHR
                     VIVTQELSEDHVQYFVYQTLRALKVLHGSNVIHRDLKPSNLLLNSNCDLKICDFGLAR
                     IVSERATDGDAHVDADDTDDNSPSSAANDGDPAISGMTEYVATRWYRAPEVMLTAAQY
                     SKSMDVWSCGCILAELLGKQPLFPGKDYRDQLILIFQTLGTPTEQELVELVENRRARE
                     YIRSLPKHPKINWRRRFPNASAAALDLLDRMLQFDPRLRITATEALSHPYLVSYHDPD
                     DEPEGTPIPSSFFQFDQWKSRLNTKDLKRLLWNEIVS"
     gene            <932415..>933986
                     /locus_tag="KLLA0_E10561g"
                     /db_xref="GeneID:2894510"
     mRNA            <932415..>933986
                     /locus_tag="KLLA0_E10561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454427.1"
                     /db_xref="GeneID:2894510"
     CDS             932415..933986
                     /locus_tag="KLLA0_E10561g"
                     /note="highly similar to uniprot|P32316 Saccharomyces
                     cerevisiae YBL015W ACH1 Acetyl-coA hydrolase primarily
                     localized to mitochondria required for acetate utilization
                     and for diploid pseudohyphal growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454427.1"
                     /db_xref="GeneID:2894510"
                     /db_xref="GOA:Q6CNR2"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /translation="MTVSRLLKDRVRYAPYLKKVKPVEELIPLFKDGQYIGWSGFTGV
                     GAPKAVPEALIKHVEENNLQGKLRFNLFVGASAGPEECKWAEHDMILRRAPHQVGKPI
                     AKAINDGRIQFFDKHLSMFPQDLTYGYYSRNRTDGKILDYTIIEATAIKEDGSIVPGP
                     SVGGSPEFISVSDKIIIEVNTATPSFEGLHDIDMPVNPPFRQPYPYTAVDQKNGLDSI
                     PVDPERVVAVVESTQRDVVGPNTPSDATSQSIARHLVEFFENEVRHGRLPENLHPLQS
                     GIGNIANAVIEGLTDSSFKNLTVWTEVLQDSFLDLFENGALDYATATSIRLTEAGFQK
                     FFDNWDDFSKKLCLRSQVVSNNPELIRRLGVIAMNTPVEVDIYAHANSTNVSGSRMLN
                     GLGGSADFLRNAKLSIMHAPAARPTKTDPTGISTIVPMASHVDQTEHDLDVLVTDQGL
                     ADLRGLSPRERAREIIKNCAHPDYQPILTDYLDRSEHYAKLHKCMHEPHMLKNAFKFH
                     LNLSEKGTMKVDNWD"
     gene            complement(<934321..>935421)
                     /locus_tag="KLLA0_E10583g"
                     /db_xref="GeneID:2894511"
     mRNA            complement(<934321..>935421)
                     /locus_tag="KLLA0_E10583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454428.1"
                     /db_xref="GeneID:2894511"
     CDS             complement(934321..935421)
                     /locus_tag="KLLA0_E10583g"
                     /note="similar to uniprot|P32785 Saccharomyces cerevisiae
                     YBL013W FMT1 Methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454428.1"
                     /db_xref="GeneID:2894511"
                     /db_xref="GOA:Q6CNR1"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="UniProtKB/TrEMBL:Q6CNR1"
                     /translation="MWGFKHGKTLSTCVIRFYSTSNGNPLKVLFFGSDQYSSHLLSAL
                     HSLLRTKDIDSLQVVTRSPKSCGRYLSEVREVPIMSVNDSLGLPPVIKCDTRSDLLGL
                     IDNPSVEFNVLIAVSFGKLIPKQLIEKVDGKAFNIHPSLLPRYRGSSPIQYTLLNRDE
                     FTGVTIQSLHPTKFDHGEIIKQTAPLSVQEILKLGTVGKFDEDVPEKVATLMDQLGLK
                     SGELLQQMIRERDFKPKPNPNYEPSLAPKITTEMKQINWKNERKLRLLAKNDALGSLY
                     CYKLSLPKRKKEVMKKRIIFPELFDLNETISMKPGEFKLSEDEKTMIIQCIDGQIGTN
                     VLQFEGFALEPVPTFVNRLNKRCGKMNSNEFL"
     gene            <935625..>936467
                     /locus_tag="KLLA0_E10605g"
                     /db_xref="GeneID:2894159"
     mRNA            <935625..>936467
                     /locus_tag="KLLA0_E10605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454429.1"
                     /db_xref="GeneID:2894159"
     CDS             935625..936467
                     /locus_tag="KLLA0_E10605g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454429.1"
                     /db_xref="GeneID:2894159"
                     /db_xref="UniProtKB/TrEMBL:Q6CNR0"
                     /translation="MNDDEKARIARRKAKFSEQRRQELLDDPLKDKSLLSRSTADNET
                     TVMMRLKTNQTVRDQMFVQIQELARSGNSDDEVIEHGLRKLREIIVSIYHSEKRNDEF
                     MNSVKNVYIYSIEFYLGRRPVNWTKLVNILEAFVRKVSGVLECKEHGSALVLYEAIEQ
                     QQYGRSLQIIQGHEKQIWDPVLCRLIVKSCATDNFHLWFYALSKLDDKTFLYKFLITL
                     PYHEQAVHTVLNIISRSYHQLTLAHITEFWFQSVPIAHLKDVISSRWTVNELNHGSIV
                     KFRK"
     gene            <936850..>937806
                     /locus_tag="KLLA0_E10627g"
                     /db_xref="GeneID:2893658"
     mRNA            <936850..>937806
                     /locus_tag="KLLA0_E10627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454430.1"
                     /db_xref="GeneID:2893658"
     CDS             936850..937806
                     /locus_tag="KLLA0_E10627g"
                     /note="some similarities with uniprot|P40356 Saccharomyces
                     cerevisiae YGL025C PGD1 Subunit of the Mediator global
                     transcriptional cofactor complex which is part of the RNA
                     polymerase II holoenzyme and plays an essential role in
                     basal and activated transcription direct target of the
                     Cyc8p-Tup1p transcriptional corepressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454430.1"
                     /db_xref="GeneID:2893658"
                     /db_xref="GOA:Q6CNQ9"
                     /db_xref="InterPro:IPR020998"
                     /translation="MAVGPPDQIFKDNLTFDTFRELIIEKESTADEVADKVLEAKKAL
                     LPIRTLMTEFVGMIANLESMGNKTSQEKFLAIRMKLIELQNNIQKFSKDFQQLQPVMR
                     TMDKFNEEVNAGEKKFFVQETLGYTQLASNGSAAGITKTSSGNDGNTTGSTANTMAMA
                     KGLKKNAAGKPNTGTGVQSGPGRRNSTKKTGHTGPATAPTTSNSAASAAAAAANTPSL
                     KQIPNTQPMQLMPGVSPMAMASPLNNISPQRKLTQHVNQSRENSLHQGVTPSASMITP
                     QNILNMSAFDLNQNQTPQSLDNVNNMDLTNLDLDSLNMEFLN"
     gene            <938243..>940372
                     /locus_tag="KLLA0_E10649g"
                     /db_xref="GeneID:2894014"
     mRNA            <938243..>940372
                     /locus_tag="KLLA0_E10649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454431.1"
                     /db_xref="GeneID:2894014"
     CDS             938243..940372
                     /locus_tag="KLLA0_E10649g"
                     /note="highly similar to uniprot|P00931 Saccharomyces
                     cerevisiae YGL026C TRP5 tryptophan synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454431.1"
                     /db_xref="GeneID:2894014"
                     /db_xref="GOA:Q6CNQ8"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018204"
                     /db_xref="InterPro:IPR023026"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ8"
                     /translation="MSVLLRQAFENAKKEGRNALVTFMTAGYPTLEDTIQIMKGFQDG
                     GVDVIELGLPFSDPVADGPVIQIANTVALKNGIDMPKVLALVKQAREEGITVPIVLMG
                     YYNPILNYGEEKFIKDAGAAGVNGFLIVDLPPEEALKVRNYVGENGLSLIPLVAPSTT
                     DERLSLLSHLADSFIYVVSRMGTTGARESVANDLSALVQKVRSFSGDIPLAVGFGIST
                     KEHFDVVGSVSDGVVIGSKIVTLIGEAAQDKRYETAKNYAEEISGGKKGKVLSKEEFW
                     NIHKANVATAKENKTVAKEFEEFHKFPARFGEFGGQYVPEALHACLRQLERGFEDAVA
                     DPAFWEEFKSLYSYIGRPSSFHKADRLTEYCGGAQIWLKREDLNHTGSHKINNALAQV
                     LIAKRLGKKKVIAETGAGQHGVATATACAKFGLECTVFMGAEDTRRQALNVFRMRILG
                     AKVVPVTNGTQTLRDATSEAFRYWVSNLESTHYIVGSAIGPHPYPTLVRTFQSVIGNE
                     TKQQFAALNDGKLPDAIVACVGGGSNSTGMFSPFEHDASVRLIGVEAGGDGIDTDHHS
                     ATLTVGRPGVLHGVKTYVLQDSDGQVHDTHSVSAGLDYPGVGPELAAWKASGRADFMA
                     ATDAEALEGFRLLSQLEGIIPALESSHAVYGAVQIAKTMKKDQHLIINISGRGDKDVQ
                     SVAEILPRLGPQIGWDLRFEKDPTAGN"
     gene            <940776..>943364
                     /locus_tag="KLLA0_E10671g"
                     /db_xref="GeneID:2894172"
     mRNA            <940776..>943364
                     /locus_tag="KLLA0_E10671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454432.1"
                     /db_xref="GeneID:2894172"
     CDS             940776..943364
                     /locus_tag="KLLA0_E10671g"
                     /note="weakly similar to uniprot|P32786 Saccharomyces
                     cerevisiae YBL014C RRN6 involved in the transcription of
                     35S rRNA genes by RNA polymerase I member of yeast Pol I
                     core factor (CF) also composed of Rrn11p Rrn7p and
                     TATA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454432.1"
                     /db_xref="GeneID:2894172"
                     /db_xref="InterPro:IPR016531"
                     /db_xref="InterPro:IPR019350"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ7"
                     /translation="MSLQPRHNERGHQLGIGVVASSTYVPFNESNNIENDNEHWALSS
                     LKKRDRMYFRDMRVLQEGNSRESHTSDLGIYNTDMEEVPYPVERQGFCNQVLRKLDKG
                     DILKDVELRPNEELISLDNTAITSKFYVPSSLVSKIAKGEMSMTSDDGHRKQNRAIRV
                     SSSHTRKDFKVIDPTRKRQIAVAELLPTVDARLDKEPTMLLITIKGPTESDLSIQTLA
                     LDKRTGLYEANSEPRVISLQSRIKHIEIPTLSKSLARYPNLFAVITNSKIHVIRLDRI
                     HNNAIDLTEFTPLEFHELEQFPIVHVAFNPWNLMEIALIDSKGNWCIAKLESHKRKPC
                     IIKLRRDASGSIFDPTETSPWNHIEWADDHTSLLVLNRSKLTMINFEQNWQHDIIQAK
                     TWSELRDYKRISERLSLLLTSKEIILIKIQDQQINRLLSWKHDWDSRDPSIRISYKIS
                     EDDQFGQLIHVLLFSKLTLKVYGIMFGYKANSWAVVVSKPFLLSLGDIKSKDGLNSIE
                     FPDTSNYTNDLDDGGDRGVSTDLVCITGFIGSDTVIQGFLSTTDSGNHIRLNLEYPSW
                     DYRGDFLDKISKIFTESLPVAPISHQADNEYQMFQEYGYNLSEKLNELLDSWKNRSDK
                     YDLNIESLASLKTFPSYFKNFTEFASLIEQLITYYKDHNLAFSDLPFTTKQLIGEGLT
                     SWEGLFNRLVIAWDSISPNAEELSRSATQDMTLSLTVCQDQEGIKNSLETITNEISDN
                     TKAVLDLWDNGSDETLSNMQSTRPPLFSASVSSQQFQVPTIKSSQQTSRKKKLPSSTS
                     RGLHSLSVSQPTQFMSGNGLPGNMAPAFSLGASTRSTQPMPTLSQPEGQQRVKKKKKK
                     KVGGFT"
     gene            <943825..>946281
                     /locus_tag="KLLA0_E10693g"
                     /db_xref="GeneID:2894173"
     mRNA            <943825..>946281
                     /locus_tag="KLLA0_E10693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454433.1"
                     /db_xref="GeneID:2894173"
     CDS             943825..946281
                     /locus_tag="KLLA0_E10693g"
                     /note="similar to uniprot|P53008 Saccharomyces cerevisiae
                     YGL027C CWH41 Processing alpha glucosidase I involved in
                     assembly of cell wall beta 1 6 glucan and
                     asparagine-linked protein glycosylation ER type II
                     integral membrane N-glycoprotein disruption leads to a K1
                     killer toxin-resistant phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454433.1"
                     /db_xref="GeneID:2894173"
                     /db_xref="GOA:Q6CNQ6"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ6"
                     /translation="MITLSRLLLFAALNAILGHSIALDLDDYSKANNQSLLWAPYRSN
                     CYFGLRPRYVNDEPFVLGAMWFNSINAQGLAKVRHFVEQGDKLDKYGWIWYDPRIGGR
                     ETIRDSESNLQLNFTFVKSHSGENWAVQVEGDLIDKNKEAAHSIVIYMKQNGKEDSSC
                     YLNQNDIFTKNRNELSFTGFSNELKGYTIKLADENSKFYKDAVPPLSPDCDPSKPTVL
                     SMNIPDDQLWKAKDVFQSLLKDSIQAHVETNPQLSANLIPSALTIRNIHNFPPGNVQY
                     IQQTFEGHFKFNIIFNKKGSKDQIAENSVDHLIVLAEGLVQQKFNKKFGIADNSLYRD
                     FAQETFSNLLGGLSYFHGTHLVDRETAFDNENFDRIELLNSNEEGPLELFSMVPSRAF
                     FPRGFYWDEGFHLLQLLDYDSDLVFEVLHSWFNLIDKDGWIPREVILGDEARSKVPEE
                     FRVQNPNIANPPTLLLAFSEILSRAKTIQEEMLESHLQENYQYEELDSSFQGDKLNNN
                     PELLISYAKEIYPKLLKHYEWFRNSQKGMLEEYMEVPSINSKVHMEEAYRWIGRTFTH
                     CLPSGMDDYPRAIPPDIAELHVDALTWVGVMTRSMKQIASVIDLVEEIKRFATIEENI
                     VENLKTLHWDDDQKLFCDITFNDDANTDEALRKFVCHEGYVSLLPFAVKLIPHTDVER
                     LKHILDSMSNTTTLLSPYGIRSLSKTDEYYDTGEVYWRGPIWLNINYLCLDALEYYFL
                     ESPLKKSEGQNEELFLQARTLYKQLRQNIIDNVYKIWKKDGYVYEQYNHKNGKGSGVQ
                     HFTGWTALVVNMIGKLPEEL"
     gene            <947393..>948907
                     /locus_tag="KLLA0_E10715g"
                     /db_xref="GeneID:2893860"
     mRNA            <947393..>948907
                     /locus_tag="KLLA0_E10715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454434.1"
                     /db_xref="GeneID:2893860"
     CDS             947393..948907
                     /locus_tag="KLLA0_E10715g"
                     /note="some similarities with uniprot|P53189 Saccharomyces
                     cerevisiae YGL028C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454434.1"
                     /db_xref="GeneID:2893860"
                     /db_xref="GOA:Q6CNQ5"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ5"
                     /translation="MTELKFQIRSLLVLATLLTYVFAAPLNHLHKKREIVTRVHTASQ
                     TNTVTDFYSTTTQIVLAPTVEFIISGSVTITTTLPLADGSVPTESPSVTITSVFNDRG
                     AAAVAVPTHPAAVAGEADPKVSTIVNDGTSTLAPITASTQSQNNDNGAASATTTTSGV
                     SVTSGSDNNNNDNTSNSGSSNESSDNDNNGNTSSSTENGNAGNADTSSSTSSSTSSST
                     STTKDSSTSTSSGSTTTAGSGTGVPNTIVYSPYNDDSSCKSADSVYSDLQTIKAKGIY
                     KIRIYGTDCNSLQTVQPAAVKLGMTINQGFWIGSSGVSSIDTAVSDVISYGQSNGWDV
                     FDFITIGNEAIISGYCSVEDLIGKISSVKAQLKSAGYGGLVTTSEPPVIFETYPSLCT
                     SSEIDFVGINSHAYFDPNSQASTAGSFVKNQLQIVKDVCGTDNVRVTETGYPSKGVQN
                     GGNIPSKANQIIAVNGILEELNGDVTILSTFNDYWKDPGTYGVEQSFGVIDFLS"
     gene            complement(<949228..>950184)
                     /locus_tag="KLLA0_E10737g"
                     /db_xref="GeneID:2893797"
     mRNA            complement(<949228..>950184)
                     /locus_tag="KLLA0_E10737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454435.1"
                     /db_xref="GeneID:2893797"
     CDS             complement(949228..950184)
                     /locus_tag="KLLA0_E10737g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454435.1"
                     /db_xref="GeneID:2893797"
                     /db_xref="GOA:Q6CNQ4"
                     /db_xref="InterPro:IPR007828"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ4"
                     /translation="MSKDLGEIIHSDKGHLLELIDEDVQSINVIKTKLREQSKDPVPS
                     KKRKMNDSTSVLDGINEEDFRQYNQAKDRVREFYKEQHEKQTMAYNLQARINFKTKVR
                     ARMTVWDALCQLSKLIDESDPDTELSQIDHALQTAEAIRNDGKPRWMQLVGLIHDLGK
                     ILYFFESEGQWDVVGDTFPIGCGFVKENIFPEFFQGNPDNSHPIYSTKLGIYEENSGL
                     KSVMISWGHDEYMYYIAKNQSTLNEKALAMIRYHSFYPWHREGAYRYLMSESDYEILE
                     AVQDFNQYDLYSKGLQKHNRDELKPYYLELIDEFFPQKLVEF"
     gene            950420..950492
                     /locus_tag="KLLA0_E10759r"
                     /db_xref="GeneID:9487421"
     tRNA            950420..950492
                     /locus_tag="KLLA0_E10759r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:9487421"
     gene            complement(<950629..>950994)
                     /locus_tag="KLLA0_E10781g"
                     /db_xref="GeneID:2893657"
     mRNA            complement(<950629..>950994)
                     /locus_tag="KLLA0_E10781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454436.1"
                     /db_xref="GeneID:2893657"
     CDS             complement(950629..950994)
                     /locus_tag="KLLA0_E10781g"
                     /note="similar to uniprot|P53188 Saccharomyces cerevisiae
                     YGL029W CGR1 Coiled-coil protein that may contribute to
                     compartmentalization of nucleolar constituents expression
                     is growth-regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454436.1"
                     /db_xref="GeneID:2893657"
                     /db_xref="GOA:Q6CNQ3"
                     /db_xref="InterPro:IPR005579"
                     /translation="MSDNTAEQQDIQIKGKPVSGRTWKVEKEPLRAKNRVVKNKKLTS
                     WELKKQKRLEDQQFKEKVRALKEEKKAEKDAVIQALKERRAKKEEQERYDRLAAKMHA
                     KKVDRLRRREKRNKALKER"
     gene            <951335..>953896
                     /locus_tag="KLLA0_E10803g"
                     /db_xref="GeneID:2893680"
     mRNA            <951335..>953896
                     /locus_tag="KLLA0_E10803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454437.1"
                     /db_xref="GeneID:2893680"
     CDS             951335..953896
                     /locus_tag="KLLA0_E10803g"
                     /note="similar to uniprot|P48237 Saccharomyces cerevisiae
                     YGR150C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454437.1"
                     /db_xref="GeneID:2893680"
                     /db_xref="GOA:Q6CNQ2"
                     /db_xref="InterPro:IPR002885"
                     /translation="MLSLGKNGKTSSTLVRNARRSVIMPASRDVRSRKRRARSVTDTK
                     DVLDLDSIDFTNEKEVQFKVNQLKEFTRNLREQIKYTDELKRKHVIEEEETKSVDPEM
                     HDFDSDAGVILSSLNDKVAGPGAEQNLSTLLLSDKADTSLLPERLSERIKDKDLILRC
                     LFDKRNRDFNPIVTELYHSEQRLKGLGIQFIYSKILSKFDKLSFTSLSQLDEMIMESV
                     GNDSSRLNGNLYEHLMLSFSRVTSPSAQGKLEVCGKLRELTERMDATLSKKSFQPTQY
                     MLNACIFAASKAMSWEYMDFFLKKFTSTYDMQPNRKNYTTVISFYTKMEHYKKAWQLF
                     DSLKFLSLEHKPDTKVYNLMLEVCQKEKNYARSLDIFQEMDDLNVTKDLKTYLNAAKS
                     LALSSADNVTSEGKADSLRLMSWKYIHKIHDDPKLSKQLTENPRNNMLLLETMMVLSA
                     YDGDVGFARALYYKYTNALFKAHFYEFKKYHKDTDPVDYIRIWKKSLSAQMFNWLMLS
                     YSKFKKSRLPVLLGYPEGSSLRRSMIYSVDYSGRDSSYENSNIQLPMLPMTELNDAEL
                     TINESKALWRFNLEFGGNYDIRELPEGMQTVKDIENIVKCAKTVNEFKLQISQRLLEW
                     KNRYVNHKILNMKSLITFLTIPIRLHEPNEFKLRLQEFTFQAFEFNERVEYQFKKSKT
                     NELESPVLSKDFNTTDSNALVDNGIIPSEFLLYLVSMKHKLATNCAIYEVSMKAAIAF
                     HDYELAMTTWKNRGKFRMTDAFQKLTPGERQQSDATFAQLMVEYFTNEKMYQDALSII
                     LSSLKTVNWQYSMVKSLHRALLAIEDENSAARLLSVVNRKSKIVELEEEIKSLDL"
     gene            complement(<954084..>955310)
                     /locus_tag="KLLA0_E10825g"
                     /db_xref="GeneID:2893757"
     mRNA            complement(<954084..>955310)
                     /locus_tag="KLLA0_E10825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454438.1"
                     /db_xref="GeneID:2893757"
     CDS             complement(954084..955310)
                     /locus_tag="KLLA0_E10825g"
                     /note="similar to uniprot|P48236 Saccharomyces cerevisiae
                     YGR149W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454438.1"
                     /db_xref="GeneID:2893757"
                     /db_xref="InterPro:IPR021261"
                     /db_xref="UniProtKB/TrEMBL:Q6CNQ1"
                     /translation="MTDQQSFRTRLATFIEFLDPIASTVQSYSQPSKQFIKQKLTNGK
                     QKLQFRDQEISPQLANFKQKTLKKLKTIDKPLQSIFFQNSSTLEKSFYPFTLFNIFLI
                     GFLIGRYPQYFHIYYTAMLCLLMPVRFYTYYKTNNHYFLADLCYFVNAMCLLFIWVLP
                     SSTHLYQSCFAFTFGTLSFAIITWRNSLVIHSVDKITSCFIHIMPPLTLYCITHAITE
                     QFKLQRFPAAAMKNSKSWNLKTNVFYTSIYYLIWQSLYHYFITLRKKQKIKSGQRMTS
                     FEYLTSHQYKNSWVVKLPPPQPMILYTLFQYCYQLVTMILCVIWLNNSIAAAGFLIFI
                     FLHAAKNGASYYVDYYGKKFEKEVDKLRIQVETLEKQLSNKGSSSSVALDESDSASIA
                     SNQSDELTWEMKIPTT"
     gene            complement(<955703..>956256)
                     /locus_tag="KLLA0_E10847g"
                     /db_xref="GeneID:2894002"
     mRNA            complement(join(<955703..956017,956254..>956256))
                     /locus_tag="KLLA0_E10847g"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_454439.1"
                     /db_xref="GeneID:2894002"
     CDS             complement(join(955703..956017,956254..956256))
                     /locus_tag="KLLA0_E10847g"
                     /note="highly similar to uniprot|P14120 Saccharomyces
                     cerevisiae YGL030W RPL30 Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_454439.1"
                     /db_xref="GeneID:2894002"
                     /db_xref="GOA:P38664"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /translation="MAPAKNQENINQKLALVVKSGKYSLGYKSTVKSLRQGKAKLIII
                     AANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILT
                     ALA"
     gene            <957487..>957954
                     /locus_tag="KLLA0_E10869g"
                     /db_xref="GeneID:2894273"
     mRNA            <957487..>957954
                     /locus_tag="KLLA0_E10869g"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_454440.1"
                     /db_xref="GeneID:2894273"
     CDS             957487..957954
                     /locus_tag="KLLA0_E10869g"
                     /note="similar to uniprot|P04449 Saccharomyces cerevisiae
                     YGL031C RPL24A and to uniprot|P24000 Saccharomyces
                     cerevisiae YGR148C RPL24B"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_454440.1"
                     /db_xref="GeneID:2894273"
                     /db_xref="GOA:P38665"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /translation="MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRK
                     NPRRIAWTVLYRRHHKKGITEEVARKRTRKSVKAQRAVVGASLELIKERRSLKPEVRK
                     AQRDEKKKADKEKKKADKAARKSEKAKLAAAQGSKVSKQQAKGAFQKVAATSR"
     gene            <958672..>958944
                     /locus_tag="KLLA0_E10891g"
                     /db_xref="GeneID:9487443"
     mRNA            <958672..>958944
                     /locus_tag="KLLA0_E10891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999355.1"
                     /db_xref="GeneID:9487443"
     CDS             958672..958944
                     /locus_tag="KLLA0_E10891g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999401.1"
                     /db_xref="GeneID:9487443"
                     /db_xref="InterPro:IPR014404"
                     /db_xref="UniProtKB/TrEMBL:B4UN68"
                     /translation="MHSPTLYISLAILTLSIFVNTQSVSTYFSTSCETIPEPFLETTP
                     ISTRTRTMTSNGETFIGITEVYQSITYVSDCVTDDYDEYTSTLVIW"
     gene            <959536..>960201
                     /locus_tag="KLLA0_E10913g"
                     /db_xref="GeneID:2894028"
     mRNA            <959536..>960201
                     /locus_tag="KLLA0_E10913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454441.1"
                     /db_xref="GeneID:2894028"
     CDS             959536..960201
                     /locus_tag="KLLA0_E10913g"
                     /note="similar to gnl|GLV|CAGL0E03003g Candida glabrata
                     CAGL0E03003g and weakly similar to YGR147C uniprot|P37293
                     Saccharomyces cerevisiae YGR147C NAT2 N
                     alpha-acetyl-transferase transfers acetyl group from
                     acetyl coenzyme A to the N-terminal methionine residues of
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454441.1"
                     /db_xref="GeneID:2894028"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP8"
                     /translation="MFKFTTRIGLKTGPKYGFNPIIRRAYAQNLKGKATVKEPTGLKK
                     LIKQYGWSALGVYLGLSCIDLPICFLAVHSLGEETIKVYINRVKQLANYGKDEQELRN
                     EIREKQNREELDRQSGAQDKSVWENFKESTLLTEILIAYGIHKSLIFIRVPITAAITP
                     SVVKVLRRFGFSADKFNKGFKTMADGAKIRNKTGKPDDFIKNGSVPKSEFSKGKKWFN
                     GMM"
     gene            complement(<960404..>961330)
                     /locus_tag="KLLA0_E10935g"
                     /db_xref="GeneID:2894029"
     mRNA            complement(<960404..>961330)
                     /locus_tag="KLLA0_E10935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454442.1"
                     /db_xref="GeneID:2894029"
     CDS             complement(960404..961330)
                     /locus_tag="KLLA0_E10935g"
                     /note="similar to uniprot|P78609 Pichia jadinii Uricase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454442.1"
                     /db_xref="GeneID:2894029"
                     /db_xref="GOA:Q6CNP7"
                     /db_xref="InterPro:IPR002042"
                     /db_xref="InterPro:IPR019842"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP7"
                     /translation="MSTYSYLADSTYGKDNVKFLKVKKSKTDPKVHEVMECNVQVLLK
                     GDFEVSYTEADNTPIVPTDTVKNTILVHARKFDTWPIEKFAANLALHFTGKYAHVSGI
                     TVKIIQDRWIKYDVDNKESYHSFIHQGPEKKICFLDYDKKNGSSSYTLVTSIKDLTVL
                     KSTGSMFYGYNVCEYTTLKPTTDRILSTDIFASLTWNSAKLGSLETLEAGKKDDIFNQ
                     YYASARDITLDIFAKENSPSVQATMYNMATAILKVAPEVEHVSYELPNKHYILFDLKW
                     FKGLDNNNELFYPSPDPNGLIKCTVGRNQAKL"
     gene            complement(<964114..>965010)
                     /locus_tag="KLLA0_E11001g"
                     /db_xref="GeneID:2894537"
     mRNA            complement(<964114..>965010)
                     /locus_tag="KLLA0_E11001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454445.1"
                     /db_xref="GeneID:2894537"
     CDS             complement(964114..965010)
                     /locus_tag="KLLA0_E11001g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454445.1"
                     /db_xref="GeneID:2894537"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP4"
                     /translation="MRFGGIFVLGAFSLASAAVAQDIVIPPYVSRTNPDFTGSLITTA
                     SSLQGTVVIVTTSNNEVVTLSVSGSPYTPPSTTSTSTSSSTSPSTSTSTSTFTSTSTT
                     PSTTTTPTSTPITTSTLSPTSTPTSTSTTGRDTPSTTPLDSHTVTSTITTTRREPTAT
                     SYTPSSIIDTVINGHVYITTTLQIPASVETQAVNTLFSTVQSVQRPSTTTHFVESTEF
                     NTVVAQHSSTSVNRVAVDTRYESVLLFTTDSWTTTSQKLHTSVQYKESTITSSKTNVV
                     TGTIRIEDVITTLTNTLTPPIP"
     gene            <966805..>968229
                     /locus_tag="KLLA0_E11023g"
                     /db_xref="GeneID:2894281"
     mRNA            <966805..>968229
                     /locus_tag="KLLA0_E11023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454446.1"
                     /db_xref="GeneID:2894281"
     CDS             966805..968229
                     /locus_tag="KLLA0_E11023g"
                     /note="uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
                     protein MIG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454446.1"
                     /db_xref="GeneID:2894281"
                     /db_xref="GOA:P50898"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /translation="MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRH
                     IRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKEL
                     ELQRQKQRNANDSAAVDSAGGTSANVIEPNHKLLKSTNSIKQDGSTFTEPLKSLRSKP
                     MFDLGSDESDECGIYSVPPIRSQNNSGNIDLLLNAAKFESDKASSSFKFIDKLPLTSS
                     SSSPSLSFTSHSINNSSSGLLLPRPASRAKLSALSSLQRMTPLSQNSESYNHSQQNLV
                     HLHHPAPNRPLTEFVDNEYISNGLPRTRSWTNLSEQQSPSGFSSSALNSRFSSSNSLN
                     QLIDQHSRNSSTVSISTLLKQETVISQDEDMSTEDAYGRPLKKSKAIMPIMRPSSTMP
                     PSSGSATEGEFYDELHSRLRSMDQLPVRNSKDEKDYYFQSHFSSLLCTPTHSPPPEGL
                     LPSLNQNKPVQLPSLRSLDLLPPK"
     gene            <968674..>969972
                     /locus_tag="KLLA0_E11045g"
                     /db_xref="GeneID:2894484"
     mRNA            <968674..>969972
                     /locus_tag="KLLA0_E11045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454447.1"
                     /db_xref="GeneID:2894484"
     CDS             968674..969972
                     /locus_tag="KLLA0_E11045g"
                     /note="similar to uniprot|P49960 Saccharomyces cerevisiae
                     YMR268C PRP24 Splicing factor that reanneals U4 and U6
                     snRNPs during spliceosome recycling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454447.1"
                     /db_xref="GeneID:2894484"
                     /db_xref="GOA:Q6CNP2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR008669"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP2"
                     /translation="MNAENNKRRPEDENVSVEEAATLKKVKNLHTHNREYTTVLVKNL
                     PPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSKLARIEFSSYDQALTAVSRTLKKIGF
                     HQITVEQLTDSTIWVTNFPPGYDASKLRNLLSQYIDSPILSIRLPSLAFNSRRRFAYV
                     DLVSPEVAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPDDI
                     TIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNALSLNGAVMNG
                     KPLHVSKVMRKAYLERQEVKRLLASRKENPKVVGIYPLSDQITPDQILAFITEKAQIR
                     PPDITKVLLVSDHEGALIIADKEAITAKVSLAINGYKFKNRILKCVSAHELSLHYPNE
                     HKTTLNQPKHAVVKEIKSQQASQNDKKLSNDDFRKLFLSK"
     gene            complement(<969999..>974819)
                     /locus_tag="KLLA0_E11067g"
                     /db_xref="GeneID:2894739"
     mRNA            complement(<969999..>974819)
                     /locus_tag="KLLA0_E11067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454448.1"
                     /db_xref="GeneID:2894739"
     CDS             complement(969999..974819)
                     /locus_tag="KLLA0_E11067g"
                     /note="similar to uniprot|P52593 Saccharomyces cerevisiae
                     YML103C NUP188 Subunit of the nuclear pore complex (NPC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454448.1"
                     /db_xref="GeneID:2894739"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP1"
                     /translation="MSSLSFAGICAFLRSGEYDKVHNEPTFQAIDKFLKDNEEILVHL
                     SRFTSVENTDSVGKQLQLRGYSYNVTVEDEKLANELSIALNVHQKECLRVISQTRTRF
                     PDCPMEKDTIVKQILHERNCVLDTTLVLLNHDSFPVLKGSMLQLVYKNRSTMISEAIL
                     LVKNCVALIGSAEQNDSYKSSLMSYDLIYITNLLNLIAFVSLNQPVGLEIITKWYELL
                     EETQYFAILKDNKDVPSEIYNMANSLMIMDTIIMTGYNTSEDTIDVKSSFFNDAATFR
                     RLLDLIINTDPPAIIVYYWSFILYSKSYLLEEDPENNLEFVQQVFNSQPISKLIKEFA
                     LTAENENVFEEISKVSQIFKDQAFFAAILTSFITFSLYFVPISIKTSKMIKTVLSNAP
                     THYVEKFLTNKEFEKKFFLIKTKAPLLKESLIPMINITSANAEFANFEWKELPTYVQE
                     VVLGSLEYDLADDAHSTDLISIKSETFARVPLEPSGNVLLPIPKDTKAKILPSVTNDD
                     VVMFLYKYNGWSLLGRVLQNACDRYLSTSSAGVQDSDVQEMILSMLDLISSVIGSGIS
                     VEKSADILLQMSTYLTEDYIFDVIFKVFEQSLHLRDYDVIDHCLNLLISSIDDFSQFV
                     WSHLARSELLDRYGKSGLISSVLGTMELPNGNYSITIKIIKLAQQLVLESLTLETEFP
                     ENLKKEILSKFFQHFIHVYESYQYWNYRSIAEKYELGTNLTILFTTVVYNIYGIDPSN
                     PPETKITKVLSSAANDITNRFLSSDSPDVRTVTSILHVLLSSNSLEALSIGNEVFYNK
                     YNQCLLKSYELANLLISVRAMLQLPPSTLESQIYGNLPKLIDIYALHNDLRNPIIKLM
                     THLVRAPWAENFPSLLSYLGQKHSKMIFNSILYDLASTIDDYQFLKSLYRFFSSVMEG
                     KQDGFSILLVTGETISVGSSPKKSEPSNSASETSILSLLKKNVLKLDCYPESVASRLL
                     EAISYAFNSWAAARNNTADKEFIDFLVKRLEKFEDKLAPDSVEATIKLSSHYRLQARI
                     AEIFALHLFTSSPSDSTITNMLNGPQLVDIVKRIFSIDGYDKTLHLTLAEEFKKIWPH
                     LDIEKFAISPLYRIGKAYQANIYDIELLDQFFCCEEKWRGNGSTPGFREQVIKSSINL
                     QYVSFQISAAKSWGALLTAFIKKTPKPLQASYVDIVTQLLALNVEHGVEAPIFSEIYL
                     LRIELVFYILYSFLQTSMKIPEDKLETLLSQLLAILKSKEVDYLGNIAQSNKNNQYRP
                     ILRSILMLLTLAKPYPMFSERYSDSLLEVFELAFSKGVNLILSSILFSFTIASNKGKK
                     VIVPNLADKIQDLLLLLSLFTKIKELNPSTSFNAVLASSLNEFGTLKSLLNLYYSSYL
                     FRSHDEPLFAELTLSFISELVTIEEVAQKIIDNGLFSVFLESPISVSIQQSGARPELS
                     PRLHNIWSNGIISIILQLLSKFGSGILSEVCLFVSYFSKQIDLAVGGWSSDSLSITQA
                     YIQETSQIILLQKMLDKLEYQRYLSVNGSKLKVIDEEEIIELFPGLDTSSERNDLANV
                     LKHLLTHPKYMNSRIIATTPDKQKMMEDEVYRNQLLHSITKQISELQSSLMSDL"
     gene            complement(<975074..>975967)
                     /locus_tag="KLLA0_E11089g"
                     /db_xref="GeneID:2894740"
     mRNA            complement(<975074..>975967)
                     /locus_tag="KLLA0_E11089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454449.1"
                     /db_xref="GeneID:2894740"
     CDS             complement(975074..975967)
                     /locus_tag="KLLA0_E11089g"
                     /note="similar to uniprot|P28239 Saccharomyces cerevisiae
                     YMR267W PPA2 Mitochondrial inorganic pyrophosphatase
                     required for mitochondrial function and possibly involved
                     in energy generation from inorganic pyrophosphate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454449.1"
                     /db_xref="GeneID:2894740"
                     /db_xref="GOA:Q6CNP0"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:Q6CNP0"
                     /translation="MSRDMRRASQHLRLIGNHLHARNYHNVLVGSKYSSSFKQYLQLP
                     NGEIGSYFHDVPLDLDVDAKTCNMIVEVPRWSNGKFEISKTEPFNPITQDIKKGKPRF
                     VNNIFPYHGYIHNYGAIPQTWEQPLIEVLPGFKGDNDPLDCCEIGSSIAKMGDIKKVK
                     LLGSLALIDDGELDWKVICIDIEDPIAIKLNKLADVDTVMPGLLDATRTWFRDYKIPA
                     GKQPNVFAFEGEYQDQASTLSTVQECHEAWNALVRGEIKADGSEAEIPSIVRAGTHIR
                     VEPNQQNDTPIPQEVDKWYYV"
     gene            complement(<976184..>978910)
                     /locus_tag="KLLA0_E11111g"
                     /db_xref="GeneID:2894693"
     mRNA            complement(<976184..>978910)
                     /locus_tag="KLLA0_E11111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454450.1"
                     /db_xref="GeneID:2894693"
     CDS             complement(976184..978910)
                     /locus_tag="KLLA0_E11111g"
                     /note="similar to uniprot|Q03516 Saccharomyces cerevisiae
                     YMR266W RSN1 Overexpression rescues sro7/sop1 in NaCl.
                     Encodes a membrane protein."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454450.1"
                     /db_xref="GeneID:2894693"
                     /db_xref="GOA:Q6CNN9"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN9"
                     /translation="MASSDDDDTRNTSTSQVVTSLVFNIVVFAVFFISFILLRLKIKR
                     IYQPKSSFDLINDEKKPQPLPSGIWQWIVPLLKKSDNFIIQQAGLDGYFFIRYLFIIS
                     AYCGFSMLYMFPVLLPINAVNGVAKKGFDMLAYSNVTEKGRYYGHVFCGWIFYWGFLF
                     VIYRELTLYNSLRHSILASPRYAKKLSSRTVLFQSVPDQYLSETEFAKLFEHTKNIWI
                     ARSAKQLSKLVKERDALALKLEAAETSYLKMAVKAISKEKKKKGGADPSKIANDITQY
                     VPEKKRPSHRLKPVIGKKVDTINYAKEKLPELNAKIQELQNKHMEEKPMNSVFVEFNT
                     QYDAQKAVQMVSHHSPLSLTPAYVGISPTDVQWFNLRMFWLERLVRKFGSIAAIVALV
                     ILWAFPVAFVGMVSNITYLTNKLPWLKFIYNMPDQLLGIITSLAPTIALAVLMMLLPI
                     FIRKMALIAGAPSYQHVEYFTQQAYFAFQVIQVFLVTTLASSATSTVTAIVEEPTSAM
                     NLLAENLPKSSNFYVGYIILQGLSISSGALLQIVPLILFFVLGMFLDSTARKKYARFT
                     SLSSMAWGTTFPVYTNLAVITFSYAIISPLILLFACVAFFLLYVAYLYNLTYVFQESP
                     DSRGIHYPRALFQTMVGLYLGQICLLGLFVVGKGWGPIVLQAICLGVTVFVHLNFNSA
                     FDHLMAFEPVDTMKALDGKSNTPSYIRDFVEPEKDEIKELPPFQIKKYHPRSSSQFDQ
                     RTTSILSDNTYEIQTGVFDTDNENTLNTVPLLADGDMTPVPPAPFWKRFLLPHIYYSY
                     KAVKTRLPEIYNLPDPTEITDEKEIKHAYDFPTVSAKCPFLWIPRDPYGFSTVQIADL
                     AGVVEISDEGARFTESGSIEWETAPPSYNDSQMQVVSNPFDEQDEDNLQREE"
     gene            <979660..>981042
                     /locus_tag="KLLA0_E11133g"
                     /db_xref="GeneID:2893764"
     mRNA            <979660..>981042
                     /locus_tag="KLLA0_E11133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454451.1"
                     /db_xref="GeneID:2893764"
     CDS             979660..981042
                     /locus_tag="KLLA0_E11133g"
                     /note="some similarities with uniprot|Q03508 Saccharomyces
                     cerevisiae YMR265C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454451.1"
                     /db_xref="GeneID:2893764"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN8"
                     /translation="MQGANWKEHEVLQRWSSVKLAQFPQCKNSEVTKIHIYDFDQTLF
                     VSPLPNPVLYPPSTINHLRYPNSLANGGWFMNSDILEYSVLCRKGKDSGKWNLTVAEL
                     VSMSIADENTLCILLTGRSEAQFTRVIEEAMKQFQEDFELSRGFDAVCLKKEQMTTAS
                     YKTSLIVSLLDFYSNVNQISIYDDRERHCKMFREFLKNYAETVRPALIPSVVIVPAIF
                     YYLPSDVEIELVHNMVADSNKIVQSINERKKHQKHQKKKSFNKSGVSNGNFNIFHLHN
                     SAMHSSYALDVETTIRLQEKAIHFLKSFEDLDADAIPESLDWFLYPYIPISLHESVAK
                     VSVNDIAELLHEDGNVRDANSLASNIQKGHQYHQRSWQIKDFVYVAHGNVIGFRVEPA
                     DTVSEVPASSYYTYLLLAGPKSISFYTSQEMHNLRNAFHHYFVIDSKDQEVFTTYLGV
                     YHNFRLKSAR"
     gene            <981392..>982696
                     /locus_tag="KLLA0_E11155g"
                     /db_xref="GeneID:2893721"
     mRNA            <981392..>982696
                     /locus_tag="KLLA0_E11155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454452.1"
                     /db_xref="GeneID:2893721"
     CDS             981392..982696
                     /locus_tag="KLLA0_E11155g"
                     /note="some similarities with uniprot|Q03508 Saccharomyces
                     cerevisiae YMR265C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454452.1"
                     /db_xref="GeneID:2893721"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN7"
                     /translation="MEHSVLFEWNSVDSALHVPALPRGGIHKICIYDFDNTLFKSPAP
                     NPHLYSAELYSSLLSPHVFSNGGWWSEPRFLEILVDEWIKGSVDDSAFWNKDIVDSAR
                     RSWDDRDNGTLTILMTGRKQLLFSPLFEKLLKHPVFGRELLFHSAFLKRAGYPTTMKY
                     KIACLRSVMDFYKEVNEIVIYDDRKQQLEGFELFFEDYKRETSRNFNHTLIAVKPVIN
                     YLPPGKEIGTVAKIFNEHNKDVRSKLEGLEMVHGPICSLGFQMDNLTLDEDSNTVRYL
                     LDCRETHKIRQLVTQMSQDTNQAYPFSLPIIVPLGSLPGSQVEMFQNHNSVTPEASTE
                     DFRKLIGDATCFCPNKVIDWSIREAISLESSRLAFSVGSTQQPGTHILFTSDYSDEDM
                     QSVMDHINNRGSLAEINHSLPSFSAIAIPKYHYLAKTACDVE"
     gene            <983669..>985150
                     /locus_tag="KLLA0_E11177g"
                     /db_xref="GeneID:2893772"
     mRNA            <983669..>985150
                     /locus_tag="KLLA0_E11177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454453.1"
                     /db_xref="GeneID:2893772"
     CDS             983669..985150
                     /locus_tag="KLLA0_E11177g"
                     /note="similar to uniprot|Q04199 Saccharomyces cerevisiae
                     YML102W CAC2 Component of the chromatin assembly complex
                     (with Rlf2p and Msi1p) that assembles newly synthesized
                     histones onto recently replicated DNA required for
                     building functional kinetochores conserved from yeast to
                     humans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454453.1"
                     /db_xref="GeneID:2893772"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN6"
                     /translation="MVQSESLQIYWHDSHPIYSLCFQPLSETNQNTRRLFTSGGDNKI
                     RVWQLNESENDGKIETIDFLSSLTQHEQAVNVCRFNKQGDTLATAGDDGLLLLWKKNE
                     TMVKEFGVDDDEFQDFKESWAVWKRLRSGSASNAEIYDISWNPQGTCIAIASLDNTVR
                     VFNVDQGKVVGHITEHNHYVQGIVWDPQGEFIVSQSADRSLAICKMIYEDNEVKGLQL
                     VNKILKSELPRRKNPGEKELDFDKSKVTFLFHNETLPSFFRRLSMSPCGSLLCVPAGV
                     FRNDEQTDASNNNPEYANAVYIYTRASLTSNSNKPVFSLPFLQKPALVVKFNPIMYET
                     ASEWVKAPYTLVFAVATTNEVLVYDTQNTSPIAIAGNLHYTPITDLAWSQDGTLLMIS
                     STDGFCSYIHFTDNDFGTPLKDQSIPILTKELESQSQSQSQPESSQKASIVNLSTGAA
                     ETPNPSPAKRSISQLVSEAATTVGKEKLKRRVQPTLVTSDQPK"
     gene            complement(<985522..>986178)
                     /locus_tag="KLLA0_E11199g"
                     /db_xref="GeneID:2893773"
     mRNA            complement(<985522..>986178)
                     /locus_tag="KLLA0_E11199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454454.1"
                     /db_xref="GeneID:2893773"
     CDS             complement(985522..986178)
                     /locus_tag="KLLA0_E11199g"
                     /note="similar to uniprot|P38428 Saccharomyces cerevisiae
                     YMR264W CUE1 Endoplasmic reticulum membrane protein that
                     recruits the ubiquitin-conjugating enzyme Ubc7p to the ER
                     where it functions in protein degradation contains a CUE
                     domain that binds ubiquitin to facilitate intramolecular
                     monoubiquitination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454454.1"
                     /db_xref="GeneID:2893773"
                     /db_xref="GOA:Q6CNN5"
                     /db_xref="InterPro:IPR003892"
                     /translation="MADQSFTLFIILAIAGYIAVKWFLSNNEQHPSIQINGFSSQSDS
                     ATASGTAASSNAASRQTRRRIRRRVNDDMIEVVQSLAPHLHPEQIRYDLEQTGSVETT
                     VERYLSGRDMPFPPDYVPESETGGNSSNGQNQSTGSSVTTGNNTNNNSTSTDPRKRSN
                     IKADNLLKKFNVDPQEDLSNLNPNDLSIEERKRLMVWQARKSMELKVENSEYLQSLLK
                     "
     gene            complement(<986623..>987123)
                     /locus_tag="KLLA0_E11221g"
                     /db_xref="GeneID:2893898"
     mRNA            complement(<986623..>987123)
                     /locus_tag="KLLA0_E11221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454455.1"
                     /db_xref="GeneID:2893898"
     CDS             complement(986623..987123)
                     /locus_tag="KLLA0_E11221g"
                     /note="similar to uniprot|P38429 Saccharomyces cerevisiae
                     YMR263W SAP30 Subunit of a histone deacetylase complex
                     along with Rpd3p and Sin3p that is involved in silencing
                     at telomeres rDNA and silent mating-type loci"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454455.1"
                     /db_xref="GeneID:2893898"
                     /db_xref="InterPro:IPR024145"
                     /db_xref="InterPro:IPR025718"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN4"
                     /translation="MAPRGHNNSNSESESKGKSSNNATSGASTRTSVKQRLSSAQQQY
                     LKDLNKKHIHNNHPKNEPLPNPMDFEQYSDEFLRRYKDRFQLKSPDNLSIQGYLLGSR
                     IGKHTYSAKRNQKNVPDARVTKQELAKGVREHFDNYTVREAECLPQFIYKVQNQKKKF
                     RMEFKG"
     gene            complement(<987351..>988325)
                     /locus_tag="KLLA0_E11243g"
                     /db_xref="GeneID:2893831"
     mRNA            complement(<987351..>988325)
                     /locus_tag="KLLA0_E11243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454456.1"
                     /db_xref="GeneID:2893831"
     CDS             complement(987351..988325)
                     /locus_tag="KLLA0_E11243g"
                     /note="similar to uniprot|P38430 Saccharomyces cerevisiae
                     YMR262W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454456.1"
                     /db_xref="GeneID:2893831"
                     /db_xref="GOA:Q6CNN3"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN3"
                     /translation="MVPCLVDAHCHVSTMVDAVGCDKIRSNLDLALAGTASDVQRCVM
                     STNVYDWELLEPLLLMKQLDDEGPGINVSLGVHPWYCHLYQLDRSLSKVGHYRNCLKC
                     KDEVQLMELVEQLPDPVDLSSYLSDERVSRVGCIGEIGLDKVFRLPQNGFLVSNNGTS
                     LERSSLSNVRVEFAHQIQVFETLLKVAKGRGLPVSIHSVKCQGTTFDICKRILLDSEV
                     NICLHSFTGTLDTVRLWLANFPHERLFFSVSCWINLKDWDSGAELLKSLPLQCILTET
                     DCSVDSVSSQEQRQMLDSVLDAISRAHGISRTKAMDTVLQNFNRFLRK"
     gene            <988846..>992292
                     /locus_tag="KLLA0_E11265g"
                     /db_xref="GeneID:2893704"
     mRNA            <988846..>992292
                     /locus_tag="KLLA0_E11265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454457.1"
                     /db_xref="GeneID:2893704"
     CDS             988846..992292
                     /locus_tag="KLLA0_E11265g"
                     /note="similar to uniprot|P38426 Saccharomyces cerevisiae
                     YMR261C TPS3 115 kD regulatory subunit of
                     trehalose-6-phosphate synthase/phosphatase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454457.1"
                     /db_xref="GeneID:2893704"
                     /db_xref="GOA:Q6CNN2"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN2"
                     /translation="MVVIIASLFLPFQPQFEIHSSSVETASLVDQPVKIRNAGSGVKS
                     SANSLYSGNPFDLGTSLTRKRSSSSHSRSSFAPLDLTMSAASGGDGMESSPAPSGEFS
                     NQHRLDEVTKPVGANPQISSESFMESLTGKAHSAAASSSKNALSNYPTGSVEEFFSSG
                     NTQLGKNYDNNTGSPDSTYSIQSSPVISAVNPTHDSTSNLLKNVNKSLLYQIVLNESN
                     SASALEGTSKHFWNSPGSTVITPRSRALPDVNSSLSGVAKGKGHLHIKSQAPAIRHVH
                     PAAQGPGNVTGTTGGGGGGSSKLKYSVNANHDEDSQEEKYEQSEQEEGEEENDENENV
                     VDDEDEDMYDIEELDSSGRYHYNVPKFGGYSNKAKLKNALLKKSENIFSTAPWTIVPC
                     AKGNGGLKNAVATALLEKTIDEQVTWVGTVGIPTDCIPEKTLDNICHELYTNYHSRAV
                     ISDDLTFKGAYKNFCKQILWPTLHYQIPDNPNSKAFEDHSWNYYQHLNQLFANEIVKT
                     YKEGDIVWVNDYHLMLVPEMVREKLPDAKIGFFLHISFPSSEVFRCFPQREKILNGIL
                     GANSVGFQTDEYARHFMQTATRLLMTDADDHQLKLQGRVVKVNNTPIGVDVFNLDEQI
                     DTEQVIQWRKLIRERWSDKRLIVCRDQFDRIRGLKKKMLAYERFLKENPEYVDKVVMI
                     QICLDTARDIDLERDIMSVVDRINALSKDISISQPVVFLHQDLEFSQYLALNCEADLF
                     IVSSMREGMNLTCHEFVVCSRERNAPLLLSEFTGSTQILKSGALLINPWDIKKFARAI
                     KIGLEMPPDEKRRRWKKMFKSVINHDSDNWIVHALNNIDSSWEFNHERSQVFNLSFKQ
                     MYAAYSQAKRHMFVLKISEPPTPRMLRILSELSANNIVYLMNSNSRGVLERLYSRVSN
                     VGLIAENGAYVRLNGNWFNIVEDVSWKDDVIKVFEDKMERLPGSYCKIGDSMVRFHTE
                     NAEDRDRVQGVIGEAMTHINTLFSDKGIHAYVNKNIVFVQEVGLALKTLQFLVSYYNS
                     VDDISCSSHSPVAQPTSAETSASPLLSPISPKNGAGFFHVAAKRENRDPIGFLTITGS
                     TSPVIEPLFQYVNELTKEGKLQYGYSVVHGDTSSTYAKEHIQGLNELFSMLQKLSSPN
                     SS"
     gene            <992638..>993105
                     /locus_tag="KLLA0_E11287g"
                     /db_xref="GeneID:2894696"
     mRNA            <992638..>993105
                     /locus_tag="KLLA0_E11287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454458.1"
                     /db_xref="GeneID:2894696"
     CDS             992638..993105
                     /locus_tag="KLLA0_E11287g"
                     /note="highly similar to uniprot|P38912 Saccharomyces
                     cerevisiae YMR260C TIF11 Translation initiation factor
                     eIF1A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454458.1"
                     /db_xref="GeneID:2894696"
                     /db_xref="GOA:Q6CNN1"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CNN1"
                     /translation="MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGN
                     GRVEASCFDDVKRMAHIRGKLRKRVWMSQGDIILVSLRDFQDDQCDVVHKYNTDEART
                     LKSQGELPENAKINETDNFGFESDDEVNFEFGNADSDEDEDDEEAGDFDIDDI"
     gene            complement(<993416..>994498)
                     /locus_tag="KLLA0_E11309g"
                     /db_xref="GeneID:9487418"
     mRNA            complement(<993416..>994498)
                     /locus_tag="KLLA0_E11309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999356.1"
                     /db_xref="GeneID:9487418"
     CDS             complement(993416..994498)
                     /locus_tag="KLLA0_E11309g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999402.1"
                     /db_xref="GeneID:9487418"
                     /db_xref="GOA:B4UN69"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="UniProtKB/TrEMBL:B4UN69"
                     /translation="MEDKYIGLFLAITSSLAIGTSFIFTKLGLNAASEENNFQGAGFN
                     YLRNPIWWGGMSLMVVGEVANFAAYTFAPAIMVTPLGALSVIIGAILAAVFLKEELGT
                     LGKLGCTICLLGSIIIILHAPSDKEISTVDEILGYAMQPAFVFYIIVVSTFSLFMIYK
                     VVPHYGTKNPMVYISICSLVGSISVMAIKAFGIALKLTLSGSNQFTHPSTYLFLIVVA
                     VCIMTQMNYFNKALDQFDTSIVNPLYYVTFTTATLTASFILFKNFEDSDPKDSLSLVC
                     GFVIIFLGVYLLNLSRKKNHAKMFGDQPDVENIPLDNNVGAFSARKSFQHTRSAHQRT
                     GSIVNYQDEEMVHLSSATNKEDDFEI"
     gene            complement(<994770..>996308)
                     /locus_tag="KLLA0_E11331g"
                     /db_xref="GeneID:2894232"
     mRNA            complement(<994770..>996308)
                     /locus_tag="KLLA0_E11331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454460.1"
                     /db_xref="GeneID:2894232"
     CDS             complement(994770..996308)
                     /locus_tag="KLLA0_E11331g"
                     /note="similar to uniprot|P38262 Saccharomyces cerevisiae
                     YBR103W SIF2 Sir4p-Interacting Factor 535 amino acid
                     protein containing 4 WD-40 repeats and a nuclear
                     localization signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454460.1"
                     /db_xref="GeneID:2894232"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CNM9"
                     /translation="MSIASEELNYLIWRYLQEAGHEVSALALQEETRVLEFEERFKEH
                     IPLGCLVQLVQKGILYTESEFLVPPNGEMVPVDQELYKRNFTLVQALEVDKQKFPEIA
                     ARGRFALENDVEAEMLEKKEQEQAAAMAADSPSGTQSASSRFIKTLSDHLTLSQSFTS
                     QWNPKYGILLVWGGAQSQARIGSIDIVTDKESWSIKDPIDLVYPKRSEEEPIISVSWS
                     PDGELVLTGTTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVIL
                     WSTLTGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLG
                     RLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWIN
                     DDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSPDRNWLTVGTLQGSAIVF
                     DVKTFLESYDQNSVQQQSVPISTYGEYQIDQDGLQVTNIAWNNESTAFAVSYINGNTR
                     LLSL"
     gene            <996736..>998898
                     /locus_tag="KLLA0_E11353g"
                     /db_xref="GeneID:2894545"
     mRNA            <996736..>998898
                     /locus_tag="KLLA0_E11353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454461.1"
                     /db_xref="GeneID:2894545"
     CDS             996736..998898
                     /locus_tag="KLLA0_E11353g"
                     /note="similar to uniprot|P38261 Saccharomyces cerevisiae
                     YBR102C EXO84 Essential protein with dual roles in
                     spliceosome assembly and exocytosis the exocyst complex
                     (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p)
                     mediates polarized targeting of secretory vesicles to
                     active sites of exocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454461.1"
                     /db_xref="GeneID:2894545"
                     /db_xref="GOA:Q6CNM8"
                     /db_xref="InterPro:IPR016159"
                     /translation="MVDFSLKKHGVSSWGRGSLSRKESSAGDSSSTFKSSRYQDMKVS
                     DPELPKVSAKERSKAGTMMKRRLSVHQSNNFGAVKMDFDNMPALPSSAADYSFASNVG
                     NATQTSLITEDQLPDRNTSLASLNTNTRRPDQELYSSKSLRQILSNPDFKAKKFITEK
                     LGDATAVDIDQFTSNLNDLSLEIQDEIKFNIDKSFKEILIVNKGLETATTELKVLRTK
                     VQEMKDIMNQFVTIAEKKLQAEQAANETADLNRTSSSASLSNHSLLPPLKPTPSATRK
                     DRTSVYILERMWNEELMTLFKNVDGAHKYITSTPGRHILLESDNWIEINPATLKPLQK
                     VRLFILNDVVLIAAPKPSKQTELTVSRFSPLRDVTVEVQSEHELSFNFSNKQHTLYRH
                     RDPQVFSKVIDIIRQAKDALREISQAEEDTTRKIRNSYTLLQQERTPNRDATTSPVKV
                     HGRQRSYGGTGTPSRHRSDAQNDALLTNITRSIHVRMGSEETTEVTKRLKRLDDALED
                     LDLEIGRQNFDLAITKLNHIQSSLKSLYSSATFDESVMVELLSLKCSQRKTILYTKLT
                     NLLACETSDMTKLKSYMLNLVALNEPVDALEVFLQNRSNFINDLTLQIGIIDNVTSFI
                     TQVAIIRFQTLKKVTQQYLEVSKNLKRDYTSLLVCWCSEEVDKHFQLMERELSNSSTL
                     SVQAIKITRKQIDELKPVGMDYVYKLDDFIRRNNNRIL"
     gene            <999242..>1000111
                     /locus_tag="KLLA0_E11375g"
                     /db_xref="GeneID:2893735"
     mRNA            <999242..>1000111
                     /locus_tag="KLLA0_E11375g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454462.1"
                     /db_xref="GeneID:2893735"
     CDS             999242..1000111
                     /locus_tag="KLLA0_E11375g"
                     /note="similar to uniprot|P38260 Saccharomyces cerevisiae
                     YBR101C FES1 Hsp70 (Ssa1p) nucleotide exchange factor
                     cytosolic homolog of Sls1p which is the nucleotide
                     exchange factor for BiP (Kar2p) in the endoplasmic
                     reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454462.1"
                     /db_xref="GeneID:2893735"
                     /db_xref="GOA:Q6CNM7"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013918"
                     /db_xref="InterPro:IPR016024"
                     /translation="MEKLLHWSIANAQGDDEAKARAGQPDPKLLEQLFGGGPDEPTLM
                     KHAMAVISNPEATLENKLVAFDNFEMLIENLDNANNIENMKLWEPLITVLDDPEPELR
                     AFALSVTGTAVQNNDQSQNNFAKYDGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRH
                     NKLIYDQFNQLNGLQIIAPVLKDANASEKLKLRAMALLSTVLTVADMNADFFALLRAY
                     NIIETTLEFLHPECNLYLIDRVLNFFSQLINVGFEFSATELEKLKVGVKNIEPVEAQL
                     NEDDYKTVQYVSK"
     gene            complement(<1000253..>1002325)
                     /locus_tag="KLLA0_E11397g"
                     /db_xref="GeneID:2894598"
     mRNA            complement(<1000253..>1002325)
                     /locus_tag="KLLA0_E11397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454463.1"
                     /db_xref="GeneID:2894598"
     CDS             complement(1000253..1002325)
                     /locus_tag="KLLA0_E11397g"
                     /note="weakly similar to uniprot|P38257 Saccharomyces
                     cerevisiae YBR098W MMS4 Protein involved in recombination
                     and DNA repair; subunit of a structure-specific Mms4-Mus81
                     endonuclease that cleaves branched DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454463.1"
                     /db_xref="GeneID:2894598"
                     /db_xref="GOA:Q6CNM6"
                     /db_xref="InterPro:IPR006166"
                     /translation="MDEVNIIDINDTTEQSLVGNEGTANGVVVLISSEGEREGPPASD
                     PIHYSLARSLSDSVGQRNVEDDDVVLLENSVSVSFSLEVEGRFQNDTAIESDNEPASQ
                     PQTQTFKRSQSRLLDEIENSGLSISALSDDEEASPLVSNQRSVIHKNIESEVKSGKYI
                     IPLPQSSPLEKMSQVFNYQLASSPTPNKSPSSRSTLPVKSPLQLSTTVANKRSYREVQ
                     PPKFDPYLTRKLKKPQNKATADVSSVALDLTKYMEDCHDLYGTLVSDTHIRQQRSLDT
                     KTNSYHSESNYEHDSIVIESDEDDDITNTRQEKPLFVQHSSQSTPVSSNKLALRQPRH
                     VEDEKIDKVKPMVNARPFTDQEYSEMVKKCLGTSEMRKLYNECNKVSRTEETIYNEMI
                     LTVNNKVMELIHSKHISFEEELKPLTIIQNYEEFPIIRFKRKCRSIYDQTHGVFYPCD
                     EVIANESICVLVYEALPFFHRYRTDKRGLWDEIRQFSKNGMKVIVVMYGLNALRKKLC
                     NMENRQHEDRVLEQLSGSASSQSQSKTRRRSTQETKMRELNIKSKNLDRIINEVTIYA
                     NVDVFPIENLNEFSHWMKNLVWVVGKMRYDVSVKYKEWSHLNVKSGKSPTDVLYSFLQ
                     QVAHVNEPKAKRVVTHYKSFQSMMNDMKAGYVAQSHDNKPLMPKSLERALHTLYTSDD
                     PNELIFTD"
     gene            complement(<1002637..>1005693)
                     /locus_tag="KLLA0_E11419g"
                     /db_xref="GeneID:2894599"
     mRNA            complement(<1002637..>1005693)
                     /locus_tag="KLLA0_E11419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454464.1"
                     /db_xref="GeneID:2894599"
     CDS             complement(1002637..1005693)
                     /locus_tag="KLLA0_E11419g"
                     /note="similar to uniprot|P32855 Saccharomyces cerevisiae
                     YPR055W SEC8 Essential 121kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which has the essential function of mediating
                     polarized targeting of secretory vesicles to active sites
                     of exocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454464.1"
                     /db_xref="GeneID:2894599"
                     /db_xref="GOA:Q6CNM5"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:Q6CNM5"
                     /translation="MDHLQPVTRNRQRALSIRSTTEAEKEAMENSVAKLQADIALLGT
                     EWNRIINKDTNPLELALRFLDETSVGLHHRFDEFIELKSRFAKDLQEVANDHYQAFND
                     SIASFSKTVYCITDAQDTLADIKNGVNNSLQKLSINDETLNDLNEDFMKQSRMISTLS
                     AMEEVIKLNQKVEQSLLNSDFTQAQEALNLGFTLAKEHDLWQLDVLKPVKEQFISHEH
                     SLFELLLEGITEIVYSKQASHKTDDQNMFAKTNNEDTFGSLENYLHHVIHEDISEESY
                     RKNQLLLDFLKKLGQVYSEDDEFAVTEETDYDKMYTYMKTLNAMNKLSLAIDLLQKRS
                     KNEIKNIITKSVEDMRLKHPSLLKMTVSLQNSSTLGLSGQDILCVLIRRLFWEIFIKF
                     LTAIQGHRVLYETTKALQPPATSNVSYPFVEIWETCLRTIKDLIAMYTKDISITKDRR
                     HKHRTSSNLLQAKTSTETQLFSLQNNISKDNSSQLGHANELKAMLTDMFPGFALSTNV
                     DLENIYLAEERFEDEDTLVPPTVFNMRMILESLLVFVQGSKDLLPPSLEDTTTSSTAF
                     FLNVMEVEFLPQLNQTMNFLYESQVESNSPFAVETLFNGTPIFKSAIDFKMLYFKLLQ
                     TTNAGNFYRRNVAHMLVSIADKFYSYYYSIYQSICGTQNTVVSKKLVSSWLTDKASGD
                     ITSKIFANDDEFIDAETLRLLNQCPRVFQERRSLEKTDHFSDSTIDTLVYFATTLEWI
                     SSWLPGIKKEVKDTDNVSESSDKRKQANNAELRSMWSFFEVSEADLTDKGGTTRFLLA
                     ADNLEEFEAVTQKFTNLHYLLLQSVRYDVRVRCLYYINCMLHSSRWNPEVTSIELDEN
                     ISSLVSDLSFLENKLRTSFAEDHSLLVFIGISNFMNHALISGSKSISVLNVHGAKKLL
                     RNVNALQQACKSATDGNDTEDLSKSITFFSICSMDEDSVLESFQKHELNGLSPDDLKS
                     AFRLVFSEELQRQMKRKSSTNQRAISMSASKRLEDAIKKIDQMASS"
     gene            complement(<1006025..>1006891)
                     /locus_tag="KLLA0_E11441g"
                     /db_xref="GeneID:2894572"
     mRNA            complement(<1006025..>1006891)
                     /locus_tag="KLLA0_E11441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454465.1"
                     /db_xref="GeneID:2894572"
     CDS             complement(1006025..1006891)
                     /locus_tag="KLLA0_E11441g"
                     /note="weakly similar to uniprot|P18888 Saccharomyces
                     cerevisiae YHL025W SNF6 Involved in global regulation of
                     transcription subunit of the chromatin remodeling Snf/Swi
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454465.1"
                     /db_xref="GeneID:2894572"
                     /db_xref="UniProtKB/TrEMBL:Q6CNM4"
                     /translation="MGVPGRKRKNKKVLRQSHQDHAQGHAANQRFSQGRKGSSGMARV
                     QATNVGSILHDESDVISFRHSLTNEFMLTSRLIDMLTTQPIPLDKIVPPEIVSAGTLE
                     LMTEHLQKQKAIVEELRVTSQDKISAVKVPDDATAFYNKWIDQLADHIYDKDVVDRAE
                     KEYSDKFKIQVKPSNIVIHRNKFSHLAPNRTHAPPDYWERHKKILAERKEQERRAKEQ
                     EEERKRQEQMALSVEPIPEDLAVPTKQDEVEQQQIVVDPNDPNLLDNVFGEEPFQNGF
                     DDGFGDLDTAFF"
     gene            <1008460..>1010949
                     /locus_tag="KLLA0_E11485g"
                     /db_xref="GeneID:2894592"
     mRNA            <1008460..>1010949
                     /locus_tag="KLLA0_E11485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454468.1"
                     /db_xref="GeneID:2894592"
     CDS             1008460..1010949
                     /locus_tag="KLLA0_E11485g"
                     /note="similar to uniprot|P18962 Saccharomyces cerevisiae
                     YHR028C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454468.1"
                     /db_xref="GeneID:2894592"
                     /db_xref="GOA:Q6CNM1"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CNM1"
                     /translation="MSDFARDEETDAAEFRLQLSKPHEHRRRSFLVTACLSLSTVLFS
                     AYLFISIISSLKGSGTLNNGSGPRLPNKQIDYTKDGLLKVSFANVRNRTFQPEVKPLQ
                     WISTPDSHKNDKGLYVTFENDTYSVRSVLDESYSKTLFEGTSFTYDSKNYTVDAVVAS
                     PELSKVLIRSETEKGWRHSTFGTYFVYENDSFHKIDSEISIAKWSPNSRDIVYVKGND
                     IYLYSSDSHETSKRITNDGSELVFNGKPDWVYEEEVLEGDTALWWSPTGDYLAFFKIN
                     ETSVEEFPIPYFVQENQTNSAYPELRKIKYPKSGSSNPINKLNIYDLSADKVSQIDST
                     SDDSLITEVTWVGNHEIIAKVSDRSSDILTVIMVDAADGSRSEVSRIEESDGGWWEIT
                     HKTTFVPKDKSRSRSYNGYIDLVPVDGYNHLVYFTTNVTTEIPSVVLTSGEWEVVDGP
                     AAFDEEFNNVYFIATKKSSTERHLYYVNLERPQKVYAVTDERLNGYYSASFSAGARFL
                     LLNYLGPDVPYQKIIDLKSDTKDKNIRGNIIGKTLYYLEKNEKLHNSLKRYAIPARIF
                     RELTLGKDQNGSDIIVNSYEILPNDFDPSLKNHYPVFFFAYGGPNSQQVAQTFGIGFN
                     QVIASQLDAIVVVVDGRGTGFKGKEFRSIVRGNLGDVESTDQILAAKLYGQNSYVNKE
                     KISLFGWSYGGYLTLKTLEKDAGKHFKYGVSVAPVTDWLLYDSVYTERYMHTPQKNPE
                     GYDKCKVHNATAFATVPRFLLMHGTADDNVHFQNSLKYLDLLNLNNIENYDVHVFPDS
                     DHSIQYHNANVIVFNKILNWIRHAYNGDFLL"
     gene            <1011380..>1014337
                     /locus_tag="KLLA0_E11507g"
                     /db_xref="GeneID:2894593"
     mRNA            <1011380..>1014337
                     /locus_tag="KLLA0_E11507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454469.1"
                     /db_xref="GeneID:2894593"
     CDS             1011380..1014337
                     /locus_tag="KLLA0_E11507g"
                     /note="similar to uniprot|P38764 Saccharomyces cerevisiae
                     YHR027C RPN1 Non-ATPase base subunit of the 19S regulatory
                     particle of the 26S proteasome may participate in the
                     recognition of several ligands of the proteasome contains
                     a leucine-rich repeat (LRR) domain a site for protein?
                     protein interactions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454469.1"
                     /db_xref="GeneID:2894593"
                     /db_xref="GOA:Q6CNM0"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="UniProtKB/TrEMBL:Q6CNM0"
                     /translation="MTKDNDIVKEAAAPGAEEKPITVPDEQNNKKKDANNEEELSEED
                     LKLKDDLEFLVSTLKGDDTSLYLGSLDQLKDSIKNSTSSMTAVPKPLKFLRPSYPELV
                     SVYESWTDDKLQSLLADVLSVLSMTYSDDGKYDSLKYRLLSNEKNIESWGHEYMRHLA
                     LEIGDVYNKQVEKEADESTPEPDADFNQQDLVSLSLQIVPYFLKHNGEADAVDLLLEI
                     ESIDKLPQFVDDTSFTRVCQYMVACVPLLAHPDDVSFLQTSFAIYLSHNELTEALNLA
                     IRIGDENLVRSVFDATADPVIHKQLAYILSSQRSSFQQEGVQDIIDNVQLSEHFRYLA
                     KELNLLQPKTPEDIYKSHLESSKASFNKTSMSSAQQNLAEFMVNGWLNLGYSSDSIYS
                     KDSNCVYKTKGDGMTSAVASIGSIYQWNLDGLQELDKYLVTEDLEVKAGALLGIGIST
                     CGVHDGEVEPALLLLQEYVTNPNVKLSSAAIMGLGIAFAGSNNDELLGTLLPVAADTS
                     LPIEVCSMACLSLAHAFVGTCNGDITTTIMDNFLERSSEELKTHYTNFFALALGILYM
                     GQGEQVEDVLDTISAIENPITSAIEVLVNACAYTGTGDVLMIQDLLHRLTPKKDSKDD
                     KEEEADEEMGDVLPSEIQDSLGLGLQDIPGAADTVYNEQDEQPEEVDVVMDDADGSNA
                     TNDETKASEQKGDEDAEDEQEGEKEENAEDAGEDKENENSQAAELAFAVLGIAMIAMG
                     EEIGKEMSLRHFGHLMHYGSDEIRRSVPLAMGLISVSDPQMKVFDTLSRFSHDADLAV
                     SMSSIFSMGLCGAGTNNARLAQLLRQLASYYSKESDALFMTRLSQGLVHLGKGTLSLD
                     IFNDAQVLNKVSLASLLTVLVGMMSPEFMLKNHSLFYYLNSATRPKYIVTLDEEGNPI
                     KASVRVGQAVDTVGQAGKPKTITGWITHSTPVLLGHGERAELETNEYISYTSRIEGVV
                     ILKKNPKYTEEVN"
     gene            complement(<1014620..>1015363)
                     /locus_tag="KLLA0_E11529g"
                     /db_xref="GeneID:2894597"
     mRNA            complement(<1014620..>1015363)
                     /locus_tag="KLLA0_E11529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454470.1"
                     /db_xref="GeneID:2894597"
     CDS             complement(1014620..1015363)
                     /locus_tag="KLLA0_E11529g"
                     /note="similar to uniprot|P23968 Saccharomyces cerevisiae
                     YHR026W PPA1 Subunit c'' of the vacuolar ATPase which
                     functions in acidification of the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454470.1"
                     /db_xref="GeneID:2894597"
                     /db_xref="GOA:Q6CNL9"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:Q6CNL9"
                     /translation="MRPLEAERFLGCRGYSFIKWVQALTHSTLVEIFLFKMSKTGSSS
                     RAAWQYTKSAINYTIITVILVYVLYKLFTNHGEDINFGKFLMKTSPYMWANLGIALCI
                     GLSVVGAAWGIFITGSSIIGAGVRAPRITTKNLISIIFCEVVAIYGLIMAIVFSSKVT
                     VANSATMFDKSNLYTGYSIFWAGITVGVSNLICGVAVGITGATAAISDAADSSLFVKI
                     LVIEIFGSVLGLLGLIVGLLMAGKAVEFQ"
     gene            complement(<1015657..>1016739)
                     /locus_tag="KLLA0_E11551g"
                     /db_xref="GeneID:2894557"
     mRNA            complement(<1015657..>1016739)
                     /locus_tag="KLLA0_E11551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454471.1"
                     /db_xref="GeneID:2894557"
     CDS             complement(1015657..1016739)
                     /locus_tag="KLLA0_E11551g"
                     /note="highly similar to uniprot|P17423 Saccharomyces
                     cerevisiae YHR025W THR1 homoserine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454471.1"
                     /db_xref="GeneID:2894557"
                     /db_xref="GOA:Q6CNL8"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CNL8"
                     /translation="MGRSFKISVPASSANIGPGYDVLGIGLALFLTLEVNIDSKNAAL
                     TNDDRNNCKLSYTPESDGYSTVPLASDENLITRTALYVLRCSGIRTFPSGTQILVNNP
                     IPLGRGLGSSGAAVVAGVMLANEVGQLNFPKQRMLDYCLMIERHPDNITAAMMGGFVG
                     SFLRDLTPQEVERREIPLAEVLPEPSGGEDTGLVPPLPPTDIGRHVKYNWNNKIKCIA
                     IIPDFELSTSDSRGVLPQAYTTKDLVFNLQRLAVLTTALTLDPPNPDLIYPAMQDRVH
                     QPYRKTLIPGLTDILSSVTPKTHPGLLGICLSGAGPTILALATENFENIALEIINRFS
                     KNKVTCTWRLLDLATDGAQVMHSSSA"
     gene            <1017355..>1018833
                     /locus_tag="KLLA0_E11573g"
                     /db_xref="GeneID:2894121"
     mRNA            <1017355..>1018833
                     /locus_tag="KLLA0_E11573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_454472.1"
                     /db_xref="GeneID:2894121"
     CDS             1017355..1018833
                     /locus_tag="KLLA0_E11573g"
                     /note="similar to uniprot|P11914 Saccharomyces cerevisiae
                     YHR024C MAS2 Larger subunit of the mitochondrial
                     processing protease essential processing enzyme that
                     cleaves the N-terminal targeting sequences from
                     mitochondrially imported proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_454472.1"
                     /db_xref="GeneID:2894121"
                     /db_xref="GOA:Q6CNL7"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6CNL7"
                     /translation="MFRLGRNSTVGRLARGKWYSQISKNAENSQVTTLDNGVKVATSN
                     VPGHFSALGLYVNAGSRFEDKNLKGCTHIMDRLAFKSTDHISGRDMTETLELLGDNYQ
                     CSSSRETMMYQSSVFNPDVEKMFHLMSETVRYPRITEEELEEQKTTALYEIDGVWQKH
                     DLILPELLHQTAYSGETLGSPLLCPKELIPSISKYYLTDYRNKFYNPENIVAAFVSVP
                     HDDAVQLTEKYFGDMKSKYPPVTKKPAKYTGGEYCIPPGPVFGGLPELYHMQLAFEGL
                     PIDHPDIYALATLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYYVENCVSFNHSYS
                     DSGLFGVSISCIPQAAPFAAEIIAQTLSNVFANDKLKLTKEEVSRSKNQLKSSLLMNL
                     ESKIVELEDLGRQVLLHGRKIPMKEMMENIEKLTVDDIKRVAETVFTGKVNNPGNGNG