GenomeNet

Database: RefSeq
Entry: NC_006042
LinkDB: NC_006042
Original site: NC_006042 
LOCUS       NC_006042            2602197 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Kluyveromyces lactis strain NRRL Y-1140 chromosome F complete
            sequence.
ACCESSION   NC_006042
VERSION     NC_006042.1
DBLINK      BioProject: PRJNA12377
            BioSample: SAMEA3138170
            Assembly: GCF_000002515.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Kluyveromyces lactis
  ORGANISM  Kluyveromyces lactis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1  (bases 1 to 2602197)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 2602197)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2602197)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382126.
            This is an updated version of the complete genome sequence. The
            Kluyveromyces lactis sequence is made of 6 chromosomes (A to F).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2602197
                     /organism="Kluyveromyces lactis"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-1140"
                     /db_xref="taxon:28985"
                     /chromosome="F"
     gene            <2473..>3519
                     /locus_tag="KLLA0_F00132g"
                     /db_xref="GeneID:2894918"
     mRNA            <2473..>3519
                     /locus_tag="KLLA0_F00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455085.2"
                     /db_xref="GeneID:2894918"
     CDS             2473..3519
                     /locus_tag="KLLA0_F00132g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455085.2"
                     /db_xref="GeneID:2894918"
                     /db_xref="GOA:Q6CQ36"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ36"
                     /translation="MSSHPFQVIDLCAPAEETSRLLLEAANTQGFLFIDGHSFSQQQV
                     DALFRLSMEYFTNTPHHEKLQYAFDVAKNYGYTDYTREQGDPSKAKDFKECYNFGSIN
                     FSNGTYNGQSRSTSENCMQHGEVPPLFTYHNDLIVDSIKKFHELARNIMGLFTVALGI
                     IQEDFFVSRFSDDKKNGCVMRLLHYPLFRDDGVDGSSGIDPTLRIGPHSDYGALTLLL
                     QKEGEQGLEVQLDPGCDQWTKVPFLTSRYEGSAPPIVVNFGDMLSFWTKGVIRSTKHR
                     VKIDPGETRSSDRYSIVFFTHPDADTTLDPVPSRVIESNSNGIGAPPVTAYEYLSAHL
                     SRVINSIPSHDGMV"
     gene            <4320..>5843
                     /locus_tag="KLLA0_F00154g"
                     /db_xref="GeneID:2895158"
     mRNA            <4320..>5843
                     /locus_tag="KLLA0_F00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455086.2"
                     /db_xref="GeneID:2895158"
     CDS             4320..5843
                     /locus_tag="KLLA0_F00154g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455086.2"
                     /db_xref="GeneID:2895158"
                     /db_xref="GOA:Q6CQ35"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ35"
                     /translation="MSATLQSIMSENNTTFREKGEAATSLETSNISSAGELKDPGRLE
                     KEQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYY
                     MDSGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALL
                     AAFSTKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIV
                     FNLSTQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDM
                     FKYPVIWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPL
                     VGLAADKFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTS
                     IITRLVGLPKLEAVYSVVWMFLGVCAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTA
                     YLLAALALWCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
     gene            complement(<6530..>6748)
                     /locus_tag="KLLA0_F00176g"
                     /db_xref="GeneID:2895159"
     mRNA            complement(<6530..>6748)
                     /locus_tag="KLLA0_F00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455087.2"
                     /db_xref="GeneID:2895159"
     CDS             complement(6530..6748)
                     /locus_tag="KLLA0_F00176g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455087.2"
                     /db_xref="GeneID:2895159"
                     /db_xref="UniProtKB/TrEMBL:Q6CLV2"
                     /translation="MVSWECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNV
                     SAYFENGSFYRWESFATVAATSDFFASH"
     gene            <7833..>8273
                     /locus_tag="KLLA0_F00220g"
                     /db_xref="GeneID:2895157"
     mRNA            <7833..>8273
                     /locus_tag="KLLA0_F00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455089.1"
                     /db_xref="GeneID:2895157"
     CDS             7833..8273
                     /locus_tag="KLLA0_F00220g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455089.1"
                     /db_xref="GeneID:2895157"
                     /db_xref="UniProtKB/TrEMBL:Q6CLV0"
                     /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLEFDMVSNS
                     TSVCFNSTNYAIDVSELPLPEWLDDWDSLLLAMPCGDEIFVSVPKDLDSNTTAKILAY
                     SLASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVQN"
     repeat_region   8285..8698
                     /rpt_type=long_terminal_repeat
     gene            <8992..>10260
                     /locus_tag="KLLA0_F00242g"
                     /db_xref="GeneID:2895214"
     mRNA            <8992..>10260
                     /locus_tag="KLLA0_F00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455090.1"
                     /db_xref="GeneID:2895214"
     CDS             8992..10260
                     /locus_tag="KLLA0_F00242g"
                     /note="similar to uniprot|Q06598 Saccharomyces cerevisiae
                     YPR201W ARR3 Arsenite transporter of the plasma membrane
                     required for resistance to arsenic compounds transcription
                     is activated by Arr1p in the presence of arsenite"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455090.1"
                     /db_xref="GeneID:2895214"
                     /db_xref="GOA:Q6CLU9"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU9"
                     /translation="MKEFFVTGENTLKGGEDAQNSEVLDGQKKARSMVYSTIKSVSYL
                     DLLLPFTILLCMIVSILISVYVPSSRHTFDAENHASLVNVSIPLAIGMIVMMIPPICK
                     VSWESIHKYLKEKYVWRQLLLSLILNWIFGPLLMTALAWLALFEHKEYREGIIMIGIA
                     RCIAMVLIWNQIAGGDNDLCVVLVVCNSVLQMVLYAPLQLLYCYVISNDHFQGSYNAM
                     FSEVAKSVSAFLGIPLCCGILIRLIFVYSIGKHNYEKHILKYISPWAMIGFHYTICIL
                     FVSRGYQFIHEIGSAFLCFIPLVLYFILAWSFTFVLMRYLTNTKPSDDEKCECDQEQL
                     LLKKNWGKKTCSSSYPITMTQCFTTASNNFELSLAVAISIYGNDSQQAIAATFGPLLE
                     VPILMILAIFARYLRIRFIWRTDVPLKAES"
     gene            <12724..>13659
                     /locus_tag="KLLA0_F00264g"
                     /db_xref="GeneID:2895215"
     mRNA            <12724..>13659
                     /locus_tag="KLLA0_F00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455091.1"
                     /db_xref="GeneID:2895215"
     CDS             12724..13659
                     /locus_tag="KLLA0_F00264g"
                     /note="similar to uniprot|P40100 Saccharomyces cerevisiae
                     YER185W Hypothetical ORF and to YGR213C uniprot|P53047
                     Saccharomyces cerevisiae YGR213C RTA1 involved in
                     7-aminocholesterol resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455091.1"
                     /db_xref="GeneID:2895215"
                     /db_xref="GOA:Q6CLU8"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU8"
                     /translation="MATGDASESFQKYRYDPSKAAAIAVCATFGVLFISMIIMIATSV
                     RRFDKMSASNKRKVRNFTILRFLPFLVGIAIEAVGYGMRYMSVNDTDKLTPYILQSVF
                     LLVAPALFAATIYMVFGQMLHYLQCTKLSIVPARWSTTIFVIGDVLSFFVQGAGAGIM
                     ANADTSSESKTGSNIIVVGLFVQVAVFGFFMITELRFLLRVKRTSAIVPYLSLHWRTL
                     NLTLLGISLLILIRSLVRAIEFIQGNKGFIISHEYFLYVFDALMMILASLVWIVTFKF
                     GDIFKIIYEVKLLDSFKEKSGDDASYMQTEAFDKK"
     gene            <14519..>16138
                     /locus_tag="KLLA0_F00286g"
                     /db_xref="GeneID:2895216"
     mRNA            <14519..>16138
                     /locus_tag="KLLA0_F00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455092.1"
                     /db_xref="GeneID:2895216"
     CDS             14519..16138
                     /locus_tag="KLLA0_F00286g"
                     /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
                     YLL055W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455092.1"
                     /db_xref="GeneID:2895216"
                     /db_xref="GOA:Q6CLU7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU7"
                     /translation="MSELKIENEDAEVVDKDDKLQNGKYTEFETSSDSIDKKEKKIDV
                     KDADELLKFMDKYESTVEPLTEEEEKKFVKKNFAAVSLLTILVTLILFMDKSTIGYTT
                     ILGIYTDTGISKGDFNNLNSIFYAGYLIAQWPCHILMQKLPLGKYLAGSIFSWAIIVG
                     LTGICNNYGSLMACRFFLGATEAVVVPACEITLGMFLTTEQREIVQPVFWAATAAAPL
                     LSSFISFGLMHTNTSTYPWRIFMAINAGLSLILAIIVLLLYPDNPANAKFLSTKEKVY
                     LIKQVQRSTESSIEQKTIKKYQIYETFKDPVSWLFFFQSFTLMLSNSLTYQQNQLYVD
                     IGVDNLGSSLVSAAGSVWDILLYLIFAFVILNYPNQSGYIAAGCLILPIASSIAMVTI
                     DWSNKYALLACMILAGSSKGITYIIALGWTTSSAAGYTKKLYRNVMFMLAYGAANIIS
                     PQLWNPKDAPRYYPSWIIQIVVSFFLNIVILLTIRYILAKRNKERYQWVQEHPEDNFG
                     IVSFTEGVNERVNLAMLDLTDFENKRFIYPL"
     gene            complement(<17067..>17537)
                     /locus_tag="KLLA0_F00308g"
                     /db_xref="GeneID:2895132"
     mRNA            complement(<17067..>17537)
                     /locus_tag="KLLA0_F00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455093.1"
                     /db_xref="GeneID:2895132"
     CDS             complement(17067..17537)
                     /locus_tag="KLLA0_F00308g"
                     /note="weakly similar to uniprot|P39718 Saccharomyces
                     cerevisiae YAL055W PEX22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455093.1"
                     /db_xref="GeneID:2895132"
                     /db_xref="GOA:Q6CLU6"
                     /db_xref="InterPro:IPR024359"
                     /translation="MRGDKETTNWLNKSLMKQARQKKLSIIAVGVLSTVAVTVGYLLY
                     LYRGQRNPNIRDVKPKSKCYVLTQDLFDKIENWQEELSKDSVMLVLPEVAHLGNHLKL
                     QLSSIEHKIVIFNNSSAVWSAVRHLKKYELVISRDKTSDMPVDLRRYVGQISHI"
     gene            <17682..>18794
                     /locus_tag="KLLA0_F00330g"
                     /db_xref="GeneID:2895133"
     mRNA            <17682..>18794
                     /locus_tag="KLLA0_F00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455094.1"
                     /db_xref="GeneID:2895133"
     CDS             17682..18794
                     /locus_tag="KLLA0_F00330g"
                     /note="similar to uniprot|P48581 Saccharomyces cerevisiae
                     YOR368W RAD17 Checkpoint protein involved in the
                     activation of the DNA damage and meiotic pachytene
                     checkpoints with Mec3p and Ddc1p forms a clamp that is
                     loaded onto partial duplex DNA homolog of human and S.
                     pombe Rad1 and U. maydis Rec1 proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455094.1"
                     /db_xref="GeneID:2895133"
                     /db_xref="GOA:Q6CLU5"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="InterPro:IPR016587"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU5"
                     /translation="MIDSPIFYATTVHLDHIVTALNCLTPFGVKGEMLITIDKNGLSF
                     AQENNHVIKIQLVLSRELFQTFHYSPITETSLTKVSLRLDHVLDSLNISNDRNDIIEC
                     TLTYNGDGSPFILIFEDNMITESVEYSTYLLKDLDNTGLVLDRTRLQFECIIKGDVLH
                     NALHDLKEIGCKDCYFYAIHNETTKKPLFALISRSQQGLSKIILPNERSILEKFEIYA
                     NDSTTLLYDHPMISVFDYGMLDKIRASARIASKIMIRRDVHGLMTVNILNETKDILRP
                     NDQEYKRTRAISGNNLPSHYPGIIIEICMLEKALPELPDVNEIKVMMIEYMGSESRHN
                     FLPNTQQPPKKTAHDDKEEENSDGYEAASQDLPLFF"
     gene            complement(<19046..>19450)
                     /locus_tag="KLLA0_F00352g"
                     /db_xref="GeneID:2895319"
     mRNA            complement(<19046..>19450)
                     /locus_tag="KLLA0_F00352g"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_455095.1"
                     /db_xref="GeneID:2895319"
     CDS             complement(19046..19450)
                     /locus_tag="KLLA0_F00352g"
                     /note="similar to uniprot|P48589 Saccharomyces cerevisiae
                     YOR369C RPS12 Protein component of the small (40S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_455095.1"
                     /db_xref="GeneID:2895319"
                     /db_xref="GOA:Q6CLU4"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU4"
                     /translation="MSDVEEVQQVPVAELTIEDALKVVLRTSLVHDGLARGLRESAKA
                     LTRGEGQLAVLVESVTEEAISKLVQGLATENNVPLIKVADAKQLGEWAGLGKIDRDGN
                     ARKVVGASVVVVKNWGADTQEREILLEHFSQQ"
     gene            complement(<20124..>22511)
                     /locus_tag="KLLA0_F00374g"
                     /db_xref="GeneID:2895130"
     mRNA            complement(<20124..>22511)
                     /locus_tag="KLLA0_F00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455096.1"
                     /db_xref="GeneID:2895130"
     CDS             complement(20124..22511)
                     /locus_tag="KLLA0_F00374g"
                     /note="weakly similar to uniprot|Q08886 Saccharomyces
                     cerevisiae YOR371C GPB1 Proposed beta subunit of the
                     heterotrimeric G protein that interacts with the receptor
                     Grp1p has signaling role in response to nutrients involved
                     in regulation of pseudohyphal growth through cAMP levels
                     homolog of Gpb2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455096.1"
                     /db_xref="GeneID:2895130"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU3"
                     /translation="MEALDPLSQDPRPSEERAIKNDQPYHLNYEWNDVPSTFKTINKD
                     GQYKQFSPIPYITSYIPTLNTPAATAELMKEEREVNLQKLRNYYHKEALDSLATRKDS
                     YVSQSTNSPQSRSSRRRTSLSHRFSSWNMDRLPEEQKSTNSFSIDTTQENQATEAAKV
                     YIKYRQKFSSNCDSFSSGEISEREENMWVPIARWQPSSPDMEPKLYTSYKIKLNVPYS
                     ETCPITITKLYPPIFSDTRVPALTYHSIVNLDSCLYIFGGMSPSYSFSEVSPDLSSFH
                     VDGIKHLPPPLDETIINNPAMLPSNKLYTFSYTSTKWTEVNATGQIPPALVCVQGSIL
                     TDRHIFYYGGFEIKHEVSIDPKTNEYYIKKRAILNDTAYILDTLCYKFTKLQLVAQPT
                     KYVKYPNTVPRFGHLQVSLKTHTHKSTRSSTSGTDSPPSSLSSSTAEKNSSTNTFEDP
                     MMNFVSSSMALSSDNIISPTSSSSPGVYSILIMGGYREGGDGKFIPISDLWKVEVTVL
                     SRGKRNFLKFADTALVTIISRLPQNAVDEAFLRDYYKKWPLPRGFMASYVVDTDSLSP
                     KSMDADLLDRLMHNFKIVDNINDEPVVNEPMIPGRTMNSSTSPKRLNKSLIIHGGSAN
                     KFIHGDMWCYDLDEGTWTKLSLKAKDKETGELKIVEFPLTGHTFVHNKQITVVIGGLS
                     QKDVDSSLYWKDYKYDEKHQHPMHDTDGTFTFISLPSRVIRNFEVVNIMNRARTKYTE
                     DMPLSALRLSCNPIVYDQDYIWTVGGLITDTESCDVFLRGAISLVNLPLIDIPGV"
     gene            complement(<23088..>24740)
                     /locus_tag="KLLA0_F00396g"
                     /db_xref="GeneID:2895131"
     mRNA            complement(<23088..>24740)
                     /locus_tag="KLLA0_F00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455097.1"
                     /db_xref="GeneID:2895131"
     CDS             complement(23088..24740)
                     /locus_tag="KLLA0_F00396g"
                     /note="weakly similar to uniprot|Q08887 Saccharomyces
                     cerevisiae YOR372C NDD1 Transcriptional activator
                     essential for nuclear division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455097.1"
                     /db_xref="GeneID:2895131"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU2"
                     /translation="MNSRDEEANYLTSPHIYRSNAGQEQLGTKYAFNSPQPMQHTLPT
                     PYTLNQNKLDHINAVERDNSDLNDYSLVENSMLNHRNHQRHHQHSHRPTVDPNTSSND
                     IDVNSSQILTDGDNSINAEFTGTTHSSTSHDVEVLLSSSNSRASASIVTGSNQGSTIQ
                     TSANSTERNGKSSISSSSSSSSAAATRTAITGNNISQPILPDINEQPSSVLHFGNFAN
                     ELLLASPEQFKEFLMDSPAGLNFWQQRQTPAKTPLKFVTNNTNLTHQQNNTGLMNSIH
                     SPLQNIDVNLMFNSASKTSLSPPRKQMSLTPYGRRILNEMGTPFTKMMQPISSNNSAL
                     VDFHRARKHNLQSTPTSRPALRNESPGSKLYCSSPTTIQLHSSGVKCSPERDPNIDEK
                     LFHLRASPTPKLSLNKSEKFRLDPSFELPKMGSFKEGLTIPSLRAPDTNNQPININNA
                     NIHSSMGTTHDISSTSEKVRKPKLNRNGNKNKSKTNQLITKQRFQIIMTDTTSFNSDD
                     GVTSNNQAKLKRSRSVIVPGEVKKKKKKKKVYETSNIIPNSQ"
     gene            <26773..>29505
                     /locus_tag="KLLA0_F00418g"
                     /db_xref="GeneID:2895316"
     mRNA            <26773..>29505
                     /locus_tag="KLLA0_F00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455098.1"
                     /db_xref="GeneID:2895316"
     CDS             26773..29505
                     /locus_tag="KLLA0_F00418g"
                     /note="weakly similar to uniprot|P32336 Saccharomyces
                     cerevisiae YOR373W NUD1 Component of the spindle pole body
                     outer plaque required for exit from mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455098.1"
                     /db_xref="GeneID:2895316"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU1"
                     /translation="MDLAESLENFHITSPEKVNTVKRSNGNFEDFINSDDFEDQNEQP
                     GIAIERPTLEKVQLKKTKKAELKPYKENENPLPQQFGSFLSKMDDWSVNYGTVKALKE
                     DSKTNGTMAQRLNNLDEGNDAPQAQWKNYLLKPKQKSDQSAKDVSDLIVTASLSDLSL
                     IPADTFKKKERNDLSSLSHETDPAREAKSVFKNVLKNQRSNYFRDNDTLTTQNTKNSN
                     GANQPYQTRNYINSDFESGSRPVSGSEDFESGSDSSSDSLSELNPSNLNSPSPKPRIV
                     TNTRRLPLITPEDAGLVFDHETGLWDKQRMIAAADSNISENSTGSFVMEEDSTTTNSN
                     SNSHSSLKPISDSFKRDPTLDNCIDTQIPVIATANSEIESGLDDEYLGSNVTLNTVTD
                     DTPLSTPKFNRNFYQKDTDKPMTRYPSSSLHKELSNIHSQGTANIADITSISRMDTSY
                     DLTKREIVSRLLEIEPNPTNWQTLYEVDLSDQAIKDSCTGIDELLPNLINLDVSNNEL
                     ISLQGIPNHIQSLNISNNKLRSQLLQFQDLPHVEHLDLSDNNLSALQDLRFTAPLSHL
                     HYVDVSNCGIVSLMGLPKFAKVDTIIAKDNKLIGSIDFKQLCETSPIPWQHVTKLDLS
                     NNRITNLKNLHYLVSLRVLILDGNSIEQLHSGSYHQGSRSRVGKKIEVGNPELRYLSI
                     KDGGVPVHSFSGFPNLRILRITVAMDSINIEENAIDSHMTNNNNSDIESPNYNASLIP
                     LSERFPMSFPLEQLEILGMPHSSPRQPSKQMFGTSTNGRKQKLGSDPNSSSAWEGFEF
                     PPQLRRVTLRSLGLTRVPQTLTNNTGLSSLDMQGNNIYSAQILLPSLPCNLLRLNILQ
                     NPVLEEPLRGTDKINTGSGTNHDLVVHQRRNKDLLRLLLHWCPALVECDLCTEG"
     gene            <31019..>32587
                     /locus_tag="KLLA0_F00440g"
                     /db_xref="GeneID:2895302"
     mRNA            <31019..>32587
                     /locus_tag="KLLA0_F00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455099.1"
                     /db_xref="GeneID:2895302"
     CDS             31019..32587
                     /locus_tag="KLLA0_F00440g"
                     /note="highly similar to uniprot|P46367 Saccharomyces
                     cerevisiae YOR374W ALD4 Mitochondrial aldehyde
                     dehydrogenase that utilizes NADP or NAD equally as
                     coenzymes expression is glucose repressed"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455099.1"
                     /db_xref="GeneID:2895302"
                     /db_xref="GOA:Q6CLU0"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6CLU0"
                     /translation="MLLRTTTAGTRLAFKSQTAAFAHALRYYSHLPLKVKVDLPNGIS
                     YEQPTGLFINNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEAADKAFKSG
                     VWSKVDPLVRSQCLSKLADYIEKDLDTIASIESLDNGKAISSAKGDVQLVVNYLRSAA
                     GYADKVDGRVIDTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALATGNTVVL
                     KTAESTPLSALYVSQYIPKAGIPDGVVNIVSGFGKIVGEAITTHPKIKKVAFTGSTAT
                     GRHIYQNAGVNLKKVTLELGGKSPNVVFADANLKSAVQNSLLGIYYNSGEVCCAGSRL
                     YVEESIYDDFLKEIKSASEALKVGDPFDAETFQGAQTSQNQLDKILKYVEIGKNEGAT
                     LITGGERIGDKGYFVRPTIFADVEESMRIVKEEIFGPVVTVTKFKTIDELIEKANDSE
                     YGLAAGIHTSNINTAIQVSNRLNAGTVWINTYNDFHHCVPFGGFNASGIGREMGSEAL
                     DNYTQVKAVRVKLE"
     gene            complement(<33094..>34980)
                     /locus_tag="KLLA0_F00462g"
                     /db_xref="GeneID:2895335"
     mRNA            complement(<33094..>34980)
                     /locus_tag="KLLA0_F00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455100.1"
                     /db_xref="GeneID:2895335"
     CDS             complement(33094..34980)
                     /locus_tag="KLLA0_F00462g"
                     /note="some similarities with uniprot|P27825 Saccharomyces
                     cerevisiae YAL058W CNE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455100.1"
                     /db_xref="GeneID:2895335"
                     /db_xref="GOA:Q6CLT9"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT9"
                     /translation="MNPLLLLSQIGFGTLAVAINPMVKGDYRIEHPNMTDLSDLQSKL
                     SSDSYFESFQYSSHDEFIHNWVISELEMEHVDETMSRAFPGLWKLESPYLVPGFSNDL
                     ALVLGSSQTRSAIAHKLDHEISVKTKEKLVVQYEVKLQKMLECGGAYMKLLKTNADDL
                     SQYDHSADDYVLVFGPDSCSMYTNEVHFILKRENPISEEFEDKYLTEAPLSGLDQPIT
                     RLYTLILDSADQSFEIRIDGEVVKAGNLLAEGTFRPSLNPPREIEDPSASQPADWGSR
                     SMIPDPTAIKPEDWDENEPKWIPDPMFKKPEEWDDSISEYIEDESRSKPDWWNDKVDG
                     RWIAPLIVNPSCYTKQGCGKWRPKMVENEKYRGTWKAEMIPNPNYQGEWKAPLIANPN
                     YYEDKTPANIDAITAISFDIWSSASDISFDNIYVGKSIEEAELVGNSTFLPKLSLEKK
                     ELEVVMEKAHSEDVNEVDTSEESSKKTPYKNVVDKENHLDYLKLIDEKIKSCKTLQTF
                     IAWFLQVDDLYKGFLISAFMVVVVSISCMGMLKFLMWSQGIDLSSSSNASRKPKKIEN
                     ETSDGPSANTVTEIAASTGYSTPSSKVISQRTIQLQGDSDFDEELEISIVEESGSASD
                     SEDK"
     gene            complement(<35333..>35929)
                     /locus_tag="KLLA0_F00484g"
                     /db_xref="GeneID:2895317"
     mRNA            complement(<35333..>35929)
                     /locus_tag="KLLA0_F00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455101.1"
                     /db_xref="GeneID:2895317"
     CDS             complement(35333..35929)
                     /locus_tag="KLLA0_F00484g"
                     /note="similar to uniprot|P39715 Saccharomyces cerevisiae
                     YAL059W ECM1 Protein of unknown function localized in the
                     nucleoplasm and the nucleolus genetically interacts with
                     MTR2 in 60S ribosomal protein subunit export"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455101.1"
                     /db_xref="GeneID:2895317"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT8"
                     /translation="MAKKPISKHSRAARRSEAAEPEAKALETLPRTEKTDFAASLIRT
                     ANKNEQLLEAKLNKRGPRNKKKSLGRVGKQQLDDSSLTSSKVMRVLNVNNRLDGKRER
                     AIHRAKYVQSARKAGWDSTNAKIRDELNILQNIQPVSEEKDQADNQDNGKETGDEQSM
                     DDNEVEVYDSAKVQQSTELPVQPSNVNTFASLEDEVEA"
     gene            complement(<36518..>37675)
                     /locus_tag="KLLA0_F00506g"
                     /db_xref="GeneID:2895318"
     mRNA            complement(<36518..>37675)
                     /locus_tag="KLLA0_F00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455102.1"
                     /db_xref="GeneID:2895318"
     CDS             complement(36518..37675)
                     /locus_tag="KLLA0_F00506g"
                     /note="similar to uniprot|P39714 Saccharomyces cerevisiae
                     YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455102.1"
                     /db_xref="GeneID:2895318"
                     /db_xref="GOA:Q6CLT7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT7"
                     /translation="MRALAYFGKQDIRYTKDLEEPVIETDDGIEIEVSWCGICGSDLH
                     EYLDGPIFFPEDGKVHDVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGT
                     CLDHYTWPNAAHAKDAECAACQRGFYNCCAHLGFMGLGVHSGGFAEKVVVSEKHVVKI
                     PNTLPLDVAALVEPISVSWHAVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIV
                     VSEPAEIRRNQAAKLGVETFDPSEHKEDAVNILKKLAPGGEGFDFAYDCSGVKPTFDT
                     GVHATTFRGMYVNIAIWGHKPIDFKPMDVTLQEKFVTGSMCYTIKDFEDVVQALGNGS
                     IAIDKARHLITGRQKIEDGFTKGFDELMNHKEKNIKILLTPNNHGELDATN"
     gene            complement(<40081..>41226)
                     /locus_tag="KLLA0_F00528g"
                     /db_xref="GeneID:2895386"
     mRNA            complement(<40081..>41226)
                     /locus_tag="KLLA0_F00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455103.1"
                     /db_xref="GeneID:2895386"
     CDS             complement(40081..41226)
                     /locus_tag="KLLA0_F00528g"
                     /note="similar to uniprot|P39713 Saccharomyces cerevisiae
                     YAL061W putative polyol dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455103.1"
                     /db_xref="GeneID:2895386"
                     /db_xref="GOA:Q6CLT6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT6"
                     /translation="MRALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLH
                     ELLDGPNFFPKDGETHEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGT
                     CQDRERYNTKGETCKACKRGMHNVCVHLGLCGCGVQSGGFAEKVVIGEKHCFKVPSWI
                     PLDVAALIQPLAVCWHAVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSEP
                     AKIRRDLAEKMGAIVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSGISVTFESSI
                     KCLTFRGTAINVAVWGDSSVKHYPMDLTSQEKKYTGSMCYTLEDFEDVVDSFTEGKTD
                     FKKAAFMITGKVSLENGMEDAFMRLINDKEGTIKILLTPKEELITWV"
     gene            complement(<42710..>44503)
                     /locus_tag="KLLA0_F00572g"
                     /db_xref="GeneID:2895526"
     mRNA            complement(<42710..>44503)
                     /locus_tag="KLLA0_F00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455105.1"
                     /db_xref="GeneID:2895526"
     CDS             complement(42710..44503)
                     /locus_tag="KLLA0_F00572g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455105.1"
                     /db_xref="GeneID:2895526"
                     /db_xref="GOA:Q6CLT4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT4"
                     /translation="MVIKKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLECIWPNSS
                     NTKDGKVGKKISQVESEDTKFNITHLKLKHRIKYTRTSDLRMEVYVKRRSDELYLYDG
                     KKLQKITKFPRELPPLPKDSTSRYIKYHEKNLLKDECWNSIAPLDLELKEFPFVDIPD
                     GLTIPPYELETPTEEEEKRYIDILQRYHRNEILDDTFFQGVDLESFIFYTCLTGFIPK
                     LGTQYTSPELTVGATFVPFVSFNPIMRQVFLCCGATFLAWKDFDRFQRFSDDYFVSSV
                     NLLRDYMSANPQYYNEDWIFGSTQLLCIRVKNAFFGTVDDSVKFLSDSYKVISHRYFD
                     NRVINPHERMFVESFIYHYSISVLCAKDISKLPSPFVIFKELNKALSCPVYNCENVLE
                     WMKNPVLGSCLDIFEIIAKLSYIARLSMPLTTTWLLKVVQLRNICIKYKHPMPEQPMK
                     EIEWFNFRINSMVGLLTAKSCYLFASKMIDFDNFDAHSSPVKECVKEIIQHFKEIPEG
                     HQIWGILSWTMLVSGSFCTDPEDQDYILQLINKMAETAHSYVGVKMTRFLHDVWNHSD
                     TVTGANGTDISTHKNNINHLFDRERLSQVDM"
     gene            complement(<45305..>46690)
                     /locus_tag="KLLA0_F00594g"
                     /db_xref="GeneID:2895529"
     mRNA            complement(<45305..>46690)
                     /locus_tag="KLLA0_F00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455106.1"
                     /db_xref="GeneID:2895529"
     CDS             complement(45305..46690)
                     /locus_tag="KLLA0_F00594g"
                     /note="highly similar to uniprot|P07262 Saccharomyces
                     cerevisiae and to YAL062W uniprot|P39708 Saccharomyces
                     cerevisiae, GDH3 NADP(+)-dependent glutamate
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455106.1"
                     /db_xref="GeneID:2895529"
                     /db_xref="GOA:Q6CLT3"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT3"
                     /translation="MSAEPYEPEFQQAYNEVYNCLKDSTLFDKKPVYKKVLPVVSVPE
                     RIIQFRVTWENDKGEQEVATGFRVQFNSAKGPYKGGLRFHPTVNLSVLKFLGFEQIFK
                     NALTGLSLGGAKGGLCFDPKGRSDSEIRRVCYAFMKELSRHIGQDVDVPAGDIQVGGR
                     EIGYLFGAYRHYKNSWEGVLTGKDLNWGGSLIRPEATGYGLIYYTEAMIKYASQGKES
                     FEGKRVVISGSGNVAQYAALKCIELGATVLSLSDSKGSVISETGITAEHIYAIQDGRA
                     AWKTLEQIVGEASVFSGSSVKYIAGARPWVHVGKVDVALPCATQNEVSGAEAEHLVAN
                     GVKFVAEGSNMGSTQEAIDVFEGVRLQTASASAPAVWYAPGKASNMGGVAVSGLEMAQ
                     NSARVSWTRETVDAELKKIMTTCFDDCVTTAKEYSNESNVEALPSLVKGANLTGFIRV
                     ADAMLHQGDVF"
     gene            <48832..>50748
                     /locus_tag="KLLA0_F00616g"
                     /db_xref="GeneID:2895530"
     mRNA            <48832..>50748
                     /locus_tag="KLLA0_F00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455107.1"
                     /db_xref="GeneID:2895530"
     CDS             48832..50748
                     /locus_tag="KLLA0_F00616g"
                     /note="some similarities with uniprot|Q12473 Saccharomyces
                     cerevisiae YLL051C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455107.1"
                     /db_xref="GeneID:2895530"
                     /db_xref="GOA:Q6CLT2"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT2"
                     /translation="MMSSFKSPEIPDAEVRLITCNLLAGQFQWGYTKSENDGFFGVCC
                     GNYLPFAQTVMQCFVDLLQGDKVAAITEYTTYCNAYTGTNLSIENSLEQFANGSNHLI
                     SNPGAGANYVPILLSSDVLKQNYYFFYYIYHNFKLAFDCSMMVNISIWIIICLLAIQK
                     RLNCRLLRKVRSRFTSTISTTHHTETKIFRWYLTILPTIGETWFLLIFLIINVLVSTI
                     HYPLYESNTGEGKMVFLVKCVANRTGGLAFGLLPLTVLLAGRNNIISSLTGMPYCTMI
                     FYHKWAARLMTIFGFTHGMLWSGYCLWKEAELLANYLKTTPLFRWGVIITDLSIILVL
                     TSTYMWKSRRYELFLTLHIVLAAVFFYGCYKHCEELGWLGWIYLSVALWVMDRAIRLI
                     KLLRFGGMKLAYCTVLDSEHEIFQVSIPNSGAMRFFPGCYAFLYVWNTRLFWHGHPFS
                     LMKNGTDIIIIIKAKDGMTRELYNKLPKDGTIYPIRAALEGPYGHEAPVENYDHALFV
                     TSGTALPGPISYLQRMHNMKDFHFVWIISNERFLNYMRYALESLLQQKKGNFEIYITR
                     PLSIDISWVPSTLSIHHGRPLLEDIIHQDLSKWKNSVVVSCAMPFVDDQVRNYVAKEM
                     QQGTVDFYDELQVW"
     gene            <51849..>52997
                     /locus_tag="KLLA0_F00638g"
                     /db_xref="GeneID:2895528"
     mRNA            <51849..>52997
                     /locus_tag="KLLA0_F00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455108.1"
                     /db_xref="GeneID:2895528"
     CDS             51849..52997
                     /locus_tag="KLLA0_F00638g"
                     /note="weakly similar to uniprot|P53912 Saccharomyces
                     cerevisiae or YLR460C uniprot|P54007 Saccharomyces
                     cerevisiae YLR460C Hypothetical ORFs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455108.1"
                     /db_xref="GeneID:2895528"
                     /db_xref="GOA:Q6CLT1"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT1"
                     /translation="MTSLKRSLEPFNVLEETIPGVHQEVKRFKNAKTEELYTSLEYVP
                     QTQKGLVVSSFTEDLKLLTDLPVPQKLKPYEILIKNKYIGLNHVDWKSKKYRFSIYSF
                     PWVNGRESSGIVVRRGEKVDEEKFPLGGEVFIASTTYRDLRTSTFQEYTVFDSRLVWR
                     VPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVGIFVVQLAK
                     SLGFTKIITITSKKHEQYLLSLGATHIIHREEKTEDIVNEIKKICPNGVSHGVDLISK
                     KTAETLSSILSAESKLVCAAGCPNKAQVNDPTIKVEAINLKLFHEDLDYGQEFVRYTT
                     ELFEKNRLKPLSNLKLFKGLENFCQGIRNGLRELEERGASAEKYVVAI"
     gene            <54232..>58356
                     /locus_tag="KLLA0_F00660g"
                     /db_xref="GeneID:2895672"
     mRNA            <54232..>58356
                     /locus_tag="KLLA0_F00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455109.1"
                     /db_xref="GeneID:2895672"
     CDS             54232..58356
                     /locus_tag="KLLA0_F00660g"
                     /note="similar to uniprot|Q02979 Saccharomyces cerevisiae
                     YPL110C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455109.1"
                     /db_xref="GeneID:2895672"
                     /db_xref="GOA:Q6CLT0"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CLT0"
                     /translation="MKFGKTFPNHQVPEWSHEYVNYKSLKKLIKEIVAVQDQLYKQEH
                     RVDGKDRENTSVSPPSKPMDVSTRTKDYLNHPEVKTLLAKFFFALDADIQKVDSFYNQ
                     QFLEYDRRLRKLLSSAQFTEFNRALMYGAANGNSGLNHTAGNGNGCLSQPMPTRYNRH
                     QSLTQNGHPGFHVNPDSVNHLMLSSNKATEEAEDWSEVLAILIELRSHFRNLKWYGEL
                     NKRAFRKILKKLDKKVGTSQQETITQSRIAPLEFANDTEINRDLHIINELLNKIFPKV
                     KSLQAETNGVSNTSNGSSDDRNSPLDIFSQLIARDDGESLMNELISVYRSAVLIPTRA
                     LVGLLNKSALSQSFKCIDEILSIIPTLGDPTDISSRNFFHHHVIALGKSHKQIKEEST
                     KSQVDLNSLMTKTLEIEAALPPEPNHRLVGAFGPDGINSNDSPSSLRYILQKLPVHLR
                     PSLLQKDNYKRTPLHYSAQYGLVETSRIIIESLIEWGAWNADIPIDDVHVWGDSEGLT
                     PIHLAVIGTHPLTVRILTSHLGPDTKLNTPRLLHLATRLNSPDLIDALLSVPGFDINY
                     RDLDHLETALYLACKLNLREAAEHLLNRGADMEIGEKLFGWTPIFVAATEGFTDLVKV
                     LKEHGANYDALDESGWSPMEHAALRGHLEITDLLRIEGNEAITNPKIVTDWNVGGASE
                     DINDKKEDSPTVDFYKQGTTTSSSIDIMTDGKPVTNPRKMLTHSLSTGKAISSKDSSQ
                     QESETVKKFGHSYLKSNESIILICLGGNDTRSTKPAVKLNKVPVSKVSSTELDTALSL
                     VISCPDTLSEESFVLDLPFDSNSDSISFKVPYKPDSSHKIIFDIVPTYGYTSSSRSVS
                     PNANTELSSDKAAHNNRGREHQQYREHSSFPGYPTSMSPISMLHAYSNPPHAGNNFLS
                     PEKPKILGRAVALLDTALTSVGSKMRSLYETITVPILGVENLDVLGTVNFEFMNVTPF
                     ENPHMGLARSEKYWKSLVSTRVIGHRGLGKNFNTKNSLQLGENTVESFIAAASLGASY
                     VEFDVQLTKDHVPVVYHDFLVAESGVDIPMHSLTLEQFMDLNNADKHHIHHSSGKVRR
                     RSLDDTDAAILRRSRLLKERGPSLNHIESDKKDPTNGAAGISNKEDSTSSEINPKSVL
                     EENDRFGKTDEISRLFEDRMRLTKTFKKNAFKGNSRGHSIASNFVTLKELFKKIPESV
                     GFNIECKYPMLDEAESEDMGTVVLELGHWVDTVLKVVFDNANGRDIIFSSFNPNVCVM
                     LSLKQPSIPILFLTEAGTTPMADIRATSLQNAIRFAKKWNLLGIVSAAQPIVKAPRLA
                     QVVKSSGLVCVTYGVENNDPDNARIEMDAGVDAVIVDSVLAVRKGLTKENNEKL"
     gene            complement(<58631..>59137)
                     /locus_tag="KLLA0_F00682g"
                     /db_xref="GeneID:2895827"
     mRNA            complement(<58631..>59137)
                     /locus_tag="KLLA0_F00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455110.1"
                     /db_xref="GeneID:2895827"
     CDS             complement(58631..59137)
                     /locus_tag="KLLA0_F00682g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455110.1"
                     /db_xref="GeneID:2895827"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS9"
                     /translation="MILIMVYLFEDQTIRVKRFSWHNEVILKSFSIATMSHSLIVSNI
                     PIHLNNATLDRYLTLKGVQVNILAFPDEYHHINDDAKTKTLQLIAETPETKVKAADIF
                     QDTDCLHEIDELAAEDEKNSGEHGYALGSSGQVHDATHSNQFIVDDVAKQPASNPQSA
                     RRISVTMI"
     gene            complement(<60425..>61384)
                     /locus_tag="KLLA0_F00704g"
                     /db_xref="GeneID:2895828"
     mRNA            complement(<60425..>61384)
                     /locus_tag="KLLA0_F00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455111.1"
                     /db_xref="GeneID:2895828"
     CDS             complement(60425..61384)
                     /locus_tag="KLLA0_F00704g"
                     /note="similar to uniprot|P00812 Saccharomyces cerevisiae
                     YPL111W CAR1 Arginase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455111.1"
                     /db_xref="GeneID:2895828"
                     /db_xref="GOA:Q6CLS8"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS8"
                     /translation="MSSDPRFDFFQQKKLGIVLAPFSGGQPKSGVENGPKYLMKQGLR
                     SDIESLGWETTLEEPLKGRDFESGKNDETDVYGIMKRPNLVGEATKLIYESVKKVSNE
                     GRLAVTLGGDHSIAIGTVAGVLDKYPNAGLLWIDAHADINTCSTTESGNIHGCPVSFL
                     MGLDAKNTPPSLKWVPKCLDPKKIAYIGLRDVDAAERKILKDNGIASYSMYHVDRYGL
                     NKVIEMALEKVAPNGDEPIMVSYDVDAIDPLYVPATGTPVRGGLTLREGLFLVERIAE
                     TGRLVALDVVECNPELASHDGHVVDTITTGCSIARCALGETLL"
     gene            <62828..>64123
                     /locus_tag="KLLA0_F00726g"
                     /db_xref="GeneID:2895829"
     mRNA            <62828..>64123
                     /locus_tag="KLLA0_F00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455112.1"
                     /db_xref="GeneID:2895829"
     CDS             62828..64123
                     /locus_tag="KLLA0_F00726g"
                     /note="similar to uniprot|Q6B2A9 Saccharomyces cerevisiae
                     YPL112C PEX25 Peripheral peroxisomal membrane peroxin
                     required for the regulation of peroxisome size and
                     maintenance recruits GTPase Rho1p to peroxisomes induced
                     by oleate interacts with homologous protein Pex27p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455112.1"
                     /db_xref="GeneID:2895829"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS7"
                     /translation="MNDDFYRPPNIADVSIETEGFEISARNDSMMIQNNSHTPTKLNN
                     LEVTVISSDGGSSGTNASEKNGTLSLSAGESTMGATSRADRTVHNSSKRSDSVKLIKV
                     MNKVDILKAVFATLTGKDRIAKIFKYVIDILRIFIQRSMYYNNKDIDVDAYLKLFSKG
                     NLLTILRNPRLSGKLFLSSSSKLFLEKGALVSSQLGFYRQIMRCGGTPFRLYHWYQKL
                     ISTFYASQKSSTLHSKGLVWYKNWWNEESLSEFIDLYYGIMDELMLLYKLKLWSNKSM
                     HAWVSKHEALSWYYDIMLGLKKNWEKLQSIKQQEFELKIQYQVRQRALELSSKLNATP
                     SVDSNKNTALIKQTIFESFKQDNLDLELEVVQKLKNYQYEKRIVKFDLTRLFFDFLAD
                     TTDVFSIKTPPGTYAILSLCSGVLGFSKLWIQAKEQPNE"
     gene            complement(<64529..>65218)
                     /locus_tag="KLLA0_F00748g"
                     /db_xref="GeneID:2895831"
     mRNA            complement(<64529..>65218)
                     /locus_tag="KLLA0_F00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455113.1"
                     /db_xref="GeneID:2895831"
     CDS             complement(64529..65218)
                     /locus_tag="KLLA0_F00748g"
                     /note="similar to uniprot|Q74ZW6 Ashbya gossypii AGR228C
                     and weakly similar to YOR194C uniprot|P32773 Saccharomyces
                     cerevisiae TOA1 Transcription factor IIA large chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455113.1"
                     /db_xref="GeneID:2895831"
                     /db_xref="GOA:Q6CLS6"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS6"
                     /translation="MSNIEASKVYETVLETVINDVRQEFEDSGVDEQTLQDLKRIWQM
                     KLSESKAATFIWDPENTTSASTVAEPVVKLPNGEFNDNSINHSGAAASAGEADIIGSN
                     INNGSSDMVNNDELQIEDNEMKPKQEIEFSMNDPDGDLTKQLKLQAKQAKKSALLETD
                     EINSDLDDSDDDYVNMDVEDEGTDVNMMLCLYDKVLRVKNKWKCNLKEGVVTIDHKDF
                     AFQKAQGESEW"
     gene            <65967..>67853
                     /locus_tag="KLLA0_F00770g"
                     /db_xref="GeneID:2895832"
     mRNA            <65967..>67853
                     /locus_tag="KLLA0_F00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455114.1"
                     /db_xref="GeneID:2895832"
     CDS             65967..67853
                     /locus_tag="KLLA0_F00770g"
                     /note="some similarities with uniprot|Q08581 Saccharomyces
                     cerevisiae YOR195W SLK19 Kinetochore-associated protein
                     required for normal segregation of chromosomes in meiosis
                     and mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455114.1"
                     /db_xref="GeneID:2895832"
                     /db_xref="InterPro:IPR024312"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS5"
                     /translation="MDFGDKPKLEFAGSGDKLNSPIRLVPDESNKENVHALESDDQQS
                     DKEQTYKRSKIEYSSPEKIEMLNSLSPIKIDIEGNDGIESDLKKSVATAIEEAVQDFK
                     KDSKAEEDEEEAFGKLNNGFRGYHESSTANASGSAGSDAPQHAHCHESLSPIRSYGDK
                     EMPLDPSDPTVWEKKFDDLSSVIWDKYEEIKYLNDTVQNLRERTVEAEFNKERDKLEL
                     IKWEQKYGDVLSKLYRSEHKLEQFDELKLQFDSVSKKFEACKQKLKEVKIELSMTNQN
                     NHILSEKFEKEYTKFTENENLVNEWKDKHDSLLLELNVKTKELKSITDELRSLKEQYE
                     RNENKLSEVESEIQELRKKMEEETIVFQDTIKPRDLSITELNKKLQQFEANGSDEVSS
                     LKSKLQITEAELDSKKNEIESLNLKLSTKETALEELRSHITQVTEDKEKSLSELEQTK
                     RDLDSLTSRNGNIESEHLAELERLHENMSHMETNLKQNVKTIANLNETVNNFENKCKS
                     LEAENIDLKARLTQTETNVNKSETDELRAKIQKLEKMVADSEAETNKKLQLLAEDLYI
                     QYSSKHEQKVKMLKKGYEAKYQDLLDKLTVENNALHDEVDQLQKAVEIERAEKQELIK
                     SLDN"
     gene            <68605..>69786
                     /locus_tag="KLLA0_F00792g"
                     /db_xref="GeneID:2895830"
     mRNA            <68605..>69786
                     /locus_tag="KLLA0_F00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455115.1"
                     /db_xref="GeneID:2895830"
     CDS             68605..69786
                     /locus_tag="KLLA0_F00792g"
                     /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
                     YPL113C Putative dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455115.1"
                     /db_xref="GeneID:2895830"
                     /db_xref="GOA:Q6CLS4"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS4"
                     /translation="MTMTTKFKILIPRKNKNDIASDSAEFQRIAELVDFQYYELTNSE
                     DFKKFLLSSNIDALWITEEMFVYLEAPSTYLDYFPKSLKLILVPWVGTDFYDAKLLKE
                     KYGISLCNGGPVASENVSDLAVFLTLSCFRLTSFWEHSFRFVHRGSIQECRGYIGGTH
                     HDTIPGFALVEGNDDLHKTVSAQQKFPKKPENDKFLNLAKDYKIAGKVMESPTDKNAL
                     IVGFGSIGQAIGKKLHTTFNMNISYTKRNGPIPESVLGYKANYIPSMDDEAFWRDADL
                     IVLALPGTPDTEDIIDKTTLEKCKDGVRIVNVGRGSCINEDDLLDALDSGKVMSAGLD
                     VYKNESDVVDSRFFERWDITLLPHIGSTVIEILQRQTAATLENIEGFFLKGTGTKYPV
                     N"
     gene            <70536..>73673
                     /locus_tag="KLLA0_F00814g"
                     /db_xref="GeneID:2895836"
     mRNA            <70536..>73673
                     /locus_tag="KLLA0_F00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455116.1"
                     /db_xref="GeneID:2895836"
     CDS             70536..73673
                     /locus_tag="KLLA0_F00814g"
                     /note="similar to uniprot|P32873 Saccharomyces cerevisiae
                     YPL115C BEM3 Rho GTPase activating protein (RhoGAP)
                     involved in control of the cytoskeleton organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455116.1"
                     /db_xref="GeneID:2895836"
                     /db_xref="GOA:Q6CLS3"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS3"
                     /translation="MEQFNDSLKETTSSTLKLLEQYENHIQEKDRNLDYIEKGDSRFT
                     KDRETGPSYDECFKENVKLRLKVEEYEKEIKLLKELISKLKENAVPVVNYEQQRLEVE
                     TPKDPTFSLPPRSADRIRHMKDTSEQSQVNVYDLKLPRSPATFQLNNQNFQEELKTNT
                     QFEKALKNDHAYESTPATASTKKDPQDAGKDSLATTGIPNNILGSPATSVTYTTSRIS
                     INSNSPNINNKPHLKRPKSPATLPNGALSPQRANRVTHLINNELHSPLKDQFSDVDKD
                     FVDDTASTSGDDITGSFIQMSPAAQRIIKEDETIMEFSPSSKQNLNKFTDLINKTFGD
                     DDSQIKGPPEKESAAAVRPPVFDPPLPRADSKVLASPVMIQNAANNLTPSGLSFPQKT
                     DISTHDLLKIVSQDNVSAISSSTSIHKSFSPKSVSSLSRIQPPNHHTSSIDMGSPYNG
                     EVPQSDSVLHSPNIISDIPLFVQPEDFSTIAVEASSTLYSNPEDASKCILCSVIDKKS
                     SKEMFKFAKSLDQLYELDHMLKIRLMEQYHLPELPKKQLFQTTVPVKVDLRRELLTDY
                     LLALFELSNLSPVMSLKLAQFISTDTAISVPIGMTDSVKEGVLLVRKNKALGSGNSWK
                     VRQAVIEDQTLLLFDQENLVESIKLVSSTIELQANLPDDKYGTKNGFILNEPKKSGLS
                     STSRHYFGAETAKQREEWISALIKVCSNSVANIKADTLSSAQDQGSISDASVDTSSSA
                     AIGPMVNLEMLGKSQQVEPATTEMDRETKRNRMRSFFPFKKNQPQLSTSSLDITKESD
                     ETSAERSFASALHGMNLHDEAISNVVFGSDIKHCLSLSSRVYQNTHEIPTVVYRCLEY
                     LYKNRAINEEGIFRLSGSSALIKTLQEQFDKEYDVNLCEYNASHEGSLKNGPYLDVNT
                     VAGLLKLYFRRLPHLIFGDDMYEECRVIAERNSGKPTETALQFRELVSNKRFEMENYS
                     LMFVLFELLMKINENNKVNKMNLRNLCIVFSPTLNIPVNILQPFVEDFQCIFNGSDPV
                     NNDDRQNINLQIPQM"
     gene            complement(<73932..>75044)
                     /locus_tag="KLLA0_F00836g"
                     /db_xref="GeneID:2895837"
     mRNA            complement(<73932..>75044)
                     /locus_tag="KLLA0_F00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455117.1"
                     /db_xref="GeneID:2895837"
     CDS             complement(73932..75044)
                     /locus_tag="KLLA0_F00836g"
                     /note="highly similar to uniprot|P32875 Saccharomyces
                     cerevisiae YOR196C LIP5 Protein involved in biosynthesis
                     of the coenzyme lipoic acid"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455117.1"
                     /db_xref="GeneID:2895837"
                     /db_xref="GOA:Q6CLS2"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /translation="MLKPGIRSVQKRFITETVVRSTQPSVSRRRKTTHFTDKLNKGPS
                     FEDFVNGNAQKFTLDPLEKARQNSEEVQRLPTWLKVPIAKGSNFHKLKNDVKELKLST
                     VCEEAKCPNIGECWGGGDKSKATATIMLLGDTCTRGCRFCSVKTNRKPSAPDPTEPEN
                     TAEAISRWGLGYVVLTTVDRDDLVDGGAYHLAETVQKIKQKAPNILVETLSGDFRGDL
                     EMVKVMALSGLDVYAHNMETVEALTPHVRDRRATYRQSLSVLECAKKTVPTLVTKTSV
                     MLGLGETDEQVLQTMKDLRAIGCDVITFGQYMRPTKRHMKVVEYVTPEKFDYWKQKAL
                     ELGFLYCASGPLVRSSYKAGESFIENVLRGRSRARI"
     gene            <75779..>76075
                     /locus_tag="KLLA0_F00843g"
                     /db_xref="GeneID:9487428"
     mRNA            <75779..>76075
                     /locus_tag="KLLA0_F00843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999377.1"
                     /db_xref="GeneID:9487428"
     CDS             75779..76075
                     /locus_tag="KLLA0_F00843g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999423.1"
                     /db_xref="GeneID:9487428"
                     /db_xref="UniProtKB/TrEMBL:B5FV94"
                     /translation="MKLLLSIYLVHVQEEPEQLQVDEVEPLHEQPEEDIVIDLFVCVL
                     VSETYPFVEFFKLNEWVFKMLKVVSSVQRSTLRDSNCSVIYVFLVDMFPYESPV"
     repeat_region   complement(76710..77104)
                     /rpt_type=long_terminal_repeat
     gene            complement(<78519..>80666)
                     /locus_tag="KLLA0_F00858g"
                     /db_xref="GeneID:2895833"
     mRNA            complement(<78519..>80666)
                     /locus_tag="KLLA0_F00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455118.1"
                     /db_xref="GeneID:2895833"
     CDS             complement(78519..80666)
                     /locus_tag="KLLA0_F00858g"
                     /note="similar to uniprot|Q02959 Saccharomyces cerevisiae
                     YPL116W HOS3 Trichostatin A-insensitive homodimeric
                     histone deacetylase (HDAC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455118.1"
                     /db_xref="GeneID:2895833"
                     /db_xref="GOA:Q6CLS1"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6CLS1"
                     /translation="MSQDPLHNFKVQFEKFVASNPNVSSVTSSASRIPESSKAVIVLS
                     PYSLSHQFPRYWVSKSYKKTIVERPERLLACCIGVSAAITMYPALFSVKTSNHHKTSL
                     LAPHVLKVHGKDWPRELLKLCKESEKKIDNEEVEVPPDWNVGDIYLSKHTIAALEGSI
                     GALEIGVDSIFQGVSVEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEK
                     YDVTHAVILDFDLHHGDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAE
                     FPKVGYFSLHDINSFPTELGYATKENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVK
                     LYQTKYRSIFAKADEFFKNAKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNV
                     PTSFYNLFTKDALKLAQMHSNGKIISVMEGGYSDGAIASGVFSHLIGFQNQNWISEWG
                     SEQVVKEIIRGCKPRWKPYKTKKARDVIRIWAEEVIMLGRSMIPEFEKVLFDTEDTVT
                     HPEVRLTRSKYHETIVKHENEIPRTETPTPVRREKPSEQPKDENVPFVDQILPSDEEN
                     EEDEDYIYDEELNKTFNRTVEDITIDDISRHLETLDIIQAKEDEEEQEQEHHGDNGQS
                     HRARTRVPVNSHQRNSRNVSESSNSSSTQETGSNVGGYKIPSNTTTRHLRSNRHSRLL
                     NFDDSDISMISHGSPPRPKTRSSSSKNGGSNRW"
     gene            <81734..>83035
                     /locus_tag="KLLA0_F00880g"
                     /db_xref="GeneID:2895835"
     mRNA            <81734..>83035
                     /locus_tag="KLLA0_F00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455119.2"
                     /db_xref="GeneID:2895835"
     CDS             81734..83035
                     /locus_tag="KLLA0_F00880g"
                     /note="similar to uniprot|Q08601 Saccharomyces cerevisiae
                     YOR197W MCA1 Putative cysteine protease similar to
                     mammalian caspases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455119.2"
                     /db_xref="GeneID:2895835"
                     /db_xref="GOA:Q6CLS0"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /translation="MYPGRAKPTYNNQQAQQAQSQVGYQTGYSNAQPQQQYYTAPQQQ
                     NVSGSSMSFQHQFYPPPNQSPPQYNTGQYARPAAPPPGQQNYRNDIQQNHASGTVNGP
                     SGYQQPQAMYKPPSQVQHTGPNNQVAYQYSQCTGRRKALLIGINYFGSANELRGCIND
                     SHNMFNFLTQRYGYKAEDIVMLNDDTTDPVRVPTKANMLRAMQWLVKDARPNDALFFH
                     YSGHGGQTEDLDGDEEDGMDDVIYPVDFQMAGHIVDDDMHAIMVSPLQPGVRLTALFD
                     SCHSGTVLDLPYTYSTKGVIKEPNMWKDVGSSGLQAAMAYATGNTTSLVSSLGNVFTT
                     ITKSNNNVDRERVKQIKFSPADVIMFSGSKDNQTSADATENGQNTGAMSWAFLTVLSK
                     QPQQSYLSLLQNMRAELSSKYTQKPQLSCSHEIDTNLQFLL"
     gene            complement(<83326..>84729)
                     /locus_tag="KLLA0_F00902g"
                     /db_xref="GeneID:2895838"
     mRNA            complement(<83326..>84729)
                     /locus_tag="KLLA0_F00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455120.1"
                     /db_xref="GeneID:2895838"
     CDS             complement(83326..84729)
                     /locus_tag="KLLA0_F00902g"
                     /note="similar to uniprot|P38934 Saccharomyces cerevisiae
                     YOR198C BFR1 Component of mRNP complexes associated with
                     polyribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455120.1"
                     /db_xref="GeneID:2895838"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR9"
                     /translation="MSTARPKQHIQKPDVTVRDKKLEPLNVQLKKIDQELSLIKQQID
                     NTDFSKDAKNSKEKLQGELKEVIKTQSDLKAKRQQIHDQIKFLDAQIKRKSGEINDLV
                     GKNKKFQNVGQIKQRLAEIDDEIASGDLSLVEERLRVKEMQSLHKLSKDFQVVEPIRK
                     SIEEEKEQIDALKKELNASNPKEVAAKFETIQGQINNLNSKNQVVYDKRKTLITKRSA
                     LYNKRDEIYTQIRKIRGDFDNEFKSFKKKLDEQRLKREEDEKLSKILEDKEEKVGKLQ
                     ERLNHAKQPAFTFELESIENMLTVLDPTYVKPVKNVLGIDFGSTSQQTATPTKTVDSE
                     GLVPIVKEREGFFSASTASKSKKHKKKAQSTKFSLEPSMIALLAELDIRVPLSKGDVP
                     ATVEQLKAKHEDLTAKQPEATEKNIAEAEEQLKKLNLEYEAKEQKVKEEIEAKKLKEQ
                     KEKEDAAAADAAVPTEA"
     gene            <85633..>86469
                     /locus_tag="KLLA0_F00924g"
                     /db_xref="GeneID:2895839"
     mRNA            <85633..>86469
                     /locus_tag="KLLA0_F00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455121.1"
                     /db_xref="GeneID:2895839"
     CDS             85633..86469
                     /locus_tag="KLLA0_F00924g"
                     /note="highly similar to uniprot|P15496 Saccharomyces
                     cerevisiae YPL117C IDI1 Isopentenyl
                     diphosphate:dimethylallyl diphosphate isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455121.1"
                     /db_xref="GeneID:2895839"
                     /db_xref="GOA:Q6CLR8"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR8"
                     /translation="MSTQTSTYADLVHSLEQDDILEKFPEVIPLNNRPNTHSTESSGE
                     TDNLLDGYDEEQIRLMNENCIVLDWNDTAIGAGTKKLCHLMENINQGLLHRAFSVFLF
                     DSDGKLLLQQRATEKITFADLWTNTCCSHPLCVDDELGLNGSLESKIEGARTAAVRKL
                     EHELGIPPQEVESKGEFHFLNRIHYMAPSDGAWGEHEIDYIFIYQLRKGETLTVEPST
                     NEVRDIAWVSQEELKQMFADGNLKFTPWFKLICDNYLFQWWNQLNDLNKVENDTKIHR
                     MM"
     gene            complement(<86695..>87897)
                     /locus_tag="KLLA0_F00946g"
                     /db_xref="GeneID:2895840"
     mRNA            complement(<86695..>87897)
                     /locus_tag="KLLA0_F00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455122.1"
                     /db_xref="GeneID:2895840"
     CDS             complement(86695..87897)
                     /locus_tag="KLLA0_F00946g"
                     /note="similar to uniprot|P25270 Saccharomyces cerevisiae
                     YOR201C MRM1 Ribose methyltransferase that modifies a
                     functionally critical nucleotide in mitochondrial 21S
                     rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455122.1"
                     /db_xref="GeneID:2895840"
                     /db_xref="GOA:Q6CLR7"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR7"
                     /translation="MLRNITRSYSNKIRSAVKVPNESYIKDRKVTFDRNFPVHKRTKA
                     WEKDGMDKDKWFRKNYAHVHAREKNARLNNGGSDPFDKKKKYYDRIKQEESSKREQFR
                     SHRSEYTKMHPLQGLKPNPLVDYVFGTNSVISALTAKKREYFVKLHHYGPLNTQIQSL
                     CSKNNIQTEEVDKHRLNLYTNYAVHNNVVLECKPLQPPELSHLGLVNHEACTFDKSEI
                     DYDQAVNTREKFMTNDNKKNPLGIYLDEVVDPHNVGAIIRSAYFLGADFMVLSHKNCA
                     PLSPVVSKVSSGTMELLPIFTTAKPLQFFEKSKQDGGWMFVTSHMSISQKGNHLTMNE
                     LSGMLNELPVVLVVGNEGNGVRTNLLNRSDFTVEIPFGRDPTEGRNTIDSLNVSVATA
                     LLINGFLN"
     gene            <88262..>88927
                     /locus_tag="KLLA0_F00968g"
                     /db_xref="GeneID:2895841"
     mRNA            <88262..>88927
                     /locus_tag="KLLA0_F00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455123.1"
                     /db_xref="GeneID:2895841"
     CDS             88262..88927
                     /locus_tag="KLLA0_F00968g"
                     /note="highly similar to uniprot|P06633 Saccharomyces
                     cerevisiae YOR202W HIS3 Imidazoleglycerol-phosphate
                     dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455123.1"
                     /db_xref="GeneID:2895841"
                     /db_xref="GOA:Q6CLR6"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /translation="MTYPERKAFVSRITNETKIQIAISLNGGPISIENSILQREESDA
                     AKQVTGSQIIDIQTGVGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALG
                     QAFKEALGHVRGVKRFGSGYAPLDEALSRAVVDLSNRPYAVIELGLKREKIGDLSCEM
                     IPHFLESFAEAARITLHVDCLRGFNDHHRSESAFKALAIAIKEAISSNGTNDVPSTKG
                     VLM"
     gene            complement(<89152..>90210)
                     /locus_tag="KLLA0_F00990g"
                     /db_xref="GeneID:2895842"
     mRNA            complement(<89152..>90210)
                     /locus_tag="KLLA0_F00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455124.1"
                     /db_xref="GeneID:2895842"
     CDS             complement(89152..90210)
                     /locus_tag="KLLA0_F00990g"
                     /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
                     YPL118W MRP51 Mitochondrial ribosomal protein of the large
                     subunit MRP51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455124.1"
                     /db_xref="GeneID:2895842"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR5"
                     /translation="MSHISNLLKNSRIAQVAKTDKPLFRPGNSSHPTHQVIETKPSSL
                     YRQEWGLKASIPSKIKTRYLVYNDLDTQQRLTTFEPMGQYQWNRIRFQEMGLAPRYVE
                     EESNPLFNGKTKRAGKYAPFSNAVNIAHNTAPSEKTRKLKEIDQHRSEFKKWLLEKHP
                     DSIAGVRNENTRPLKALATEFLHEKMGKLNINTAANSEWHIVGTGGLTYNLKGRLRQS
                     PNGVKQKHVVPGRVLSVQGPDRAVAVGGFIAEAKSVGRNPRALQYNMGDFVRQEVLPF
                     AIEDPKVEGGNVTLSASLVEPRNDFSFAQKIGLGQSRSHYTRSDSRNSSRKTVRSVTA
                     EESRSQSEEFLNLLKTTM"
     gene            complement(<90772..>92442)
                     /locus_tag="KLLA0_F01012g"
                     /db_xref="GeneID:2895856"
     mRNA            complement(<90772..>92442)
                     /locus_tag="KLLA0_F01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455125.1"
                     /db_xref="GeneID:2895856"
     CDS             complement(90772..92442)
                     /locus_tag="KLLA0_F01012g"
                     /note="similar to uniprot|P48813 Saccharomyces cerevisiae
                     YDR508C GNP1 High-affinity glutamine permease also
                     transports Leu Ser Thr Cys Met and Asn"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455125.1"
                     /db_xref="GeneID:2895856"
                     /db_xref="GOA:Q6CLR4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR4"
                     /translation="MTEECLKEVATFSNLSDPTRTNSIDTTADVTLPKNELKQSIKPF
                     HVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVGELVVAFPS
                     MPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINFWNENINPSIVVA
                     LCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNTGVVGTSGYLGFKYF
                     HSPGFFRNDEGLFKSIAATLITACFSTGGTEFVALSCAEQNTEDMPRSIKRASIQVVV
                     RIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIPHIVNAIIL
                     LSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFIAE
                     YKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGS
                     YISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGNWK
                     PFIRAPEIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKLSDNLVK"
     gene            <93422..>95305
                     /locus_tag="KLLA0_F01034g"
                     /db_xref="GeneID:2895858"
     mRNA            <93422..>95305
                     /locus_tag="KLLA0_F01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455126.1"
                     /db_xref="GeneID:2895858"
     CDS             93422..95305
                     /locus_tag="KLLA0_F01034g"
                     /note="similar to uniprot|P06634 Saccharomyces cerevisiae
                     YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
                     helicase required for translation initiation of all yeast
                     mRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455126.1"
                     /db_xref="GeneID:2895858"
                     /db_xref="GOA:Q6CLR3"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSDIAENMSNLSVQDNDSGATSGDSRRSYVPPHVRGQQRSGSGN
                     YRGRSDNFGGNERSFFGNERRGGGYSRGGRGSVNWGGSNWGGRNDSRGSGGYGGGNSS
                     GRWIDGKHVPAAKNANLELELFGVAEDKSFQSSGINFDNYDDIPVEASGNDVPEPISE
                     FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVL
                     SESFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVV
                     YGGASIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFE
                     PQIRRIVEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENIT
                     QKILYVEDFDKNDTLLDLLAASNEGLTLIFVETKRAADSLTDFLIMEGFKATAIHGDR
                     TQGERERALSAFKTGRATILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTG
                     RAGNTGVATTFFNRGNKNVAKELVSLLSEANQEVPSFLTTIMREASSGRGGARGGRGG
                     YNRGNSTRDFRRGGAPSGGFSSGGGSSGGWGNGGGSSGGWGNSSGNWGNSSNSSNSNS
                     GWW"
     gene            complement(<96166..>97656)
                     /locus_tag="KLLA0_F01056g"
                     /db_xref="GeneID:2895859"
     mRNA            complement(<96166..>97656)
                     /locus_tag="KLLA0_F01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455127.1"
                     /db_xref="GeneID:2895859"
     CDS             complement(96166..97656)
                     /locus_tag="KLLA0_F01056g"
                     /note="similar to uniprot|Q02939 Saccharomyces cerevisiae
                     YPL122C TFB2 subunit of TFIIH and nucleotide excision
                     repair factor 3 complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455127.1"
                     /db_xref="GeneID:2895859"
                     /db_xref="GOA:Q6CLR2"
                     /db_xref="InterPro:IPR004598"
                     /translation="MSLNLFKTTVNDYLEGLPEQVQSRLYESPATCLAIYRLLSPMAK
                     FFIMSMLFQDHDVSLRDLDKWVKPDAKYQLQYSIKSMKSLNLIIEGESKQPLLIRLNP
                     IFKKSFKNVLTGGEINNSFGDVADDDTNPVSTATLDQYSAEKWETILHYMVGTPNTNT
                     PGGKVLDLLQHSGLMEEAEYGELKITNQGFQFLLQDVNAQMWTLLLQYLKMAESLQMD
                     PVDVLNFIFMLGALQLGKAYKCDQLSNTQRTMLQDMRDYGLIYQNQSDYAKFYPTRLA
                     TLLTSDTKAFRSASVALDSVLNKANETTAVEGDSGQDETTERTQDGALIIETNFKLYS
                     YSNSPLQIAILSLFVHLKSRFANMVTGQLTRESVRNALLNGITAEQIIAYLETHAHPR
                     MRRLAEENLSKKLELDPTVKETLQVLPPTVVDQIRLWQLELDRIISYDGYLYTDFESY
                     QEYQTVADYAKDIGVLLWQNEKKKMFFVSTEGNSQVLDFHRRNFDK"
     gene            <98331..>101759
                     /locus_tag="KLLA0_F01078g"
                     /db_xref="GeneID:2895857"
     mRNA            <98331..>101759
                     /locus_tag="KLLA0_F01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455128.1"
                     /db_xref="GeneID:2895857"
     CDS             98331..101759
                     /locus_tag="KLLA0_F01078g"
                     /note="highly similar to uniprot|P22276 Saccharomyces
                     cerevisiae YOR207C RET1 second-largest subunit of RNA
                     polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455128.1"
                     /db_xref="GeneID:2895857"
                     /db_xref="GOA:Q6CLR1"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR1"
                     /translation="MNHTDSHNPDGYEKDEAFDALLKPVFKGKKLTDEINTAEDKWNL
                     LPAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANEVILSDVDPEFYLKYIDIRVGYKHN
                     GNKAIMTPPHECRLRDMTYSTPIFVDIEYTRGRSIVLHRDVEIGRMPIMLRSNKCILD
                     GAAENDMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKNIVQASVTS
                     STHERKSKTYVVTKNDKIYLKHNSIAEEVPIVVVLKACGVVSDLEIMQLVCGNDSSYQ
                     DIFAVNLEEAAELKIYTQQQALEFIGTKVKTVRRQKLSILQEGIEAIATTVIAHLTVE
                     ALDFREKALYIAMMTRRVVMAIDNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFN
                     NDFKANIDKVLKKPNRAEMYDALLTINVHSNNITTGMNRAISTGNWSLKRFKMERAGV
                     THVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVK
                     NLALMTHITTDDEEEPIKRICYLLGVEDISLIDSASIHLNYGVYLNGTIIGTTRFPTK
                     FVSQFRCLRRTGRASEFISIYTNTHQKAVHIATDGGRICRPLIIVSNGQSSVTADHLR
                     SLLAGKLQFDDFLKLGLVEYLDVNEENDSFIALYEKDLSENITHLEIESFTVLGAVAG
                     LIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELI
                     DYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCETRRKNTTVLKRYPNHT
                     QDIIGGMRVDENGEPIWQHQALGPDGLGEVGMKVESGQIYVNKSVPTNASDSILTQTQ
                     AQYKETPVVYRAPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGV
                     CGIIVKQEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCF
                     GGSKLEDMSKILVDNGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHA
                     RARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVC
                     EKCGLMGYSGWCTSCKTAEHVVKMTIPYAAKLLFQELLAMNIAPRLKLGDVFEA"
     gene            complement(<101843..>102499)
                     /locus_tag="KLLA0_F01100g"
                     /db_xref="GeneID:2895861"
     mRNA            complement(<101843..>102499)
                     /locus_tag="KLLA0_F01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455129.1"
                     /db_xref="GeneID:2895861"
     CDS             complement(101843..102499)
                     /locus_tag="KLLA0_F01100g"
                     /note="similar to uniprot|P32489 Saccharomyces cerevisiae
                     YPL121C MEI5 Meiosis specific protein involved in
                     DMC1-dependent meiotic recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455129.1"
                     /db_xref="GeneID:2895861"
                     /db_xref="InterPro:IPR018468"
                     /db_xref="UniProtKB/TrEMBL:Q6CLR0"
                     /translation="MSNVMNFEGDSETTLVQENDSFSDILPKLSCRNPEERSTGSVLL
                     LKEIRRLENDLDRQIRDLTKKEFALKRAVKIMQTYDNELKTIELINKWRSICQCGMSY
                     MLNTILVKIDRMGGYQEYKRKEIEARKRQVEYQYDDGIQQQMEEILESPDFFHLPIEE
                     KEEIRERMDEKVREAEEMKQNELQKFENELRKEDNDEMTLQELAAKLKVDYDMVYTNQ
                     "
     gene            complement(<102765..>104903)
                     /locus_tag="KLLA0_F01122g"
                     /db_xref="GeneID:2895860"
     mRNA            complement(<102765..>104903)
                     /locus_tag="KLLA0_F01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455130.1"
                     /db_xref="GeneID:2895860"
     CDS             complement(102765..104903)
                     /locus_tag="KLLA0_F01122g"
                     /note="similar to uniprot|P39744 Saccharomyces cerevisiae
                     YOR206W NOC2 Protein that forms a nucleolar complex with
                     Mak21p that binds to 90S and 66S pre-ribosomes as well as
                     a nuclear complex with Noc3p that binds to 66S pre-
                     ribosomes both complexes mediate intranuclear transport of
                     ribosomal precursors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455130.1"
                     /db_xref="GeneID:2895860"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ9"
                     /translation="MGKVSKATKKFQTKHLKHTLDHRKKLKDHSKRTAGRRGNKTEEE
                     KNAAALTKEDQKLKKSAKEEVFNDMKVEEFFDNGFDIPKMSKKMAKETEKASKVKDND
                     SESSAEEDEDVKMDMEDLAKKDPDFYKYLAENEPDLLSFKSTNPLDEISDDEEGQVGE
                     EEELKEPDLSKSKKEEKDSKIAVDIKLVNKWKKDLKNSPSFKTIRSVVSAFKAAVNMN
                     NEENVDDYKFTVLDEKAFHELMFVALVDMPKAVQKLTPYRVSKNETRTLPSNKNVTKL
                     SSVLKSHVPSLIVLLSDITNTDVASMILHSTYELLPYFISFRRLLKELISQVVEVWST
                     TGDVETQIATFAFLNNASREYKKALLEVVLKSTYSTFIKSCRKTNIRNMPLINFQKNS
                     AAELFGIDDVISYQSGFEYIRQLAIHLRNSINATTKRSSKVDPSSAYKIVYNWQFCHS
                     LDFWSRVISIQCNPEKENGHESPLRQLIYPLVQVTIGVIRLIPTAQFFPLRFYLIRSL
                     IRLSQNTGIFIPVYPLLSEILSSTAFTKKPRKSTLPAFDFDHNIKCTQAYLGTKIYQD
                     GLAEQFVDLLGEYFVLYSRSVSFPELTTLAVISLRRYIKNSENVKFNKMLQNVVDKIN
                     QNAQFITKKRSDVDFGPNNRTEVEKFLNEISWKDTPLGSWVAIQNEVKEEKARLLRES
                     LESDDDEEEENISDGAQDIVMDDAESEADE"
     gene            <105169..>106983
                     /locus_tag="KLLA0_F01144g"
                     /db_xref="GeneID:2895862"
     mRNA            <105169..>106983
                     /locus_tag="KLLA0_F01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455131.1"
                     /db_xref="GeneID:2895862"
     CDS             105169..106983
                     /locus_tag="KLLA0_F01144g"
                     /note="similar to uniprot|Q08622 Saccharomyces cerevisiae
                     YOR205C FMP38 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455131.1"
                     /db_xref="GeneID:2895862"
                     /db_xref="GOA:Q6CLQ8"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MNSASNMVIDMLGKVSTKDATNCKQNVERCNSFEPLLIRVLRYM
                     HQKIVVVLPFMKSRLQAFKQFTRFVSCKSCGVELQSKNPSVTGYYKPPRAVRKDAGTI
                     EDLKYLMFTQELQLKKHEIGLLDPDTDPDYKEPIPKRLVCKRCVDAISHNRYNSSDFP
                     IHSFNDIKGALPHAANVYHVVSLSDFPLSLDKTILAEKNNRNYLLLSKADQITYKSSM
                     LPHKGSAFFAEFCRRHIGVHVKKVVLFSNPRNWNIPSVINALAKRCYLLGNPNVGKTS
                     LINSLLHEKSTSFQAQLDKRGNVIGPPKGHEQIQSTRRRAIFNEGGVSHIPNFTRTMQ
                     TYLIEDKVVNDLPGYTMDPTKVSDLANYIEKETLDNIRKTSKFKIDKLIKQNYTSLTG
                     SKTGKCLSFGGIFHLVPPNSTINQVVNYIPLPEHEFSNVEKAVSLSLEVLQSENHSLR
                     QFFALKKPFTDIKMFDRHVIPPFNGAIEIVLKDIGYFQVKPTGKYGFNGLYELWVPKG
                     IRVCIREPLSKLISKSYEKYIESGDIADVCPTDRPLISDTYIMNHTEEDTFARMREMY
                     INRTSKDILSRRLLQKDPNDIVGTLQSPPSNLYWYYKW"
     gene            <107298..>108683
                     /locus_tag="KLLA0_F01166g"
                     /db_xref="GeneID:2895863"
     mRNA            <107298..>108683
                     /locus_tag="KLLA0_F01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455132.1"
                     /db_xref="GeneID:2895863"
     CDS             107298..108683
                     /locus_tag="KLLA0_F01166g"
                     /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
                     YPL120W VPS30 Protein required for sorting and delivery of
                     soluble hydrolases to the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455132.1"
                     /db_xref="GeneID:2895863"
                     /db_xref="GOA:Q6CLQ7"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ7"
                     /translation="MTDLTLRCMHCHSMLEIDVSLMDLSMAQRDLLVSSDANTSGKDS
                     SANSNQIPADKLKVMKEVKQPSQLRLTKPGNIASDSYVFLTDTEYSLQKSKIGGDESG
                     DEEDYDDRNKTLSSRINALGNIFNILSSKNNVDYPVCQGCCDTLLEKLKEEYNQELKK
                     RDTYHDFMKRIQEHKNVNGINIGDNRALEELSSLKKEKEQLLRELQRLEDEDEKLQKE
                     TILLQEELAKKKDQYIVRLQKQNIQELEQLTFIKDVQSLKNQRVVTLNHIDKLRKLNI
                     YNETFRISHDGPFGTINDLKLGSVPNASVPWSEINSALGQVVLLLSLIAEKLSVSFTD
                     YKLIPMGSTSSIEKFDPKTNQWFVHKAFSGDEFSFGSLFHKESAIDKALTCILEIISL
                     LSAKVSSDSQDPASIELPYEILGDKINGLTILLNGATPSLEWTTSCKFLLTNVKWLLA
                     FSTAHIDKNKP"
     gene            <109136..>111703
                     /locus_tag="KLLA0_F01188g"
                     /db_xref="GeneID:2895877"
     mRNA            <109136..>111703
                     /locus_tag="KLLA0_F01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455133.1"
                     /db_xref="GeneID:2895877"
     CDS             109136..111703
                     /locus_tag="KLLA0_F01188g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
                     reductase (RNR) and to YIL066C uniprot|P21672
                     Saccharomyces cerevisiae YIL066C RNR3 Ribonucleotide-
                     diphosphate reductase (RNR), large subunit; the RNR
                     complex catalyzes the rate-limiting step in dNTP synthesis
                     and is regulated by DNA replication and DNA damage
                     checkpoint pathways via localization of the small
                     subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455133.1"
                     /db_xref="GeneID:2895877"
                     /db_xref="GOA:Q6CLQ6"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ6"
                     /translation="MTENIELWDASSSHKETFNKDKLKKFLQTLTFSLNAEYIELDTL
                     VEKILVGIPNEPTERSKFVSYVAETVAGSTSAHPDYSILAARVEIRELHRIIGDATFT
                     ENLAKLRKISREVTEDATKRRKITRDLSKNLISDEFYQYALKFKDKIDQAIDKSRDYN
                     FTYFGWKTLCKSYLMKRNNEQTHETPQFMFMRVALAIHGPFDDIDSVLETFELMSQKY
                     FIHASPTLCNSGTVNQYLSSCFLVGMEDDSIDGIYKTLHKTALISKASGGVGIHVSNI
                     RANGAYISGSNGTSNGLVPMLRVFNNTARYVDQGGNKRPGAFCIYLEPWHADIIDFLQ
                     LRKNHGKEEMRARDLFYALWIPDLFMKRVENNEDWSIFSPDEAPGLTDCYGDEFDKLY
                     ERYEKELIPRKKMKAQQIWSEILQSQTETGVPFMLYKDACNKKSNQKNLGVIKSSNLC
                     CEIVEYSSPEEVAVCNLASVALPTYVNLSSDGPPVFDFVKLHHVVKVLVKNLDRTIDV
                     GKYPVPEARNGNIRNRPLAIGVQGLADTFMLCRTPFESVDAATLNKQIFETIYHAAIE
                     ASTELAELFGHYESFPGSPASEGQLQFDLWSLNKDNYKFLFDDWDSLKSRITKGKGLR
                     NSLLVGPMPTASTSQILGFTESFEPMTSNIYSRRVLSGEFTIINQYMVDDFCQLGIWN
                     EKLKNRILRDNGSIQTIEGIPEEVKNLYKTVWETSQRKMIDLSSDRAPFIDQSQSLNL
                     YLREPTMGKLTAMHFYTWKKGLKTGMYYLRTQAASRAIQFTLNDENTLLDKVTTKVKD
                     SRPLHPKKFLGQYPKHANDDNHKADKILPIEDTYGIHDSTPLVCNIIEGSTCESCSG"
     gene            <112835..>114331
                     /locus_tag="KLLA0_F01210g"
                     /db_xref="GeneID:2895878"
     mRNA            <112835..>114331
                     /locus_tag="KLLA0_F01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455134.1"
                     /db_xref="GeneID:2895878"
     CDS             112835..114331
                     /locus_tag="KLLA0_F01210g"
                     /note="similar to uniprot|P37292 Saccharomyces cerevisiae
                     YBR263W SHM1 Serine hydroxymethyltransferase
                     mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455134.1"
                     /db_xref="GeneID:2895878"
                     /db_xref="GOA:Q6CLQ5"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /translation="MLSRSARCSRAVLFSAKRSLASQANTGANASANQVMVSKHVQDI
                     DPEMYDILTKERKRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNQ
                     FIDMAESLCQKRALELYNLDPQLWGVNVQPLSGAPANLYAYSAVMETNDRLMGLDLPH
                     GGHLSHGYQLPSGTKISYISKYFQTMPYHVDSQTGIIDYDFLSKTSKLFRPKVIVAGA
                     SAYSRVLDYKRFKEIADACGAYLMSDMAHISGLVAAGVTRSPFEYSDIVTTTTHKSLR
                     GPRGAMIFYRKGVRKVTKKGKEVLYDLDKRINFSVFPGHQGGPHNHTISALAVALKQA
                     ATPEFKEYQAAVVENARIFGEELVKKGFELVSGGTDTHLILINLSNLGIDGARLETLL
                     ENINIAANKNTIPGDKSALFPSGLRVGTPAMTTRGFGPQEFAQVAAYIDRAVKLAIGI
                     KSQESPDAKDARSKLASFKELCKESDQVKQLADEVYQWVGEFPVPGEL"
     gene            complement(<114430..>115062)
                     /locus_tag="KLLA0_F01232g"
                     /db_xref="GeneID:2895879"
     mRNA            complement(<114430..>115062)
                     /locus_tag="KLLA0_F01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455135.1"
                     /db_xref="GeneID:2895879"
     CDS             complement(114430..115062)
                     /locus_tag="KLLA0_F01232g"
                     /note="similar to uniprot|P36019 Saccharomyces cerevisiae
                     YNL093W YPT53 Involved in vacuolar protein sorting and
                     endocytosis GTP-binding protein of the rab family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455135.1"
                     /db_xref="GeneID:2895879"
                     /db_xref="GOA:Q6CLQ4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ4"
                     /translation="MTESTYISTVKLVLLGESSVGKSTIVTRFTTGEFHINSPTIGAA
                     FSTKAMEWVDSEDGIKRRVNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTQLASE
                     KKAQSWIDELNNYLEDYKKDTVQLRVVGNKIDLVDEETLQNWNDAELVSAKTGEGIDE
                     LFLKIGKDIPIDKFTLLQEDVPQSTSTSNEGGGINLEQSPEAVSTGNCSC"
     gene            <115485..>119945
                     /locus_tag="KLLA0_F01254g"
                     /db_xref="GeneID:2895824"
     mRNA            <115485..>119945
                     /locus_tag="KLLA0_F01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455136.1"
                     /db_xref="GeneID:2895824"
     CDS             115485..119945
                     /locus_tag="KLLA0_F01254g"
                     /note="weakly similar to uniprot|P29539 Saccharomyces
                     cerevisiae YBR275C RIF1 Protein that binds to the Rap1p
                     C-terminus and acts synergistically with Rif2p to help
                     control telomere length and establish telomeric silencing
                     deletion results in telomere elongation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455136.1"
                     /db_xref="GeneID:2895824"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ3"
                     /translation="MMRDPSRRTRSEGKTKALDALDKHMTQRSTLKKSLAANGPNVLA
                     LSESLVLNHLPSNSENVYQRSPTPRRSRESDVVMLEDKSSGLIFEEDAGEKALLSSPI
                     RKGVSFSDRVESSPTMQTMGSSPIRPSSMTKPPARSILKHPSLHYSKHDRPSSRNSPS
                     KASHLSIDPSSTNFWVEGEIKSMINTNNVAEFKKILKGGLHVLNVTKTRDFEIYATFN
                     NVIPSMNGVILNDIVHQKIDVLIECLDELLDTSIYALSHLQESLLLQQKKDPFKSRCF
                     IQVIRFLTLLFSNFKIIKFLDGNLSLQLKFIEVLKACEESLTHSNTNKVMVIYPLTLL
                     KEEKFGQFYLPDSQIRQLVNSVFTMKYIDSTNVQCERLMVLKQFLQKYSKVMLETLRT
                     WFPSEVAARYLMEDRVTSAKTRSCCNLIILDLLRKCISNDKVRTAIIEIESLSLKSVV
                     ENCPFGTEVDVEYTEFIKDQTLGTALCNKLISLMNDKEEYKLSMDFWLGMTGLLFNST
                     KNLSLLLEPVGSRWLAVNDVCFNSKKSNLRGIAIKNRRILNYMIITTITHDIDNHVLD
                     ALIQIVMRPFEFPDNEGLSEYIIFAFNSIMYLTCCDYKDMSSKRFALLFEVILKPLFQ
                     RINQPTLLPILGPQAHQILPRIIRLFSDEENSSPRRSIGFQPLKALSTIGIDLPDFEP
                     MSNTILENNWNSIVELLKGMIAWPGFNSQNSLMMLQHCIRRSPSVIPSNQACAQSLEY
                     LKLILEKGEIDRNEEVFKTIIRSLAEKYELHLFSNSSILLTKIFPMDQVTSAVQFEMF
                     KNIFQLVKPFVKPLLLFGYFDRFSNDLISNYIANIVGSMLIPTNMSQQEYKSLLQIVN
                     KMPVPEVIDNLFTWLRKTDNWGSIAGELNLSTWNDHLFANFIQKWIQEQKNSWSQETV
                     RMLTESLWNRPAAFKELTALLINAEQTQIIKDTLEKNPDIIDDISPLGDLSLLDILPA
                     TLVKSSFSKIQQYDDVIKTKLFLCISTLDEISIIKSNTELLYQLLLPTDDDVSLNNDR
                     NIIMDMLLKSSIGHQDWDLLSMLFEVCLLRRDSDKIVDFLTAGKIKFENIKPNTIARM
                     INESGKLNSDLIDFLRDSFKNLNPSYVIDLMEQLLKQTKYQVFDIITEELLSFIFDIK
                     QQLSADDKERLKGIFPAIVDYFVGSNPKILTDIMKYVVNIMKSAKEKQYGTSLIVLFL
                     NHPDFKIQGNKTLLKKLNVFKANAKRNSTRQYKFIPPKENKKVSDRETLQHNEQQDNT
                     NIFPLSTLSVIETKVTSSEELEVPLQTLSETSDELIRTGCQKVVEPIQNSNDNEPVKM
                     AASVQSEKLEAETTQNAVSQVSSGEMEKQTPSIKDSSTEVSECLPGVANNDEISKNLD
                     TVTSVNSPSGLPLKIPIFNPFFTDVIKLEEDLASKGDTYISGKRSLELMNSAGDVASA
                     NCEGQHHTKKIMRIVSSLNDVDIDDVKSLSNNDKKLLRKVMYNFMLNLED"
     gene            complement(<120001..>121560)
                     /locus_tag="KLLA0_F01276g"
                     /db_xref="GeneID:2895825"
     mRNA            complement(<120001..>121560)
                     /locus_tag="KLLA0_F01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455137.1"
                     /db_xref="GeneID:2895825"
     CDS             complement(120001..121560)
                     /locus_tag="KLLA0_F01276g"
                     /note="similar to uniprot|P38147 Saccharomyces cerevisiae
                     YBR274W CHK1 checkpoint kinase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455137.1"
                     /db_xref="GeneID:2895825"
                     /db_xref="GOA:Q6CLQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ2"
                     /translation="MSFSQIAQLPHIDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAV
                     KFIHLPSCEKQGMSQEDVLREVKLHSRCSNFVNVLKVIDCNLSDPFLWIAMELAEGGD
                     LFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDTCGVAHRDIKPENILLDKDGNLKLAD
                     FGLASLFKRKDGSKRISRDQRGSLPYMAPEIIYCDGYYADMTDIWSIGVLLFVLLTGE
                     TPWELPHEDDETFRNFIKGEGKLDQGSWLKIDFVELNLLRKILQPDPEKRASLDTLRK
                     HTWYQTNPKFADENGLCKNPSLLAEKLLSKLKVSLSDADYLSSTQEVFANQHAKMSFT
                     QPLNRELAHIDSLPANLRNGYSATQKVTCSTNFSSERELMTQEPFSTKRIQEDLASLQ
                     FNINDMKLMPNFSSDRLTKFFSTDDISVILSDLENALVAYGVRVSRNLHDNFLELKRQ
                     IGESNPYPVSIQLKTYDRNKLPLSGSLVIMQLEGDLKSVTFERKRGDPLEWRRFFKRI
                     TVFCRDIVYVN"
     gene            <121988..>123169
                     /locus_tag="KLLA0_F01298g"
                     /db_xref="GeneID:2896003"
     mRNA            <121988..>123169
                     /locus_tag="KLLA0_F01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455138.1"
                     /db_xref="GeneID:2896003"
     CDS             121988..123169
                     /locus_tag="KLLA0_F01298g"
                     /note="similar to uniprot|P38349 Saccharomyces cerevisiae
                     YBR273C UBX7 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455138.1"
                     /db_xref="GeneID:2896003"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ1"
                     /translation="MNTMDTLDTHFVSSVENAVQESLRENKALLVYTTGGDNSWFESW
                     FTPLVGEQLKDSCVWLRLAAGSREMGYFEQIFPDVKVPSVYCIAKGQIVEMINPDQLD
                     MDGFATRLIRAVGKSKRRISETDAVDASNTVGAAGDTGARSGSCLSQNAKLMEYQIKA
                     KKHQLTEQQERERIVRLMKADREEMKQRRLSSSSPNHTKEHINEVLAVPIHDNIKNRD
                     IINAAVCTLLIRLTDGKTLKNDFDSSQTLNDVRTWVDANRTDKDGPYQFHRSIPRETF
                     TESQELLSLKALELTPRSALILKPLEKHTYSRKIADVEGPGLLGKMYQNVTSWWYGKS
                     TVVDQNIPEPAEALTSQASSRYVSPLSSPRLVHSDASIPSRAVSPSSIHYGHVSDDNS
                     R"
     gene            complement(<123277..>124602)
                     /locus_tag="KLLA0_F01320g"
                     /db_xref="GeneID:2895930"
     mRNA            complement(<123277..>124602)
                     /locus_tag="KLLA0_F01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455139.1"
                     /db_xref="GeneID:2895930"
     CDS             complement(123277..124602)
                     /locus_tag="KLLA0_F01320g"
                     /note="weakly similar to uniprot|P47048 Saccharomyces
                     cerevisiae YJL049W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455139.1"
                     /db_xref="GeneID:2895930"
                     /db_xref="GOA:Q6CLQ0"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6CLQ0"
                     /translation="MLPESRLRSLYSDFRGLKLLNIDGYEANIRQWKEYLIKEFWSDL
                     IIINAADLLSELSNSQYGAPKSIDVVLDEMVKEGTLVSLNEYHKRNQNIVISMMSWAI
                     SKTILDLSWKSRKNETAMYLKPVKYVNIAWLKRNDEVLQDLLKNNIKESAHKATDYVF
                     TKGHFYKASGIDSIVKDWDSYGIILDYLCDKNQIIVGSENIVKIISPLLSASPQVASK
                     EVSEEDICVANINEYVFTAETEIKSAQKVLDLTTKRLTSAISSGLSQEIKRTLLRLKK
                     RSEKNLEQAYTSLESLRKLQDEISNASQNVVMINLLKQGSTALKAINSQLLDEDSISN
                     ILDDFQENTEKQDRIHNLLVGESVSDNDALEEELSLLEKELSTEDTKEKEKKKIEEQK
                     SAAPLESGSTEDLIKKLGSLRVSSRDSPRAEKTEVKEPKKEEMTEKLLA"
     gene            <124864..>126273
                     /locus_tag="KLLA0_F01342g"
                     /db_xref="GeneID:2896004"
     mRNA            <124864..>126273
                     /locus_tag="KLLA0_F01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455140.1"
                     /db_xref="GeneID:2896004"
     CDS             124864..126273
                     /locus_tag="KLLA0_F01342g"
                     /note="similar to uniprot|P38348 Saccharomyces cerevisiae
                     YBR272C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455140.1"
                     /db_xref="GeneID:2896004"
                     /db_xref="GOA:Q6CLP9"
                     /translation="MTDVTKDIDNLADALLTMEISPEINDLMEKLALNLTSSNNLPVD
                     VKHLLTSIKTYLTQSSSEMLDYNLLLEVLDAVVGLCPFEDVLKVFSVDDLITALKSGD
                     KALTETVCQVIAAASPRDIFAGTPLLDEMLKLYFCESTVVAIVNALEKTLGILVTNQL
                     NRRRILENNLPVLISVKDCKNSTTFCRFLDLIKILSASVTFEEFRKDIFIIDNMVTNK
                     MMENDILVFIHICQYYIELLTISLTEDGKEWVIRYVKPSFEIFGEAFSRREELFDVGH
                     FAKSYLLTLFSKISYLDDKSYIQLLEAQFFPLYPDKQYLDEFLTVLDPSYIAKVHLDL
                     LKEKALRAGNVHMFVNLIKDEDCFVQLKDEINSKTLNDMPYIEKMLLLDGLTLTSYGI
                     QHLTRNMPSVMNSIIDSGNQVTEKLSFDLRLRVFENLLEANPQELSVWLIPLQSEYAN
                     ILNGRRGRFSSGQLADDYL"
     gene            complement(<126312..>129533)
                     /locus_tag="KLLA0_F01364g"
                     /db_xref="GeneID:2896039"
     mRNA            complement(<126312..>129533)
                     /locus_tag="KLLA0_F01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455141.1"
                     /db_xref="GeneID:2896039"
     CDS             complement(126312..129533)
                     /locus_tag="KLLA0_F01364g"
                     /note="highly similar to uniprot|P47047 Saccharomyces
                     cerevisiae YJL050W MTR4 Dead-box family ATP dependent
                     helicase required for mRNA export from the nucleus
                     co-factor of the exosome complex required for 3' end
                     formation of 5.8S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455141.1"
                     /db_xref="GeneID:2896039"
                     /db_xref="GOA:Q6CLP8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP8"
                     /translation="MSDSLFDVFGETPNEDFELPPEALEESENEKSVVKNSGTKRSNG
                     DDAEQLQNSDISSSKKVKMGITLIEDKKNKSVVIPVVADAFEREASREVEASAGLGNT
                     QTVQLESDGKVKLRHQVRHQVALPPNYDYKPIGDHVRTNEARTYPFTLDPFQDTAISC
                     IDRMESVLVSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGD
                     VGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVW
                     EETIILLPDKVHYVFLSATIPNAMEFAEWICRIHSQPCHIVYTDFRPTPLQHYLFPAH
                     GDGIHLVVDEKGTFREENFQKAMASISNQTGDDVHTINGRGKKGQSYKGGAAKGDAKG
                     DIYKIVRMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSEEEKEALTKIFKNAIDL
                     LPESDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIG
                     LNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQ
                     VAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLENSFFQFQNAISVPVMEKK
                     VAELTSVLESIKVDDEPAVKEYYEIRKTLDGYNEDVRTIITHPANSLAFLQPGRLINV
                     KIDNKYDYGWAAVVDFVKRTNKRNPTAVYSDEESYIVNVVVNTMYADSPINLIKPFNP
                     TFPEGIRPAEQGEKSTCTIIPITLSSIQSIGNIRLYMPNDIKAESQQATVGKTLREAL
                     RRFPDGVPIVDPVKNMKIDDDDFLKLLKKIEVLEGRLYSNPLTNTVRLRELYEKYSNK
                     VAIEADIKNLKHKINEAQAVIQLDDLRRRKRVLRRLGFCTQSDIIELKGRVACEISSG
                     DELLLTELIFNGNFNELSPAQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREVAGK
                     IAKIIKDSKIELVEKEYVESFRHELMEVVYEWCQGASFTQICKMTDVYEGSLIRMFKR
                     LEEMIKELIDVSKTIGNATLKEKMEAALNLIHRDIVSAGSLYL"
     gene            complement(<132122..>134323)
                     /locus_tag="KLLA0_F01386g"
                     /db_xref="GeneID:2896040"
     mRNA            complement(<132122..>134323)
                     /locus_tag="KLLA0_F01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455142.1"
                     /db_xref="GeneID:2896040"
     CDS             complement(132122..134323)
                     /locus_tag="KLLA0_F01386g"
                     /note="weakly similar to uniprot|P47046 Saccharomyces
                     cerevisiae YJL051W Protein of unknown function localized
                     to the bud tip mRNA is targeted to the bud via the mRNA
                     transport system involving She2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455142.1"
                     /db_xref="GeneID:2896040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP7"
                     /translation="MVSYLRECIVLTGSLLNMATGSLSIAMICLRSYWKEMSSIIIIA
                     CSSMLCGICQLMQLGLRYRLLKTLNTLITITILVTFGASVSHCYYLLHNFKIEELNIP
                     LMRAHLGVLLAAMLLGGMQLNIIMLEPVPKQNVTDVEKEAPTTYAKGDIKVCNQTRER
                     FVSLKASAQTLTPELEIAIEKNWMNEYPTNYSGSDATSTPSVIKHKLPYQSVVDASNH
                     TLKSKLKNSSFTAISPTSKKQVFEKIQRKFSIKSPTDKDKQSPSNPRTPESISYLETE
                     IDAKYVTRLSTIPDVSKSYLNILKQTNEVNSARSVCLYDSDDIDGNLLKMEKDAINLY
                     NSVLLPSILHNPKALEPTVNSSPPGNEVVKYNDMRDSAPSNQNEEESDDVLEQLLEND
                     LQIQPEHAVYSTQNSVSQPALNTDIGNSTITIDYWNKNKDMLLNREKDHTQPADQLYP
                     AFDIDTSFSFPLKKTTFPQGHEMYDGDDEVMSFVDRAIHPHETGLMEEGLKQNTSPIV
                     PALYSHIEHSPTKSISSIVTAIRTPIKFNSGAFSTQDGRDDSQISLYLSNNNSRQLSS
                     VQSSPTRLKKRLSQRLSRTNLRNDEESHGNMHFHSKSLTLTSFHQHQHSNSNSVNNID
                     LSYVHSLQQKHSPQKSISTLNARRRSSIYQPVNDFRVSTTNLPKADCPIDDLQAPSDL
                     ESFDIKEEDGNFGSSLSFHAETEYSGMDTGLSEYDREKLSILLNRQQIHNK"
     gene            <135424..>136302
                     /locus_tag="KLLA0_F01408g"
                     /db_xref="GeneID:2896026"
     mRNA            <135424..>136302
                     /locus_tag="KLLA0_F01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455143.1"
                     /db_xref="GeneID:2896026"
     CDS             135424..136302
                     /locus_tag="KLLA0_F01408g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455143.1"
                     /db_xref="GeneID:2896026"
                     /db_xref="GOA:Q6CLP6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP6"
                     /translation="MSFLKTILKTKKSKKFGNDSPRLIQGTTCEVEIVSKSDGSKLAL
                     KKFRSWDLHNHHKEVCVKEYELLKKLNHKCIIEALDCNKRKHTITFPYYSYTVLYLMK
                     MSMLPTFEERALWFCQICEGIAYLHSHNIVHRDLKLENIMVDESLCNIKIIDFGSAVD
                     VGPNKEACHGIRGSEQLMAPEVFQRLKYEGTPVDMWSLGIMMFEFFNNSNKPAFPWKI
                     AKIDDVAFEAYTKNPTTLNISIDLCMKLLSVDVKQRLSIQDVINDSFFQENHNSVDGV
                     SAHARTKRILERSQTT"
     gene            complement(<136295..>137209)
                     /locus_tag="KLLA0_F01419g"
                     /db_xref="GeneID:2896041"
     mRNA            complement(<136295..>137209)
                     /locus_tag="KLLA0_F01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455144.1"
                     /db_xref="GeneID:2896041"
     CDS             complement(136295..137209)
                     /locus_tag="KLLA0_F01419g"
                     /note="highly similar to uniprot|P40335 Saccharomyces
                     cerevisiae YJL053W PEP8 vacuolar protein sorting protein
                     that forms part of the multimeric membrane-associated
                     retromer complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455144.1"
                     /db_xref="GeneID:2896041"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP5"
                     /translation="MSLFYKNPVDIEILFDGEDSRKHVEIPTNSHSAKSLFDKYPLFE
                     DGESVTGLVTLRVREGKKLEHSGIKVSLIGSIDTTGYNNDVKNKNLDTFLTLSMDLCP
                     PGELVHSVNYKFNFKDVEKRFESYLGKNVSVMYYIKVTMIRKSADIVKLKKFWCHRYA
                     NESSIKDNEGKPIKLDIGIENCLHIEFEYSKAQHTLKDVIVGRIYFLLTRLKVKHMEL
                     SLIKRETCGTEPNQLSDTTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNMTCNYFNV
                     KNYLSLVIIDEDGRRYFKQTEIMLYRTM"
     gene            complement(<137575..>138990)
                     /locus_tag="KLLA0_F01441g"
                     /db_xref="GeneID:2896042"
     mRNA            complement(<137575..>138990)
                     /locus_tag="KLLA0_F01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455145.1"
                     /db_xref="GeneID:2896042"
     CDS             complement(137575..138990)
                     /locus_tag="KLLA0_F01441g"
                     /note="weakly similar to uniprot|P47045 Saccharomyces
                     cerevisiae YJL054W TIM54 Translocase Inner Membrane 54kD
                     Translocase for the insertion of proteins into the
                     mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455145.1"
                     /db_xref="GeneID:2896042"
                     /db_xref="GOA:Q6CLP4"
                     /db_xref="InterPro:IPR021056"
                     /translation="MWKKLPSPGWLAFGTVVTVAGSGIAYDKYEQSQIRSLYVNHVRN
                     EMSSSLSTNVKPRKLLVLVAPPPNDYLDTSLKLWRRWIKPILHSSGLDYEIVSGTKQG
                     EIRTEIASRVRQLRKELIEQEQQQQHDAQSKKSRSWLDWFKWCRGVSTTPDPVSEESP
                     AASFDTRSVLGIFYHNEPQPVVTEDSLLDPSVAGGVICVGRGAYKEYIAGVHEGILGP
                     LEEPPKVVESDASSVTDTTASAVITENPSVKEISVTQPAETAVAAATVGTTMNETGAV
                     NTDSTPAETIPAETTPTENTPIETTPDESSEEKEGPKISKPYILPSDYANASIPAELS
                     KPLIIDPKTGAPAFFEQPLLVVAVPNLSGFTTIPTRIARFYQKRFLCEQVSHSTLAIV
                     EAKSRPFTTTDLDLSAYEELDWPKSWVESGKERGSEWVQPLQGDDRVLQKFRVVEPAI
                     VPSLQLKEDQSKKQELSPENK"
     gene            <140343..>142688
                     /locus_tag="KLLA0_F01463g"
                     /db_xref="GeneID:2896037"
     mRNA            <140343..>142688
                     /locus_tag="KLLA0_F01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455146.1"
                     /db_xref="GeneID:2896037"
     CDS             140343..142688
                     /locus_tag="KLLA0_F01463g"
                     /note="some similarities with uniprot|P47043 Saccharomyces
                     cerevisiae YJL056C ZAP1 Zinc-regulated transcription
                     factor binds to zinc-responsive promoter elements to
                     induce transcription of certain genes in the presence of
                     zinc regulates its own transcription contains seven zinc-
                     finger domains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455146.1"
                     /db_xref="GeneID:2896037"
                     /db_xref="GOA:Q6CLP3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP3"
                     /translation="MCDSFNKQLLQMGGNSVPAHKGVVHGHIHNYNNLTYIHGHIHKN
                     DVEDGAVPDPDDVLNCAQYQDCEHFEFINCHSLNLFGENGDTNEKQPAVQSNSSQHHL
                     EQQNEQKGPPRFVEITSDDKNEAVPNSLSNALDFLDCHLTCDSPMLEDEDEDEDIEDE
                     DDEEGRGKGRGDEEYTKKELDKILNNDSTSNLNLGAISQQHLQALDNGATSSNNNSKL
                     IHSENFKIANPTLNTPLLNEENGNLTVGVDHLQNGLPDPLSINMKNEQAHQLEDEMNR
                     FLTPSSTNSQNLSVKRESPKSINPSAVNVMDISVKHNNNRDLLGLKPELKSEELHDLK
                     QQCIDMEDNDDDKDTSVDDQLFENLCSQCVVNYELMETPHFHHNSHSHIINTPTDMKV
                     LKDLSSISTLYELLGKHEHTHDNLNENNPQHHDHVSMNLLHCTLNGYNEYNHTENQHI
                     QLKQSHDHECDHDHDHDDSHQHPDQNMDEDKEEDEGKNHHYHHGCGQTQDQEYAQLPL
                     HSHRITSDLNTDLIANTINFNWSFNTNNEPIYCQWDDCLQPYDNLLDLQTHVLKDHVA
                     IDDSKVLSCKWTECDFNTADPCTMVNHVNGKHGINFDVKVLDNKTMAKQVTAHKQLHE
                     EPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRH
                     LKVHSKYKPFRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIR
                     THTGEKPLSCPICNKRFNESSNLAKHIRTHKRENCRNSKRV"
     gene            complement(<143345..>143830)
                     /locus_tag="KLLA0_F01485g"
                     /db_xref="GeneID:2896038"
     mRNA            complement(<143345..>143830)
                     /locus_tag="KLLA0_F01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455147.1"
                     /db_xref="GeneID:2896038"
     CDS             complement(143345..143830)
                     /locus_tag="KLLA0_F01485g"
                     /note="weakly similar to uniprot|Q02486 Saccharomyces
                     cerevisiae YMR072W ABF2 Mitochondrial DNA-binding protein
                     involved in mitochondrial DNA replication and
                     recombination member of HMG1 DNA-binding protein family
                     activity may be regulated by protein kinase A
                     phosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455147.1"
                     /db_xref="GeneID:2896038"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP2"
                     /translation="MIFKRFLSVSPIALEAAVKPKRPPTAFSYYFSQVHDHICASHNV
                     SNPGAMKIAGKQWRSLSESEKQKYVDALKPLREKYSAAYEAYAKTLPPKKPATSFGSF
                     LKEKSPQLRTENPGLSQIEILKLASSKWKSLDASTKEQYQNKYREDLAEYRKVMGQQS
                     A"
     gene            <144356..>145774
                     /locus_tag="KLLA0_F01507g"
                     /db_xref="GeneID:2896056"
     mRNA            <144356..>145774
                     /locus_tag="KLLA0_F01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455148.1"
                     /db_xref="GeneID:2896056"
     CDS             144356..145774
                     /locus_tag="KLLA0_F01507g"
                     /note="some similarities with uniprot|P47042 Saccharomyces
                     cerevisiae YJL057C probable serine/threonine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455148.1"
                     /db_xref="GeneID:2896056"
                     /db_xref="GOA:Q6CLP1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP1"
                     /translation="MSLVVYSQDRDLVPGEGQIVVYNQAYFEYLQAEDGYAGFEDGAR
                     RRNSRIPEDIFVQGYYQRFFKQVGVLGNGSRAVVYKVKHMLLENELGTFALKKICIGD
                     DMHWLYRCLKEVKLLNRLTEESSHLITYNHVWLERCPVESLILTQNDGSSVNMDIPTT
                     MPYMFILQQFCRGGNLEDTIQYQVFNRISGNESRLERRKKLLNHKKSRIGLTTRQIVS
                     IANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGESQLYGQL
                     RDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPFNSKDMSAIKHEI
                     NELSFSPEAMSKLHDSLDLAPIDPSLYNLVCEMLNHTPSLRPDSSQIEYQLNIIMKSI
                     NKSINQEPEIRPCYFRFATLYALLIALTLTTLNHSHWNWWKYCVLFITGLCFNHGQDA
                     GNLDLLTVLIASTIISIISMYA"
     gene            <145940..>146662
                     /locus_tag="KLLA0_F01529g"
                     /db_xref="GeneID:2896027"
     mRNA            <145940..>146662
                     /locus_tag="KLLA0_F01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455149.1"
                     /db_xref="GeneID:2896027"
     CDS             145940..146662
                     /locus_tag="KLLA0_F01529g"
                     /note="some similarities with uniprot|P38346 Saccharomyces
                     cerevisiae YBR270C BIT2 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455149.1"
                     /db_xref="GeneID:2896027"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:Q6CLP0"
                     /translation="MKKARKRLFHKDDSPVAPPLNIDALLKNVHSLELNYQGFQPSEK
                     KALLRTISALCKEVIENAMCHGLDGCIKLEDLNLLFRFYVDLEKEFKLDFNKDIKKMI
                     LEGLAKFENDFVLNSNEKVINVALKRLCAIWARFYSRVYPDCMICLIQIPADIEQLLL
                     ICFRDAIVLPYYKNFMNADEGISMSFSKYIQNEEENGVKQQHKLILIQCFGVLSSIKG
                     KDMNQRLIEDLLSGVRRSIEVL"
     gene            complement(<146711..>147874)
                     /locus_tag="KLLA0_F01551g"
                     /db_xref="GeneID:2895071"
     mRNA            complement(<146711..>147874)
                     /locus_tag="KLLA0_F01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455150.1"
                     /db_xref="GeneID:2895071"
     CDS             complement(146711..147874)
                     /locus_tag="KLLA0_F01551g"
                     /note="similar to uniprot|P47040 Saccharomyces cerevisiae
                     YJL059W YHC3 Homolog of human CLN3 vacuolar/lysosomal
                     membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455150.1"
                     /db_xref="GeneID:2895071"
                     /db_xref="GOA:Q6CLN9"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /translation="MELDRDKKTFAYFWLFGLINNILYVVILSAASDIIGPSLPKSIV
                     LLFDIMPSFLIKLSAPFFVHSIHYDKRIPILILLSMLGIILVSTRSLWLCLPGIVLAS
                     LSSGFGEITFLQLTHFFGSKSLTGWSSGTGGAGIVGSFSYLLLTTVFRLNIQLSLLLY
                     AALPLIFLLYYKINDSIVSSQVYQSLDMPIDSSDGPIELLKSNGWVDIVKRLSKLVIP
                     YMIPLSTVYLFEYLINQGVAPTLLFPIDTTPFVKYRDIYVTYGTLYQLGVFISRTWGH
                     KLPVKNLYLFSVLQLINLLITLSQSYYYWTDSISWIMVLIFYEGLIGGSSYVNCFMNI
                     LKDVDPNEREFVLGSVSISDSLGTLIAAFLGIILEPSLCKHQIGTGRPWCRME"
     gene            <148328..>149113
                     /locus_tag="KLLA0_F01573g"
                     /db_xref="GeneID:2895303"
     mRNA            <148328..>149113
                     /locus_tag="KLLA0_F01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455151.1"
                     /db_xref="GeneID:2895303"
     CDS             148328..149113
                     /locus_tag="KLLA0_F01573g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455151.1"
                     /db_xref="GeneID:2895303"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN8"
                     /translation="MSKHIEMPDIDIGEWIDSVSFKKNGYEIALVCTSRGVYEITSPA
                     RHVSREQKHKHKQCKIQSPTHKQLLSLDVRDPLWTLQKRNDGYVVISNGYDRYQYGQA
                     DVGDLMEITAEISPKTGHHPHNSNEVTYRSRFYTVICQNVSEKNETIVRVVHNDVDDS
                     HLDRNREMPALVLNDTKILQIVPASQGRYLLFGTKVAIVKISTSSTATRNFEVSLLEA
                     SMAPQLPLAVGGHLELENVVIQCPYASTSRETKVRIPLPHCLS"
     gene            <151557..>153518
                     /locus_tag="KLLA0_F01595g"
                     /db_xref="GeneID:2895334"
     mRNA            <151557..>153518
                     /locus_tag="KLLA0_F01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455152.1"
                     /db_xref="GeneID:2895334"
     CDS             151557..153518
                     /locus_tag="KLLA0_F01595g"
                     /note="weakly similar to uniprot|P42835 Saccharomyces
                     cerevisiae YNL327W EGT2 Glycosylphosphatidylinositol
                     (GPI)-anchored cell wall endoglucanase required for proper
                     cell separation after cytokinesis expression is activated
                     by Swi5p and tightly regulated in a cell cycle-dependent
                     manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455152.1"
                     /db_xref="GeneID:2895334"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN7"
                     /translation="MKLSSFALIQSATLGFLATANAQIFSNTSSVEPSSTPTSPVTGL
                     DVADINILNGWTGSKDSYDRYAPFIFTIDIDAAETGSVWFAPPAEFGGFPESIEFDYG
                     TITNDGNNFTVEFTSVPDSGAATIEFVGSLTADGIAGIPSPDVVTFTSDSSSGSFSDN
                     INFQALPETASSNVGLIGGDLYYSINVPVAVFDGSLSVASSSEDGYSFDASYSAVYFV
                     GTDAFNNGTLTGADGVNESEESSVLVSFEGSIPDGHVAVRVVYKAIISGSAESYSNTA
                     DLSLPSLPGALSKRDTTITFTSTIYVTGPLAGTVESSSSSVSSDDTDSSSETSATETS
                     GEPSATETSGTESGSSEPTTSVATATVTDLSTTVITTCPTCTGSHKTTDVYVSTVTAT
                     VSGIVTEYTTYCPISTVSKVKSHEGTVETCTVNIHEVTSGVYTVKTEYIPISKGTTVT
                     DLSTTLVTVCPTCSEKTATGTTAPVAPGTTETGSPAASGTTETGSPAAPSTTETGATA
                     APGATGTTAPVAPGTTETGSPAASGTTETGSPAAPSTTETGATAAPGATETTTVEGET
                     GVTTIKSVTVVTGATGATGVTTAVGTTGAPGAEGVTTAAGTEAGKPSSSITTIRVSTQ
                     SGVSTYEGAAANVQAGLVTILMAIAAFVL"
     gene            complement(<154025..>155359)
                     /locus_tag="KLLA0_F01617g"
                     /db_xref="GeneID:2895821"
     mRNA            complement(<154025..>155359)
                     /locus_tag="KLLA0_F01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455153.1"
                     /db_xref="GeneID:2895821"
     CDS             complement(154025..155359)
                     /locus_tag="KLLA0_F01617g"
                     /note="highly similar to uniprot|P47039 Saccharomyces
                     cerevisiae YJL060W BNA3 Arylformamidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455153.1"
                     /db_xref="GeneID:2895821"
                     /db_xref="GOA:Q6CLN6"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN6"
                     /translation="MRRFGIRSVSNMTQQGKTGIRANKYFMGNVPKDVWTLTNEAAQA
                     ASKNEKNQGRSILNLGQGFFSYSPPKFAIEQAVSALNVPLNNQYSPTRGRPSLLKSLT
                     DFYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDEVIVFEPFFDQYISNIEIPG
                     GKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTKCIILNTPHNPIGKVFTRE
                     ELTQLGDICVKNNIYIISDEVYEHLYFGDEFTRIATISKEIGDLTLSVGSAGKSFAAT
                     GWRIGWVVSRNAELLSYVSKAHTRICFSSPSPFQEACAHSIDIGLHNGYFENMREEYK
                     EKFAILTRVFDELGLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWL
                     VNELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDNQYLEESVERLRLLKDYL"
     gene            <156067..>156462
                     /locus_tag="KLLA0_F01639g"
                     /db_xref="GeneID:2895822"
     mRNA            <156067..>156462
                     /locus_tag="KLLA0_F01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455154.1"
                     /db_xref="GeneID:2895822"
     CDS             156067..156462
                     /locus_tag="KLLA0_F01639g"
                     /note="similar to uniprot|P38345 Saccharomyces cerevisiae
                     YBR269C FMP21 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455154.1"
                     /db_xref="GeneID:2895822"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN5"
                     /translation="MLSSIRKQSVRLVGLRPAFVRLNQIRTFQERRAGPPPLPKEDQE
                     EFERLQKLASSQEAIDSYNAQFESDHTMESVKSPILKNDIGGFSPEFMKTIPEFEGEK
                     NPKTGEIGGPKQDPLRHGDYSFNGRVTDF"
     gene            complement(<156609..>158672)
                     /locus_tag="KLLA0_F01661g"
                     /db_xref="GeneID:2895945"
     mRNA            complement(<156609..>158672)
                     /locus_tag="KLLA0_F01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455155.1"
                     /db_xref="GeneID:2895945"
     CDS             complement(156609..158672)
                     /locus_tag="KLLA0_F01661g"
                     /note="weakly similar to uniprot|P40368 Saccharomyces
                     cerevisiae YJL061W NUP82 Subunit of the nuclear pore
                     complex (NPC) forms a subcomplex with Nup159p and Nsp1p
                     interacts with Nup116p and is required for proper
                     localization of Nup116p in the NPC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455155.1"
                     /db_xref="GeneID:2895945"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN4"
                     /translation="MLLFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQS
                     DHETQYRSYNVELPFVPEQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGI
                     KKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCD
                     IAFDPTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHK
                     SLSLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIR
                     NSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMS
                     WSLRSNTTFNNLSVITMFNAKGQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIR
                     LHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINR
                     TDEVKYTYKPSLPTSGKELDMLLTKYKTEANGFISGIPDSLAPLPLKNNSNERQLEVV
                     SELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQE
                     RYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNY
                     VHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSSLQQMLLNDKKVINSCMNELSASI
                     EDLAV"
     gene            complement(<158967..>159263)
                     /locus_tag="KLLA0_F01683g"
                     /db_xref="GeneID:2895826"
     mRNA            complement(<158967..>159263)
                     /locus_tag="KLLA0_F01683g"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_455156.1"
                     /db_xref="GeneID:2895826"
     CDS             complement(158967..159263)
                     /locus_tag="KLLA0_F01683g"
                     /note="similar to uniprot|P36532 Saccharomyces cerevisiae
                     YBR268W MRPL37 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_455156.1"
                     /db_xref="GeneID:2895826"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN3"
                     /translation="MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEP
                     VALEDSEYPEWLWTVLDANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI"
     gene            complement(<159469..>161832)
                     /locus_tag="KLLA0_F01705g"
                     /db_xref="GeneID:2895006"
     mRNA            complement(<159469..>161832)
                     /locus_tag="KLLA0_F01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455157.1"
                     /db_xref="GeneID:2895006"
     CDS             complement(159469..161832)
                     /locus_tag="KLLA0_F01705g"
                     /note="similar to uniprot|P40367 Saccharomyces cerevisiae
                     YJL062W LAS21 Integral plasma membrane protein involved in
                     the synthesis of the glycosylphosphatidylinositol (GPI)
                     core structure mutations affect cell wall integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455157.1"
                     /db_xref="GeneID:2895006"
                     /db_xref="GOA:Q6CLN2"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /translation="MGRKLYYVLATLQLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQ
                     LASKPVFKKLVLVVIDALRSDFLFQKDSSDFEFLHGLLNSGEAWGYTAYSNPPTVTLP
                     RLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLF
                     PLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQMEHQKNWDVLILHYLGLDHIGHKGG
                     SKSHFMPSKHREMDSVIKQIYEKIDGDTLMVVLGDHGMNDLGNHGGSSSGETSAALAF
                     LSKRLKKYQSSDIQQSSNVPVEDAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGV
                     IIDELLQLLPSKLAAIKVQDNYLQLTKLKPGYEAQLEKKSAGTLLEEMREIQSSLAMA
                     ATNYNYTFLTYGTTLMIIGTLIVTVWNFQLSQEYIEHVGTSVLLGISMFASSFIEEEH
                     QIWWWITISVLLLMQISNGKKLVVLSGLRLIRGWNNSGQKYIYDNVLHTLLKSHTSVL
                     WWLNVVTFLSVGFPFLRNKDESEKMVSLLSVSFLALSSITYKICFAIVNGDKVPSGLY
                     TFALRSCAMYLANENATESDISQCLVPIARIFFQICGVSIIILLFMKYALNKSTNMLN
                     KLLSVIKFVLLLQTSSANIPLFLIFEILTSVTPDITPIFSLCLQNLTFFQFGGTNSIA
                     TVNLTNAYNGVSSNYNIYVVGVLMFLSNYAPSIYWALSLIPQSYKQKTLRLQHYYITG
                     TCLMIACIALRYHLFIWSVFSPKLCYYAAWSLYNVVMDFAITLLGVL"
     gene            complement(<162226..>163440)
                     /locus_tag="KLLA0_F01727g"
                     /db_xref="GeneID:2895345"
     mRNA            complement(<162226..>163440)
                     /locus_tag="KLLA0_F01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455158.1"
                     /db_xref="GeneID:2895345"
     CDS             complement(162226..163440)
                     /locus_tag="KLLA0_F01727g"
                     /note="similar to uniprot|P38344 Saccharomyces cerevisiae
                     YBR267W REI1 Protein of unknown function involved in bud
                     growth in the mitotic signaling network proposed negative
                     regulator of Swe1p and Gin4p contains dispersed C2H2 zinc
                     finger domains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455158.1"
                     /db_xref="GeneID:2895345"
                     /db_xref="GOA:Q6CLN1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CLN1"
                     /translation="MAGYTCNTCGVVFDTAVGQREHMKSDWHRYNLKRRVAGLPSIDE
                     ATFSEKVANARVEKEEEENKHKKDKVKQMTKKEMRRLEKEKLLAKKQQLLQLAKESML
                     KNMQDSTPVNKASDDPEVQVEAEQKDEVAKSKAEEIPEEEMTPDQLAEKLMAEKLHNR
                     VEIPETECLFTGKKYKTFEENLDHMFRDHGFYIPEQKYLVDKSGLFKYFSEKIGLGNM
                     CFCCSYQGRSLEAVRAHMLSKKHCRIPYETEAEKLEISEFYDFSSTYEELDKAVNEDE
                     SQWVDVDEDDDGDIENDKKEDDEEEEELPEHILYNDGVELHLPTGVKVGHRTLQRYYR
                     QNLKPERELSEGQGTIVAADTRHFATIFDRQQQQVQKTTWQTEVKDKKRDDKRAAKFV
                     NNQPHYRDQLLQ"
     gene            complement(<163821..>164762)
                     /locus_tag="KLLA0_F01749g"
                     /db_xref="GeneID:2895346"
     mRNA            complement(<163821..>164762)
                     /locus_tag="KLLA0_F01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455159.1"
                     /db_xref="GeneID:2895346"
     CDS             complement(163821..164762)
                     /locus_tag="KLLA0_F01749g"
                     /note="similar to uniprot|P38342 Saccharomyces cerevisiae
                     YBR265W TSC10 catalyzes the second step in the synthesis
                     of phytosphingosine 3-ketosphinganine reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455159.1"
                     /db_xref="GeneID:2895346"
                     /db_xref="GOA:Q6CLN0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MKGFNCNGQVILISGGSQGLGESFAKRFVQDDDGPGSNTNKVII
                     VSRSQSKLVKACERIGVDGVSLDRYVNDTNRNETKLIYHSCDTSSYDKVALMFKLLVK
                     SELVPSQVYMCAGGSIPKLFLDLTPEELQNGITTNYSTAVNLAHVSLKHDVPHLLFFS
                     SEVAFFPFIGYAQYAPLKQSIRSLVAILRQEHSSTRITCVYPGNFQSEGFDLENITKP
                     AITKEIEGPSNPVTAAQCRDKIISSLKWGLDDITTDSIGWLLMACDQGLNKHSTSQFM
                     FVFSWILGALLNITIVPIYMLICKFQIYQWKRNKDTK"
     gene            complement(<165000..>165266)
                     /locus_tag="KLLA0_F01771g"
                     /db_xref="GeneID:2894931"
     mRNA            complement(<165000..>165266)
                     /locus_tag="KLLA0_F01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455160.1"
                     /db_xref="GeneID:2894931"
     CDS             complement(165000..165266)
                     /locus_tag="KLLA0_F01771g"
                     /note="highly similar to uniprot|Q3E7B2 Saccharomyces
                     cerevisiae YJL062W-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455160.1"
                     /db_xref="GeneID:2894931"
                     /db_xref="GOA:Q6CLM9"
                     /translation="MLEPSPYQDHKTWKMTPAMIRARQPFFKKNLMGLVILLGVTGTI
                     YTYTYKMLNKDSDFADVPIPPIDEKELEQLKKEYELEKIRRAQK"
     gene            <165790..>166530
                     /locus_tag="KLLA0_F01793g"
                     /db_xref="GeneID:2894792"
     mRNA            <165790..>166530
                     /locus_tag="KLLA0_F01793g"
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /transcript_id="XM_455161.1"
                     /db_xref="GeneID:2894792"
     CDS             165790..166530
                     /locus_tag="KLLA0_F01793g"
                     /note="similar to uniprot|P22353 Saccharomyces cerevisiae
                     YJL063C MRPL8 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /protein_id="XP_455161.1"
                     /db_xref="GeneID:2894792"
                     /db_xref="GOA:Q6CLM8"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM8"
                     /translation="MTRGLARHLSRTKPHRDALIRNMATQLLQHGTISSTTPKLKETQ
                     RYVERIITIAKNGIQNGNPSSSVPELQSRLYLSGDNSKLLKKLFDEIAPRYTARNGGY
                     TRVMKLEPRLGDRAPQAILELVDAPVQNEDGQLLKGNLKLWLLTKTCMQQIEDAGQLA
                     PKTVQNLKKMVHNKTLDQLLHEIGVIRKYILESQQQNSTTEVSELPEFDETLQQQFLA
                     AVKDQIQNHTAEKKQPDGYVFRERPTQG"
     gene            <166880..>167947
                     /locus_tag="KLLA0_F01815g"
                     /db_xref="GeneID:2895283"
     mRNA            <166880..>167947
                     /locus_tag="KLLA0_F01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455162.1"
                     /db_xref="GeneID:2895283"
     CDS             166880..167947
                     /locus_tag="KLLA0_F01815g"
                     /note="similar to uniprot|P53206 Saccharomyces cerevisiae
                     YGR012W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455162.1"
                     /db_xref="GeneID:2895283"
                     /db_xref="GOA:Q6CLM7"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM7"
                     /translation="MSQFIRRLHVPPLANKGFTDAIGSTPLIKIQRLSKELGRNIYGK
                     SELQNPGGSVKDRAALYLIEDAEKKGLIDPSRPVTVVEGSAGNTAIGLAHICKAKGYN
                     AVFYMPDTQSEAKINLLKWLGAEVYPVPVCPITDPLNFNNRARDHAKRLDNAVWTDQF
                     DNQSNWKAHYHTTAPEILQQIEEAGMMLDAFTCSTGTGGTYTGVAKFLKEATNGNCKL
                     VVADPPGSVIYSYIKTRELKREGGSFTEGIGQGRITENMRQSVDITDDAVFIPDEESI
                     IMLFRLLDEEGLFVGGTTALNVVAAAKVAQTLPEGSNVATILCDSGHKYADRVFSKSW
                     LQSKKLYDVLPDHLKKYASLE"
     gene            complement(<168045..>170255)
                     /locus_tag="KLLA0_F01837g"
                     /db_xref="GeneID:2895285"
     mRNA            complement(<168045..>170255)
                     /locus_tag="KLLA0_F01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455163.1"
                     /db_xref="GeneID:2895285"
     CDS             complement(168045..170255)
                     /locus_tag="KLLA0_F01837g"
                     /note="similar to uniprot|P38148 Saccharomyces cerevisiae
                     YBR276C PPS1 Protein phosphatase with specificity for
                     serine threonine and tyrosine residues has a role in the
                     DNA synthesis phase of the cell cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455163.1"
                     /db_xref="GeneID:2895285"
                     /db_xref="GOA:Q6CLM6"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM6"
                     /translation="MQVDQIPEITSKRQSESLSQMPFKRGKDTIFSEEVWQLLNNQWK
                     SPLPDASVMFPWLHGDTQEVLPQRYVDEPYHSDFDRFVVSVIRSNIRDNKYIENSGLL
                     KSSLEVFDILLPIGKETTIDTVVKDLLKSLEGVSEEDVLQLIEDCSLFEAMPLLKTDP
                     FHSVYNSDNNCVRNNYQKWKQPRTFRRFDLQPSLQFHLTKHCIVYCVTDSCCCDRLIN
                     VLKWARRLAKLPECQFKILRGEIQDKLWGTPPILLSSLQTKKGLCSDFDLATFKNWDR
                     DMYYTERLEVSKMSSATKVENIWCGNSTDAEIWKIGKFTENDTLETPTTYYEPSNSVV
                     NATDLNDNALFNIPSKTNDWRLFINCFENAQLPSLEKISELIKHPVDTPVWLSFPSSG
                     SIGLGNLNLDSIQTILNVCHLLEFYPQNKLVFSPDGYTETSFLLVAYLIFKLDKSLDE
                     VIFDLHKKYDRPFFLFLIDIQVLSHLETLLRQYSPMRNETTDPKLPLTIDADTFSKIF
                     FIKPPTDSPFLKCKGPLPSRILPHLYLGSLKHAQCPEMLKELGIRNIISVGESVSWCR
                     PRSNTVNEEITLPARNMERKRSNSFNVLPTANSQAASVINITEQDGFRVCHIDNLGDN
                     GMDPMLHQLDMVLDFIDQCYRKNEAVFVHCMVGVSRSATVCIAECMKRLDCGLLKAYL
                     YVRVRRLNIIIQPSLMFVYELLKWQELYESHDPDVTWDWNMICRCISQLNSNYI"
     gene            <170883..>171383
                     /locus_tag="KLLA0_F01859g"
                     /db_xref="GeneID:2895286"
     mRNA            <170883..>171383
                     /locus_tag="KLLA0_F01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455164.1"
                     /db_xref="GeneID:2895286"
     CDS             170883..171383
                     /locus_tag="KLLA0_F01859g"
                     /note="some similarities with uniprot|P27344 Saccharomyces
                     cerevisiae YBR278W DPB3 Third-largest subunit of DNA
                     polymerase II (DNA polymerase epsilon) required to
                     maintain fidelity of chromosomal replication and also for
                     inheritance of telomeric silencing mRNA abundance peaks at
                     the G1/S boundary of the cell cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455164.1"
                     /db_xref="GeneID:2895286"
                     /db_xref="GOA:Q6CLM5"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /translation="MDEYKSKLPRIPISKCKKIARTDPEYILTSQAAFAATAFTTELF
                     IQMLAEETCSLAQIHKQTKTLRLNYEDLSTAIRNLDKFQFLSDVVPQTENLASLVREN
                     KVRYTIVNPSPEIDIESEDEVDEANEPEVGEPEVDEAEVEAEVEAEAAEPETHTLDEP
                     RPESSS"
     gene            <171694..>172395
                     /locus_tag="KLLA0_F01881g"
                     /db_xref="GeneID:2895284"
     mRNA            <171694..>172395
                     /locus_tag="KLLA0_F01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455165.1"
                     /db_xref="GeneID:2895284"
     CDS             171694..172395
                     /locus_tag="KLLA0_F01881g"
                     /note="similar to uniprot|P40364 Saccharomyces cerevisiae
                     YJL066C MPM1 Mitochondrial membrane protein of unknown
                     function contains no hydrophobic stretches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455165.1"
                     /db_xref="GeneID:2895284"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM4"
                     /translation="MGLYRGSDDKDYKGENESVAFPGEVWEGLLSSGVVHDVLQGLGF
                     PGGWAWNIDKLVDDVNNGITTRTKTPSVEQFSKCNELKGVSVWDTRGLWRCLFPQSVV
                     QNGGLSREAVEADKDHKLGLFFPEYSGFLSWRAHMMALAKQKRKEEREIYSLSTPEDV
                     MLNQVDSLGKNVVGTSSYSTYKATPEGKERIKEEKTYYEDGTVLVKTKKKIYPHDGEP
                     RVESSEKLLNTDESS"
     gene            <172931..>174667
                     /locus_tag="KLLA0_F01903g"
                     /db_xref="GeneID:2895287"
     mRNA            <172931..>174667
                     /locus_tag="KLLA0_F01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455166.1"
                     /db_xref="GeneID:2895287"
     CDS             172931..174667
                     /locus_tag="KLLA0_F01903g"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
                     induced under low-nitrogen conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455166.1"
                     /db_xref="GeneID:2895287"
                     /db_xref="GOA:Q6CLM3"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM3"
                     /translation="MLKGGETAQSSSVWLKSALVASVLLLTGFKIFSQLETSNDVVTN
                     VQEFIPYCRDNYEPLAPKVSSKFLNKIDKILNNKEFKDDVAAKLSGAVQIPTVIGDVF
                     PNPKDDLEFYSEFFKLHDYLEKTFPLVHKHFKKEKVNEVGLLYTWEGSDSSLKPVLFM
                     AHQDEVLVNPETVGDWKHPPFSGYYDGESVWGRGSADCKTTLIGELVAMEELLRDGFQ
                     PQRTIILLFGFDEESGGEIGARTLSQFVEERYGTDSIFTIMDEGAGVVEVESGLYAAV
                     PITQERGFGNIEITISGPGGHSSVPPKHTNVGILSELVYTLENNSFDYVIEDTHPFLS
                     YYQCVAEFSNKIDPGFRHIIKKAATSYKYRLEFVKALEVFDPLSALTFKTTESIDMFH
                     SGVKVNALPETGSLEINYRIGMHSNAKEVLERTAGITNKIAQNHGYNLTIDGDRVIYS
                     DPQNVGTLNLKMYTYKDPSPRSPSYQDNDKVWDLFAGTIRDYFENRVLSKDEPSKLFI
                     TTGTMTANTDTRHLWNLTSHIYRFQGAIFPIELFDIVHSVNEHSPVANVLQLAGFIYQ
                     YVLNADGADVGF"
     gene            <175031..>176317
                     /locus_tag="KLLA0_F01925g"
                     /db_xref="GeneID:2895104"
     mRNA            <175031..>176317
                     /locus_tag="KLLA0_F01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455167.1"
                     /db_xref="GeneID:2895104"
     CDS             175031..176317
                     /locus_tag="KLLA0_F01925g"
                     /note="similar to uniprot|P38351 Saccharomyces cerevisiae
                     YBR279W PAF1 RNA polymerase II-associated protein defines
                     a large complex that is biochemically and functionally
                     distinct from the Srb-Mediator form of Pol II holoenzyme
                     and is required for full expression of a subset of cell
                     cycle-regulated genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455167.1"
                     /db_xref="GeneID:2895104"
                     /db_xref="InterPro:IPR007133"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM2"
                     /translation="MSRQELIAKIRYENELPAPLLPPKLIKYQASPDEDVSSSKLLTS
                     LYTKTNVTPLIDLDHDLGMPLDLLTIPGVLNQQNVGGLFGYDNIKLKQEDRVLLRDPG
                     MDKVVQSDLSKVTFLRRTEYVISTNMSKADKVKRTRSALQNEETLTPEQVLEKVESTF
                     NHRTDDLEKLRHPIKKKVKAVNSWNLLPDTVSMDQGYFTVKFVGSAALDGKEKEKYDM
                     STALLRPVELEEDEWISAYSTEKESSTKLSENLEQQIDEISHDDSIYKFKRFRDFDMK
                     QIEPETQSSDLALRYDNDKRTVYYKPLRSRLELRRRRVNDVIRPLVREHNWDQINVRL
                     RAPTTKETKVRDAIRMRYDPIDFPALDDDEEEEEAEDNEDRDSQNGEDSQNQGLASTE
                     NVKPTASDEVKEESVQSATNELASQKDEDIKPESPV"
     gene            <176686..>177573
                     /locus_tag="KLLA0_F01947g"
                     /db_xref="GeneID:2894919"
     mRNA            <176686..>177573
                     /locus_tag="KLLA0_F01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455168.1"
                     /db_xref="GeneID:2894919"
     CDS             176686..177573
                     /locus_tag="KLLA0_F01947g"
                     /note="highly similar to gnl|GLV|CAGL0J05324g Candida
                     glabrata CAGL0J05324g and similar to YJL068C
                     uniprot|P40363 Saccharomyces cerevisiae YJL068C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455168.1"
                     /db_xref="GeneID:2894919"
                     /db_xref="GOA:Q6CLM1"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="InterPro:IPR014186"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM1"
                     /translation="MALKINSAIAVCGGKLLKLSHFSSCTGTDMDVNLYLPKQYYTSI
                     DDSKLIPSVLYLSGLTCTPQNASEKAFWQIQADKFGFAVIFPDTSPRGDGVATDPEGS
                     WDFGLGAGFYVNATEQPYSSHYKMYDYVHKELPEVLAEEFGSKVDFFKNISITGHSMG
                     GFGALSGYLKNINRYKSCSAFAPIVNPSAVPWGQKAFTGYLGSSNKEAWDGYDPTKLI
                     KHVENLNGNKILIHVGSNDPFLEKHLRPHLLQEAAKGTFWEGKIEVNFEDGFDHSYYF
                     ISTFVPQHAEFHAKHLGLI"
     gene            complement(<177739..>179541)
                     /locus_tag="KLLA0_F01969g"
                     /db_xref="GeneID:2894920"
     mRNA            complement(<177739..>179541)
                     /locus_tag="KLLA0_F01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455169.1"
                     /db_xref="GeneID:2894920"
     CDS             complement(177739..179541)
                     /locus_tag="KLLA0_F01969g"
                     /note="similar to uniprot|P38352 Saccharomyces cerevisiae
                     YBR280C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455169.1"
                     /db_xref="GeneID:2894920"
                     /db_xref="GOA:Q6CLM0"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR027046"
                     /db_xref="UniProtKB/TrEMBL:Q6CLM0"
                     /translation="MKSEAPTSNEIKESLPPDIVQTILPYLTSKDIKNLSLTNKYFNK
                     LLDYSNSSILWHELFRKSFGNTYTNDEPFISKNSKRFQTCSETILLNTHPGIEWDKLY
                     NLRKYRSAVFTWGCIKHGRLGYTISSNSRLSADSMNQLDRRITFGVCKPVEVPWMLYS
                     VPISGRANSWDDDDTEEETNILGEYDRSIVQISGGGFSFQILTQSGKLYSTGATYHGG
                     HNGPGPLAGEHDFQPIDETIRSLERSFPLVHGPFRVMGSIGDPIRIQNPHHTTNLTGT
                     FQQHEDIYADLMKLSDISSKCLPGNDQVRRMLPKSIFNVKDPKDFDESMIDSVRFVAV
                     SSGRSHFLALDDKNDLYSWDGREVNHGVKLIFNDLPMRSTNPILKISCGWNCNCIFIY
                     GVGLVVWKSRDTTVGFDGFANAHYKVIPNTGEVNGANKIVDFACGSDNAVFYITNEGE
                     KLWLYSNEIEKYIDLPIEGKMVKVQASNNTLAIFTSDTCYTVEIKDSEVAHNTLTKIE
                     ITPNVKIISLSFGDYHGIALSDTGDMYTWGLESEMCGCLGLGKPESIVSSGAGTFERA
                     RSIRVQRPTKVDIDGTCVAITAGGWQSGAIIIKD"
     gene            complement(<179904..>182510)
                     /locus_tag="KLLA0_F01991g"
                     /db_xref="GeneID:2894906"
     mRNA            complement(<179904..>182510)
                     /locus_tag="KLLA0_F01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455170.1"
                     /db_xref="GeneID:2894906"
     CDS             complement(179904..182510)
                     /locus_tag="KLLA0_F01991g"
                     /note="similar to uniprot|P38149 Saccharomyces cerevisiae
                     YBR281C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455170.1"
                     /db_xref="GeneID:2894906"
                     /db_xref="GOA:Q6CLL9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017149"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL9"
                     /translation="MSPSQLHKWSHDFCILSTVTFPRKKLLFAGTQDSRILCIDLRTY
                     NLIHTIRLGALDGTNTRSSVLCLTKSKNEEYLFSGGADSLVRAWSVGGNTHDYSLAVK
                     EMVTIYSLMDIGDIFSLAYIDELDLVVFGSQNASLLYVANVFKQNNLKKDYTMLPHLR
                     FDKFFDSKGPQQQSTQPLADSFETLPSTISSLSLHDEESACQTLQVPSSNILPFAHNG
                     FVYSIVKLESHRDTLPIYLDLKPDVQYIISGGGDGVSKLWSLHVDPADDQSVKICLVT
                     ELDNDEPVLTQFLEFPFLYVGLTDGLLKIWDLNTNQSVSTLQSDDPSDITSLAVCQDQ
                     IFASQRKGVTKFFQDDVYHWQGHQGSILSSEIICKSCTKNPYTRLVTGGNDGSLILWN
                     ITDLINNGQEDIDPIFHSHEATAKDRHNSWTATNLDNDHMLHNLSTLIHFQTVSRKAD
                     TRHLLEGRRCATHLQQLFYKLGARNCDLIPVHNEGNPIVYSAFSGNSRNVEKRKKIVW
                     YGHYDVVAADMDYWNTDPFKLTCENGFLKGRGVSDNKGPLLAAMYSVAELVQNGELDH
                     DITFIIEGQEENGSAGFKEALADNRYRFGEKIDWVILSNSYWLDDNIPCLNYGLRGMV
                     NLTVSVTSDEPNRHSGFDGGVHREPTADLISIISKLQDDGGKILIPHYDDNIKPLSEK
                     ELAQLIEIVERAQLHESVTVDSLIAKWTKPSLSVTTMKVSGPCEPTVIPQSASVDISI
                     RLVPGQDLNVIKQSLNDYLHSCFSRLKTKNHLSIKVLNEAEPWLGNPSNSAYQIIREE
                     IGKEWNTEPLMVREGGSIPSIRYLEKTLGAPVVQIPCGQSNDKAHLPNEQLRMKNWYK
                     MREILTRVFNRL"
     gene            <183770..>185470
                     /locus_tag="KLLA0_F02013g"
                     /db_xref="GeneID:2894905"
     mRNA            <183770..>185470
                     /locus_tag="KLLA0_F02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455171.1"
                     /db_xref="GeneID:2894905"
     CDS             183770..185470
                     /locus_tag="KLLA0_F02013g"
                     /note="similar to uniprot|P40362 Saccharomyces cerevisiae
                     YJL069C UTP18 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455171.1"
                     /db_xref="GeneID:2894905"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL8"
                     /translation="MDHTIPPPDEEELVLSKLVFGDNSDFYNELQNINLELSSEEDAT
                     EYVQNSDSEDSESDNEIGKVMDDQLFFVDDGELNVDDEDAMDIDDENEQASGSDYSNE
                     SEENESDAWVDSDDDRLQITVTENNRSKKLRKSHVESQINGREYLQRLRSQFEKIYPK
                     PNWIEDEDDSELDNDSENESGDYDNVIDGDINALTKILERTYNYTTANSKLLPPQTLD
                     ITRLKDANASHPSHSAIQSLSFHSTKPILLTGGYDRTLRIYHIDGKANHLITSVHIKG
                     TPVQTCSFYSSQDGKEQKVYTGGRRRYMHAWDLSNNNTSVAKIDKISRLYGHQDTQRS
                     FEKFKLAHFQDANGARHGLICLQGNNGWVNILHSSTGVWLQGCKIEGAISDFCIDYKP
                     QQNGHFHTILIATNTYGEVWEFNLNENGNTVRKWKDDGGVGITKIQVGGGSTISSPKK
                     RIIPNRWIAIGSDSGFVNVYDRQSDSQRPVFTLDQLTTSISSLEFSPDGQMLCIASRA
                     TKDALRLVHLATGTVFSNWPTSGTPLGKVTSVAFSPQGEMLAVGNEQGKVRLWRLNHY
                     "
     gene            <185846..>186283
                     /locus_tag="KLLA0_F02035g"
                     /db_xref="GeneID:2894827"
     mRNA            <185846..>186283
                     /locus_tag="KLLA0_F02035g"
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /transcript_id="XM_455172.1"
                     /db_xref="GeneID:2894827"
     CDS             185846..186283
                     /locus_tag="KLLA0_F02035g"
                     /note="similar to uniprot|P36526 Saccharomyces cerevisiae
                     YBR282W MRPL27 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /protein_id="XP_455172.1"
                     /db_xref="GeneID:2894827"
                     /db_xref="InterPro:IPR019189"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL7"
                     /translation="MKPTSARFFQQSQITQLTRPWKKYRDGTLFYGASKVGNKRVPLT
                     TKDGNKSMYKGTRSSGIGRHTQYGGYKINWNRVRTYTVPKDFNTDLKPLLSHNLPELK
                     HQFSGYQKGYTDPKLYFDKLKKYVKEGKIQSEASNVESYVERG"
     gene            complement(<186620..>188266)
                     /locus_tag="KLLA0_F02057g"
                     /db_xref="GeneID:2894828"
     mRNA            complement(join(<186620..188064,188257..>188266))
                     /locus_tag="KLLA0_F02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455173.2"
                     /db_xref="GeneID:2894828"
     CDS             complement(join(186620..188064,188257..188266))
                     /locus_tag="KLLA0_F02057g"
                     /note="highly similar to uniprot|P38353 Saccharomyces
                     cerevisiae YBR283C SSH1 Subunit of the Ssh1 translocon
                     complex Sec61p homolog involved in co-translational
                     pathway of protein translocation not essential"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455173.2"
                     /db_xref="GeneID:2894828"
                     /db_xref="GOA:Q6CLL6"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL6"
                     /translation="MAGFRLIDLAKPFLAFVPEIELPYDNLPFDDKLVITLTTALIYL
                     FGQFPLAGITKESVDVKDPIFFLRGVFAAEPRTLLEFGIFPPIATALILQLLAGFKLI
                     KVNFNQRTDRELFQTLIKIVSIGSYAILANIFIASGYYGEDLSLMAKFLINSQLIGAG
                     FFVTLLIEVIDKGHGFASGAMAIIAISLSTGLVDDLFGVQQIPVGQEGHREPRGAVIN
                     LLQGFRAKHKTFLGALVNAFQRDYLPNLTSGLLVIVLGGTVCYLQNIRTELSIRSTKA
                     RGMSNVYPIRLLYTGGLSLLFSYSILFYIHILGFVIIQLIGGNQEGSIINKVLGGYES
                     TEFFYLARFPLSLLTPPTSFFAVFKQPLTVVTFSAFLIVTGVWFATNWQEISGSSSRD
                     VSKQFKEQDVALAGHRDASKELIRIIPVASATGAATLAVLVAVGELLGLKGKGAGIVV
                     AVCSAFAILEVVTVDFQQTGGQSSIAQMLGGRAA"
     gene            <188816..>189100
                     /locus_tag="KLLA0_F02079g"
                     /db_xref="GeneID:2894826"
     mRNA            <188816..>189100
                     /locus_tag="KLLA0_F02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455174.1"
                     /db_xref="GeneID:2894826"
     CDS             188816..189100
                     /locus_tag="KLLA0_F02079g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455174.1"
                     /db_xref="GeneID:2894826"
                     /db_xref="GOA:Q6CLL5"
                     /translation="MSKLLKLTGFTTLSTLLGVSYYYYVIDRPLYQQTALHKTNVQVE
                     NIIDNKAQFQYEHMSRDSQAVVQRPFAETVKDIWNKEVRNTADWLYSWGK"
     gene            <189413..>190096
                     /locus_tag="KLLA0_F02101g"
                     /db_xref="GeneID:2894825"
     mRNA            <189413..>190096
                     /locus_tag="KLLA0_F02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455175.1"
                     /db_xref="GeneID:2894825"
     CDS             189413..190096
                     /locus_tag="KLLA0_F02101g"
                     /note="similar to uniprot|P38340 Saccharomyces cerevisiae
                     YBR261C Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455175.1"
                     /db_xref="GeneID:2894825"
                     /db_xref="GOA:Q6CLL4"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL4"
                     /translation="MTTPDSNINYKDAIDYWTSIPATVDGVLGGYGDQTPLPNMDVHG
                     SMHFVRKLKSRMITEGPKNSCDIGAGIGRVTKNFLSKISDKVDLVEPVVPFVEQAHVE
                     LDALKKEGKIGEIFAIGMQDWNPEEGKYWLIWCQWCVGHLPDEELIQFFHRCKKGLQK
                     NGTIVVKENNTVGDDDFDPVDSSVTRSNEKFMQLFKEAGLKVIATERQRGLPDGLYPV
                     QMYALKTVV"
     gene            complement(190183..190319)
                     /gene="SNR60"
                     /locus_tag="KLLA0_F02112r"
                     /db_xref="GeneID:9487280"
     ncRNA           complement(190183..190319)
                     /ncRNA_class="snoRNA"
                     /gene="SNR60"
                     /locus_tag="KLLA0_F02112r"
                     /product="snR60"
                     /note="C/D snoRNA monocistronic SNR60"
                     /transcript_id="XR_002633605.1"
                     /db_xref="GeneID:9487280"
     gene            <191154..>193190
                     /locus_tag="KLLA0_F02123g"
                     /db_xref="GeneID:2894824"
     mRNA            <191154..>193190
                     /locus_tag="KLLA0_F02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455176.1"
                     /db_xref="GeneID:2894824"
     CDS             191154..193190
                     /locus_tag="KLLA0_F02123g"
                     /note="similar to uniprot|P38339 Saccharomyces cerevisiae
                     YBR260C RGD1 GTPase-activating protein (RhoGAP) for Rho3p
                     and Rho4p possibly involved in control of actin
                     cytoskeleton organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455176.1"
                     /db_xref="GeneID:2894824"
                     /db_xref="GOA:Q6CLL3"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL3"
                     /translation="MSVDTSESGTDPNLTGCVAEPSQSNDLLQREEVKKVLSSDIAIN
                     ALLSRLKGSLLTCEEFTKFMRKKYLYEEEHAQEMSKTTKHFFQETGNSGLSRSIHQLL
                     EYDNKLSQVKISYVRALQKIYDEVTALLLTVTKTRKSLKEKSRRLEKDVSDAIHTAEK
                     AKSRYISLCQDWEKLRLTDPTKTKLTLRGSKTTKEQEEDLQRKIDSADLEYKQRVDHS
                     NSLRNTFLSKERPQIVSELKDLILEIDTAMSIQLQKYTIWTENMILNSGVSVNPVDGN
                     SKSMRSSATSMNNELDLYNFLNKYNTSKSGSMINKNLIPVEYKKHPSMARSYTSSAMG
                     TSSNFGKISGPSNFVVNNSKNSLPKRVMSTQHESPFNSSSAAAALSSTVSPSATTHPP
                     NSASSGPSQSSVNGNSITSTSSRPLKSMVDVVPPSETNKKDFPTLDPRPNIRQTSVAP
                     SVATTETMTRPPSTVQTIGSLPPGTAKDFKTFAVPLENLLDYDQDLVPAIVRQCIYVI
                     DKYGLNLEGIYRKSANVLDVSRLKSEIDKDPSNVFMILPPKNYTDSDIYLVGSLLKTF
                     FANLPDTLLPREMTEEIKTCLSIEDSTTRKNYMHGIIYKLPDGQYWTIRALIFHLKRI
                     LEHETKNRMGLKALCIIWGPTIISPNNEDLNDVNYQISAMELLFDVADQAFEPE"
     gene            complement(<193239..>195395)
                     /locus_tag="KLLA0_F02145g"
                     /db_xref="GeneID:2894822"
     mRNA            complement(<193239..>195395)
                     /locus_tag="KLLA0_F02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455177.1"
                     /db_xref="GeneID:2894822"
     CDS             complement(193239..195395)
                     /locus_tag="KLLA0_F02145g"
                     /note="some similarities with uniprot|P47050 Saccharomyces
                     cerevisiae YJL047C RTT101 Cullin family member subunit of
                     a complex containing ubiquitin ligase activity binds HRT1
                     and is modified by the ubiquitin like protein RUB1
                     Regulator of Ty1 Transposition Regulator of Ty1
                     Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455177.1"
                     /db_xref="GeneID:2894822"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL2"
                     /translation="MYRIKVPPSTYSQCDMPLLVPERIKSSKVLYDSLLSELELLLRQ
                     YQIPGDDLKHDEKIYFTLQKLIRCKVPRLAKASSNSSQYAAVFKDTFVEDLWSLLSKL
                     INEQVDEEDFTNIEWLTNLCELEDAYKKIQGKVNSLQYYTKAFLRNLPNSLENISCRS
                     LEGYATLVFFSRIANRLHSQLRQTIESFIVEALESRTTSQFSLVKNIIRYDIPIDKSS
                     VLGLFEETTNRIINSFTYSSDHFKRVDSLQKQIIYYCSEYQILCQNLSINTVDILLLK
                     FKYFEDFFDRCMDDQMTIITIIEELGDMIYAYYPWRGEEYDNFVVRVICKMLDEDYLS
                     SFISTYSMSSESFDSNRKAIMKNMITLTFNADIKNIEKVDRWLCKVSEEGQFSGIKDL
                     VRSCCIFMNDIFPPDSKQDELLWNIYKRKYFLRSVLKSLGGSEQLIKTNERFDQQLLC
                     CGLLKSVHILELQQLNDELIESLRMKRAPKITPVILKQSNISDSLDSSEISGLILPEP
                     LNGMVNKQWEYYKVLDRNDHKTMSLQCQLNLLELKSPFRHGISSEIVILHVNLLQASI
                     FHLFNNSARLSLEQIKNTLTETKHNIPQIDSNMEMFLQMNMFKKDSEDCFYLNTKYKP
                     KKEALNDGKLTLYHLPKISPKIMENDKADNRWFTEIVCACIIRTLKQRRKCTKTKLFE
                     YVASAFPGISRGEFKDALGRCGEYYTSENGNVQYLL"
     gene            complement(<195562..>197445)
                     /locus_tag="KLLA0_F02167g"
                     /db_xref="GeneID:2894823"
     mRNA            complement(<195562..>197445)
                     /locus_tag="KLLA0_F02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455178.1"
                     /db_xref="GeneID:2894823"
     CDS             complement(195562..197445)
                     /locus_tag="KLLA0_F02167g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455178.1"
                     /db_xref="GeneID:2894823"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL1"
                     /translation="MNIRNGKELTWFTYGNLVNKSEDELKDVNKRLTRWIDQLRYSDA
                     NGLDDNKNRLLDVTRGFLQSFDNEMQHMTNTIESPLTIGSLAKHILTIKLQLRKIQPL
                     FLPLERALHKLGLNIRHYSLLVQWLVTIVGYKLYSELNDLIRRGFEIEVETRSISNDQ
                     FYEVCKLFSDLGFDSHYHHFLDPISLPKNNDVNPRFILSILEGLVLTFKTQLQVQSDI
                     KDFEAEAYTFMNYLHNVTLQIYPEEVFAVTRAGFFAVFADVDFYKASISQKLGSSQPL
                     NSQRISYNICGLQSVLTEKDILSANLEITTKWVQDLTEVGPNYHRLLIRMMDFILQQR
                     KPIMSRQYAFELDSKNTIKFMRLMVKHILTYFPGTTNIGDVLGKKAYNMTEKERRWLT
                     KIGVFLKNTRQFQPFSASYFEQYVIKEIIRDNLTIDLVKSILVGKKLELDAPLARFYI
                     VMQQDAGTLNNINRMFSHLSLKITRNNRKNDIILPAKIFPNIYSENSAKLPFNLPGKW
                     VNKHEPRITSDGINVHFYDQPHLHRVIMKPTIFQKTNISINFNLCHAVILDTLFNKKL
                     SWSLDEMISALSVRNQAMFSHYLSSLVKHGLLIRKEDGIFALNLGFKPNSKLLVNNIF
                     TIP"
     gene            <197699..>198085
                     /locus_tag="KLLA0_F02189g"
                     /db_xref="GeneID:2894821"
     mRNA            <197699..>198085
                     /locus_tag="KLLA0_F02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455179.1"
                     /db_xref="GeneID:2894821"
     CDS             197699..198085
                     /locus_tag="KLLA0_F02189g"
                     /note="some similarities with uniprot|P38337 Saccharomyces
                     cerevisiae YBR258C SHG1 Subunit of the COMPASS complex
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455179.1"
                     /db_xref="GeneID:2894821"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:Q6CLL0"
                     /translation="MNSNGNDLKEESLDPAKYLAETFKKEGHLDSLKNEILSQNVEGD
                     ISLDEFIKSRVRDLVRDRVNEDESLIFKNRGTTTALLEGQLFKDGFKSLNTSNIDVEK
                     LLSDSLDDATTRQKIRTILEAKTNDS"
     gene            complement(<198132..>198956)
                     /locus_tag="KLLA0_F02211g"
                     /db_xref="GeneID:2894820"
     mRNA            complement(<198132..>198956)
                     /locus_tag="KLLA0_F02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455180.1"
                     /db_xref="GeneID:2894820"
     CDS             complement(198132..198956)
                     /locus_tag="KLLA0_F02211g"
                     /note="similar to uniprot|P38336 Saccharomyces cerevisiae
                     YBR257W POP4 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends binds to the RPR1 RNA subunit
                     in Rnase P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455180.1"
                     /db_xref="GeneID:2894820"
                     /db_xref="GOA:Q6CLK9"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK9"
                     /translation="MDRIQPFIEECLFTKCFDNPRKPINENRLTQTLFLMPTDGGLST
                     KLRKKSKAKLLHSSSMGGSAGLKHPNYKAVNKNSRVLLKEYINKCNNASASCKKLAKR
                     LKISDRDQLQRVLEEKHKDLLEQLPNFETFSSMFEDIWCPYMKELLNIPDNHKVGNPL
                     PLNSQQTLIKLSMADYNGCKLKVSKSKNKSLTGKNGIVIWDAQKTFIIITKGGLVDEL
                     KSIPKKGTTFDFEIPINEEESLAYTILGDRFKYRSVDRAGRKFKSRRCDDLLYYIS"
     gene            <199224..>200429
                     /locus_tag="KLLA0_F02233g"
                     /db_xref="GeneID:2894818"
     mRNA            <199224..>200429
                     /locus_tag="KLLA0_F02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455181.1"
                     /db_xref="GeneID:2894818"
     CDS             199224..200429
                     /locus_tag="KLLA0_F02233g"
                     /note="similar to uniprot|P47051 Saccharomyces cerevisiae
                     YJL046W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455181.1"
                     /db_xref="GeneID:2894818"
                     /db_xref="GOA:Q6CLK8"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK8"
                     /translation="MISKCTHRVATTLLRSGISVPKRLYTPANNQIPFELDETDEKYK
                     ELNNIYRELFTPTDKANILTTKDIESNKRSEVDEINEELNSLYSVGVLSPAELEDAVK
                     SNGRFVIRSVSTNPYFNLALEDYVFRNTPLTENKTGNERILLYTNDKCVVVGKNQNPW
                     KETYMRNIASRGYNFVRRRSGGGAVVHDLGNVNYSYLTSRESFRREFFNQQLVQWLSN
                     ENITLNDRGDLIYKGYKISGSAFKIAKGKAYHHGTMLIDSDLAQFKGLLKPDVIPGVE
                     WTCNSVESVRSKVDNIGGKAISSIDDFCNLITDQFRNLVDDSEIPMFYCDESSSLLEI
                     TEISENLRSKEWKFMSGPRFEVICNDVTIKVEKGVIIESDWPELVGMPFYKFYDEVRE
                     DDKIFKHLL"
     gene            complement(<200492..>202426)
                     /locus_tag="KLLA0_F02255g"
                     /db_xref="GeneID:2894819"
     mRNA            complement(<200492..>202426)
                     /locus_tag="KLLA0_F02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455182.1"
                     /db_xref="GeneID:2894819"
     CDS             complement(200492..202426)
                     /locus_tag="KLLA0_F02255g"
                     /note="similar to uniprot|P43606 Saccharomyces cerevisiae
                     YFR029W PTR3 Component of the SPS plasma membrane amino
                     acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
                     external amino acid concentration and transmits
                     intracellular signals that result in regulation of
                     expression of amino acid permease genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455182.1"
                     /db_xref="GeneID:2894819"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK7"
                     /translation="MSIEQILKDLEQNLFLPSEILRSGNKISVKYRYIDDAYVQSCGC
                     IMSEQLSKEIQTSLSATCPVCHTASVTGVGPVGPLRHLYDQLRFYQNNKPPNEDILED
                     PTLTQSTERSRRHSDKSHSLLSLFLQVASKVATEDEQDSPVKNGALKDVNDVQNFKAS
                     AEEPIAVETGSLDNISNSKTIPIQDNNSSMVETPLFPINTATIASEFNEEKEYYFAKC
                     FPMYRKRSQFNTHSKFLRTKSKLFINNSISPDCTKFALITPNKWEVFSIPSTNSGSKN
                     KEPELLFCGNTNGEFGPNFESLSFPQNATVLQPIYNESWDAATMRTTRKKTKDNSAAT
                     ALSQWEHIYCKLSNRLLVVAGTRGIFRVFNLSRGGEPIYTYCSSFPIRSIDINPITSI
                     VSCGITGRDRTTGSEQALLLFHRFEFDQSSQSWQFPQPITITLPYRDPIHTLQFSSDG
                     KYLSCSTALESRFLVISLRKINEPRLVMKSLRSLDTSLESEGITDTKLFPGNPNLMCV
                     TSVAFNAPPIVINTKIESINGVQSVAQPTMLLRLDELGSKIHKCEISPRNDSIAFLDR
                     NGTVNILFAPTMMDNEKRRILTVDVVSNAYRMREAASMRFSVDGHTLYILDRKGILYV
                     EDFAFALPQHPEVTKCKQIN"
     gene            <203211..>204107
                     /locus_tag="KLLA0_F02277g"
                     /db_xref="GeneID:2894817"
     mRNA            <203211..>204107
                     /locus_tag="KLLA0_F02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455183.1"
                     /db_xref="GeneID:2894817"
     CDS             203211..204107
                     /locus_tag="KLLA0_F02277g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455183.1"
                     /db_xref="GeneID:2894817"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK6"
                     /translation="MQFPLLMQIGLVCLQIFNCVESFPVSSQTHSLSFDTIRRVFNGI
                     DSLLSEIGKNVTILENQLAKSITFDSTTLPEKEISSETNFNELQEALCEFQVVLDNCI
                     RFLPHEYQRVNNSKAHISRVVAGLESMDAIYYRTHKMVANYIAFQTTRLDELSKVMWK
                     CSVENSNTKNGCNNMALKQVQLLENVELTMKLTNSYLDIIKDSKFLTEIKSQQPQNDN
                     FHDPTDIIRLLEEESLEDLSCVTLIFKLLLLFGATSFATPLICFWTGYLKNGSRICEK
                     WAVNITFKEFYIIMELVRRIKA"
     gene            <205549..>208167
                     /locus_tag="KLLA0_F02299g"
                     /db_xref="GeneID:2894816"
     mRNA            <205549..>208167
                     /locus_tag="KLLA0_F02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455184.1"
                     /db_xref="GeneID:2894816"
     CDS             205549..208167
                     /locus_tag="KLLA0_F02299g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455184.1"
                     /db_xref="GeneID:2894816"
                     /db_xref="GOA:Q6CLK5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK5"
                     /translation="MRCVLACSRCRQQKIRCIHDGKPPCTYCLHKGCGDECVLTYPPL
                     KTNKSKVNKRKANKPLGNNRNGDMSGVAVAAAETPVSAAVAPPPPPPPTVTTNNLIPN
                     GELPHNQQGYSQERRPDAVLTNRNLNVVPPPPMDAIFSPGVIPTINNEMLQYQSLKNN
                     VRAPLFSSIQSLVSSTPKSHILTAIKRVEISFPECLFFHIPTYENRLEEVNHILIGAL
                     LAVCSYSSPFKVPDLKSEFSSEDKWLGVNSFQVKHSLYEKLALDAIFNNCHFISKPDI
                     EICQSLLLLSCVKWGHNDYFAAWMLHGCAVRMIQAIQFDERFQHSCKQDPLLNELRNR
                     TFWSAFCLDRVISTGEGHCFTVNRFMDVELPLPESYFFGLSGVSNTGKTNVPLNGDVY
                     GLSKINSQSSDIGIEQEVSASNTQLAAAFNIQLKSKVTIGSFNKFYKAYPQLLLQNER
                     SAFIKCYSLWGSINEYMMDGGRVKRSAEVPWDLENSTVGKITKEVDDFWNVIPAEWKW
                     GNFDYASQRPYHIKKLFMITSMNCLHFLTIIFCIREYLPFLPSKELGPCGPIEPPFMP
                     QPPYTTYWSDMSRKCFAALRQLCEILKVVFETESENTKGSINLIESSPFFSFCAFVCA
                     IQCNYGSNFPFMDPDAALYKKNKDKNLSYCYKMVLKILKSRESFCPVTKNWLHMVFKV
                     QEMYKSVAGSRTSSKVVPNGSEQTQTYVPIQPTILNPNSSQNTFQRPADPPGISQSTA
                     QRIQNQSLPNYGAPLPLGQLMSPSDSMASNRDQLPSGSSSLIPDSSSSIIVGTGSDGI
                     FGSNIGNSENNGLLTNSKTTPVLQHATTTSDIASGSSSNPSSTPRFPIEVEPETDKLS
                     LLFSDQEFEMLMQFSK"
     gene            <208858..>209721
                     /locus_tag="KLLA0_F02321g"
                     /db_xref="GeneID:2895823"
     mRNA            <208858..>209721
                     /locus_tag="KLLA0_F02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455185.1"
                     /db_xref="GeneID:2895823"
     CDS             208858..209721
                     /locus_tag="KLLA0_F02321g"
                     /note="similar to uniprot|P46669 Saccharomyces cerevisiae
                     YOR340C RPA43 RNA polymerase I subunit A43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455185.1"
                     /db_xref="GeneID:2895823"
                     /db_xref="GOA:Q6CLK4"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK4"
                     /translation="MKRSSEEVKALRLIKRFKKTSKNPIDEEDGCSKCIVRVPVFMYV
                     SLAPIYQQLPKEGIMRQHLNGMVMKYNADVGGVILGYENLSILGEEPTEEDEKLMKLT
                     ADTPFAFTWCNVEVIVWQPQVGDTIEGWIFIQSASHIGLLIHDAFNASIKKNNIPNDW
                     TFIHNEETTENGQDSTDDRKFQSLGHWVDGNGQQLGGKLKFKVKNVYTTGRMVSLEGT
                     LLDDSARGSHSEAENLPVVSNKKIVFDDEVSKENTDSHKELELSVVKEDNGDEIIYEK
                     DSSDSDSSESD"
     gene            <209983..>210849
                     /locus_tag="KLLA0_F02343g"
                     /db_xref="GeneID:2895008"
     mRNA            <209983..>210849
                     /locus_tag="KLLA0_F02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455186.1"
                     /db_xref="GeneID:2895008"
     CDS             209983..210849
                     /locus_tag="KLLA0_F02343g"
                     /note="similar to uniprot|P39731 Saccharomyces cerevisiae
                     YAL034W-A MTW1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules critical to kinetochore assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455186.1"
                     /db_xref="GeneID:2895008"
                     /db_xref="GOA:Q6CLK3"
                     /db_xref="InterPro:IPR008685"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK3"
                     /translation="MTTPTMQSTSLLTEHLGYPPISLVDDIINAVNEIMYKCTNAMEK
                     YLMQRNIIGKKDFSDEIKIGTAKLESLLENSVDKNFDKLELYVLRNILSIPSDLLEEN
                     RFRLLHHEKLVLTDSATRAHTDTSIEQKLQEIERQYQLNVMLRDRIQNTKELLTEVVQ
                     FKKKVIDLLRCDDNLTTALHELWDDLKPLDVAVKLITTRLKQIYLENEEFYSIDQVNR
                     LVKRYNELRNTSIVRNGYIDKKSQHILDELHISVNSTQNNEDSTNTSIRSLQEDDPEI
                     EHPDWSSMQKVI"
     gene            complement(<211473..>212747)
                     /locus_tag="KLLA0_F02365g"
                     /db_xref="GeneID:2895009"
     mRNA            complement(<211473..>212747)
                     /locus_tag="KLLA0_F02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455187.1"
                     /db_xref="GeneID:2895009"
     CDS             complement(211473..212747)
                     /locus_tag="KLLA0_F02365g"
                     /note="similar to uniprot|Q06855 Saccharomyces cerevisiae
                     YOR338W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455187.1"
                     /db_xref="GeneID:2895009"
                     /db_xref="GOA:Q6CLK2"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK2"
                     /translation="MEFNSPRPEHIQLQGQGTIVHPKGTSNIISSLNERILANTSDAN
                     GSRNANSIDKNITQDETGSRAVILGNGFTLLAPRPMAGRDAALYEPVDEYLIPSPPLS
                     PKETDTHRNTSHTSAEDGSVVARGNQPLNITGLEIKLKEIDQQQEHPEESSLDGIVVK
                     GVWDNYNKENGTKTYQLHINAFLSQYKVLKPKISSNFGGRSVSPISRYTRRTRTSNKT
                     YASNSDFERVYRTRRTTGGNTTSTRNGGATSDDSSAVPYLPRQRPVTPVSRRKPVSHH
                     HPSPLSHSSITTAAGSSSANHHHHTVNMSWEKLPDYSPSLDTLPPNNNKCLKVDWKGS
                     SMDLSHDPLRNKLHPAELVLAQILRLPCDLYLDSKRRFFIEKVHRLKQGMPFRRTDAQ
                     KACRIDVNKASRLFAAYEKIGWLQDSHFKRFL"
     gene            complement(<213669..>215852)
                     /locus_tag="KLLA0_F02387g"
                     /db_xref="GeneID:2894907"
     mRNA            complement(<213669..>215852)
                     /locus_tag="KLLA0_F02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455188.1"
                     /db_xref="GeneID:2894907"
     CDS             complement(213669..215852)
                     /locus_tag="KLLA0_F02387g"
                     /note="similar to uniprot|P47988 Saccharomyces cerevisiae
                     YOR337W TEA1 Mutants are defective in Ty1
                     Enhancer-mediated Activation Ty1 enhancer activator and to
                     YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
                     CHA4 Zinc-finger protein with Zn[2]-Cys[6] fungal-type
                     binuclear cluster domain; DNA-binding transcriptional
                     activator or CHA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455188.1"
                     /db_xref="GeneID:2894907"
                     /db_xref="GOA:Q6CLK1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK1"
                     /translation="MVNFEKHTSHQQHKNETSQHETKLQMDSEASSEPPAKRLACANC
                     RRRRKKCDLEYPCGRCQELGLGCNINKVDLRKKRYNLTYVKNLEDHVAEMELRLRQYA
                     KLADEILPEDATDIKRLMVDEVLNGLSPMPSTGSPITAAKPNTPVLIKSLPSNVDSSC
                     NVPSDGYVDDNENTVGNNRPPSAQSNDSSLSNSSVHHDVLRNKKFVKGSIYPEGPTSY
                     KKRKRDTTSIFSQPTQRIGDLKSTVIVRNQIDPNDGRLNSDPAIIQSLSNFYKWLYPG
                     NFIFVHRESFLYGFFNHTDETYDNSQHCSEELIYAVAAIGSRLSKDLHHLSEKYYQIA
                     KTRLLKIVFEEQSIAKITTVQALLCLAFYELGNGENQLAWYFSGLAIRVGYDMGFQLD
                     PKVWITDDSINENQDLSDSELEIRSRIYWGCYIADHFICLILGRAPSLTVSNSTVPES
                     DELPEIEGTEDFRYESQTVLQVSQPLKNLMILSRIIQIFTSKIFIEPNTTSRRIEYLK
                     KFNLKVSNWRQSLPEFLKWSKSLVQSVDMSTDPTISYFWYHYYIVLITFNKPFMEDCE
                     ESKTVILEILGDLKTLLSNLKLKFGNGLRQATLYHLYTCLLSISCFQKLKSMGSDSVI
                     DSVFPNLSLELNWFKSVFHDLSNMYDLPNKIEEEDLELEQQQQENSAHQTHLNPHQGY
                     QGYQGFQGFHQMNNIHDFSLSDEIDDLIKQVFGFDTWNINPSYQV"
     gene            complement(<216348..>220091)
                     /locus_tag="KLLA0_F02409g"
                     /db_xref="GeneID:2894908"
     mRNA            complement(<216348..>220091)
                     /locus_tag="KLLA0_F02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455189.1"
                     /db_xref="GeneID:2894908"
     CDS             complement(216348..220091)
                     /locus_tag="KLLA0_F02409g"
                     /note="weakly similar to uniprot|P22023 Saccharomyces
                     cerevisiae YOR336W KRE5 Protein required for beta-1 6
                     glucan biosynthesis mutations result in aberrant
                     morphology and severe growth defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455189.1"
                     /db_xref="GeneID:2894908"
                     /db_xref="GOA:Q6CLK0"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="UniProtKB/TrEMBL:Q6CLK0"
                     /translation="MVLFRLRIVFLLLTVLHITQAFNEGIGKRWLSASLVDYDALSTD
                     QWMQLYRKITLSDEEEDEEDEDDDEGIEESISSASAEKVQQVEGLSGAISKYVQIAPI
                     DDEFKETCFVLNGKIYSKSDDSFYFKTSELDAQALVPDFDVLKDREIAIGTNASAPIV
                     VLYGCETDLEFADFNRNLYNEAKFGKIRMTWRPTCIIGDTPEYALSATLSDKNWDQKA
                     NVHLVIDDSDLKIKDPVKLKYLDQKELEDLDMKFTALLLEKFNEDHDFDSFFEYFKSL
                     SYNFPAVAPVIASKDNIDTTPAKNIVKDFNKRKISHELLGLYINGQQWRLSELDETTL
                     PAILAKEWSRVNDLKEKLSKFPGAELENFLKYFTVGYSYTAYFDKNRYDFYRTPGFSE
                     AVVFFNNFEKDELYKDLPEDNMAFLEPSDFEPIPSIKQNWNELIFFINFDDMTQFKDD
                     GAVGSLLQAIDQMETGYPIRLGLIPFSSSGSNSVVDMIYKLKSESDKPLQSIIDYLRT
                     LIGHSEKIQPQTKHKGSAYDEYLERFKIADTCIAMNGVLLPFQAKAWKIHTSRILSAD
                     IEYLKSELQALGDSSNLSVRQLLHHRSLTLKNPVYIPNRMLDETFTRVNNRALHVLGS
                     RTIIFSDPNQKTSPIHTITLVDDFNSYSAVQKIRALLRNNHKSVSFRLVHVGDLSKSW
                     DNFKMEFSTGKLSGKIASKTTVNFIVDPFLNVLSSWLPDISIKALRKPFAVINGKFFN
                     TDDDLYSVELWHNILVHHSSRTLDVLKTLHHIGALDENIMNPSAIEELTAAVIKYVHH
                     GYLVLNNGIPYTTESSMPRVSLSELEEYTITSRSDQSVINVTLLLDPVEERTQRLLYL
                     SSLLKDLPFVKTEVALVPTANLTLNPVHRFYNASTGISDNGFLSEFDYPHNINPDDKS
                     IIIEAHVFDEGDDVSIDIIDGLAGVCLQLMDNAGNVIDKGLSMKSFGYVQLSLPSLQK
                     GLKLENCDSSYEITALSTMAEANYIEVESFDVDNSLPTQIHVKVRKTTAEIMNEKDDR
                     VNVMVVVHDGQESVAVKRIERVKKEIGDKAKFYILAQRPKLIVREMPASVDYHLLTYT
                     WPLWLRPQRFSAKELEAKSILLLDTMVPKNVDYLVVLSLTDDSSDTIPWNDIASFSDA
                     VFYLKPAKTKEGSYWNFGYWKKYLQKYDLPFYDLSSSYIINMKKWREIDAGTSLRLHY
                     HLLSKSFISLNNFRADLVNSIQLKVPIAPLEEHTDELFEQDEL"
     gene            <220848..>223718
                     /locus_tag="KLLA0_F02431g"
                     /db_xref="GeneID:2894909"
     mRNA            <220848..>223718
                     /locus_tag="KLLA0_F02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455190.1"
                     /db_xref="GeneID:2894909"
     CDS             220848..223718
                     /locus_tag="KLLA0_F02431g"
                     /note="highly similar to uniprot|P40825 Saccharomyces
                     cerevisiae YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase
                     required for protein synthesis point mutation (cdc64-1
                     allele) causes cell cycle arrest at G1 lethality of null
                     mutation is functionally complemented by human homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455190.1"
                     /db_xref="GeneID:2894909"
                     /db_xref="GOA:Q6CLJ9"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:Q6CLJ9"
                     /translation="MTIGDKSKWTAANVRSTFLDYFKSKGHTFVPSSPVIPFDDPTLL
                     FANAGMNQYKPIFLGTVDPSSDFYKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFF
                     EMLGNWSFGDYFKKEAIEYSWELLTKVYGIPGDRLYVTYFEGDEKLGLEPDFEARDLW
                     KSVGVKDDHILPGNAKDNFWEMGEQGPCGPCSEVHYDRIGGRNAAHLVNQDDPDVLEI
                     WNNVFIQFNREQDRSLRALPAKHVDTGMGFERLVSVLHDVRSNYDTDVFEPLFNRIQE
                     ITGVRSYTGKFGAEDTDGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSQLSVTLIEQVKDMFPEVARDPSYLFEILDEEEASFAKTLD
                     RGEKLFEKYAEDALKKADKTLDGKQVWRLYDTYGFPVDLTELMAEEQGLKIDTIGFEK
                     AKQESYEASKKGGKKGASDLIRLNVHELSQLNGDNVAKTDDSSKYGTENVEATILRIY
                     DGEKFVDSMTEIGKQYGVILDKTCFYAEQGGQEFDTGKLVIDGEAEFNVDNVQAYNGY
                     VFHTGSLGDGKLSIGDSIIASYEELRRHPLRNNHTGTHILNFALKEVLGNDVDQKGSL
                     VAPEKLRFDFSHKRALSYEELVEVEKLSNEKIRDNLTVYYKEVALDLAKTISSVRAVF
                     GETYPDPVRVVSIGKAVEEVLENPTSEEWQKYSIEFCGGTHVAKTSDIKEFVIVEESG
                     IAKGIRRIVAVSGPEAYEVQRIATEFDGELTAVEKLPFSPLKAQKLKELGVRLGQLTI
                     SVITKTDLKDKFNKIEKEVKDELKSRAKKEIKQTLDDVKHHFDANKESSFYVKHIDIP
                     TNAKAITEAINHIKTNSKDKSIYLFTCNEPDGKVAHGCYISDAAIAQGVDGSSLAKTV
                     SSSIGGKAGGKGNVFQGMGDKPNGIDSAVAEVEALLKERLTI"
     gene            <224029..>224673
                     /locus_tag="KLLA0_F02453g"
                     /db_xref="GeneID:2894910"
     mRNA            <224029..>224673
                     /locus_tag="KLLA0_F02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455191.1"
                     /db_xref="GeneID:2894910"
     CDS             224029..224673
                     /locus_tag="KLLA0_F02453g"
                     /note="similar to uniprot|P28005 Saccharomyces cerevisiae
                     YAL033W POP5 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455191.1"
                     /db_xref="GeneID:2894910"
                     /db_xref="GOA:Q6CLJ8"
                     /db_xref="InterPro:IPR002759"
                     /db_xref="UniProtKB/TrEMBL:Q6CLJ8"
                     /translation="MLHITRFRVMMEINCEGIKILIKDGCATTFIRGFHPTINKTCCH
                     NRQNRRNPMVRLKSRYILFEVLYPDVDDEYETVPDITKKDILTTHHKVSPNTISPRNI
                     LQELRKQLQVNFGDYGLGKATALLQIKYFSNRTSTGIIRCGHDDHQYVIMALALMNQI
                     ESVGPIIMNPIKVSGTIKKVELFAIRRSHRLNRILLTDDRNDEFSSITDDENND"
     gene            complement(<224749..>226041)
                     /locus_tag="KLLA0_F02475g"
                     /db_xref="GeneID:2894911"
     mRNA            complement(<224749..>226041)
                     /locus_tag="KLLA0_F02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455192.1"
                     /db_xref="GeneID:2894911"
     CDS             complement(224749..226041)
                     /locus_tag="KLLA0_F02475g"
                     /note="similar to uniprot|P28004 Saccharomyces cerevisiae
                     YAL032C PRP45 Ortholog of human transcriptional
                     coactivator SKIP can activate transcription of a reporter
                     gene interacts with splicing factors Prp22p and Prp46p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455192.1"
                     /db_xref="GeneID:2894911"
                     /db_xref="GOA:Q6CLJ7"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="InterPro:IPR017862"
                     /translation="MSFRTLSSLLPSPQNSEVSESSAFSRQSKENIKDTIILDKLRPE
                     NLPVASISDFVPLRQRDISLEAPFPSTSQINQTYVKTKAFLDSLLTKKSSLQLSSIAN
                     KDIVKREAISSVKSGTQRSVKVIEHKKDPLQPVTHRKRKVVVPSEEIQAPILHKSDDP
                     SIKPTKEELDKWRIPSAISNWKNPNGFAISLDNRVAIESIKTDCPDNDKKDNFLLLSE
                     ALDEAEREARQRINIKQEAYKELEKEETLKKEQRLRHLAERARQDRENRRQYENEDHY
                     VREMERNQRRRAERELERSNKMSTAEKLRRLAYQQGRDVSDKVVLNAAKATETPDLQY
                     DSRLFKKAASSVASSSNQIFDHPLFNNSQIDNIYRPTTGSNLENEDIVDRLSNKKGRT
                     GPVEFSAADDGKNAEQNEEDNEHAREYGLQVRKKPHTS"
     gene            complement(<226225..>228498)
                     /locus_tag="KLLA0_F02497g"
                     /db_xref="GeneID:2894912"
     mRNA            complement(<226225..>228498)
                     /locus_tag="KLLA0_F02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455193.1"
                     /db_xref="GeneID:2894912"
     CDS             complement(226225..228498)
                     /locus_tag="KLLA0_F02497g"
                     /note="some similarities with uniprot|P39732 Saccharomyces
                     cerevisiae YAL031C FUN21 Cytoplasmic protein of unknown
                     function potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455193.1"
                     /db_xref="GeneID:2894912"
                     /db_xref="GOA:Q6CLJ6"
                     /db_xref="InterPro:IPR026241"
                     /translation="MLAKAAASASSSMEKGSVYLDFTDIKCIQYTSSIRKLEQLVHVC
                     KVLLRNLSMKSNENLIPLSNIVIALGSGFQFNVSAAIEKRIELLSQFRSCKANATNLP
                     LSTTSLKLEVDLVPVEEDSVLFVSKFYNKELQSQLLTTLQRVAEDSLQIYQARIRQLT
                     MERNSNRPTDLSGRTTIFNEDALNDLLSPNELAFGLDLLVNIRNRSTDTSSSAFFALA
                     LPILEKFRSNLNDKCIPPIRSYYTSIMKFSRTKGVFSNNVLIQLPYWQFTLHRMYAAS
                     LRAKCLIDVIRAVLRQIYIPNKHHFHDNTTKLHSKNLHEYSELLEELETFCFTQELEK
                     DLIEAFKSYGNQNTVYQVQFNNISSAYQRLLLKSTQMLRKAAKLVDSFSTQWKSISDN
                     MKASKYDDMNIDEMAKMAEEKLAVDELAYNEKIKEQERQREEKKNSSLSQKNTSSSSS
                     ITSNSSSLNVSPNILSPLRLSRTSSVSRSEESRSPSSPIPFTDAKSNISAKKTRSVRT
                     RNRSSSLQSVSSLEDTSTARNGMRSNSLQSGSLNTQRIVQNAYSKALLSLNEKRGPRL
                     TPTKLNNSIRSKSPSPTVSRQNSVKQRNKVNILKLNEVDEDDINEKFHDLKLDDDTLI
                     VSQEVLSPEGSETPKIIVSVADDNQSSSNNDSEVEGIVKKVRFIGVPPMSQDENPEPK
                     RRGWYKKPAVLHYPPPPAQHSLQKFRTTQEGLAFRTSLISRDQGSDKKFGFDSMYSSG
                     QGADTKIVGKIKDKLFK"
     gene            complement(<228859..>230187)
                     /locus_tag="KLLA0_F02519g"
                     /db_xref="GeneID:2894913"
     mRNA            complement(<228859..>230187)
                     /locus_tag="KLLA0_F02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455194.1"
                     /db_xref="GeneID:2894913"
     CDS             complement(228859..230187)
                     /locus_tag="KLLA0_F02519g"
                     /note="similar to uniprot|Q01926 Saccharomyces cerevisiae
                     YOR334W MRS2 Mitochondrial inner membrane Mg(2) channel
                     required for maintenance of intramitochondrial Mg(2)
                     concentrations at the correct level to support splicing of
                     group II introns"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455194.1"
                     /db_xref="GeneID:2894913"
                     /db_xref="GOA:Q6CLJ5"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /translation="MYFRFGKGLQIQLRHSSKAVRSQLRWNSTTKLIKPIASTQHPFL
                     VKPVTPHESYVSCTIFNEKGDVTAVSHKFPKWEFLQKYGLYPRDLRKIDSSTIDVIPS
                     FVIKPKCILVNVLHIKAMIQKDKVFVFDTTNPDAAIKLGVLMYDLESKLSQRNINYQG
                     KSVSYQENYEHRALESILINVMTCLETEYKYHHSVCGMILNDLENQIDRDKLRDLLIK
                     SKTLTAFAQKSVLLRDLLDELLESDEDLAGMYLSEKKHPDADDHSDLEMLLETYYKQC
                     DEYVQQSESLIQDIKSTEEIVNIILDANRNSLLLFELKVTVYTLGFTVATLVPAFYGM
                     NLKNFIEDSNWGFASVVGLSVAAAAVVTITNMRALRSVTKLTLLNNHTGANNKKHLAN
                     AKLALDKEIPTFWDRWLTSARVLWSGREVLYKDGSKRDMIWKWLVDDDKK"
     gene            complement(<230613..>231302)
                     /locus_tag="KLLA0_F02541g"
                     /db_xref="GeneID:2894914"
     mRNA            complement(<230613..>231302)
                     /locus_tag="KLLA0_F02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455195.1"
                     /db_xref="GeneID:2894914"
     CDS             complement(230613..231302)
                     /locus_tag="KLLA0_F02541g"
                     /note="similar to uniprot|P22203 Saccharomyces cerevisiae
                     YOR332W VMA4 vacuolar ATPase V1 domain subunit E (27 kDa)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455195.1"
                     /db_xref="GeneID:2894914"
                     /db_xref="GOA:Q6CLJ4"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:Q6CLJ4"
                     /translation="MSTITALSPNQVNDELQKMQAFIKKEAEEKAREIELKAQQEYEI
                     EKTGLVRNETSAIDNNIASRMKKAALKQQIVKSTIANKMRLKVLGTREEVLDSIFEKT
                     KAELKQISSKKEEYKPVLHSLVLESLLKLLEPSAIIKVRETDVEIIESLVDDVAKEYE
                     EKTGKPIKIELSSSYLNKDIAGGVIVSNGNGRIEVDNTLEERLKLLSEESLPAIRLEL
                     FGPSKTRKFFD"
     mobile_element  complement(232832..234840)
                     /note="DNA transposon of KLLA part of the newly discovered
                     ROVER DNA transposon family of the Kluyveromyces:
                     degenerate copy"
                     /mobile_element_type="transposon"
     gene            <235864..>237840
                     /locus_tag="KLLA0_F02596g"
                     /db_xref="GeneID:2894917"
     mRNA            <235864..>237840
                     /locus_tag="KLLA0_F02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455198.1"
                     /db_xref="GeneID:2894917"
     CDS             235864..237840
                     /locus_tag="KLLA0_F02596g"
                     /note="some similarities with uniprot|P34758 Saccharomyces
                     cerevisiae YOR329C SCD5 Multicopy suppressor of clathrin
                     deficiency and of ts ipl1 mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455198.1"
                     /db_xref="GeneID:2894917"
                     /db_xref="UniProtKB/TrEMBL:Q6CLJ1"
                     /translation="MSFDWLNVPGLDISNDSQASVSSSSPPPAVSFSFTTADRPQEPS
                     NLQQPQSQQSLRGREGNKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETA
                     QELQVPLAVPEFQLTPDERKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKE
                     RITHIFRTCRYAVNEEQFYAIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAG
                     QEVYEEVEEDPNNATDKKVDFDGFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNL
                     VTFANDLSTKAMSSISRSGKPAVTAPDNAASTESSPSDDSTLDLSLPMEQLLAKLSSR
                     NRNNSALVKELPSDTQPETQEEREVLEDMKDSLSHFRQIQKVDSVTQLPNNMSSYESS
                     NSSGREQALEPLKPTATGSANYLFRQTVPPSHNIDANKNDNHILEPLKPTATGSANEI
                     FKNIFRRSKPAEHLPQQGRTAPFVPPQRKVQFTEAMKPTSTGSANYLMKQQFQDLQEF
                     QPFQSALPSQQQQQQQYLSPRPSINAFQPPNQGQFLQPNAGGLVTSPQPQLSSHSNLS
                     SDGYFSSLITPSPPMMPTSSPQPQNISNGVNLSAAYQQHIPECGSNLNYQVRPNAVSP
                     RPARSQSDNILDDLKALQQQVDQLNQTYSYDGRR"
     gene            complement(<238258..>238551)
                     /locus_tag="KLLA0_F02610g"
                     /db_xref="GeneID:9487382"
     mRNA            complement(<238258..>238551)
                     /locus_tag="KLLA0_F02610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999378.1"
                     /db_xref="GeneID:9487382"
     CDS             complement(238258..238551)
                     /locus_tag="KLLA0_F02610g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999424.1"
                     /db_xref="GeneID:9487382"
                     /db_xref="UniProtKB/TrEMBL:B5FV95"
                     /translation="MHRPCVQRTRISVAHILQLRRKTDLLNSYFKQSFKENVIESATR
                     YVVNYCKRYGETSDIPLLSKPGEPLDINHVKKSKFLKAIWIPGPEHCGIPLCA"
     gene            <240871..>241524
                     /locus_tag="KLLA0_F02640g"
                     /db_xref="GeneID:2896006"
     mRNA            <240871..>241524
                     /locus_tag="KLLA0_F02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455199.1"
                     /db_xref="GeneID:2896006"
     CDS             240871..241524
                     /locus_tag="KLLA0_F02640g"
                     /note="weakly similar to uniprot|Q03362 Saccharomyces
                     cerevisiae YDR476C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455199.1"
                     /db_xref="GeneID:2896006"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="UniProtKB/TrEMBL:Q6CLJ0"
                     /translation="MSENTTSAKGTAQSIIAHMNKDHKLALEDFLYVFGNVPITDQIS
                     SVRLKEFELDHMTILFQHAAIDFDIEKVIPFDPPLSSFRDSRDRLVSMAKEAAEKRGV
                     SHVMINEMSYPRDFVEYLIIILVFLPIVVFMKRSLLQYFPLPQYIIDFISKDAVLISI
                     IIGEIICHAAETYFLLRPRLNYHRVPTDFLVEWYFFGMLEGYPIVKRFDDLAYQRTH"
     gene            <241804..>242565
                     /locus_tag="KLLA0_F02662g"
                     /db_xref="GeneID:2896007"
     mRNA            <241804..>242565
                     /locus_tag="KLLA0_F02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455200.1"
                     /db_xref="GeneID:2896007"
     CDS             241804..242565
                     /locus_tag="KLLA0_F02662g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455200.1"
                     /db_xref="GeneID:2896007"
                     /db_xref="GOA:Q6CLI9"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI9"
                     /translation="MDCFWKWFNQFWDWLYTASTQKQLSIAVVGLQNSGKTTFTNLIA
                     GEEFVVDTIPTLGVNIKDVKLPNHTNLKVYDLAGQTRFQKLWDRCFQQVDLLVFMIDL
                     SDLTNWEQAKNKLHDVIIATNLEHVPILILGNKVDLIPKFHRDLYVAKSDVSDQRSSV
                     ENSARKQTWNYVSPLLHNYEYEDIPKYDLNPENQHVLSKVEVLSKELGIDLKHGLLHL
                     PHDSKVKLNRDIALFSVSCKDGTLIDTVIDWILEL"
     gene            <242962..>245301
                     /locus_tag="KLLA0_F02684g"
                     /db_xref="GeneID:2896008"
     mRNA            <242962..>245301
                     /locus_tag="KLLA0_F02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455201.1"
                     /db_xref="GeneID:2896008"
     CDS             242962..245301
                     /locus_tag="KLLA0_F02684g"
                     /note="some similarities with uniprot|Q99248 Saccharomyces
                     cerevisiae YOR019W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455201.1"
                     /db_xref="GeneID:2896008"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI8"
                     /translation="MLEKTDPFYYKRVKFCLCDHCTEGSEELQRYKSNYSSDSRSSVD
                     SLLNGAGEKLVPTVSWDTVPIEGVSNEESGYDSDPHNLDYALDRFYDSDDSHDDIRHG
                     RGSSRTHLGITPTLTDRVRGSSPMRPRQNNDFTFQLDVGGSSNNPKIFFGPNGEIRRR
                     DYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEILFPKVKVD
                     LTDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHTWVALDW
                     AMAELAEDIDYIVIIANIPRRDWSTRSGSYTRSRSASRSRSRSRSRMRSVSRTREFGT
                     DDDQPDATWCDGCTVGEVNDLLQRLIEYSTLIMGGKKLKITVEIVIGSTSQILIDSLN
                     AYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKKLQR
                     DILFKQRVLPSDKDTDLDVSSFSVSTTETDDTENEDTDDDDDVETTSNLSLGNREKTV
                     KQIQKLRHNYRCLVDKKLKLLDEDTGLPTPEQYYGKMDSIINATLNFNKELETWGDSA
                     DMAEIKRSITGGVRPRVMKKKSMLDFSDLPPKRKSKIPTEHENSKETMDFNQNTFKNK
                     KLPKVVLSSPPPSRPVSPLANNGEGGIKFANSVKSKDGKGAIQRIKSYDPYSQNSDPF
                     DREDSALSLSVVRSHQPKSDSTSLRKVLSTTSLDKKESKKGRLLSFLFGGGSNNNIGS
                     NSSNSSPVVSESNSRRGSIASQSSSDSTKKRRSIFGLKK"
     gene            <245783..>248653
                     /locus_tag="KLLA0_F02706g"
                     /db_xref="GeneID:2896009"
     mRNA            <245783..>248653
                     /locus_tag="KLLA0_F02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455202.1"
                     /db_xref="GeneID:2896009"
     CDS             245783..248653
                     /locus_tag="KLLA0_F02706g"
                     /note="uniprot|Q96W95 Kluyveromyces lactis MSH2 Mismatch
                     repair protein Msh2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455202.1"
                     /db_xref="GeneID:2896009"
                     /db_xref="GOA:Q6CLI7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR011184"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI7"
                     /translation="MSSRPDLKFSDIAEERGFYKRFLQLPQRSQNTIRLVDKSDYYIV
                     VGDDALFVADQVYHTSSVLKDCKIDPSTLRQFDLQEPLKYVTMSIQIVGNLLKTSLLE
                     LGKKIEIYDRNWKLLKTASPGNLEQVDDLIVGSVETNIVLASLKLNFNGTAASNYCTI
                     GVSFVDNTNYRIGLFDLLDNEVFSNLESCLIQLGIKECLIPDLRDNPSMANDLKKILS
                     VIDRCSCVASFVKPSDFNGKDVEADLAKLCGDELSLSVSKFSANCLGACSVLLNYLNI
                     MNNEANVGNFEVVDHSLSQFVKLDASAIKALNVFPTGSQGNTALLSVGSPQKCSSLFQ
                     LLNRCKTNSGVRLLNEWLKQPLTDIDQITKRHDLVEFFMDQLELRSSLQEECLPSVPD
                     IRRLTKKLQKNGNLEDVLKIYQFAQMVPVISDLLKQKTEEVDSNDLMILVKEVLLDPM
                     LENANPLEKLKELVETTVDLEAYEETNEFMIKVEFNEQLSIIRTHLDELKDAIRTIHL
                     DTADDLGFDPEKKLKLENHHLHGWCMRLTRNDAKALRQHKKYIELSTVKAGIFFSTKE
                     LKNIAEETSELQKKYEQQQASLVKEIVSITLSYTPVLEKLSVVTAQLDILCSFAQVSS
                     YAPIPYVRPKMYPLNDQNRTTELIASRHPIVEMQDDVTFISNDVKLVQGDSEFIVITG
                     PNMGGKSTYIRQIGVICLMAQIGCFVPCDEAKIAAVDAILCRVGAGDSQLKGVSTFMM
                     EMLETASILKNATHNSLVIVDELGRGTSTYDGFGLAWSISEHIATNINCFTLFATHFH
                     ELTTLADKLDNVSNMHVVAHIEDNGSHNSDDITLLYKVEAGSSDQSFGIHVAEVVQFP
                     SKIVNMAKRKAAELEDLKKDNDSLKKAKLSPEDIVLGTESLKKSLKVWCKELKKNNLI
                     DRLDDPSVQEECVDKLKQQIDNLAREEDTTSLFVDWVRDTLL"
     gene            <249240..>250232
                     /locus_tag="KLLA0_F02728g"
                     /db_xref="GeneID:2896010"
     mRNA            <249240..>250232
                     /locus_tag="KLLA0_F02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455203.1"
                     /db_xref="GeneID:2896010"
     CDS             249240..250232
                     /locus_tag="KLLA0_F02728g"
                     /note="similar to uniprot|P38115 Saccharomyces cerevisiae
                     YBR149W ARA1 Large subunit of NADP dependent arabinose
                     dehydrogenase involved in carbohydrate metabolism small
                     subunit is unidentified"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455203.1"
                     /db_xref="GeneID:2896010"
                     /db_xref="GOA:Q6CLI6"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI6"
                     /translation="MLHPLSTEIYFTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAI
                     KAGYRHIDTAWAYGVEEYVGEALQELFEERVVKREDLHITSKVWHTMWNDVDKSLNES
                     LARLKVDYVDLFLQHWPLCTQKVPDPHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQI
                     EKIYLDKNDKRVRAIGVSNFPIEYLKRVLKECRTVPACNQVELHPHLPQRELCEFCSE
                     HKILVTAYSPLGGNGAPLLELPILKGLCEKYNASPNDILTSYHLRQGTIVIPRSLNST
                     RIASNLEFVPLSEEDVNKLNEFGQKNKKRYINGAVSSVIPGFKEDFLKEQLQQS"
     gene            complement(<250368..>253814)
                     /locus_tag="KLLA0_F02750g"
                     /db_xref="GeneID:2896011"
     mRNA            complement(<250368..>253814)
                     /locus_tag="KLLA0_F02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455204.1"
                     /db_xref="GeneID:2896011"
     CDS             complement(250368..253814)
                     /locus_tag="KLLA0_F02750g"
                     /note="some similarities with uniprot|Q12180 Saccharomyces
                     cerevisiae YOL089C HAL9 Putative transcription factor
                     containing a zinc finger overexpression increases salt
                     tolerance through increased expression of the ENA1 (Na /Li
                     extrusion pump) gene while gene disruption decreases both
                     salt tolerance and ENA1 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455204.1"
                     /db_xref="GeneID:2896011"
                     /db_xref="GOA:Q6CLI5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI5"
                     /translation="MIRSITEDAGIPAITSHAEGVTTKPAKKRVSKACDRCRRRKIKC
                     DDLDPVSGKCSNCIKYKVPCTFHYHEEMIRRTNSKAKSRITKFSSDTTKSELHSITNN
                     DNNDNTNSNNNQNNSTNANGSVDTDNNNSSQIDTKNDTNSENNNHNNKSTPSTSNASN
                     AYNPGIIVNPISLKQKANSNGIQRNTMIENLSTVPMTNNNLSEAVLPNNLLSNSNDQT
                     STSSPSLEQNSVFVHYPNSVPVNSIYQTPLPFNNTPTNGYTSQPGHIDMIPVSIVQNS
                     VLLPQHNQYQPQPLSQHQHPVVPPPVNHSLNQPLQQLPRQRNQQRDNTEHDRQNQQQK
                     ATTNATQNITNPQKHRDHHNDPVGNSSLEGMVTQGQLSVLDNKIDILGRKMTLLMDYC
                     TRLDWIGRQCELFINKSEQSLKTEEAKGRNSEVHATPKRYNSCQYTESTLLWLRTKVC
                     PEISKDEYLRPLVPVKAMVSRWYFIQMKRLVKNISDESQLLPIPDSIRCQRIMETYYS
                     LLSAEDLNVIEPKACQKIFEKYFSSKAEEISYSEHLIVNILLSLGSLYARHSLMESNH
                     YRKDKLDFTPEKLFQIENDCYQNSLFYYHKISLVCEGLLSVQALLLLYSYIRSCVSTE
                     AALNIFVVAVKFARDLELCYLDNFNHLPREDFLQIRSIWLYCYLNDSNLSMTLGKPPI
                     IDESDMSVSFGRNYFKTLKAECPISRSPDANVVDAMKDESMVVGWVKINPWYFPVILN
                     YFRACLCKISNKITRYLFSVDVTSVMTFDEIVAKINEIKDDLITYSNNIPLYLRLDNQ
                     RTFLARIYHELAESQKIANFKLMSVLMTEINIKRETLFIILANFTRAFFDDNWDIVGG
                     GLRPDCEELSKYFEVNKLHSFKATLKASKAIDFKDYTILLHKQHVFFDLLLVVLSASF
                     YVINNVDSSAAFELLCMLKDLYYRVTNGTSITELHLQQNIKWLVSIFLLSFQLEMGTM
                     HYKNKNALACTYPLDSDRYQLVMKEISVTIGKETEKITAVFNKERSSLSKESSISSNA
                     GKMPTWALLKPFGLADDSTEEMLRSWWDKESQKQVTKQEDTAKMPKGILENAKNSDGK
                     NNLTNSRNYDLGFNFNERWFPPDMRFLSQESFMNSSGRNNSDASYVHPTTLFEDISSL
                     NR"
     gene            <255901..>256842
                     /locus_tag="KLLA0_F02772g"
                     /db_xref="GeneID:2896012"
     mRNA            <255901..>256842
                     /locus_tag="KLLA0_F02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455205.1"
                     /db_xref="GeneID:2896012"
     CDS             255901..256842
                     /locus_tag="KLLA0_F02772g"
                     /note="similar to uniprot|P38281 Saccharomyces cerevisiae
                     YBR151W APD1 Protein of unknown function required for
                     normal localization of actin patches and for normal
                     tolerance of sodium ions and hydrogen peroxide localizes
                     to both cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455205.1"
                     /db_xref="GeneID:2896012"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI4"
                     /translation="MGLIKLLKGFSLQSEADSSATVEKIKEAIDVCDSSECTGDCVNE
                     DADEKDALQKDEGIFAKLKIDHEQPLYGSSTTSKIHFIIPTSQTDWAHDACMEKPGSV
                     QAVMQKWINANSDKYSDIESEGETIRCSVSSLPIDLLDIDVMKNTKNDVLIFPHFLKI
                     KAVKSDLVAELLNEVVPLLLKNERGTLLAKDYIEEIKDNSFILLCSHRTRDKRCGITA
                     PILEKHFNKHLQRHHLYRDNSDFRPGGCRVAYVNHVGGHKFAANVIIYLKKTHQLIWL
                     GRVTPLHAEPLIECLIVPNEPKLPYPEKVRCVAKYKF"
     gene            complement(<257091..>257873)
                     /locus_tag="KLLA0_F02794g"
                     /db_xref="GeneID:2896013"
     mRNA            complement(<257091..>257873)
                     /locus_tag="KLLA0_F02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455206.1"
                     /db_xref="GeneID:2896013"
     CDS             complement(257091..257873)
                     /locus_tag="KLLA0_F02794g"
                     /note="similar to uniprot|Q99316 Saccharomyces cerevisiae
                     YOL088C MPD2 Protein disulfide isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455206.1"
                     /db_xref="GeneID:2896013"
                     /db_xref="GOA:Q6CLI3"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI3"
                     /translation="MKILLCLSLIATVALAIVESVTSLDQFYGVVNNFNATNPTYTVV
                     KYYTNWCSHCKKLKPVFEQLSESSVLSEVDIVDPALTSGINFAFFEVDCELFGNMLCK
                     RLDGFPAVEIIKPLRSELNVTRLEDPRGWIDRLLDTITNAGYDLTWTLDTDRIVTFNG
                     RRNLDVFERFVQAVVTSDQWDRVLQLIVNDNCSDKDELCEDGREYFLKMNDETNCAEK
                     IADIENEMKDLKDVPKDLMLRYMILNKISELNNEEPLEQDEL"
     gene            complement(<258214..>261069)
                     /locus_tag="KLLA0_F02816g"
                     /db_xref="GeneID:2896014"
     mRNA            complement(<258214..>261069)
                     /locus_tag="KLLA0_F02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455207.1"
                     /db_xref="GeneID:2896014"
     CDS             complement(258214..261069)
                     /locus_tag="KLLA0_F02816g"
                     /note="some similarities with uniprot|P42946 Saccharomyces
                     cerevisiae YJL108C PRM10 Pheromone-regulated protein
                     predicted to have 5 transmembrane segments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455207.1"
                     /db_xref="GeneID:2896014"
                     /db_xref="GOA:Q6CLI2"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR024528"
                     /translation="MSSSYGNNGDKNNHEKFGFNLLRKKPQQPSNRSERRADDSSSSE
                     DEAGPSSNYVSSSQLNLPSFRPSGGSTDELNRANRTNVGSSDARYSPRTASNTESGNR
                     RQQMIEDDAIATIRDNSGAARCFDDDDEEEEEHQEQKDSGENPADISPRTSGVTKKLQ
                     FKSHPSIIPEDTATQDGGEYYEEKDAEKEDQDDSVSTQSSESKMDHFRHLFRRRSTAR
                     PHQETNDGRNSAESHSKGGMRNLNGADDEVEDGGFLSKFLSLTGGGLTPAVNNTDPSG
                     ENDHERNAGQNNLEDPIPMSDIAATAQQIVQAHSMMAGKSAPGTQHGASGSASSEHPN
                     GEHNLGTEAGVTSPFEPVSPFNQSTDGETMVSSHQDDAFYVPATNHYDDIDDPDDLEP
                     LGIEGSYIAPVDRVRGGVLGSLLKLYQNQDDQYTKSQLSLNDSSIEQTPEPVDQAGKS
                     DQKTGKKIYNPFHKHSKSQTNVSGANKSGSSMNLPNFKATRPKAAAKNLVKAKNFKKK
                     AAAEARITVHIADLLQRQRFILRLCKALMLYGAPTHRLEEYMVMTSRVLEIDGQFLYV
                     PGCMIISFGDMTTRTSEVQLVRCNQGLNLWKLHGVHSVYKQVVHDIMSVEDANMEIDR
                     ILTGKNLYPPWVSVLLYAFCSSMVTPFAFGGDWINMAVAFGIGLCVGSLQFIVSQKSN
                     LYSNVFEVTASIVVSFCGRALGSIPNSNICFGATVQGSLALILPGYIILCGSLELQSR
                     NLVAGAVRMFYAIIYSLFLGFGITLGAALFGWIYHDATNETSCSKNISPWFRFIFVPC
                     FSIGLGLINQARWTQLPVMTLISCCGYVVTYFSGKHFANSTEFTSAMAAFVIGILGNL
                     YSRIWKGFAVSAMLPAIFVQVPSGVASQSSLLAGVQSANAIVNNSTTTVVQDDLSGSM
                     SFGVTMIQVSIGISVGLFASTLFIYPFGKKRTGLFTL"
     gene            <264329..>266596
                     /locus_tag="KLLA0_F02838g"
                     /db_xref="GeneID:2896015"
     mRNA            <264329..>266596
                     /locus_tag="KLLA0_F02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455208.1"
                     /db_xref="GeneID:2896015"
     CDS             264329..266596
                     /locus_tag="KLLA0_F02838g"
                     /note="similar to uniprot|P32581 Saccharomyces cerevisiae
                     YJL106W IME2 Serine/threonine protein kinase involved in
                     activation of meiosis associates with Ime1p and mediates
                     its stability activates Ndt80p IME2 expression is
                     positively regulated by Ime1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455208.1"
                     /db_xref="GeneID:2896015"
                     /db_xref="GOA:Q6CLI1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI1"
                     /translation="MPALTLTTADSFIPPDVNNPPFYIPLKNIDARYNVIQELGKGSF
                     GSVTLAETMYDMNSSATQISSMYPETLMDQTLIRNVEQENWYYKKKGIVAIKTMMNRL
                     PTLHDYTRVREIKFILQIPAHKNLVTIYEMFIDDSLYHLHIVMECMEQNIYQLMKHRK
                     RRVFSLPTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYS
                     DNYVVKLADYGLARHVNNRSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVE
                     LATFSPLFPGSDETDQIWRILDLLGSPDHSINGKEHFGGSWLDSKPLYQALNYEFPYV
                     EGKTIRDVLPNPQLEDLYDVVTSCLKWNPSERATANEICALPYFKEYVMREASLAKTN
                     NGTASKNKDNTALANKLAANPSISNQWSRILSGLPHNPELGIVPSFNSPQKLPKVQKN
                     NQMNCVTDKSQQQPRRGGVASWFKFSTQKNHVNINPNTNNDEKILTSVNTNTNSQKNQ
                     GIVEKKQQEQQVNAHNERLDSSTNANGNSIPDINLIGHANNDNEVFTIELDDSMETMT
                     GSDQISKELNDKIELYQDTTNQMNPPTLDVDDDDDEHDSIDMDHENYRIQVLDEFDTD
                     ENLEHEIRATDKDENNEVAVDKMKISNQGEDEDDADSLLNYYQDMMAKKLPLNKNKGN
                     YMHSNGPAGPTLSDQMAIDDSLDLQEQIPRNLLERAVQQRVLDCLLDPSEHASQNLIQ
                     TSNSHNHTFQDGLSF"
     gene            <267100..>268401
                     /locus_tag="KLLA0_F02860g"
                     /db_xref="GeneID:2896016"
     mRNA            <267100..>268401
                     /locus_tag="KLLA0_F02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455209.1"
                     /db_xref="GeneID:2896016"
     CDS             267100..268401
                     /locus_tag="KLLA0_F02860g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455209.1"
                     /db_xref="GeneID:2896016"
                     /db_xref="GOA:Q6CLI0"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6CLI0"
                     /translation="MSNYDVVIVGAGIFGLSTAVQLARSKYKVVVVDKFQIPSQLSAS
                     CDYNKIVRLEYNDEVYAALAVEAMGYWHGESDKFLPRGMLHDCYSHCGRLSAIQDKNT
                     SRYAFDNDSLQLLQTKFNKCKTVELHKELTCGGKFPQFSHSQRYDEIRYNPDCGIGLA
                     RDSLVTMKNYAESLGVVFHENDGAVSVSAGTVQCESGRKFLGHKIIVACGANTVSLLP
                     MYGQIRATGLYVGHIQLTDKEYQKLKDIPVVFNSSLGYLFPPDKHTRILKICTSAMSA
                     YDDMSNKSRAVYRALQPDAAPSVPIEAVVRIRTVLGKYLPDLVFDTKRKSKLRDIIDC
                     KICWISDTSNSDFIIDMIPDLKNVYVCCGDSGHAYKFLPNIGSYVQQKIEGRLAPILA
                     HKWRYRESDWNGTEIEWRVEPEKKALQEIEWYQESYGTPRL"
     gene            <269162..>271552
                     /locus_tag="KLLA0_F02882g"
                     /db_xref="GeneID:2895775"
     mRNA            <269162..>271552
                     /locus_tag="KLLA0_F02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455210.1"
                     /db_xref="GeneID:2895775"
     CDS             269162..271552
                     /locus_tag="KLLA0_F02882g"
                     /note="similar to uniprot|P36124 Saccharomyces cerevisiae
                     YKR029C SET3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455210.1"
                     /db_xref="GeneID:2895775"
                     /db_xref="GOA:Q6CLH9"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH9"
                     /translation="MTDGTIEHAQDQSLIDDASTLLMFSKTSNSNVNSSDEGKDELKA
                     DIHTHKMTPTPSAGTASQVGSQAGSHSGSAGDISMHMNPMTSPGPASVALIKDDDDDD
                     HLKGSPVDNGIHRSNSNSEKTKKSGNKKGMVAAAALAQAATMPLPLKRKAENDRKPAA
                     NNSVPMPRSGAEEKSPSKQAKSEDKVVEQEDSFKEAVEEQKLEKSETDRFSSVPESYV
                     VDPDAGIITCICGYEDDDGFTIQCDHCFRWQHAICYGIEHEKDAPDDFLCNICNSRFV
                     DVKLAKKKQQERIRNAQNKKRRRTANGNIKEVKTKEATSGTKDSRNPGTSEATDHRIE
                     PEAIPSADPLTNIVLINAKEAYPTVYLPLTSNDYKDKYVELFVKDHADDDWVIPYHKL
                     TFKPIPIEIKPYSDSNHSRLFPGYPKLAVYLKQGCDEGDYIDEFLGEIDFQRKYLEDP
                     RNNYRVWGTAKPKVIIHPHWPIYIDARLSGNLTRYLRRSCNPNVELVTIKLTNSNNQD
                     EIKFVLRALRFIDKGEELHIKWDWDLRHPIWKLINHNESIDSIEEPQRYLFIHSIDTI
                     LGSCDCACGSNSKDCYLLKIKRHSQSLYRSVKSKMNNRYKLNEILHGNKLQTKKQSSI
                     LSKLAHATISDAARANEFLLKFNAVKLKMLEPVSDTVQKKSFHTNAGSIRGNKYRVSV
                     TESKNRVDPLKESLSFISDPSKFDESQIKHPADLPIPIQTISTEDNPPTDTTITNITE
                     TISNQGQTSVTSDSNSIKNSLKRGIDSVPGPSSTIHQAQMKKKLSFADYKKKIKPA"
     gene            complement(<271837..>272994)
                     /locus_tag="KLLA0_F02904g"
                     /db_xref="GeneID:2895776"
     mRNA            complement(<271837..>272994)
                     /locus_tag="KLLA0_F02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455211.1"
                     /db_xref="GeneID:2895776"
     CDS             complement(271837..272994)
                     /locus_tag="KLLA0_F02904g"
                     /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
                     YMR097C MTG1 Peripheral GTPase of the mitochondrial inner
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455211.1"
                     /db_xref="GeneID:2895776"
                     /db_xref="GOA:Q6CLH8"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH8"
                     /translation="MNVSVKCVKYSGRRLQSTFVPRMVFPDFNIPTSDFKGHQKKAIQ
                     RAQNLLPQLNLLVELRDSRAPIATRNLIFDYLSLEKKVDRLVVYTKTDQCDPAIIASL
                     NKWHKEMDEQYIMIDGRSKKGAKDLLHILKWKYDKFLQKNDPGKKTVGLPLGYRMLIG
                     GMPNVGKSTLVNSLRFTGYAGLDHSDGSKPKKVAKTGDQAGVTRNTSECIRISDYKGG
                     LFLYDTPGISLPAKAMSKQRMLSLSLCGCVKNNLVDPVIQADFLLYLLNLQGKYQFYT
                     HYTTTPTNNIDILLSGLKKQVGMTNENAAAIYWTDSWRQGRVLKSGLRSGSKKSSKAT
                     PALFELEPILENFQYKKTMQEELEILKGWDVLSQPLLNKREKHLSKANTLF"
     gene            <273193..>274212
                     /locus_tag="KLLA0_F02926g"
                     /db_xref="GeneID:2895777"
     mRNA            <273193..>274212
                     /locus_tag="KLLA0_F02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455212.1"
                     /db_xref="GeneID:2895777"
     CDS             273193..274212
                     /locus_tag="KLLA0_F02926g"
                     /note="similar to uniprot|P34253 Saccharomyces cerevisiae
                     YKL110C KTI12 Protein associated with the RNA polymerase
                     II Elongator complex involved in sensitivity to G1 arrest
                     induced by Kluyveromyces lactis toxin zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455212.1"
                     /db_xref="GeneID:2895777"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH7"
                     /translation="MKRGKTQSLFQTLQQRLVNLEPLDCTAMPLVLLTGFPSSGKTTV
                     AKKLVTLLQETIDSNDKLSNYSVVYHSDETLNISHDDYIGSNEERRARSKIMSVVKRD
                     LSRQKVVIVDSLNYIKGFRYQLHCEVKNVMTTYCLIHTVCPMSNLVEWNEKETDLHKP
                     WESNFLNALIQRYEEPNPQTRWDSPLFTILTSQDDISTLYTDISKAIFPTVFKPATND
                     RDTEKILQQLKPNNATILKAASHTNSLQILDSEASSVIKIIMKYMQQNVVSGGTSRII
                     LTPENTDLNDPNCLYVDLSLQNCSMPQLQRIKRQFVAMNRLRNLEQDRVKPLFVEYLN
                     KHLNV"
     gene            complement(<274341..>276029)
                     /locus_tag="KLLA0_F02948g"
                     /db_xref="GeneID:2895778"
     mRNA            complement(<274341..>276029)
                     /locus_tag="KLLA0_F02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455213.1"
                     /db_xref="GeneID:2895778"
     CDS             complement(274341..276029)
                     /locus_tag="KLLA0_F02948g"
                     /note="weakly similar to uniprot|Q03153 Saccharomyces
                     cerevisiae YMR098C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455213.1"
                     /db_xref="GeneID:2895778"
                     /db_xref="GOA:Q6CLH6"
                     /db_xref="InterPro:IPR025210"
                     /db_xref="InterPro:IPR025656"
                     /translation="MHRSYAVLLRNNVARLCYRPGSTLFIRNFTTRHSLRQSKPWYLD
                     ISENKEEDSNSPFIKPIRFPPTEIPASLETISKYLNDKLAVTDIVVFDTAHSSSATSI
                     QSMASYVLIGTVKSFRHLQNCNDELIKFIKETFDEVPKSEGLVTSGILRKRQRRLGRK
                     TNLGKIAKIENDESGWCLIDSNVDGLFINIMTEERRDDLNLEELYCRVEELDQYKKQI
                     NLNPPAEEEDDVLLGLRKLMMKNTKRYYSTVGESPKPTFLEALTIQDLDSASKLIKEE
                     KKPYHVIASALGRLPNHIELDAENWIKLFNEATPTEGPLDYEYWGARFKFFQLLYISK
                     RNNIEENTQLDASTIKEFNRELNYFINDFFRFKQLALCQPTREELIGFLEICIQHLKL
                     SKSYNQLISVNMWILKALQSYQYSDPKVVHDPRVIKLLVKSMHTENTNLNSLYEYVNL
                     ITNEFEVRSLTNDVIKEIITTLVESENWPTLFKFWKQCLCESAVDSNVWDFFIKSLLN
                     KNDKVILSDIVDNGHLLWIHRSKLVISDDLKASLSKLLDRVDGSHTNIKKLLKL"
     gene            complement(<276288..>277772)
                     /locus_tag="KLLA0_F02970g"
                     /db_xref="GeneID:2894945"
     mRNA            complement(<276288..>277772)
                     /locus_tag="KLLA0_F02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455214.1"
                     /db_xref="GeneID:2894945"
     CDS             complement(276288..277772)
                     /locus_tag="KLLA0_F02970g"
                     /note="uniprot|P26375 Kluyveromyces lactis KLLA0F02970g
                     BAF1 Transcription factor BAF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455214.1"
                     /db_xref="GeneID:2894945"
                     /db_xref="GOA:P26375"
                     /db_xref="InterPro:IPR006774"
                     /translation="MSLYEYKHPIINKDLAAPDPVSAQKRSFPTLEAWYDVINDYEFQ
                     SRCPIILKNSHKNKHFTFACHLKSCPFKILLSYQGANNSGSSEDGSPHGLSGDGGSSS
                     SGSNHHNGHTNLAEDGRAEDEDDDEDDDAAVTAAIAAAVAAVADSQETIKGPFVVTKI
                     EPYHNHPLESNLSLQRFVLSKIPKILQVDLKFDAILESLCNDDDNTVAKFRVAQYVEE
                     SGILDIIKQRYGLTEAEMDKKMLSNIARRVTTYKARFVLKRKKDGVYAMPTAHQLTGG
                     DHHQVQHHHHPSIPAHHQHQLPEGQQRDVQHHHQQQQQQLQHQEQHQSHVDSGHNVYQ
                     NRIGSISDNDDSAIHNLDDTNVRVAAAAAAAAAALQSRENHDTEDLKRTLEQVQDDES
                     LDVGVPDSKRQLHRRERDRVAEALKMATRDILSNQSVDSDVNVDVDLVTGHKQLSPHD
                     DMAEQLRLLSSHLKEVEAEENVSDNNLKKDDIPDENIQPELRGQ"
     gene            <278441..>279586
                     /locus_tag="KLLA0_F02992g"
                     /db_xref="GeneID:2895779"
     mRNA            <278441..>279586
                     /locus_tag="KLLA0_F02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455215.1"
                     /db_xref="GeneID:2895779"
     CDS             278441..279586
                     /locus_tag="KLLA0_F02992g"
                     /note="similar to uniprot|P26793 Saccharomyces cerevisiae
                     YKL113C RAD27 5' to 3' exonuclease 5' flap endonuclease
                     required for Okazaki fragment processing and maturation as
                     well as for long-patch base-excision repair member of the
                     S. pombe RAD2/FEN1 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455215.1"
                     /db_xref="GeneID:2895779"
                     /db_xref="GOA:Q6CLH4"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGIKNLATLISEQVPNAIKSRDIKYFHGRKVAIDASMSLYQFLI
                     AVRQQDGVQLAGEDGETTSHLMGMFYRTLRMIDHGIKPCYVFDGSPPELKKYELDKRK
                     VRREDTEAKLKEATEQAEIIKHERRLVKVLPWHNEEAQKLLSLMGIPYVVAPAEAEAQ
                     CAELAKSGKVFAAASEDMDTLCYQTPVLLRHLTFSEARKLPIQEFDTDVIYNTLDLTQ
                     TQFIDLGIILGCDYCEGIKGVGPVNALKLIKEHGSLEAIVEKFENGDISSGRWKIPEG
                     WQFKEARDLFMQPDVIPSEEVTLKWEEPKAEELIEFMVKEKGFNEDRIKSGIERLRKG
                     LKVGVQKRLDSFFKIQPKTKEELATAAKKAKDAKKKAAAKGKIAKRR"
     gene            complement(<280155..>282614)
                     /locus_tag="KLLA0_F03014g"
                     /db_xref="GeneID:2895780"
     mRNA            complement(<280155..>282614)
                     /locus_tag="KLLA0_F03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455216.1"
                     /db_xref="GeneID:2895780"
     CDS             complement(280155..282614)
                     /locus_tag="KLLA0_F03014g"
                     /note="similar to uniprot|P32497 Saccharomyces cerevisiae
                     YMR309C NIP1 Subunit of the eukaryotic translation
                     initiation factor 3 (eIF3) involved in the assembly of
                     preinitiation complex and start codon selection"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455216.1"
                     /db_xref="GeneID:2895780"
                     /db_xref="GOA:Q6CLH3"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR008905"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027516"
                     /translation="MSRFFLKTYEYDSTSSGEEEDLLSQSEEDLVSSSSEEELSDDSF
                     FNDSDESSDNDEDNDSDSKPYGPDWFKKPEFRKGGGSGANKFLKSTNYSSDEDSSDEE
                     DGKKVVKSAKEKLLDEMKSIYQKIDSAEAQQDWESLLNHLETILKLYTKAQQQNYGTP
                     NIFVKSLARFEDAVSATSQDEIKNKAVARAYNTTKQRVKKLIRENETSVKAYRENPED
                     FDKEPVLDADIDSRDVSATPFSLSGKKNLDLASVANNISELDFFKTLNIIIDSRGKKN
                     TDHTEQIKTTEELLKIAKTPYEKICTYLNLIPIRFDASVSLSYQPLEQWKASKDNLDG
                     LLEVLEQEIDHYQVTEFAPRNDFIEDEPEANEHGVKEILGSIFSMVERLDDEFSKSLL
                     NIDTRSSEYMERLRDEQSIYNLIIRSQLYFERVTAEEHRDRLLARVFNRRLEHIYYKS
                     DKLISIMETVAWKQIREGTASLESSFVRLNESDSADADYNFKVISELSDFLIKQKSNN
                     VFNYRKGTLYKTYYIALNQEYAPAKKIMLSSDIAKFISGSDAALQILYNRCVIQLGLA
                     AFKAGLINECHQVLNGLCINPHLREILGQQSLQRANANSNVVQGAPVEQLCLPFHQHI
                     NLDLIDTVYMTCSLLLDVPHMAAYYSGIKVKRIPVFQKSIRRILESSEKAIFHGPPET
                     LRDHILYAAKSMQKGDYLQSIEYLRKISVWSLLSKSDDIINQLSEKVQIETLKTYIFT
                     YKRFYSKISISKLSKLFDLDIEKVLAVAQNIINDYEVKAKLDENNEYIIFERGEEITK
                     LEEVAIKLVKETKYHSERLRQ"
     gene            complement(<283504..>284439)
                     /locus_tag="KLLA0_F03036g"
                     /db_xref="GeneID:2895781"
     mRNA            complement(<283504..>284439)
                     /locus_tag="KLLA0_F03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455217.1"
                     /db_xref="GeneID:2895781"
     CDS             complement(283504..284439)
                     /locus_tag="KLLA0_F03036g"
                     /note="highly similar to uniprot|P15703 Saccharomyces
                     cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
                     protein of the cell wall involved in cell wall
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455217.1"
                     /db_xref="GeneID:2895781"
                     /db_xref="GOA:Q6CLH2"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH2"
                     /translation="MRFSTLVSATLLAGASTVAAVGELAFNLGVKTHDGSCKQKDDYL
                     ADFETLKGYTSKVKVYAASDCNTLQILGPAAEEAGFTIFLGIWPTDSAHFEEEKQALT
                     QYLPWIKTSTIEAFLVGSEALYREDMTASELADAISDVKDYIKDIKDSDGNSYSGKQV
                     GTVDSWNVLVDGGSATAIQAADFVMANAFSYWQGQTMDNASYSFFDDIMQALQTIQTT
                     KGSTDIQFWVGETGWPTDGTNFESAYPGLDNAKQFWADGICAMRGWGVNVIVFEAFDE
                     DWKPDTSGISDVEKYWGVWDANRNLKFKLDCDFSS"
     gene            complement(<284859..>286088)
                     /locus_tag="KLLA0_F03058g"
                     /db_xref="GeneID:2895782"
     mRNA            complement(<284859..>286088)
                     /locus_tag="KLLA0_F03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455218.1"
                     /db_xref="GeneID:2895782"
     CDS             complement(284859..286088)
                     /locus_tag="KLLA0_F03058g"
                     /note="similar to uniprot|Q04867 Saccharomyces cerevisiae
                     YMR310C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455218.1"
                     /db_xref="GeneID:2895782"
                     /db_xref="InterPro:IPR003750"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH1"
                     /translation="MSVKRSKEQSKQNYKKVKRDTKVTEKRDHLAQFKRAKKVVKVST
                     KTVNHSICIPTTVLDSCKNLEQITYTLYQIARSACIYNVAEIVILKAESETNKGESDR
                     KNDKKQGAKIKFDDGNNTNNASTEYLEDSEKEDGKKRLSKPMLMASLLQFFITPPYLV
                     NSVFKKDYMKYFTYAKQLPRIPSLPFMRFYQDNNGRYREGLAIRMSKPGERGKSKKSF
                     DQTKYINIGKDKNLELKGQLVPINVRVTVDTIEQKVVSPEEAYGDFVGAKASFGYHVR
                     VAKSFADLFTQSPFPQGYTQTVWINSGDFFFDETLKKNVKVQTQIPSIEKVIRPTEEE
                     IELDPSKANPANLLAVFGKWDHVKKSFESCKEQFEGATGAFEFFDGELSLPGSTPQGQ
                     LRTEDACMIALTLLSTY"
     gene            complement(<286585..>287169)
                     /locus_tag="KLLA0_F03080g"
                     /db_xref="GeneID:2895783"
     mRNA            complement(<286585..>287169)
                     /locus_tag="KLLA0_F03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455219.1"
                     /db_xref="GeneID:2895783"
     CDS             complement(286585..287169)
                     /locus_tag="KLLA0_F03080g"
                     /note="similar to uniprot|P41818 Saccharomyces cerevisiae
                     YMR311C GLC8 Regulatory subunit of protein phosphatase 1
                     (Glc7p) involved in glycogen metabolism and chromosome
                     segregation proposed to regulate Glc7p activity via
                     conformational alteration ortholog of the mammalian
                     protein phosphatase inhibitor 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455219.1"
                     /db_xref="GeneID:2895783"
                     /db_xref="GOA:Q6CLH0"
                     /db_xref="InterPro:IPR007062"
                     /db_xref="UniProtKB/TrEMBL:Q6CLH0"
                     /translation="MGGILKNAIPEEQSPNIESESISQFRKQVLKNTELNAKRTSNSK
                     IAHHGHGIPKDVLSMKLGEQDPESLKWNKKNLEENEITKQEFGDIHIDEPKTPYQGAV
                     DPNGEYYKIDDDDEDLGGFSLGEPQVDLKEDKEPVTLLNNEDPQVSPPVLETEEDEAA
                     KKHRKFEEMRKKHYNVKADLQNAKQNLPDDDDDE"
     gene            complement(<287943..>288860)
                     /locus_tag="KLLA0_F03102g"
                     /db_xref="GeneID:2895784"
     mRNA            complement(<287943..>288860)
                     /locus_tag="KLLA0_F03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455220.1"
                     /db_xref="GeneID:2895784"
     CDS             complement(287943..288860)
                     /locus_tag="KLLA0_F03102g"
                     /note="similar to uniprot|P53337 Saccharomyces cerevisiae
                     YGR284C ERV29 Protein localized to COPII-coated vesicles
                     involved in vesicle formation and incorporation of
                     specific secretory cargo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455220.1"
                     /db_xref="GeneID:2895784"
                     /db_xref="GOA:Q6CLG9"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG9"
                     /translation="MSFRGNNLDTFPTAKPGFQGASYGQASQSHNVSAKDKYRRLFEQ
                     FAKRVEDLTEHPLVLKIRPYTPIIARFFIVATFYEDSLRIIAQWSDQVFYLWNYRHFP
                     YYFVVFFLFCVVISMFTGATLLILRKQTVYATSALICTVILQGLVYGLFTGSSFVLRN
                     ISVIGGLLIAFGDSIVTNRMTFGMLPELDSKDGKFKNYLLLAGRILMVLLFITFTFTK
                     SWLTVLLTIAGTVCIAIGYKTKFASISLGLILAFYNITVNNYWFYGSSKRDFLKYEFY
                     QNLSIIGGLLLIGNTGAGQLSIDEKKKIY"
     gene            complement(<289514..>290815)
                     /locus_tag="KLLA0_F03124g"
                     /db_xref="GeneID:2895709"
     mRNA            complement(<289514..>290815)
                     /locus_tag="KLLA0_F03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455221.1"
                     /db_xref="GeneID:2895709"
     CDS             complement(289514..290815)
                     /locus_tag="KLLA0_F03124g"
                     /note="highly similar to uniprot|P32527 Saccharomyces
                     cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
                     chaperone contains a DnaJ domain together with Ssz1p acts
                     as a chaperone for nascent polypeptide chains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455221.1"
                     /db_xref="GeneID:2895709"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG8"
                     /translation="MFELPPLSGAVGATVESGAKLTPSIRRPIEPVGKFFLHHAQRTL
                     RNHTWSEFEKIEAEKNVQNVEQSNVDPDELLFDTELADESLLTHDARDWKTADLYAAM
                     GLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGASLDQDGFFKIIQKAYETLTDSNK
                     RPQYDSCDFEADVAPPKKGTNYDFFEAWAPVFESEARFSKKKDVPTLGDMNTSKEDVE
                     KFYSFWHRFDSWRTFEFLDEEVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLV
                     ERAMNEDPRIKQFKEEEKKEKERKKWEREAGARAEAEAKAKAEAEAKAKAEADAAQAA
                     SAKVDKKKAKEAAKAAKKKNKRSIRNAPKDADYFGDADKSTTIEEQTGLIVDSLDDEQ
                     LVDVAEKIKSDTAAAKNILSDAAKALTDAGKLPAAIVSYYL"
     gene            complement(<291215..>292882)
                     /locus_tag="KLLA0_F03146g"
                     /db_xref="GeneID:2895710"
     mRNA            complement(<291215..>292882)
                     /locus_tag="KLLA0_F03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455222.1"
                     /db_xref="GeneID:2895710"
     CDS             complement(291215..292882)
                     /locus_tag="KLLA0_F03146g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455222.1"
                     /db_xref="GeneID:2895710"
                     /db_xref="GOA:Q6CLG7"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG7"
                     /translation="MTKTDEPKKPNFLIIVADDLGFTDVSSFGGEIQTPNLDKLSKGG
                     FRFTGFHTASACSPTRSMLLSGTDNHLAGLGQMAEYARQFPEKFKDKPGYEGYLNYKV
                     AALPEILSPEYYTLISGKWHLGLEKPYWPSDRGFQKRFTLLPGAGNHFKCNLDSKFLL
                     PWIYQENGERVDHNKFPENFYSTTYFTDKFLEYLKDDEERKGRPFFGQLTYTAPHWPL
                     QAPAETIAKYKGKYNGGPQALRRQRLERARDLGIVPADVVAHLVETQREKTWDELDDK
                     GKAYESRIMEIYAAMVDELDQNIGRVIDHLKETDEFDNTVIMFMSDNGAEGMLMEALP
                     FGGSTFKERISSDYNNDFDNIGKTNSFVYYGDLWAQAATAPNYMYKMWATEGGINCPL
                     ILHAPQLTGLWEPGQIIDQFTTVMDILPSVLELANVPHPGTSFEGRKVHEPRGLSWIP
                     FLKKESERIYDDTRVTGWELFGQRAIRQGPYKGVYIPPPFGPGHWLLFNIDEDPGETT
                     DLSKEHPDILEKIIDHWSVYKAETGLIELEDSVFDNAHYVKRVLDDY"
     gene            <294261..>295817
                     /locus_tag="KLLA0_F03168g"
                     /db_xref="GeneID:2895711"
     mRNA            <294261..>295817
                     /locus_tag="KLLA0_F03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455223.1"
                     /db_xref="GeneID:2895711"
     CDS             294261..295817
                     /locus_tag="KLLA0_F03168g"
                     /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
                     YOL119C MCH4 or uniprot|Q08777 Saccharomyces cerevisiae
                     YOR306C MCH5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455223.1"
                     /db_xref="GeneID:2895711"
                     /db_xref="GOA:Q6CLG6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG6"
                     /translation="MSSDSMGVKGIDGQLTQAAMSNIETIELKGINEQRTRKNVIGSE
                     VGININELQPVQSFDNDDGGSDAYTDYDDDGFTYAEGGIAAWLVVLGSFLGILPTWGL
                     YFSAGVIQTYVARHQLKDESTSTVSWIFSVSSCLLLGTSVFSGMYFDRYGARKPLVIG
                     TVMTVGGVLAVAQCTKVWQFILALSVCVGTGSGITSSPLLGCICHHFQKRRAIATAVA
                     INGGSIGGVIFPLFLEKSFKNLGFAWTMRIMALICGVCLTVSMFLIKEDPEKRAAVEP
                     KDASTPFHKNLLYNIRDSFDYKSIVSDQKYLFCVLASCLAEVSTGAVLTYITSYCTTV
                     GYSENTSFLLVTILNTLSIVGGYMFSFLADKVMGRFNVMIMINFLLGFVPLIFWLPFG
                     NIGPSVMYGFSAVYGLFYGSLINLAPVCCGQISRTNEFGRRYATMYCFVGLSFLVAIP
                     VSGVIIGDGSLKNYNNFIIYVSVLSMISSGLYTMSKCYAVKQKLNRSPRNAHNNTILS
                     SVFAFVTKKF"
     gene            complement(<296121..>296402)
                     /locus_tag="KLLA0_F03179g"
                     /db_xref="GeneID:9487423"
     mRNA            complement(<296121..>296402)
                     /locus_tag="KLLA0_F03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999379.1"
                     /db_xref="GeneID:9487423"
     CDS             complement(296121..296402)
                     /locus_tag="KLLA0_F03179g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999425.1"
                     /db_xref="GeneID:9487423"
                     /db_xref="UniProtKB/TrEMBL:B5FV96"
                     /translation="MDENDPYGWYLEEPDNSDWETDDTQQIINSEMYTRSLQPEKLPA
                     LPPIKEITDDNLKRDRSERSDSKMVTNTTYSNSNSDPPNELHGIKRQRK"
     gene            complement(<296883..>300236)
                     /locus_tag="KLLA0_F03190g"
                     /db_xref="GeneID:2895712"
     mRNA            complement(<296883..>300236)
                     /locus_tag="KLLA0_F03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455224.1"
                     /db_xref="GeneID:2895712"
     CDS             complement(296883..300236)
                     /locus_tag="KLLA0_F03190g"
                     /note="similar to uniprot|P03965 Saccharomyces cerevisiae
                     YJR109C CPA2 Large subunit of carbamoyl phosphate
                     synthetase, which catalyzes a step in the synthesis of
                     citrulline, an arginine precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455224.1"
                     /db_xref="GeneID:2895712"
                     /db_xref="GOA:Q6CLG5"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG5"
                     /translation="MSTSIYSSTEPTTSAFNTDEYNPQLVEGVESVLVIGSGGLSIGQ
                     AGEFDYSGSQAIKALKEANKKTILVNPNIATNQTSHSLADEIYYLPVTPEYITYIIER
                     ERPDAILLTFGGQTGLNCGVALDKAGVLAKYNIKVLGTPIKTLETSEDRDLFAQALKE
                     IDIPTAESIACETVDAALEAADIVGFPVIVRSAYALGGLGSGFANNAQEMKQLASQSL
                     SLAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVFAPSQTL
                     SDEEFHMLRSAAIKIIRHLGVIGECNVQYALSPDSLDYRVIEVNARLSRSSALASKAT
                     GYPLAYTAAKIALGYTLPELPNPITKTTVANFEPSLDYIVAKIPRWDLSKFQHVNRSV
                     GSSMKSVGEVMAIGRNFEEAFQKAIRQIDPSFIGFQGSDEFDDLDNALSEPTDRRWLA
                     VGQALIHEGYSVEKVHELTKIDSWFLFKCMNIVDMYKDLEQVNDLESLDKELLLEAKK
                     LGFSDAQIALCLNKGSDSRTSELEVRSYRKSFGIVPFVKRIDTLAAEFPAQTNYLYTT
                     YNATKSDIEFTDNGVLVLGSGVYRIGSSVEFDWCAVNTTKALRKEGKKTIMINYNPET
                     VSTDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQLPQNIALKLLHNGAHILG
                     TSPEDIDKAENRHKFSTILDSIGVNQPEWSELSSVEEAKVFANQVGYPVLIRPSYVLS
                     GAAMSVVTGEHELEVKLTTASDVSPDHPVVMSKFIEGAQEIDVDAVAHNGMVLVHAIS
                     EHVENAGIHSGDATLVLPPQNLSQNIKDRLKEIADKVAKAWNITGPFNMQIIKDDRDE
                     GVSLKVIECNIRASRSFPFVSKVLGVNFIEAAVQAFLSKDVPEPVNLMDKAYDYVATK
                     VPQFSFTRLAGADPFLGVEMASTGEVASFGSNALESYWTAIQSTMNFNVPLPPSGILF
                     GGDLSKNYLGEVVKYVAPLGYKLYATNEDTKKYLETFSKGVSVELIEFPKNDKRKLRE
                     LFQAKDISAVFNLAAKRAESLEDVDYIMRRNAIDFALPLFNEPQTAMLFAKAMSLKIA
                     EKVKVLESKDVIVPHEVRTWSEYLHCKPI"
     gene            <302915..>303832
                     /locus_tag="KLLA0_F03212g"
                     /db_xref="GeneID:2895713"
     mRNA            <302915..>303832
                     /locus_tag="KLLA0_F03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455225.1"
                     /db_xref="GeneID:2895713"
     CDS             302915..303832
                     /locus_tag="KLLA0_F03212g"
                     /note="similar to uniprot|P33303 Saccharomyces cerevisiae
                     YJR095W SFC1 Mitochondrial succinate-fumarate transporter
                     transports succinate into and fumarate out of the
                     mitochondrion required for ethanol and acetate
                     utilization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455225.1"
                     /db_xref="GeneID:2895713"
                     /db_xref="GOA:Q6CLG4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG4"
                     /translation="MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA
                     VGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK
                     ETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACY
                     TIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIG
                     LISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITP
                     RVMRVAPGQAVTFTAYEFIRKELEKTGVF"
     gene            complement(<304531..>305034)
                     /locus_tag="KLLA0_F03234g"
                     /db_xref="GeneID:2895714"
     mRNA            complement(<304531..>305034)
                     /locus_tag="KLLA0_F03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455226.1"
                     /db_xref="GeneID:2895714"
     CDS             complement(304531..305034)
                     /locus_tag="KLLA0_F03234g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455226.1"
                     /db_xref="GeneID:2895714"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG3"
                     /translation="MTQHSSEIEFHDKEEPSTLGFPQLMGMVYHTDFQVTNDVTKGDD
                     MTRWLDNQTDEVSSNLLQSVEDTQSIQSDISLISEFFRSKTDLVKSLLERNSEGNNDF
                     SEPDPIILNLQQHVDGTSQDENDAKTLFDLDPMEEMNLIEQEVMNKIFTERVILEIIT
                     TLRHVHI"
     gene            <306731..>307588
                     /locus_tag="KLLA0_F03256g"
                     /db_xref="GeneID:2895715"
     mRNA            <306731..>307588
                     /locus_tag="KLLA0_F03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455227.1"
                     /db_xref="GeneID:2895715"
     CDS             306731..307588
                     /locus_tag="KLLA0_F03256g"
                     /note="highly similar to uniprot|P47137 Saccharomyces
                     cerevisiae YJR096W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455227.1"
                     /db_xref="GeneID:2895715"
                     /db_xref="GOA:Q6CLG2"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6CLG2"
                     /translation="MELSVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGY
                     RHFDTAVLYGNEYEVGQGIKKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHC
                     LQEVEDLGYIDLLLIHSPLGGKKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELL
                     NWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVAN
                     EVGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSFEWTTDQMDQLDKPYAYEP
                     TDWECTNAP"
     gene            <311639..>313267
                     /locus_tag="KLLA0_F03311g"
                     /db_xref="GeneID:2895718"
     mRNA            <311639..>313267
                     /locus_tag="KLLA0_F03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455230.1"
                     /db_xref="GeneID:2895718"
     CDS             311639..313267
                     /locus_tag="KLLA0_F03311g"
                     /note="similar to uniprot|P53943 Saccharomyces cerevisiae
                     YNL065W AQR1 Plasma membrane transporter of the major
                     facilitator superfamily that confers resistance to
                     short-chain monocarboxylic acids and quinidine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455230.1"
                     /db_xref="GeneID:2895718"
                     /db_xref="GOA:Q6CLF9"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF9"
                     /translation="MRRASIRGTDLQADTETKKKNCDNTGSESSVFRTVTRELRDDTD
                     DVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTYRQKWFMVALLTSAGFWSSLGSPIY
                     YPALKELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVI
                     ASIGLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAVSGFTLM
                     GQAFGSLIGAALTAAYDWRAIFWFLVIGCGTCMIILCFLLIETKRTIVGNLSIRPKSW
                     INIAPITRLPAIRKQFKYDNPDYSSRDLSEVKFDITSAMRILILPEIILSLLPAAFQF
                     SLWTLSLASLPAELALDPYDYSLTMIGVCYLPSGIGGLLGSFCTGKIIDVYYKRSHKK
                     FLEKKEAGLIDKDARFNTFKARLISGAPQNVCAAVVFTLFGWALKQRWHIAVVLVTSF
                     IGSFCAMSTLSTSSTLLVDLYPSKSSTATSCYNFMRCVLSAIFMACFSKMKSSMNVGG
                     TFTCISGMVFVGNFLILIPMKYGMKWRYERGMKL"
     gene            complement(<313991..>315220)
                     /locus_tag="KLLA0_F03333g"
                     /db_xref="GeneID:2895719"
     mRNA            complement(<313991..>315220)
                     /locus_tag="KLLA0_F03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455231.1"
                     /db_xref="GeneID:2895719"
     CDS             complement(313991..315220)
                     /locus_tag="KLLA0_F03333g"
                     /note="highly similar to uniprot|P25491 Saccharomyces
                     cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
                     envelope protein) heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455231.1"
                     /db_xref="GeneID:2895719"
                     /db_xref="GOA:Q6CLF8"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF8"
                     /translation="MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAA
                     EKFKEITSAYEILSDSQKREVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSS
                     RPRGPQKGRDIRHEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVKKCTACS
                     GQGFKFVTRQMGPMIQRFQVECESCHGAGEIIDPKGRCKVCSGKKVVNERKVLEVNIE
                     PGMKDGQRIVFQGEADQSPGIIPGDVVFVVSEQPHPVFKRDGNDLHYDAEIDLLSAIA
                     GGQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIKFNIKFPP
                     AHFTDDETLKKLEEILPPRNVPSIPADAEVEDCVLADFDSSKHGARAGGNGRGQSYDS
                     DDEDGHHGAEGVQCASQ"
     gene            <316145..>317032
                     /locus_tag="KLLA0_F03355g"
                     /db_xref="GeneID:2895720"
     mRNA            <316145..>317032
                     /locus_tag="KLLA0_F03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455232.1"
                     /db_xref="GeneID:2895720"
     CDS             316145..317032
                     /locus_tag="KLLA0_F03355g"
                     /note="similar to uniprot|P53944 Saccharomyces cerevisiae
                     YNL063W MTQ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455232.1"
                     /db_xref="GeneID:2895720"
                     /db_xref="GOA:Q6CLF7"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF7"
                     /translation="MPRISPRILKSVANIDRRLPYLLFECSGNISDAKQELSWIKNEL
                     QDANLINRACWLRYNRVPLQYILKTQPFGPLDLLVRPGVLIPRWETEEWCMDLIAKLP
                     EKARQGQFKVLDLCSGSGCIALAIAHTRTEYIVKSVDLSPKAIALLKDNVRKVGLQNT
                     NVQCIQADILRHSEHIYSKDKFNLITCNPPYIPSNNFVKECTTSVKLYEPRLALVADL
                     EFYDNLLQYWIPRTESFVYEVGDMKQCQHVINGLSHNTSWKTGIKYDSNDKPRCVYGY
                     LANPESTIDYVKIFDSFST"
     gene            complement(<317185..>318615)
                     /locus_tag="KLLA0_F03377g"
                     /db_xref="GeneID:2895721"
     mRNA            complement(<317185..>318615)
                     /locus_tag="KLLA0_F03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455233.1"
                     /db_xref="GeneID:2895721"
     CDS             complement(317185..318615)
                     /locus_tag="KLLA0_F03377g"
                     /note="similar to uniprot|P41814 Saccharomyces cerevisiae
                     YNL062C GCD10 Subunit of tRNA (1-methyladenosine)
                     methyltransferase with Gcd14p required for the
                     modification of the adenine at position 58 in tRNAs
                     especially tRNAi-Met first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455233.1"
                     /db_xref="GeneID:2895721"
                     /db_xref="GOA:Q6CLF6"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /translation="MTKHSGIDPLTQISPNQHVLIRLPSDNLKIVELKANAIVSLGKF
                     GAFRVNEIIGYRFGTTFDIVYDGVEEEFVKGTQTMIGKISVLENRLKASSPALENSSE
                     NNRGLINLGSVVQEMSMAEIEAMKREAASGDAIISKMIESHKSFHQKTVHSQEKYLKR
                     KKQKFAKFFTVEYLDSSGLLHYLIEKGDVLRVMDISQESLGMALNLANINSNGQYLCI
                     DETGGLIVYAMLERMFAGDSNSKANGKIVVVHENEHPNLDLLKFSSYSDNFIQRHVKT
                     ISVLDFFEPAKEADIKSLFKPLSAEEINDLKSNKKSAYFRRLKWYHNQLSNIEVAASS
                     FDGLLVASTLYLPTLIPRLGEKIHGSRPIVCYSQYKEPLLELSHSLYENLNYLAPSLL
                     ETRCRPYQTVRGKLHPLMTMKGGGGYLMWCHRVLPAAEPKLHQETLEKSEIKNSDEEG
                     DEDAHKLDQEKQVIKRRKPNEDNEKL"
     gene            <319007..>320866
                     /locus_tag="KLLA0_F03399g"
                     /db_xref="GeneID:2895255"
     mRNA            <319007..>320866
                     /locus_tag="KLLA0_F03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455234.1"
                     /db_xref="GeneID:2895255"
     CDS             319007..320866
                     /locus_tag="KLLA0_F03399g"
                     /note="similar to uniprot|P40991 Saccharomyces cerevisiae
                     YNL061W NOP2 Probable RNA m(5)C methyltransferase
                     essential for processing and maturation of 27S pre-rRNA
                     and large ribosomal subunit biogenesis localized to the
                     nucleolus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455234.1"
                     /db_xref="GeneID:2895255"
                     /db_xref="GOA:Q6CLF5"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF5"
                     /translation="MGSRRLKHKQGAPPTLEEFQAKKERHQHRKEKTKRVSEEDRSDE
                     TRRSKKSKKSKKNQEDDDEAAALKELKKAEQELPEVDSKELAAAKKTLFDDVEEDDEE
                     LKDEFDLEQEYENDEDDEVEERPLFSDDEEADMDELNAANMEALSMKLDEEAKLEEEE
                     AEAELVETDKMQPRAEILPNAEQEAIEEQGPPDLTAIRTRMIEIVKVLEDFKTLGAEG
                     KSRTEYVDRLLKDICHYFGYTPFLAEKLFNLFSPAEAMEFFEANEIARPVTIRTNTLK
                     TRRRDLAQTLVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGHYILQAASSFLP
                     VIALDPQENERILDMAAAPGGKTTYISAMMKNTGCVFANDANKARTKSLIANIHRLGC
                     TNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFMQIPHLQK
                     QLLLSAIDSVDSNSKTGGVIVYSTCSVAVDENEAVVDYALRKRPNVKLVETKLAIGKE
                     GFTSYRGKTFHPSVKMTRRYYPHTYNVDGFFVAKFQKTGPSKFDDNQASAKEKEAAAR
                     QEAVEEGIIKDDFASFDDEDDERYIERSKKVGLLKKGINPHAKKPASSDKNKK"
     gene            complement(<321000..>323243)
                     /locus_tag="KLLA0_F03421g"
                     /db_xref="GeneID:2895256"
     mRNA            complement(<321000..>323243)
                     /locus_tag="KLLA0_F03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455235.1"
                     /db_xref="GeneID:2895256"
     CDS             complement(321000..323243)
                     /locus_tag="KLLA0_F03421g"
                     /note="similar to uniprot|P53946 Saccharomyces cerevisiae
                     YNL059C ARP5 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455235.1"
                     /db_xref="GeneID:2895256"
                     /db_xref="GOA:Q6CLF4"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF4"
                     /translation="MTANTRDSSLQPLTVYPLNDPPLTTEPEPFDDPNDYNPNTPIAL
                     DFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHSRSPY
                     DGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQAQRSNWYQLLFECY
                     GIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGILSEAKRIDWGGN
                     QSIDYLKSLLSLKYPYFPSKLTDYHFQSMYQNHCYFAKNYEEEVSDMFKLDVLENKDI
                     VLEAPFTEVIQPQKTEEELRIQAEKRRETGKRLQEQAKQRRLEKLRQKEEEYEYYVNI
                     REELRDQPKRQILITLQNAGFDDEQDFINYISNLEKVLKRGRILDVEDDDQEESQESK
                     FDLVDVPDEELNDEQKKEKRKQRLLKANIEARLKAKEEKAQLQKALEEAKKKDEDWRK
                     QDLKGWTRDKRFKLAKLIKSRKDKLKLKEEMKDRKSQATQRRMKNLASLAEDSVGPGK
                     RSRQATIDNDPSDTFGANDDDWTIYNDIAITPEALDESIEDEYREIVELEKSLLEFDP
                     SFTEEDTLDAQYDWRNSVLHLFLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPSM
                     GGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTKIPNLRERIVNEF
                     TGFLPVNTPLNVNYAQNVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKL
                     GNVRFVD"
     gene            <324020..>324691
                     /locus_tag="KLLA0_F03443g"
                     /db_xref="GeneID:2895257"
     mRNA            <324020..>324691
                     /locus_tag="KLLA0_F03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455236.1"
                     /db_xref="GeneID:2895257"
     CDS             324020..324691
                     /locus_tag="KLLA0_F03443g"
                     /note="highly similar to uniprot|Q00245 Saccharomyces
                     cerevisiae YIL118W RHO3 Non-essential small GTPase of the
                     Rho/Rac subfamily of Ras-like proteins involved in the
                     establishment of cell polarity GTPase activity positively
                     regulated by the GTPase activating protein (GAP) Rgd1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455236.1"
                     /db_xref="GeneID:2895257"
                     /db_xref="GOA:Q6CLF3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF3"
                     /translation="MPLCGGSSSKQPIERKIVILGDGACGKTSLLNVFTRGYFPKVYE
                     PTIFENYIHDIFVDNQHISLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLE
                     NVQNKWVGEIADHCEGVKLVLVALKCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGL
                     ISYEEGLDMAKKIGALRYLECSAKMNRGVNEAFTEAARCALTATPKGANDTIPQDKGS
                     SCIIM"
     gene            complement(<325270..>326349)
                     /locus_tag="KLLA0_F03465g"
                     /db_xref="GeneID:2895258"
     mRNA            complement(<325270..>326349)
                     /locus_tag="KLLA0_F03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455237.1"
                     /db_xref="GeneID:2895258"
     CDS             complement(325270..326349)
                     /locus_tag="KLLA0_F03465g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455237.1"
                     /db_xref="GeneID:2895258"
                     /db_xref="GOA:Q6CLF2"
                     /translation="MDLEYYEASAVVLEERALPALTTSTEETTAKQTSTNTDDDKTTS
                     TSTSTSTGTSSKNTKLPSLTTKTTDGSTLTTSTGTSSTETASYTTPVMELPSAKGNPN
                     IWSSNKPTGTVFIAVGSAAGFIFLALLVWFIINTWMSYSQAKQLKKFNNMEKQFQNPF
                     IDDIDFSSGGGYYKADEDISTYKDTPVPTKNGGNNSFTPYKRASHSMIRLLGGSTDDG
                     FGGGTPSSIGNTNLGSMNPLERVDAIDAANTGVRKSLYISPTMEVMNQQRRSTLFNNL
                     NQSAVSIDTPEMMEPTRTVSPERRTYKHEKSKSSLSKLVDSTIDLTASTTLDNQKRQG
                     RSKGHNKSSSITPSVYLDNMLEDNS"
     gene            <326689..>327231
                     /locus_tag="KLLA0_F03487g"
                     /db_xref="GeneID:2895259"
     mRNA            <326689..>327231
                     /locus_tag="KLLA0_F03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455238.1"
                     /db_xref="GeneID:2895259"
     CDS             326689..327231
                     /locus_tag="KLLA0_F03487g"
                     /note="similar to uniprot|P53949 Saccharomyces cerevisiae
                     YNL056W Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive-strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455238.1"
                     /db_xref="GeneID:2895259"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF1"
                     /translation="MKYIPPLSFAPVVGTDVDLYRSGYPMPLNYSFIKHQLHLKTVIY
                     VGDKDILPEYKAFLEEESIKFHHIPMKSTKDPEIQKEMETVLKLVLDVNNYPILVHSN
                     KGKHRVGVVVGIIRKLLLGWSMTGIYQEYDLFTGGQKGDIDLEYITMFNTSINVPLDR
                     LPDFVNFKNHPNETHEKLAV"
     gene            <327598..>328761
                     /locus_tag="KLLA0_F03509g"
                     /db_xref="GeneID:2895260"
     mRNA            <327598..>328761
                     /locus_tag="KLLA0_F03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455239.1"
                     /db_xref="GeneID:2895260"
     CDS             327598..328761
                     /locus_tag="KLLA0_F03509g"
                     /note="similar to uniprot|P07172 Saccharomyces cerevisiae
                     YIL116W HIS5 Histidinol-phosphate aminotransferase
                     catalyzes the seventh step in histidine biosynthesis
                     responsive to general control of amino acid biosynthesis
                     mutations cause histidine auxotrophy and sensitivity to Cu
                     Co and Ni salts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455239.1"
                     /db_xref="GeneID:2895260"
                     /db_xref="GOA:Q6CLF0"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CLF0"
                     /translation="MTFDIAKVVRPKILNLEPYRCARDDFQEGILLDANENPYGPTIQ
                     EYNVDSLLHRYPDPHQLEFKKLLSDYRNKTSIFKDQNLKPLDADNLCLGVGSDESIDA
                     LIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETL
                     QNDPSIKLVFITSPGNPTGTFIDVNRIEKILSQWQTGLVVVDEAYIDFVEGSDKGSLA
                     PLATKYENIAVLQTLSKSFGLAGIRLGVTYTSKAMSRVLNSMKAPYNISCSTAEVALK
                     AVQPKNLKLMEENAATVKKEKLRVLKELTSSPYVSQLGGLDANFILLNINNGDNALTK
                     KLYERLAVESAVITRYRGNEPGCAGGLRITIGTKQENDVLIKEFRKHLALIMA"
     gene            complement(<328830..>333227)
                     /locus_tag="KLLA0_F03531g"
                     /db_xref="GeneID:2895261"
     mRNA            complement(<328830..>333227)
                     /locus_tag="KLLA0_F03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455240.1"
                     /db_xref="GeneID:2895261"
     CDS             complement(328830..333227)
                     /locus_tag="KLLA0_F03531g"
                     /note="some similarities with uniprot|P40477 Saccharomyces
                     cerevisiae YIL115C NUP159 Subunit of the nuclear pore
                     complex that is found exclusively on the cytoplasmic side
                     forms a subcomplex with Nup82p and Nsp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455240.1"
                     /db_xref="GeneID:2895261"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE9"
                     /translation="MTSSVVDALNVETTESLGFKFLFSKQIVPGFNEDLPFSKLANAS
                     IHPLKKLLAVASSKTVSVYDLQSVRDESFITLNTKEFTAKVVGVFFVAESLATVLEDG
                     SVWVTELDQFAWEQYWDGNGVNEVICSVIFQGNVLLASNANVVFKISLSQKHSSEQLH
                     SITGCIAIDTLKHQLYVLHKNGSIAVLDEQFNVTSSIEKPSLDEPNEPLSINALSESS
                     LLVSYGEPVDASEEDIMYDLTVYFVNVNTKSFTPSMDIAPPYSTVKRNPSYYSQTLYQ
                     LAQQLPHLFVIGSSCASELSIATPNVMYKPDQDAACAILPINPETDNDTQPIGMALDV
                     FSSGTVYEPCSGVEAADNLPILYVLTNLGELFCWALFHHSALQNSSFTLEPTKTQYVQ
                     SFEILSHKIESGSSSMEKEKVTLISPQDTKNTITEVRKVPEQSSFFETTNSFAKGFSF
                     TPKNMTDSTNAESEGSQNPLLSSGSSPAFGKPAFGQATFGQVTSSQATPGQSAFGQPA
                     FGLPTFGKPVSSQPTSGQSAFGQPAFGEPAFGKPASSQPTSGQSAVGQPAFGQPAFGE
                     PAFGKPASSQPTSGQSAFGQAAFGPPTFGKPASSQPTSGQPAFGQPAFGQPVSDQSAP
                     SKPAFGKPTFGSTSFGTQSQTNTTSPLSEEAETSSVFGTPSFGSTSFGIQGANVTSPF
                     GTNTKISSESSFGKSLFGTSQFGSDSAVTNPAPNSFATSAKLSSPFSAFATDQKTINP
                     FETQTSDPFGHLNSKKEDTKSFNFTGFGESISEANHSLPSVTQDSLNSKEVSDSTIEN
                     DQSEVPSPANDSSISEDQDDIESNIVSSTDESDSLYGEDREIYDNDRSDIHIEASSKP
                     SSTVLNSNSDIEEDEAEQSNEEQAKVETKDGQEEEEEEEEEEEEEEEEEEEEEEEEEE
                     GEEEEEKEEGEEEEKEQQAQDEEQVKDDTKDVSKEKKQEEDKGNDKQVKGDLLTEGSF
                     PSAESTTPVAASYVTEEDDTRSSVASFTDRIKKAANLSTENIANPFMKSTAVENKDSS
                     PFSGFTNSLSKDTGKAPAFSFANLKKDGSEITSPLSNVNSISNESVMREPEPELKQKT
                     GDEPDPEVATPSTNLASSEQKKEALSKDQEIVPSSTVSPESGSVSSSPVVVDYPPVKM
                     SKSSGTTTKEYVSQHVQASVPVGSASTQSLTKESADFTLQAFENDEQYIAERYLPEMP
                     SAFYSTAELKEFSTISSDEVVQAVEKTNAQVLANIQVLRSNIDNIGKFIGDHSQNLFK
                     RTEKTVPIVSSWRLGEAATLLDILTSKAKQSYELKQSYQRLADSSSAVTNFDMLITTL
                     KRQYDILELSNRTSNHSNRKLSWSQHHISTMVKRKLEEVSSKLDEIRESIQVLKLYNL
                     TNTKEALHAVQQLSLNGGIGRENLLTEIQSLREEISVLKLSAEKPNQLEPENLLINTA
                     STSLPLLETTLELYTRAQLGDFFSSKLST"
     gene            complement(<333841..>334689)
                     /locus_tag="KLLA0_F03553g"
                     /db_xref="GeneID:2895262"
     mRNA            complement(<333841..>334689)
                     /locus_tag="KLLA0_F03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455241.1"
                     /db_xref="GeneID:2895262"
     CDS             complement(333841..334689)
                     /locus_tag="KLLA0_F03553g"
                     /note="similar to uniprot|P04840 Saccharomyces cerevisiae
                     YNL055C POR1 Mitochondrial porin (voltage-dependent anion
                     channel) outer membrane protein required for the
                     maintenance of mitochondrial osmotic stability and
                     mitochondrial membrane permeability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455241.1"
                     /db_xref="GeneID:2895262"
                     /db_xref="GOA:Q6CLE8"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE8"
                     /translation="MAPPFFSDISKDINGLLNKEFFHATPASVDVKTTAPNGVAFTVK
                     GKTSPKDGSIAANVEVKASDKSTGLTFTQGWNNANTLDTKIELAELTPGLKTELITSG
                     VPGVSKAAKLNVNFVQPLFAARGFFDLLKGPSFVGDLTLAHEGFVGGAEVGYDISAGA
                     VSRYALALGYNASGAYSVGLSVNNAQLITASFFQKVSPILQVGAKAALNPQAGSNVNI
                     EFASKYALDAVSQVKAKVADSGIVALSYQQILRPGVTLGIGASFDALKLAEPVHKLGW
                     SLSFAA"
     gene            <337386..>340505
                     /locus_tag="KLLA0_F03575g"
                     /db_xref="GeneID:2895263"
     mRNA            <337386..>340505
                     /locus_tag="KLLA0_F03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455242.1"
                     /db_xref="GeneID:2895263"
     CDS             337386..340505
                     /locus_tag="KLLA0_F03575g"
                     /note="weakly similar to uniprot|P53950 Saccharomyces
                     cerevisiae YNL054W VAC7 Integral vacuolar membrane protein
                     may function to regulate Fab1p kinase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455242.1"
                     /db_xref="GeneID:2895263"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE7"
                     /translation="MVAGLGSEDDGNKMIVETELVQTEKQNILPVSQQPSQQFDKNGI
                     GTDTENSTLTQKKLLNNTKRDTMPGSPTRKEGHDRIDTHDLHDLHDDMSATLKPHQSQ
                     NRIASLQLQDSTHQSITSHQEKEGTPLSHQHTNPLSTHALSSTGLRNKKSSLLIDCAV
                     DGARDFSLPPLTNSDQMLDLSLVSKNSSHDLPSFTTAMSKQKTKPQLSKLSSYQEESS
                     DGRIDSDSQLTTSQDSKTKEWERRQGIRTSNSPPPQQLASQISLGAGDMNGGSSAVLP
                     SSGVSLPLQQQQHQRSQTQGLNNPTVQVQSASANLTPNGQISLPTVTDSESVRKLNKE
                     SSSKADFFAARLATAVGENEISDSEETFVYQSTANSVKNASINDVSATPNNTINSIQN
                     NNNNSKSYGIPAKLSAPQLKQNDKLLNRLKNTRHTSIAAIPNSQGPPSSNSEQDDVAS
                     LRSINRNTMQEMQSIKSHRTQMSASPKKRLSITSLQKVQNRQQKQQPQSVITNGATKS
                     STSTTPTKSTFAFGQPKSGKTTSSIPKNSKQHFPQPMLPLAQNKVMHQNHRRTSSKPG
                     DSKKSALRTRSSKVFDPNGSSLRRYSGVPDDVNLEDFVDQYDGEFDIKMHRPSRTTEK
                     KSNNQQHQSNAASQRGTYSSDNHIQYEPNDNHSGYGDDEIDLDNNDIQSNSDISDIHG
                     LTYHNQTNYDEHSYADEDGDDIESMFYYNGGSIVPNNARVGRRFSELDDGTEDVESQG
                     FFYGDPNNAERSNEGKGLGSSQLPYFNQASEYTPLKNKRVSRKRSDFYGDFSPHNFYT
                     KKGSWSKFKNFVYFSFIVASLLTLGFISGFLLATNKELHDFQLLAMDNVLVSLDELVF
                     DITATAFNPSLFTIGIKDVELDIFAKTKHVDVSSNEDKLYSTPYQTILLGTVYNLESE
                     LQFRGRLINRNYDVSVASVKLLNPGAPKNNGDDEDGDNDDDDDDNGNKKKMGHDNQDE
                     KGNHKLENDIDRWKELIKYEFELIVRGNMYYSIPFFNNQKVLPVQQQISVDPDNSPFR
                     KKHGNNHAQ"
     gene            <341326..>342408
                     /locus_tag="KLLA0_F03597g"
                     /db_xref="GeneID:2895264"
     mRNA            <341326..>342408
                     /locus_tag="KLLA0_F03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455243.1"
                     /db_xref="GeneID:2895264"
     CDS             341326..342408
                     /locus_tag="KLLA0_F03597g"
                     /note="similar to uniprot|P38590 Saccharomyces cerevisiae
                     YNL053W MSG5 Dual-specificity protein phosphatase required
                     for maintenance of a low level of signaling through the
                     cell integrity pathway regulates and is regulated by Slt2p
                     also required for adaptive response to pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455243.1"
                     /db_xref="GeneID:2895264"
                     /db_xref="GOA:Q6CLE6"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE6"
                     /translation="MEAPQRISTRSHHSMQNKNSKNLCLRIGDSPTKNKLIMVDSKPN
                     ESNDTFAVPLRHQLTKRVSEAQIYTLPPQLKSARSTPSTPQLPSGSSGFDSAASPSSS
                     TSSSPFNKPTLPTINTKFHNRPRATTIATSVPQIQTPSNDSMESTTRYWVLQENTPMS
                     STNYDNDMKSIPYNTHSDEDSPSYSESYREKYYPSGPLLVVPPFIYLYSEPSLKEVMD
                     YDVIINVAKEITNYKEQLPLSKQGCYYHFTWSHTSQITKNLPQLTELIQNAYASKKKV
                     LIHCQCGVSRSASLIVAYMMRYDKLSLNEAYNKLKSVAREISPNMSLLFQLMEWEDWL
                     NNCDSINDNCRKQSFESISEFGELSL"
     gene            <342770..>345652
                     /locus_tag="KLLA0_F03619g"
                     /db_xref="GeneID:2895265"
     mRNA            <342770..>345652
                     /locus_tag="KLLA0_F03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455244.1"
                     /db_xref="GeneID:2895265"
     CDS             342770..345652
                     /locus_tag="KLLA0_F03619g"
                     /note="similar to uniprot|P40480 Saccharomyces cerevisiae
                     YIL112W HOS4 Subunit of the Set3 complex which is a
                     meiotic-specific repressor of sporulation specific genes
                     that contains deacetylase activity potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455244.1"
                     /db_xref="GeneID:2895265"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE5"
                     /translation="MSEPVKKRSLGSYLSRLEERREERERSEQQQRESPKPVGENGNY
                     SVTNVPVKEEEVSQKVTSTDQNSTKQPSDEPYVVSQANSSDQKVGSPLNNQESIPVRQ
                     AETKGPINEIKQETDVEEKKNLPKVGRNKHSDEEYSSALSEVESDAPTEPASPPRPKM
                     GRLIRGDQLESGNNSRQSSAPVLTNDGESDSDLSDLDEARTAKISSSAIHEDSSPVKH
                     YNEHKRKSSSIENSSNHKKQKHSAGKKIPKTKRGVHRDAGGRTKLQIACDKGKYDLAK
                     KLIEEDGYDVNDQDNAGNTPLHEAALNGHSAIVELLVRNGANVNIQSYDMFLDTPLID
                     ASANGHINVVKYLLDHGADPTMVNAKGLSAIESIEEESDMDNDDRRIVHDMKDMLKRA
                     TRKYIKHSHRTLQSSSMSRHSDDIDKQLNHDDDFYWTDISSKLGKNKLLKASKEGKLA
                     YVGSYLENGGRPDFRCFLESCIYGHDDVVSLFLAFGAQVNMSNKEGQTPLMLSVGRGH
                     VNVVKLLLEAGADPQKTDKRKKTALHYANHSSLGLTDPDEVNLLKAAVRAKYGYEVSN
                     NSDEEGEEDSEGKSPSPREISSIPSTKGEEQDRSLEIRKDDSPYHSEPQSKIGNINEE
                     KPKLLPDSQTTAETASLVRPSLERLDSTKSTSSTSLTHRYKSASPTHQLSTPPILPKE
                     SEEERAARLKSEEEYRQKRLQQKKRKEQEFLNRLAEDERKRVEEKEKLKQQEEQRLEQ
                     AKKEELLKEEELRNRNEVEKRLKIRERYPIGLRVIDFKDLENYDKFGPVYYFTEDGSK
                     WVLDLQISVIIKSSTEELKKQSSEFKEVEKGQYPQLWNLFKFIFLYGGSDNANNSKSL
                     PWRQLSEIDQTEYVKFYELPLTWIKLSRLNLQDLNPKMNDWIEKNMIEFIPASTSALY
                     RTRKVLLRDSKRPGQNENNANTRFVPAKYQSRSKMLPWLNASKALW"
     gene            <346255..>347211
                     /locus_tag="KLLA0_F03641g"
                     /db_xref="GeneID:2895266"
     mRNA            join(<346255,346760..>347211)
                     /locus_tag="KLLA0_F03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455245.1"
                     /db_xref="GeneID:2895266"
     CDS             join(346255,346760..347211)
                     /locus_tag="KLLA0_F03641g"
                     /note="similar to uniprot|P00425 Saccharomyces cerevisiae
                     YIL111w COX5B or uniprot|P00424 Saccharomyces cerevisiae
                     YNL052w COX5A, subunit Va or Vb of cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455245.1"
                     /db_xref="GeneID:2895266"
                     /db_xref="GOA:Q6CLE4"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE4"
                     /translation="MLRSSVSRVARVTPVRFAQTQALSKASIVDLPNRWEDLPATEQQ
                     DIVLKLAERQKLPWTELTNVEKQAAWYISYGAWGPRRPVHGKGDAAFIAKGVAAGLIA
                     SLLIFAGIRQLSGDPPKTMTKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            <348137..>349243
                     /locus_tag="KLLA0_F03663g"
                     /db_xref="GeneID:2895267"
     mRNA            <348137..>349243
                     /locus_tag="KLLA0_F03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455246.1"
                     /db_xref="GeneID:2895267"
     CDS             348137..349243
                     /locus_tag="KLLA0_F03663g"
                     /note="similar to uniprot|P40481 Saccharomyces cerevisiae
                     YIL110W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455246.1"
                     /db_xref="GeneID:2895267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE3"
                     /translation="MSFAFGFSNEDFSDDELDIANQNTDDKPSTSVPRINPLDSEVLL
                     GESVNQPKYIDLDDLLRSLANVRLSFEEVQTPTTNSVLYRRELFDVKHQLMSEVDSGT
                     NNVELEILMGETNEDLRRNVYEGGLKSWECSIDLVDSFVKNPAQISQCQNIIELGCGT
                     SLPSEFLFMEYLRSNINTGINFTLCDYNESVIRLVSIPNLIVSWAKTVISNEQWIELQ
                     ASEDSNIPIASDELLLTEKLLEAFKSDLEFRNVSFSFISGSWGRKFMDVLIEHKATPL
                     SNTLILTAETIYQPDTLPVISETLIELIVDNKKNSYPVKCLLAAKDIYFGVGGSIVDF
                     ENYIAKRIATDNLPLCLNKFKVNAGLKRSIVLIE"
     gene            <349421..>350593
                     /locus_tag="KLLA0_F03685g"
                     /db_xref="GeneID:2895268"
     mRNA            <349421..>350593
                     /locus_tag="KLLA0_F03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455247.1"
                     /db_xref="GeneID:2895268"
     CDS             349421..350593
                     /locus_tag="KLLA0_F03685g"
                     /note="similar to uniprot|P53951 Saccharomyces cerevisiae
                     YNL051W COG5 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455247.1"
                     /db_xref="GeneID:2895268"
                     /db_xref="GOA:Q6CLE2"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE2"
                     /translation="MAQNDPLQGFEDFLEADFQPLRFANDLLKVTNNGTDTDVLDLKT
                     CVKRCSYDLQELDRRIEGAIKTNPSHVLEQIEKRKKEKSFVGDTLKSNTEYLSMSYNR
                     LQQDILEPFERALKLQTVSSKIHQTTTLLRSSLIYVHMISQLQMMPLETDSTDDEQLA
                     CGLKIAALHSQLKINIEQNPNLATLQLIKSCENNVVSPNRQELLRYLSTNLTRDCLNN
                     LKMENNPKRIVTLIKALYTLSPVDLFDTIDKVLSSKIQTTAQVLSKTITSIRNFNLSL
                     DDAMENRNSILTLQNLMEECEIEGNTNTLRNYLSQRKFSSLIDQFWSKVTNSFKRDFE
                     MSYNRGGPVGKSLQSNSNLIYEAISKCFGENDPSNELQGELQYILKAVSILDTNRK"
     gene            complement(<350639..>351460)
                     /locus_tag="KLLA0_F03707g"
                     /db_xref="GeneID:2895336"
     mRNA            complement(<350639..>351460)
                     /locus_tag="KLLA0_F03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455248.1"
                     /db_xref="GeneID:2895336"
     CDS             complement(350639..351460)
                     /locus_tag="KLLA0_F03707g"
                     /note="weakly similar to uniprot|P53952 Saccharomyces
                     cerevisiae YNL050C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455248.1"
                     /db_xref="GeneID:2895336"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:Q6CLE1"
                     /translation="MRCNLRIFSSSSQEHLAKLNKSIMSGLRVVSRNELFDTTTNVTA
                     TDDRVVLPKLDLEFVDVQTQQEDNIKSDRNDESDVNNSAEEFEFPLFSFGTITDSTTP
                     ANDVGESVQTDENRGRKATALIKVSLREPSPDSAPIGRARTYYCAEYSEQDRHNFSAA
                     AVSADVILKYAELGPYPGWLQFRGKVIDVDEHNRKVHTEQVRIRHLRRKRPGKRQRMA
                     RLHGKEREDLRKQRDSEIKKLLKKKFHKRGGKKNKKKATNPLADAGAISKAKAKP"
     gene            complement(<351716..>354490)
                     /locus_tag="KLLA0_F03729g"
                     /db_xref="GeneID:2895337"
     mRNA            complement(<351716..>354490)
                     /locus_tag="KLLA0_F03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455249.1"
                     /db_xref="GeneID:2895337"
     CDS             complement(351716..354490)
                     /locus_tag="KLLA0_F03729g"
                     /note="similar to uniprot|P40482 Saccharomyces cerevisiae
                     YIL109C SEC24 The Sec23p-Sec24p complex is one of three
                     cytoplamic COPII factors involved in ER to Golgi transport
                     vesicle coat component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455249.1"
                     /db_xref="GeneID:2895337"
                     /db_xref="GOA:Q6CLE0"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MSHHKKRVYPQAQYQIAEGIAQPIVGGGVPPQTVGAGQPQFLTP
                     AQQHLHQQIDQASNGIGNMQLHNVPVVDPTAFQQAGTPVQQPPYGGAPQYGQPMNSGY
                     GADNISGVQQQYQQPMQQPYGQTYGQQQQQPQYQQPGVGMAVGKPMNQLYPVDLFQEL
                     PPPITDLSLPPPPLMLPPEKMIVPNDTVNNCSDHLRCTLNAVPKNNSLLKKSKLPLAM
                     VIRPYTKLTDSECPVPTSEDGVVVRCRRCRAYLNPFVQVIENGLRWRCNFCNLANNFP
                     QAIDMNGNRYERPEFNHSVVDFVAPKEYAVRPPPPSTYAFILDVSQASIKNGLLATAA
                     RTLLESLDTIPNHDERTRISIICVDQSLHYFRIPLDEEGDNIKMYDVADLDEPFLPSP
                     TGLLVPLIEARSNIEKLLTSLPEIFQQNIQPRFALASALKSALNLIRAQGGKIIVVGA
                     TLANVGEGTLHKRNEKAVANTSKEASTLLNTGDAFYKSFPIECNKYQVTVDMFMASDD
                     YVDIASISNLGRFTGGQTHFYPGFSALNLIDVTKFSKEFSKHVSMDLSLEAVMRARGS
                     SGLKMTGFYGHFFNRSSDLCALATVPRDQSYVFEIGIDEQLTKDFVYIQIALLLTSNA
                     AQRRIRVITIGIPTTDKLTEVYASADQLAITAYFAQKAVERAPSSGFEDTREFFNKSV
                     QEVLATYKKEVLTSNTGGGAPLMLCSNLRMWPLLMHSLTKHMAFRSGIVPADHRAQAL
                     NNLETLPLPYLIQNIYPTVYSLHDMPDEAGLPDEETGEIVLPQPINSTSSLLERYGLY
                     LIDTGLDMFLWIGGDAVPELVTDVFGTPDIMEIPIGKNELPLLDATEFNLRVRNVITK
                     IREHDDVIFYKTLHIVRGASPSEPMNHPSAREVASLRLWTASQLVEDKVQNSWNYREF
                     LQNMKTRISK"
     gene            <355439..>357490
                     /locus_tag="KLLA0_F03751g"
                     /db_xref="GeneID:2895338"
     mRNA            <355439..>357490
                     /locus_tag="KLLA0_F03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455250.1"
                     /db_xref="GeneID:2895338"
     CDS             355439..357490
                     /locus_tag="KLLA0_F03751g"
                     /note="similar to uniprot|P40483 Saccharomyces cerevisiae
                     YIL108W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455250.1"
                     /db_xref="GeneID:2895338"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD9"
                     /translation="MSQIQFYNIKNGEEVHTPALIVHGNINTNANSVQVHHSQLPPLT
                     FPVNNHGFKCIISLTPGENLLWFTGNDNSTAQLTIQYVPLLQNPPIHLCLLLAKDSPL
                     KYDAPAVQIRKEGGNGLDLAIKKLRTGARIMQAFTNEQMVRNGVGQRTFRFVEEFTKD
                     TLLKDDELRNTVKIHILKSEKTTVELRDINIAQQNPNAKDAGGLFGIAMKELERYGAP
                     FNDNYNTSQAAVMFMDSHWDKKLKLITAHAALGGGTNKIKLAIFGSHGLYSWPTCFQD
                     IVPYFLDDTRASTSEVANDCNQCGTHWECLAITLGAFMHEIGHLLGCPHQENGVMLRD
                     YMTLNRSFLTKEAYSLRTNSYGAQSPIYPKLECTWHRLDILRFLYHPSFALPQDFYDP
                     QLLRPGQLDHWKYQKATLFPMGNQTASIKSESGIYCIEIICGEFGKAHLEYLPKQHGG
                     VGPQKEILVTLDQLRSMIPPAQVPEFGNKFNIKVHSINAATAEFTNFPEIINVKPISM
                     KEYGFGNNVLGVKSTLLGNANRGSPTGLVPIKVEQCYIVRVYHGAALDGIRFYAKDTS
                     EAPQIPPRTYAGKVSSIFKGAKDVMTSGPSVLFGKETANYSDLRLESNEYITGFNVRA
                     GAWIDAIQVITSKGRLSEMFGSKSGGSLGTLTPPPNKKVLAIYGNVSSWVDAVGIVFE
                     A"
     gene            complement(<357597..>359915)
                     /locus_tag="KLLA0_F03773g"
                     /db_xref="GeneID:2895339"
     mRNA            complement(<357597..>359915)
                     /locus_tag="KLLA0_F03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455251.1"
                     /db_xref="GeneID:2895339"
     CDS             complement(357597..359915)
                     /locus_tag="KLLA0_F03773g"
                     /note="similar to uniprot|P40433 Saccharomyces cerevisiae
                     YIL107C PFK26 6-phosphofructo-2-kinase inhibited by
                     phosphoenolpyruvate and sn-glycerol 3-phosphate has
                     negligible fructose-2 6-bisphosphatase activity
                     transcriptional regulation involves protein kinase A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455251.1"
                     /db_xref="GeneID:2895339"
                     /db_xref="GOA:Q6CLD8"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD8"
                     /translation="MFRRVSFSEHVLVSSSDSELEPTQSIEDKRHDQATQLKMDENED
                     GIYEVDNLPQFQKRPLSDTPVVSRFQSPSSSVETSAETSPQSSRSTSPTGSPVLGPVT
                     EEQLSSENGFQSGAEDWQDQSMLENHPPSHMVPKRRPTTIDVPGLTKSKTSPDGIISQ
                     KDPGSKLIIIMVGLPATGKSFITNKLSRYLNYSMYYCKVFNVGNTRRQFAKEHNMKEQ
                     DSNFFDPDDEHSKMLRNKWALDTLDQLLEYLLNGPGSVGIFDATNSTKERRRMILKKI
                     HERNKFIKVLFLESICSDKETVEKNIRMKLLGPDYKGKDPESSLSDFKGRLSNYMKKY
                     ETIEDDENVPYIKMIDIGKKIVSYDIQGFLASQTVYYLLNFNLAERQIWITRSGESEF
                     NVSGKIGGDSQLTKRGLKYARALARFMEEQRKLFNENQMKEHLKVCTQDTKHEFTPTE
                     FFVWTSMKKRAMATACTFNDRHFDIKQMKMLDELSAGDFDGLTYEEILLRSPEEYEER
                     LLDKLRYRYPGIGGESYMDVINRLRPVITEIERITDNLLIVTHRVVARVLLGYFLNLS
                     KDVITNLDVPLHSVYCLEPKPYGVSWYLYEYNEETDTFSKVPHTDLNTTKVKEVGLVH
                     QERRYSIIPTAPSSATSGKSRSVSHSSSFTTTSSGGQSSNRLPHNLPYSSSTNMSGAS
                     RSVHPARQLPPYRTNPSLLARTMSRNHSSDHVGILKRSVSPRELANSIELDKLNEKLS
                     KLATNEKSKSDTTPQAPPLSRSQSETMSPHTS"
     gene            <360687..>361737
                     /locus_tag="KLLA0_F03795g"
                     /db_xref="GeneID:2895340"
     mRNA            join(<360687..360706,360840..>361737)
                     /locus_tag="KLLA0_F03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455252.1"
                     /db_xref="GeneID:2895340"
     CDS             join(360687..360706,360840..361737)
                     /locus_tag="KLLA0_F03795g"
                     /note="similar to uniprot|P40484 Saccharomyces cerevisiae
                     YIL106W MOB1 Mps One Binder;(putative) transcriptional
                     regulator involved in mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455252.1"
                     /db_xref="GeneID:2895340"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD7"
                     /translation="MSFLQNFHLSPGQTIKSTRGFKWNTAKNTNKDGNGNGNTNGNGF
                     QNVNLTNDLSLPQFNDNMPQQLSTPQKQATTAHLFQSGLDHGAGPVTDFNYTPSHQRP
                     YIQSTSGTVVSSHQDLRQIVETTLGSKGVLNQAVKLPKGENIDEWIAVHCVDFYNQIN
                     MLYGSITEFCSPQTCPRMIATNEYEYLWNVHPGKPPISLPAPKYVDYLIRWCQQQFDD
                     ESYFPSKPGAPFPKDFKDSIARPILKRLFRVYAHIYCHHFNEILELNLQTVLNTSFRH
                     VCLFSEEFHILKTNDYGPLLELVIEFKDR"
     gene            <362093..>363805
                     /locus_tag="KLLA0_F03817g"
                     /db_xref="GeneID:2895341"
     mRNA            <362093..>363805
                     /locus_tag="KLLA0_F03817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455253.1"
                     /db_xref="GeneID:2895341"
     CDS             362093..363805
                     /locus_tag="KLLA0_F03817g"
                     /note="similar to uniprot|P53954 Saccharomyces cerevisiae
                     YNL048W ALG11 Alpha-1 2-mannosyltransferase catalyzes
                     addition of the terminal alpha 1 2-Man to the
                     Man5GlcNAc2-PP-dolichol intermediate during
                     asparagine-linked glycosylation in the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455253.1"
                     /db_xref="GeneID:2895341"
                     /db_xref="GOA:Q6CLD6"
                     /db_xref="InterPro:IPR001296"
                     /translation="MKLADFVTYVFGSLLAGLVTLKVLSSFIPSLLVTLPAKVRLRVN
                     NSLLKCSNNLNRIPVLDFGWKNSSVRRAFILASERPSDYTNKIYGDRVHIAYNDRIKR
                     ESFVNKLGFDSKRKLLGFFHPYCNAGGGGEKVLWKAVETSLNQDKNNICVIYTGDTDV
                     NGSDILNSVRRRFEYDLDSDRIVFIFLQKRRLVESKSWPKFTLLGQAYGSIILSIEAL
                     TTLAPDYWIDTMGYPFAYPFVSLFARIPIVTYTHYPVISTDMLQKLKTMPGFHTNFKL
                     IGKYVYWKIFMLAYKFSGLFVEIASTNSTWTYNHIKSIWSSTKNIHIIYPPCSTESLI
                     EGCDKSDPVKRLNQAVVIAQFRPEKRHELILSSFSSFIDATTKKDLIPKIIFIGSTRN
                     VEDREYVETLKKYAFEALKIPTHLVDFKTDCKYDDMKSILYSSWFGINAMWNEHFGIA
                     VVEYMASGLIPLCHASAGPLYDIVVPWDSKKNEQSTDKANETGFFFIDETDPDFLAKD
                     SSKYSSLRTLFAQVSKLNTVQRIDISNRAKMCSLSKFSDSEFERSWNEVLEELNLTHN
                     RMFS"
     gene            complement(<363977..>365923)
                     /locus_tag="KLLA0_F03839g"
                     /db_xref="GeneID:2895342"
     mRNA            complement(<363977..>365923)
                     /locus_tag="KLLA0_F03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455254.1"
                     /db_xref="GeneID:2895342"
     CDS             complement(363977..365923)
                     /locus_tag="KLLA0_F03839g"
                     /note="similar to uniprot|P40485 Saccharomyces cerevisiae
                     YIL105C SLM1 Phosphoinositide PI4 5P(2) binding protein
                     forms a complex with Slm2p acts downstream of Mss4p in a
                     pathway regulating actin cytoskeleton organization in
                     response to stress phosphorylated by the Tor2p-containing
                     complex TORC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455254.1"
                     /db_xref="GeneID:2895342"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD5"
                     /translation="MSKQNTMTSSIADMLSQNQHSLQQLQQLQQQPSRSLTSADYKNF
                     QQSGLNGTSANNRVSVAGQTIPYPTDNISIDVNQPRGSMSADVVGVQGNANATGLEEG
                     ISFPQMNSSKRQQQTNSLTSSHTHVSRNRASLQRHRSNGQDPRSPLVVLMPTNANPTE
                     VLSQRFAAWRGIIRSLLVYLQETVSIQDEVVRQHLRLQHAINFPFFTIDSQHQPTTPE
                     DKNIQKFFLPLGHGSIQDLPTLFNQYHTQMVHAASKASKELSQDVIPRLEDMRRDLLV
                     KIKEIQSLESDFKNSCNKELQETKIRLKAFQESLENSKYGSVKQDPFLAKILLEKQIK
                     KQLTEENFLHEAFNNLQTSGRELEKVVMMEIQNALTSYAKVLGQEAQIVFDVLISKLD
                     TGFFNKDPVFEWENFVAKDPNFIDPNLPMRRVKDIVYKNQNDPFTYEIKSGILERRSK
                     FLKSYSRGFYVLTPSFLHEFKSGDRKKDLIPVISLSLNDCTVAEHSKKGSSDFKFILH
                     TKQNGIIHRGHNWVFRTDSYESMMDWFNNIKQLTSTSNPVEKARFVTEKLNLDGSHNK
                     SVLTHSTPQGNQAARASVDNNDSILATPRTENEIHAFSETTGNTTLNNSNIEPMNKAS
                     QFLTPKNPRKSGQYSLENSAKNNV"
     gene            <367117..>367527
                     /locus_tag="KLLA0_F03861g"
                     /db_xref="GeneID:2895343"
     mRNA            <367117..>367527
                     /locus_tag="KLLA0_F03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455255.1"
                     /db_xref="GeneID:2895343"
     CDS             367117..367527
                     /locus_tag="KLLA0_F03861g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455255.1"
                     /db_xref="GeneID:2895343"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD4"
                     /translation="MQYFTKDASMVYTYDGIQKTNAGNIKLRRLKTSSISRLFSRSKT
                     ARLRNRGTRNKQAKFVGSDLNKLERFIYSERFMPCVIFVICIVTLLHLILARLINMFQ
                     EMVKYYFYANLFGMGWDWYSKWNWIVLHILEKFV"
     gene            <368275..>370263
                     /locus_tag="KLLA0_F03883g"
                     /db_xref="GeneID:2895344"
     mRNA            <368275..>370263
                     /locus_tag="KLLA0_F03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455256.1"
                     /db_xref="GeneID:2895344"
     CDS             368275..370263
                     /locus_tag="KLLA0_F03883g"
                     /note="similar to uniprot|Q10740 Saccharomyces cerevisiae
                     YNL045W Similar to human LTA4 hydrolase but in vivo
                     substrates not yet defined."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455256.1"
                     /db_xref="GeneID:2895344"
                     /db_xref="GOA:Q6CLD3"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /translation="MLFNFYNKTSAACKSLPAKALSNVRYFQTSPISRKMPLPPVLES
                     RRPKESPEFDYSTLSNYKSFKVKHSQLDVSVDFKKKTISGSVSYEIEKVKKDENTIKL
                     DTSYLKISKVKVDDEDDVKFKLLERKHPLGAQLIVSPSSLPEIFHLCLQFSTTADCTA
                     LQWLDEHQTSGKPYVFSQLEAIHARSLFTCFDTPSVKSTYLANIKSELPVVFSGIQTG
                     YDDSTKVYSFKQEVPIPAYLIGIASGDLASADIGPRSKVYVEPYRLKDAQWEFDGDVE
                     KFITTAEDIIFKYEWGTYDILVNPNSYPYGGMESPNMTFATPTLIAHDKSNIDVIAHE
                     LAHSWSGNLVTNCSWDHFWLNEGWTVYLERRITGAIHGEATRHFSSLIGWNDLEGSIS
                     AMQNPERFSCLVQNLKDGTDPDNAFSTVPYEKGSNLLFYLENLLGGKEVFDPFIKHYF
                     TKFARQSLDTWQFLDALFEFFHDKREILESVDWQTWLFTPGMPPKPKLITDLADDVYA
                     LANKWIASAQKFTEREQFEKEFSIKDISEFSSNQIVLLLDTLVQGGMPEKDTFKWSNY
                     PEASEIFTDIYEDKISKSQNAEVIFRNYRLQVKSHITSSYPELAEWLGTVGRMKFVRP
                     GYRLLNEVDRELAIKTFHRFRDSYHPICKSLVKQDLGI"
     gene            <370581..>371282
                     /locus_tag="KLLA0_F03905g"
                     /db_xref="GeneID:2895696"
     mRNA            join(<370581..370604,370776..>371282)
                     /locus_tag="KLLA0_F03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455257.1"
                     /db_xref="GeneID:2895696"
     CDS             join(370581..370604,370776..371282)
                     /locus_tag="KLLA0_F03905g"
                     /note="similar to uniprot|P53633 Saccharomyces cerevisiae
                     YNL044W YIP3 Interacts with YPT proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455257.1"
                     /db_xref="GeneID:2895696"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD2"
                     /translation="MNNFAQLSQISSFAQNLSVERIKSEFGSLQNRLASVRPPQEFFD
                     FKRISKPQNFGEVQSRVGYNLGYFSTNYVLIISALSIYTLLTNFLLLTVIVFVVFGTM
                     GINKLNGADLVTPFGSFKTSQLYTGLLCVAVPLGFLASPISTLLWLIGASIVTVFSHA
                     SFMEKPIETVFEEETV"
     gene            <371730..>372767
                     /locus_tag="KLLA0_F03927g"
                     /db_xref="GeneID:2895697"
     mRNA            <371730..>372767
                     /locus_tag="KLLA0_F03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455258.1"
                     /db_xref="GeneID:2895697"
     CDS             371730..372767
                     /locus_tag="KLLA0_F03927g"
                     /note="weakly similar to uniprot|P53958 Saccharomyces
                     cerevisiae YNL042W BOP3 Protein of unknown function
                     potential Cdc28p substrate overproduction suppresses a
                     pam1 slv3 double null mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455258.1"
                     /db_xref="GeneID:2895697"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD1"
                     /translation="MQNDNKEEVPALAVLLGSNVKNWPYSEDTLVHALQLRSQQEQTK
                     RQYYKLENVNKTLEMLKTAVSAGIPVNLIPQLFNSDHSGMETDPADLRHMNHSKEQSP
                     LLAVPDKQMKSYKFPPENQSLRPPTTGAELKTHRRTHSPARIGAEAVAALNSSMALKE
                     KELHGNDDERRKTIGSERHIHKRMMSMPIFKNEPTTGVLNFSAWQTYNGQNLSGNHPG
                     SGRKLTTTGPSSFPHAVRKHRRTHSTNSAFGVIDLNSINQVAFKQSNSRGSSAIGNNV
                     NDHGDSPTSGKNNSKVEKESDPSSVGTNDDAFGDDSSNDTTIDDIKKISPSPPRTLLK
                     GPNYVDNLLNT"
     gene            complement(<372819..>374246)
                     /locus_tag="KLLA0_F03949g"
                     /db_xref="GeneID:2895698"
     mRNA            complement(<372819..>374246)
                     /locus_tag="KLLA0_F03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455259.1"
                     /db_xref="GeneID:2895698"
     CDS             complement(372819..374246)
                     /locus_tag="KLLA0_F03949g"
                     /note="similar to uniprot|P40486 Saccharomyces cerevisiae
                     YIL104C SHQ1 Essential nuclear protein required for
                     accumulation of box H/ACA snoRNAs and for rRNA processing
                     interacts with Naf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455259.1"
                     /db_xref="GeneID:2895698"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="UniProtKB/TrEMBL:Q6CLD0"
                     /translation="MITPRFTVTQDDEYIYVQIKVSSIRFNSAGVEVVIDGCMFIFHL
                     SPYYLRLRLSDELVEDETLNTVEYDSKQESINCKILKAVKGKEFKDLDLASKLLAAKN
                     EPKVTDGPLIQEISNEKESIADIREEGEHFDWEIKQEVQVDNTPTTKYGFDNLYTGYI
                     VMSVANGNDINELDDPEHTSPENRVKERLKKENLKFDPEYYAAEYITIKQGDEEEIQI
                     NGIKRLLGYLPPLCERYQQWFERSDNESKERNVSFPVEFTEAEQTQMQDHIPKKKYLI
                     NDVKSQYLTILSILYSYTFEQIENEGQHTTESQWTIGKLTPQISMLDQQILLSESLIH
                     FSQIKGTIVTGIRRALSYPLHRNYDLCIKAWQLAIKLLLGGKRLVIKALLDIHELFRY
                     HDVYYVYNKILLDDLCAWFISQGNDNVIQSLALQAKKELESITKSDIEFECISGMNEE
                     TGEVEWETLNISEIEYLAEQEEIVQ"
     gene            <374590..>375858
                     /locus_tag="KLLA0_F03971g"
                     /db_xref="GeneID:2895699"
     mRNA            <374590..>375858
                     /locus_tag="KLLA0_F03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455260.1"
                     /db_xref="GeneID:2895699"
     CDS             374590..375858
                     /locus_tag="KLLA0_F03971g"
                     /note="highly similar to uniprot|P40487 Saccharomyces
                     cerevisiae YIL103W DPH1 Protein required along with Dph2p
                     Kti11p Jjj3p and Dph5p for synthesis of diphthamide which
                     is a modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) may act in a complex with Dph2p
                     and Kti11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455260.1"
                     /db_xref="GeneID:2895699"
                     /db_xref="GOA:Q6CLC9"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /translation="MTMGEVEKKPRRRFVGIKKAAEESDPSGSTTELVKKIKPKTNIR
                     HAINQIPPELLNDEELNAAIKLLPSNYNFEIHKTVWNIRKHKAKRVAIQMPEGLLIYS
                     LVISDILEQFCQCEIVVMGDVSYGACCIDDYTARSLDCDFIVHYAHSCLVPIDITTIK
                     VLYIFVTINIDETHLIKTLQKNFPRGSRIAAFGTIQFNPTIHSMKDKLLQSEEHMLYI
                     IPPQIKPLSKGEVLGCTSERLNKEQIDAMVYVGDGRFHLESAMIHNPEIPAFRYDPYN
                     RRFTRERYDQKQLVEVRASAIDKARSSKKVGLILGALGRQGNLATVENLETKLKASGR
                     TVVKIILSEIFPQKLAMFDDIDAFVQVACPRLSIDWGYAFNKPLLTPYETNVMLENDR
                     MFNEKYYPMDYYHINGYGRGKVPNHDDVTI"
     gene            complement(<375915..>378254)
                     /locus_tag="KLLA0_F03993g"
                     /db_xref="GeneID:2895700"
     mRNA            complement(<375915..>378254)
                     /locus_tag="KLLA0_F03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455261.1"
                     /db_xref="GeneID:2895700"
     CDS             complement(375915..378254)
                     /locus_tag="KLLA0_F03993g"
                     /note="similar to uniprot|P53959 Saccharomyces cerevisiae
                     YNL041C COG6 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455261.1"
                     /db_xref="GeneID:2895700"
                     /db_xref="GOA:Q6CLC8"
                     /db_xref="InterPro:IPR010490"
                     /translation="MDFLDFPALVVDESAALPQPASRLSLASLRLNDDEQEAKFVLPN
                     VSKHDTEFTDLHSKMKHFASISLGEIRPASVSLSKEVAAPISNNIEKPTTTNQLLSKK
                     INSLLNVPNYASYTSDSETKRALQILDANHSDLGLNFNQLVASDFVGTLNRKSLRSKL
                     ENSMLNSHSDILSNFQSIARRIKRLSGPLERINNAMQNFKDTTESIDFEFEHVKDRLD
                     QLKARRQVIIKLRDSLTLTQLELDHLQNGTINDLFFQILNKINFIKEKATYLLSNEKT
                     TSAGVALLKTMNNNLTVSNKRIYNYLINFIEEYDTLSRQYGERTIGDESLSNFQTSLI
                     HLSNDVQFFQDFLNRIVGLRSKRLLDDFLSQFDIDNKKLQRPIILSAHDPVRYLGDVL
                     AYVHSMIVNELEFLKSTFKLKSELVTSDSVLKDNMDFIGDLHLKLLNEIFTSLANTIR
                     IRLEQIVRFENNPMLNLDIVQCLSLYQMMLVKNGINESSQLMTSLNDLENLARSKIVS
                     SVTSYLKDLDKNQIAAADLLPPDWFVDYLSKLSQLLNKLEQQNETRILTDDLYDKLIL
                     DPINNNLVLNLQNWFPTAKKEKSARIDLLIVQINSFDLVKSKLGPFHSTIFSSDYGKS
                     VFSKLETQYTLCVTKLKETMNSYLFESTGMELYFNLFNMIFPIISVQDELDYDMYLSA
                     VENPIMKLAVIHDNIHEKLNTYLPLAVSDFQDVKLFNLMPPAVEEDIVSTCFGNFIKF
                     YKVFKSVLNKIYPEDEEMIMSTLNFTTNEVSTLLGVEDK"
     gene            complement(<378710..>380215)
                     /locus_tag="KLLA0_F04015g"
                     /db_xref="GeneID:2895701"
     mRNA            complement(<378710..>380215)
                     /locus_tag="KLLA0_F04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455262.1"
                     /db_xref="GeneID:2895701"
     CDS             complement(378710..380215)
                     /locus_tag="KLLA0_F04015g"
                     /note="weakly similar to uniprot|P40489 Saccharomyces
                     cerevisiae YIL101C XBP1 Transcriptional repressor that
                     binds to promoter sequences of the cyclin genes CYS3 and
                     SMF2 expression is induced by stress or starvation during
                     mitosis and late in meiosis member of the Swi4p/Mbp1p
                     family potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455262.1"
                     /db_xref="GeneID:2895701"
                     /db_xref="GOA:Q6CLC7"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC7"
                     /translation="MPSVVGNDQYGVYPTDGTTFQLSPDPLDDYQRYLFVEVYELMRP
                     SLAQFPHALKSQLSIDRKEYKTNTVFESFESQSSGDINEEGSHTLGQENNGKYTNERR
                     QNHRNKSGSLGKLKKSTSLICNEYIIPDISRNPVTQRTFDPHFQPYLQLTPYNILSLE
                     DEQEDTDPNQPCFPDDLSSSDRELRTAINLSNKPGSNITKNQEFRMIKLNAKINQTLI
                     INPNNCIIWNCETGYVFFTGIWRLYQDIMKCLCTTNRQYQQDQSARIHCCKELQKVLF
                     QVIYGKLDKPSKKDSQQKWNKWFQRESFSTYIDLHWHKLNPTLSTLLGQSYDAKIPFE
                     RMVKRIRGGYIKIQGTWLPYPVSKELCSRFCYPLRYLLVPLFGPDFPEKCEYWYSQRT
                     EISPSLTASISPKSTNSISTLTSDERDSLNTAQDLLNISRRSSWNEYRHPSIVPQIHL
                     QNRHYRSQSWTGIVQQNPAAEERRKSSDVTLPPIQYLFDDIRNSYLDDPKR"
     gene            complement(<383428..>384081)
                     /locus_tag="KLLA0_F04037g"
                     /db_xref="GeneID:2895702"
     mRNA            complement(<383428..>384081)
                     /locus_tag="KLLA0_F04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455263.1"
                     /db_xref="GeneID:2895702"
     CDS             complement(383428..384081)
                     /locus_tag="KLLA0_F04037g"
                     /note="similar to uniprot|P53615 Saccharomyces cerevisiae
                     YNL036W NCE103 Carbonic anhydrase poorly transcribed under
                     aerobic conditions and at an undetectable level under
                     anaerobic conditions involved in non-classical protein
                     export pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455263.1"
                     /db_xref="GeneID:2895702"
                     /db_xref="GOA:Q6CLC6"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC6"
                     /translation="MSPVASDFVPFTLQSNSNIKDYLKANEKWRSEMQNEHPNLFTLN
                     GQGQDPHTLFIGCSDSRYNENVVGVLPGEVFTFKNIANKVNVEDLTCLATLEFAINVL
                     KVNKIIICGHTDCGGIKTCLKDQRKELPGLQCSHLHQYLQEIDDLIHENKVLLNSPEY
                     QNDLEKQSRLLSILNVKKQYESLLSVDTVQKALENKSIETYGLLYNVDSGKVEMIDL"
     gene            <385832..>387541
                     /locus_tag="KLLA0_F04059g"
                     /db_xref="GeneID:2895703"
     mRNA            <385832..>387541
                     /locus_tag="KLLA0_F04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455264.1"
                     /db_xref="GeneID:2895703"
     CDS             385832..387541
                     /locus_tag="KLLA0_F04059g"
                     /note="similar to uniprot|P08019 Saccharomyces cerevisiae
                     YIL099W SGA1 Intracellular sporulation-specific
                     glucoamylase involved in glycogen degradation induced
                     during starvation of a/a diploids late in sporulation but
                     dispensable for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455264.1"
                     /db_xref="GeneID:2895703"
                     /db_xref="GOA:Q6CLC5"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC5"
                     /translation="MNNPNTMLSKSSRKPRIPKHSHYFLSFVCISSLLAYYFLLSPFQ
                     AGNHNANHSIECPLSRSSPLIEVSDFNRISEFKLQPIPVSKNISRNDFNKWLEEQTEI
                     SFYHMFENICHAETSDKFDNCTPGVVFASPSKNKPDYFYHWIRDGAITINTLINTYLD
                     IDRERTLETVLDYVNASLDLQHKSNPSGPADDPLFRNLGEPKYHVDNSAYELVWGRPQ
                     NDGPPLRAIALLNFLNQVDDGETEKYNWIFDEVIALDLKFVLYNWHIPTYDLWEEVRA
                     YHFFTSMVQLKALVEGKRYLLTSEAKGVKLSKQLTILLKDIETCIDKIEDFIIDANSG
                     FINHEKGYIVETPSILDERSGLDIAVIMASTLTHDDSIKDMNTVYDSFLFDIDDPFIL
                     NHFNELIERMAVLYPINHNRLNTNMGVAIGRYPEDIYDGIDISEGNPWFISTLTSAEL
                     IYKLVNKMYHDEKPLLIDPISNKFWTKFFEFGNMKDSLILIPYNTLAFNQTLYTIFKY
                     GDSFLSKVNEHVSNDGSMSEQFNKYHGYNQGAPNLTWSYGTFSNALRWREIVDRFIHP
                     IAI"
     gene            complement(<387824..>388303)
                     /locus_tag="KLLA0_F04081g"
                     /db_xref="GeneID:2895704"
     mRNA            complement(<387824..>388303)
                     /locus_tag="KLLA0_F04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455265.1"
                     /db_xref="GeneID:2895704"
     CDS             complement(387824..388303)
                     /locus_tag="KLLA0_F04081g"
                     /note="similar to uniprot|P40491 Saccharomyces cerevisiae
                     YIL098C FMC1 Mitochondrial matrix protein required for
                     assembly or stability at high temperature of the F1 sector
                     of mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455265.1"
                     /db_xref="GeneID:2895704"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC4"
                     /translation="MSELTLSTYKSLLRSLVRSAKHNKIQQLQQDTKKQIALLTYNRI
                     QLVRQQQEKGLDAMARSKVLKQLSAVGKKIEILKTKDPLKSKELLFYSHSKHLKDIVL
                     SLKDDPRSLQHLKDIAAFVVNQSEYEQLIERYNPGLKMSQEEKVQKTANKVGLQVPE"
     gene            <389159..>390244
                     /locus_tag="KLLA0_F04103g"
                     /db_xref="GeneID:2894997"
     mRNA            <389159..>390244
                     /locus_tag="KLLA0_F04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455266.1"
                     /db_xref="GeneID:2894997"
     CDS             389159..390244
                     /locus_tag="KLLA0_F04103g"
                     /note="uniprot|O94229 Kluyveromyces lactis KLLA0F04103g
                     IDH1 Isocitrate dehydrogenase subunit 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455266.1"
                     /db_xref="GeneID:2894997"
                     /db_xref="GOA:O94229"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /translation="MLRQGIAAQKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEV
                     TDSVVKIFENENIPIDWETIDISGLENTENVQRAVESLKRNKVGLKGIWHTPADQTGH
                     GSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVIIRENTEGEYSGLEHESVPGVV
                     ESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEIGANEY
                     PELDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFGR
                     EYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVISEG
                     KSTTRDIGGSASTSEFTNAVIEKLAKL"
     gene            <392229..>393728
                     /locus_tag="KLLA0_F04125g"
                     /db_xref="GeneID:2895705"
     mRNA            <392229..>393728
                     /locus_tag="KLLA0_F04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455267.1"
                     /db_xref="GeneID:2895705"
     CDS             392229..393728
                     /locus_tag="KLLA0_F04125g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455267.1"
                     /db_xref="GeneID:2895705"
                     /db_xref="GOA:Q6CLC2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC2"
                     /translation="MTSFENRLQGSDNGSVSDDYDVHKTLLKAPGQKHQDVEDVVEVQ
                     NYGDDTSVSYKDGLTESDEEGHQIKYKTCSWQHTTGLLLSEYIVLAIMSFPWSYSVLG
                     LIPGLILTAFVAITVLYTGLIVLDYCERFPHLKNVCDIGQHLFWGSKAAWYATAVCFI
                     ANNTLIQGLHVLVGAKYLNTVTNHSVCSVGFAAIVAVISFVFSIPRTFSSLSKVAYFS
                     AITMFISVILAMIFAGIQDHPAGYDGTAVTYQLWPKKGTTYVDAMGAFLNIVYTFVGQ
                     ITYPQFISEMKRPREFKKVLWIVTALELIIFSLAGALIYVYVGNEYMTAPAYGSLTKT
                     YKIISFSFAIPTIVFVGSLYSNISSRFVFFNVFRNSEHLYSHTKVGWLAWIGLLLLTW
                     VGAFVIAEVIPFFSDLLSLMCSLFDCWFGYVFWGMAYLKVKQNKYKQSNPYPYLTKIE
                     KVHFIIAGILITIGIYILGPGLYATVQSIIYNFQSDAYGSVFSCASNGI"
     gene            complement(393907..393978)
                     /locus_tag="KLLA0_F04147r"
                     /db_xref="GeneID:2895706"
     tRNA            complement(393907..393978)
                     /locus_tag="KLLA0_F04147r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2895706"
     gene            <395518..>397269
                     /locus_tag="KLLA0_F04169g"
                     /db_xref="GeneID:2895707"
     mRNA            <395518..>397269
                     /locus_tag="KLLA0_F04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455268.1"
                     /db_xref="GeneID:2895707"
     CDS             395518..397269
                     /locus_tag="KLLA0_F04169g"
                     /note="similar to uniprot|P38361 uniprot|P38361
                     Saccharomyces cerevisiae YBR296C PHO89 Na+/Pi
                     cotransporter active in early growth phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455268.1"
                     /db_xref="GeneID:2895707"
                     /db_xref="GOA:Q6CLC1"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC1"
                     /translation="MALQQFDYIFAITMLFAFLDAYNIGANDVANSFASSISSRSLKY
                     WQAMILAALCEFLGAVLAGARVSGTIKNNIISASPFEDDPAVLMLTMACALVGSATWL
                     SIATSIGMPVSSTHSIVGGTIGAGIAAGGAKGVQWGWGGVSQIIASWFIAPILAGCLV
                     TIIFLISKFLVLDVKPIEKAIKNALLLVGFLVFATFSVLTMLIVWKGSPNLKLDKLSG
                     TTTALAIVLTGLVACAVYFIFLYPYYRRRILHRDWTLKWYDIYRGPTFYFKSTDDIPP
                     LPAGQSLTIDYYEGRRFEDETAGDDETQIETSHTADGRDTVEGHIEINDKESVNQSIK
                     LVQTETLQEEKPTTKQLWWSLLKQGPKKWPLLLWLIASHGWTQDVIHSQVYDTGALST
                     DFKDMYKRSAFYDNRIEFIYSILQAITAATMSFAHGANDVANATAPLAAVYDIWQKNT
                     VESKSDVHTWVLAYCAAALVLGCWTYGYRIIKNLGNKMILQSPSRGFSVELGAAVTTV
                     MATQLSIPVSTTQVAVGGIVAVGLCNRDLKSVNWRMVAFCYSGWFLTLPMAGLIAGIL
                     NGIILNAPRYGGDYQLS"
     gene            <397611..>400268
                     /locus_tag="KLLA0_F04191g"
                     /db_xref="GeneID:2895708"
     mRNA            <397611..>400268
                     /locus_tag="KLLA0_F04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455269.1"
                     /db_xref="GeneID:2895708"
     CDS             397611..400268
                     /locus_tag="KLLA0_F04191g"
                     /note="similar to uniprot|P19735 Saccharomyces cerevisiae
                     YBR055C PRP6 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455269.1"
                     /db_xref="GeneID:2895708"
                     /db_xref="GOA:Q6CLC0"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:Q6CLC0"
                     /translation="METPSFLKQSPPPGYIAGIGRGAVGFSTRGSKDDKRVPARLNRY
                     GRDAPDTSVTKNPNRYRSAVSNESSEKQVKDEDEQEMRVYEKIEQRLKNKKIIDNETS
                     LKTKPDDEPDKLSSKFVDLKRNLATLSEQDWLDIPDASDMTRRNKRNRIEEQLERKTF
                     AAPDTLFQVNVNLSKLTEEREKLLAVQIDKSFDYSKSQLTDDAEYLNRMNQDDNTISS
                     TDLEDIRKNRSLLAAYRKSHPRNPENWISSARIEERANQFNRAKSLLAEGCKLCPKSE
                     AIWLESIRMNASDKEYCKRLVTVALRLNEFSEQLWLKAIALEQHNTDKIKVTRKALIK
                     LPLSSILWEVAVNLETSTLEKLKILKKAVELVPKDSQLWLKLIRLQSVESAVDTLKSA
                     EEHIKKDITYWLLKCQLEEKRTTANLDTLVNIISSAIKDLHELEVNPTITEWFENAVA
                     ISTEGLYPLTAKAIITATINNLFEDASSNFQSLSKLLVNDTTLQCTLFSSFLIKYPTK
                     YSIWKEFTNFAEDFSRKLELHETFRKILFTDSQAVKKYPVLVLMYAKDVWDWGSGSTE
                     ALSILDKALVTNSAYPEFWLAKLKILNRDGKLDEIINSFEEAESHLVECIDKLVPFYV
                     KCLQSKGSLEIAHSTVDIALAREPNDKHLLILKAQLYRQQRDLSSAKRVLQRATDISN
                     HDPEVCLEFSRLVMETQDWGKARSILSVSLLKNPKSDTLYEALITLELQVKDNKQVTY
                     LIAQGLKACPHSWRLWCLNIRTLPKKSLRKTTFQDALEATKEHPMVITEIGKVFQKEH
                     QYAKAYKWFIRASENNLQFGDPWVWLYICESCMNPVDLQINEEKTLKKLKENEPRYGI
                     LWEPAVNSYLHISNSPIDILHSIINNLHQ"
     gene            <400673..>402979
                     /locus_tag="KLLA0_F04213g"
                     /db_xref="GeneID:2894968"
     mRNA            <400673..>402979
                     /locus_tag="KLLA0_F04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455270.1"
                     /db_xref="GeneID:2894968"
     CDS             400673..402979
                     /locus_tag="KLLA0_F04213g"
                     /note="similar to uniprot|P40971 Saccharomyces cerevisiae
                     YDR034C LYS14 Transcriptional activator involved in
                     regulation of genes of the lysine biosynthesis pathway
                     requires 2-aminoadipate semialdehyde as co-inducer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455270.1"
                     /db_xref="GeneID:2894968"
                     /db_xref="GOA:Q6CLB9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB9"
                     /translation="MSFGKGRNESLDCLTPASYVSQGAAPEAPAPTQSVRASQPPLFP
                     ASSRHILSPSTLLAHPSPHSVPSTATLLGLSSEHVITSPQSVQLKNTPTSIGPSPRDV
                     LVTNLSPISDILQGDRSSMSPASGISSVDASGATPSTDADGKIVKRKYSRNGCLECKK
                     RRMKCDEGKPTCWQCARLNRKCVYILNPKNKKRKPRKPKSAGACATCTEDGDEKGKVK
                     NDATMKSETNFSLNSHVNDSLVNSGLPNLIPAGSINAMDANLLIQNLNDIVSMKLNDS
                     LVSDELKDLEFNDLDLPDLNFPMLNTASEFSSVPISFLVDNTITFNTSLESFKLGGLH
                     DKYLRTFYHDCLDSITPFFQDQNNPLRDILLSFGRNEPYLLSAILAVGASIVHRKSNK
                     MEDEKAYCGYLSHCLQLLGDQFKNETNVINKLEPIILTVILLTWDCIYTMNSQWRSHL
                     KGITELFKKINSGNSSKVLNVAKCWFKVMETFASISTVLGGALVEETDLDAIFDPYDF
                     QYVESLKSLNITTSLNEFNLLRGHNEEFDLVIKEVFKSLNLIRSLEKTSMDGNKGGMI
                     NKNIDYLLFFDSHSEAYMNKLSYFKIQKIIVEIDKQLEYQFIDKSGVIPADNQSHPSN
                     SKILDHAIDLVTLKNGDVIAISWYDISHQTQVLSFLLIVLLKLLGIPKESIAVQQVVK
                     RIMSLFRFLDSDQPPVNLRTCYSNFAVLIAGLNAIEEETKYLVRKYYEVNGSRFRRLT
                     EHNLNRLEKVWSGNAGKFNLEDQDVLTW"
     gene            complement(<403194..>404537)
                     /locus_tag="KLLA0_F04235g"
                     /db_xref="GeneID:2894969"
     mRNA            complement(<403194..>404537)
                     /locus_tag="KLLA0_F04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455271.1"
                     /db_xref="GeneID:2894969"
     CDS             complement(403194..404537)
                     /locus_tag="KLLA0_F04235g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455271.1"
                     /db_xref="GeneID:2894969"
                     /db_xref="GOA:Q6CLB8"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB8"
                     /translation="MIANNIAYITALFSYLLIAHSHFVPATNQKSSSFQIENDAPVDV
                     ELLQQDSLMYQLYGDLLQSRNGEESEVAAARPLIKVHPEETDEEFRGMCSFYNDHENE
                     YPEDDFEDDLLQFTGIVSFAHTPIAQCFRNTSLEMDIAIVGAPFDTSVSYRPGARFGP
                     NGIRQGSRRLGNGISPVRGFPGSKLRKLDPYHSGYKIVDCGDIPMTPFDNKLALNQLY
                     RGQRALHNHSSLVHKEQPPKLITLGGDHTITLMALRSAYEHYGKVSVIHFDSHLDTWD
                     PKVLGGNISKRAGLNHGTFLHFAHENGYLQDDKNIHVGIRAPYIAPGFYDEDHDYECG
                     FEKIVARDLDIISLKEVVSAIKKRVGDGPVYISVDIDVVDLASAPGTGTPETGGLTSR
                     ELLTILDGLEGLNIIGADIVEVLPAFDTNGDITTIIAAQVVDSILGLMTVDSVEN"
     gene            complement(<404952..>406457)
                     /locus_tag="KLLA0_F04257g"
                     /db_xref="GeneID:2894970"
     mRNA            complement(<404952..>406457)
                     /locus_tag="KLLA0_F04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455272.1"
                     /db_xref="GeneID:2894970"
     CDS             complement(404952..406457)
                     /locus_tag="KLLA0_F04257g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455272.1"
                     /db_xref="GeneID:2894970"
                     /db_xref="GOA:Q6CLB7"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB7"
                     /translation="MIEMSSFGSKPEGSESGKTFYNYEVDKTMIKTPSVKNHDVEDGE
                     FEQYGDDTSLSYRDAFEESDEEGHQIKYKTSSWQHITGLMLSEYIILAMMSFPWSYSV
                     LGLIPGLILTVFVAGVVLYTSFIILDYCEKFPHLKNACDIGQHLFWGSNFAWYATAVC
                     YVANNTLIQGVHVLVGGKYLNTITNHSTCTVAFGVITAIISFVFSIPRTFASMSKVAY
                     FSAITMFISVILAIIFVGIQDHPVGYDGTHLTFSLWPQKGTSYVDAMGAFLNIVYVFA
                     AQVTYPQFISEMKRPRDFKKVFLLVTAIEVVIYSITGAVMYYYIGNEYMTTPAYGSLT
                     RKYKIIAYSFAVPTIIFVGSLYSNITTRFIFFKVFKNSEHMHSHTTIGWLSWIGIIVL
                     TWIVAFIVAEVIPFFSDLLSLMCSLFACWFGFVFWGMAYLRVKQTKYEKTNPYPCLDK
                     GEKIRFYIAGFLILFGVYVLGPGLYATVQSIIYNFQANAYGTVFSCADNSI"
     gene            <407511..>408962
                     /locus_tag="KLLA0_F04279g"
                     /db_xref="GeneID:2894971"
     mRNA            <407511..>408962
                     /locus_tag="KLLA0_F04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455273.1"
                     /db_xref="GeneID:2894971"
     CDS             407511..408962
                     /locus_tag="KLLA0_F04279g"
                     /note="some similarities with uniprot|Q05497 Saccharomyces
                     cerevisiae YDR338C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455273.1"
                     /db_xref="GeneID:2894971"
                     /db_xref="GOA:Q6CLB6"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB6"
                     /translation="MVPGEDSSLIAHRGGDSGYNTVESLKKDGETSLEYEFWYMTKTS
                     IPLIITFLLQCSLSSSALVFAGRVGTLEVGGISIGNVTFAVTSAIFIGIATCLDTVCP
                     QAYGAGKYNMVGLYFQRGVAISFLFAVPVIAFWYNSEYVLSFLVEDADVVHIAAVYLR
                     IMILSLPGYIIFECGKKYLQAQGDFVTGQNILFVCAPLNILLNYLFVLKYKFGYIGSP
                     ISMVLSYTLMGLTIVAYICRQIYFGNSSCWHPITGNFSAIFKNWGPLIALALPGLIMI
                     EAEFFAFEIITVLSAKFGTEVLAAQSIVATLQTFFFQLPFSCSVAASNRIAYHIGSGI
                     TENCKTATKATMFGVGPAAGIINFTVLYFGRYKLCSLFNADPVLVNKAAGLLCVVALN
                     QIYDCFNVMAAGVLRAQGRQRIGGYLNIMAYYLVGLEVGILLAFKFKMEVLGFWIGIG
                     VGVLFLAIGENYFVYISNWRNIISKSQDLRHEA"
     gene            <409431..>410447
                     /locus_tag="KLLA0_F04301g"
                     /db_xref="GeneID:2894972"
     mRNA            <409431..>410447
                     /locus_tag="KLLA0_F04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455274.1"
                     /db_xref="GeneID:2894972"
     CDS             409431..410447
                     /locus_tag="KLLA0_F04301g"
                     /note="similar to uniprot|P38235 Saccharomyces cerevisiae
                     YBR053C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455274.1"
                     /db_xref="GeneID:2894972"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB5"
                     /translation="MTEVTETVHKNGPYYFDSKIRLSEGISYAAESKALFWIDIYNAY
                     IHRVTDIDDISTHTVWHASVDNYEGLYPFTTDLPERIGAIFPIDRADGVEEVYFGAKY
                     GIARMNYTTLRWQYLVHYSDSGLQKDWTGLRSNDGNVSPDGEIFIGIMNDFHCTVDSE
                     DPKGALLKVNLRENICELVIDKLMIPNAINWSQDGTTVYFTDSLNFSIYKYPYQDKNL
                     IVEDKALFIDIKKFNSQFDSPEPDGSFIDPDTHNIITAVWSTSTVQRYDTKGDLIHKW
                     TFPETNRISACTLAQGHMFVTTANEIIEDNASPEGLGGSIFKVENVSTYMGSSKRNPI
                     TAEH"
     gene            <411143..>411739
                     /locus_tag="KLLA0_F04323g"
                     /db_xref="GeneID:2894973"
     mRNA            <411143..>411739
                     /locus_tag="KLLA0_F04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455275.1"
                     /db_xref="GeneID:2894973"
     CDS             411143..411739
                     /locus_tag="KLLA0_F04323g"
                     /note="highly similar to uniprot|Q12335 Saccharomyces
                     cerevisiae YDR032C PST2 Protein of unknown function with
                     similarity to members of a family of flavodoxin-like
                     proteins; induced by oxidative stress in a Yap1p dependent
                     manner; GFP-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455275.1"
                     /db_xref="GeneID:2894973"
                     /db_xref="GOA:Q6CLB4"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB4"
                     /translation="MAKVAIIIYSMYGHVAKTAEYEKKGIEAAGGSADIYQVPETLSE
                     EVLKLMHAPAKPDYPIASKDTLTEYDAYLFGVPTRFGNFPAQWKAFWDTTGGLWASGA
                     LHGKVAGFFVSTGTGGGNEMTIVNALSTLAHHGIIYVPLGYKNVFGELTNLDEAHGGS
                     PWGAGTIAGADGSRTPSDLELKVHEIQGKTFYETIQKF"
     gene            <413160..>415718
                     /locus_tag="KLLA0_F04345g"
                     /db_xref="GeneID:2894974"
     mRNA            <413160..>415718
                     /locus_tag="KLLA0_F04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455276.1"
                     /db_xref="GeneID:2894974"
     CDS             413160..415718
                     /locus_tag="KLLA0_F04345g"
                     /note="weakly similar to uniprot|Q00816 Saccharomyces
                     cerevisiae YDR028C REG1 Regulatory subunit of type 1
                     protein phosphatase Glc7p involved in negative regulation
                     of glucose-repressible genes involved in RNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455276.1"
                     /db_xref="GeneID:2894974"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB3"
                     /translation="MQNNLAAYFAQGNASQGNATPGRVALNRSSSNDEYGTSSVNKQV
                     PNYDDMGPSVSMAVHADDDDHFKNSTFNLKRTRSMGLLDPYIDDTQKLLAGSSSVDSD
                     NFSNSNIDGLSNDLNSGDSSGSMNNINNNNNNNNNNNNNNNNDNENKTDNINKNSNNT
                     SYNDDNDGNDTTLNDTGLNKHNTTVGGTDEDYTDENMQVDNYDDDYEADYDYDYDYKD
                     VEDSNSPPDPGTDDFLIHHDDNDLMYEPNRHVDYLSHKWNENEISQSWRYIILKKKRK
                     DTDLINAARLENASWRTWSKARNNLKTVNPESLNWSKDSDVTWLYGPIVVGDQNNSTS
                     SSKPTSNVEIGNNHAATMGYGSDDENSKRLIQKSQSPGPKPILKKRTVSEIIEENSKW
                     RLDIARQHRKQTSDLHAILDPQSSQTTHDDYDAIAAKVNAQYYKNIHTPPDESVESIS
                     PVVTETNSSIVNTTPGPISGSVIETPSARSDPPILSSILTSSMKQKQKRERHIHFNDR
                     VEQCIAVNHNPIDANPNDDEVPMTNTDYHSDDMSDGARSSHQYSDFDDGYRNSGANSV
                     EDYADDEDDEDADSYDYDEDDDEDDEDDGLFISAHTRKNRTNSGASDGTDVANSLRSL
                     SLSKFPNATIKPLPATTLNYGSDDEYYDEDENEWYYGNAVSHNVNTSRGFDYMYDYNS
                     VYTGDTSNFVTVDNSCDILDVPDGIGLDTPIQDANDGYMDDDSRGKIYTYHQSLPVQD
                     DNDEHPDNEFIADSSQPGFSHDDEEHDDNGEELELTAKDPLSLRRTSSIGKSRANSIH
                     DFITPSNSASPVLKQTHSFITGEPLSQHNSTVRRPPLKSPSSGSFLFGSDSDSE"
     gene            <416114..>418654
                     /locus_tag="KLLA0_F04367g"
                     /db_xref="GeneID:2894975"
     mRNA            <416114..>418654
                     /locus_tag="KLLA0_F04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455277.1"
                     /db_xref="GeneID:2894975"
     CDS             416114..418654
                     /locus_tag="KLLA0_F04367g"
                     /note="similar to uniprot|Q12071 Saccharomyces cerevisiae
                     YDR027C VPS54 Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455277.1"
                     /db_xref="GeneID:2894975"
                     /db_xref="GOA:Q6CLB2"
                     /db_xref="InterPro:IPR012501"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB2"
                     /translation="MPDRLLGSETPALSLTPDSRTQLSRSPLLVPSHASDDASSLNDD
                     LSVLSRNRDQIRDSMSMRRSSFDSTFNSFSTTMHTQKHGLDYSPLVDNSIYEIVMNTR
                     FKRWLRHPTTEDIPPVVLSKNDIKDKWDKDINQYRDDIKDEYRVYQSTNNISKLNRME
                     QMRSIDHDKTALGLQNTKAKAFEEIPEFYFDKEFKLDHPNFFRMLLRDFEFDANQLLN
                     DDDKVRNDSYEELQGRLAFYLDTVEGLLVSEISKSIQSFFDALEDVDKIRENATETIN
                     ELDSAAEALERINGDKISKRIEMIKDLIRRKNVEKLQQGILQVKLAKEKCEECKEIYQ
                     EEKLQECLKLVKAVENLINGDNDDPTVNDWTSQWPYKLTNISSFSSLQGIIDMLNNLK
                     VDIGGSYSLSLVTVLLEDLRTYSKSQSKNDTIIKLQSRKDKNKPHLKIDETFRKQIKE
                     NLIQLIDCDQLVPAVKLYEDKFIAELKSVIKVNLPHERQTPEESKDGSKPTAANGSRL
                     SKLIQEQSSQEFQSMLVNIFTSEIELLKRLTRHQKMLLDISLSELPTTAEQSDKMIID
                     LDIRKSVNEGIRIVQLRMGKIISVRRDITCTLRFDHFLQFYEICMLFMRECESISGEF
                     LTKYLSDVLNLQIDTYLKSLQNLNIRVLKQKIDVERWTPFIVEPELQKDVNDIVSCID
                     IDPSNWTRFIELNKPSPLDETKDEKQSSTGHKKSVVLGDKTFVASEALILAIKMIKTL
                     LVLASNFPSQYARHCERQLSDVLKFFNTKAIESISSSLTDRLSTKTDKNLNIMAESLD
                     CLAEITLLLQGYFQRTLGSKTDKYENIWKQLQQSSEKLFQTNNIPPPV"
     gene            <419265..>421052
                     /locus_tag="KLLA0_F04389g"
                     /db_xref="GeneID:2895000"
     mRNA            <419265..>421052
                     /locus_tag="KLLA0_F04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455278.1"
                     /db_xref="GeneID:2895000"
     CDS             419265..421052
                     /locus_tag="KLLA0_F04389g"
                     /note="uniprot|Q05950 Kluyveromyces lactis KLLA0F04389g
                     REB1 DNA-binding protein REB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455278.1"
                     /db_xref="GeneID:2895000"
                     /db_xref="GOA:Q05950"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /translation="MSQNDTNHESVEEAVFKYVGVGLEKSGEDDAVNKQKSVDWFLKE
                     QDQDQDQDQDPGRDQDQEDNAKHRDANDVSAVAAAAVAAALSVKKRGRPSEQSSTGSS
                     GKGSGSSGQNNKKSKKNKNKLHLAAVDPELASLDDNLVDGNDSEEQSHHQLVHKAIMD
                     TDNIASQHPDFQQYLNTEDDQEPKKEKSEERSYGDLSNIDDHVDDVSVSGSIPSQVRL
                     KKTAEVLPKVLSSESHNDDQQDDVSNLIQEAAAKASHIINPATQSNGKSFDESEEEAL
                     EQFIKEYQKIRGLSRRQICERIWSNERRKDDFWTNICRVLPYRTRSSIYKHVRRKYHI
                     FEQRGKWTPEEDAELARWCAEKEGQWSNIGKVLGRMPEDCRDRWRNYVKCGPNRAANK
                     WSVEEEEKLKNVIHQMLDNASTAYEDGEDDEMKDSSTKIEDSGDADMLDVQDSDKKPS
                     ISNSKKKPAAKDIINWTVVSEQMGGSRSRIQCRYKWNKLLKKEALNKIKNISDDDKFW
                     LLTKLRDMGFTEDSQVDWEELSTLMPGRRWTGTELKLLYEKVRTTVRQYKRKTINVIC
                     KELVGYPEASLPLDDEIRQHHSGDDEDKD"
     gene            complement(<421860..>422927)
                     /locus_tag="KLLA0_F04411g"
                     /db_xref="GeneID:2895304"
     mRNA            complement(<421860..>422927)
                     /locus_tag="KLLA0_F04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455279.1"
                     /db_xref="GeneID:2895304"
     CDS             complement(421860..422927)
                     /locus_tag="KLLA0_F04411g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455279.1"
                     /db_xref="GeneID:2895304"
                     /db_xref="UniProtKB/TrEMBL:Q6CLB0"
                     /translation="MSSRIDANEYDTEDEESILQQNVDDSLYAEVMKSLGINYGSNGE
                     KPKPIDRELLLQLVELKKKEIGTDLERLKAENLNKLDMILTKITALNLPSEVILALVE
                     SSPGQLESNLERIGVVPLVPANGQLTSPKQLRNWPQVTPPQTQAQPPLQAVQSQIPPL
                     IQQSQFSPQSLPQAPPQGPPQFVPTYHSRTLSQPVELMTSLQKPNQQPLLQQQQQQQR
                     QQLPPPMLPPGGQQQFCPLPSLSGSQMKYNFPPPPMPPDASPNASLSNNRTGLYYPQR
                     YQRPISYGSQNIPPAIYEQVPPLPNYRMGHKRAHSAMTVPEMSTFTIRRNEPNEMLEI
                     DGSKKPGKVSFLINTPKNPPK"
     gene            complement(<424427..>425668)
                     /locus_tag="KLLA0_F04433g"
                     /db_xref="GeneID:2894976"
     mRNA            complement(<424427..>425668)
                     /locus_tag="KLLA0_F04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455280.1"
                     /db_xref="GeneID:2894976"
     CDS             complement(424427..425668)
                     /locus_tag="KLLA0_F04433g"
                     /note="some similarities with uniprot|P40472 Saccharomyces
                     cerevisiae YIL123W SIM1 (putative) involved in control of
                     DNA replication"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455280.1"
                     /db_xref="GeneID:2894976"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA9"
                     /translation="MRFTTALASASFISAAMVSALPHAHAKRDEDCSTTVHAHHKHKR
                     AVAVEYVYQTVTVNGQGETIAPATVTSTEEAATTSSTEDQQTTTLEPSTSSSEEESSS
                     SSSSSSSQSSTESSTEASESSTSSQSSSSSSSGSTSTSTSSSGDLSWFSSPTEEFEDG
                     VMSCDEFPSGQGVVYLDWLGFGGWSGIENSDGSTGGTCKEGSYCSYACQPGMSKTQYP
                     SDQPSNGVSIGGLLCKNGKLYRSNTDEKYLCTWGIDSAYVVNELSDVVSICRTDYPGT
                     ENMVIPTIVNGGSKLPLTVVDQDTYYTWQGMKTSAQYYVNNAGVSKEDGCVWGTSGSG
                     IGNWAPLNFGAGATGGISYLSLIPNPNNREAANFNVKIVAADGGSVIGECVYENGSYN
                     GGSDGCTVSVTSGAANFVLYD"
     gene            complement(<428010..>428927)
                     /locus_tag="KLLA0_F04455g"
                     /db_xref="GeneID:2894977"
     mRNA            complement(<428010..>428927)
                     /locus_tag="KLLA0_F04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455281.1"
                     /db_xref="GeneID:2894977"
     CDS             complement(428010..428927)
                     /locus_tag="KLLA0_F04455g"
                     /note="similar to uniprot|P40471 Saccharomyces cerevisiae
                     YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
                     phosphate reductase found in lipid particles and ER
                     involved in phosphatidic acid biosynthesis and required
                     for spore germination capable of metabolizing mammalian
                     steroid hormones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455281.1"
                     /db_xref="GeneID:2894977"
                     /db_xref="GOA:Q6CLA8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA8"
                     /translation="MSETKYALVTGASSGIGYEVTKELLRRGWYVYACARRTHPMEEL
                     RAEFGDRCIPRKLDVSNQNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEE
                     IIDNTFRVNVYGPINSCREFAPLIINAKGTIVFTGSLAGICPFPFGAVYSASKAAIHQ
                     YARVLHGELGPLGVRVINMITGGVATDIADKKTLPEGSIFNFPEGIKAVETRKKMSEK
                     NQPMSPADYARETVNDIENGSIDPVDIYRGTMATVVKWLMLLIPYALLEWGLRKKFKL
                     YPAYSVLNKRQLQSQRQRQRLLENTIKHD"
     gene            complement(<429732..>432785)
                     /locus_tag="KLLA0_F04477g"
                     /db_xref="GeneID:2894978"
     mRNA            complement(<429732..>432785)
                     /locus_tag="KLLA0_F04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455282.1"
                     /db_xref="GeneID:2894978"
     CDS             complement(429732..432785)
                     /locus_tag="KLLA0_F04477g"
                     /note="highly similar to uniprot|P20967 Saccharomyces
                     cerevisiae YIL125W KGD1 Component of the mitochondrial
                     alpha-ketoglutarate dehydrogenase complex which catalyzes
                     a key step in the tricarboxylic acid (TCA) cycle the
                     oxidative decarboxylation of alpha-ketoglutarate to form
                     succinyl-CoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455282.1"
                     /db_xref="GeneID:2894978"
                     /db_xref="GOA:Q6CLA7"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA7"
                     /translation="MLRTIRSSQRLLHASKFTRIGAVSKPTSLAVFSRGLASGASSTD
                     NFLSTTNASYIDEMYEAWQKDPTSVHVSWDAYFKNMGNLNIPASSAFTAPPTLIPIPT
                     GPGVPQDILIGGSLSGVDQDITTHLKVQLLCRAYQVRGHQKAHIDPLQISFGDDKSKP
                     LPRELTLEHYGFTEKDLDRDITLGPGILPRFSRDGRKTMKLREIIAALEKLYCSGYGI
                     EYIHIPSKEQCEWLRERIEIPQPYNYTVDQKRQILDRLTWATSFETFLSTKFPNDKRF
                     GLEGLEGVVPGIKTLIDRSVELGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFKGS
                     VAPEEYEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLEAADPVVLGRTRAIQFS
                     KNDIGKYDKAISVLLHGDAAFAAQGIVYETMGFLHLPAYSTGGTIHVITNNQIGFTTD
                     PRFARSTLYPSDLGKTIDAPIFHVNANDVEALTFIFNLAAEWRATFHTDAIIDVVGWR
                     KHGHNETDQPSFTQPLMYQKISKQKSVIDVYTEKLVSEGSFTKQDIDEHKKWVWGLFE
                     EAYEKAKDYKPTSREWLTAAWEGFKSPKALATEILSHEPTVVDADTLKNIGKTISSWP
                     ENFEVHKNLKRILTNRGKAVESGEGIDWSTGEALAFGSLVLEGNHVRVSGEDVERGTF
                     SQRHAVLHDQKSENTYTPLKHLSEKQANFTICNSSLSEYGCMGFEYGYSLTNPDYFVV
                     WEAQFGDFANTAQVIIDQFIAAGEVKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQ
                     LGNEDPRYFPSEEKLQRQHQDCNFQIVYPTTPANLFHILRRQQHRQFRKPLALFFSKQ
                     LLRHPLARSNLNEFTEGGFQWIIEDVELGKSIAPKEEIKRVVLLSGQVYTALHKKRET
                     IQDKNTAFIKIEQLHPFPYAQLRDALNTYPNLEDIVWCQEEPLNMGGWAYAQPRLQTT
                     LKETDKYKDAIIRYAGRNPSGSVAAGSKALHNAEEEAFLKEVFGQ"
     gene            complement(<434569..>435144)
                     /locus_tag="KLLA0_F04499g"
                     /db_xref="GeneID:2894979"
     mRNA            complement(<434569..>435144)
                     /locus_tag="KLLA0_F04499g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_455283.1"
                     /db_xref="GeneID:2894979"
     CDS             complement(434569..435144)
                     /locus_tag="KLLA0_F04499g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_455283.1"
                     /db_xref="GeneID:2894979"
                     /db_xref="GOA:Q6CLA6"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA6"
                     /translation="MKYIQTDQVLDVPEGVTVQIRSRIIKVTGPRGVLTKNLKHIDVT
                     FTKVSNRQIKITVHNGDRKHVAALRTVKSLISNLITGVTKGYKYKLRYVYAHFPINVN
                     VIEKDGAKFIEIRNFLGDKKVREVPVREGVSVDFSTNQKDEIVLSGNSVENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSEKGLIEEEE"
     gene            complement(<435649..>439683)
                     /locus_tag="KLLA0_F04521g"
                     /db_xref="GeneID:2894980"
     mRNA            complement(<435649..>439683)
                     /locus_tag="KLLA0_F04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455284.1"
                     /db_xref="GeneID:2894980"
     CDS             complement(435649..439683)
                     /locus_tag="KLLA0_F04521g"
                     /note="similar to uniprot|P32597 Saccharomyces cerevisiae
                     YIL126W STH1 helicase related protein snf2 homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455284.1"
                     /db_xref="GeneID:2894980"
                     /db_xref="GOA:Q6CLA5"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA5"
                     /translation="MDQVVVTNNADTAPPYPLPIVNSENVDNGNSETENQDVNGNIED
                     NHVGADKGSNNNFRNDSGSAIGQNQIAAVLEEMKKVERVILPLPETKEQLENLIYRYR
                     YISQYRDHNKLEVEAIEQIFTQISDKQEEYKERLLRLRENAAKDIQWDEKLLKEQMVS
                     LQLLSKDINIPDGLLEDDDDESVSSDSSDISVQLEKVKLSVDFDETSVRLGLPEALSN
                     FRLKSGNEASLGDWEVEKIISTLIAKRIKQLENLPSNLGTYSLNDALDFVTKDDIPTG
                     ADDFKLRALVELKSLKMLTKQKSLRKRLIESVAAKSHNIIPSLRDSPYTLAAQRSIHV
                     RPKTIVPQTARLAEELERQELVESRRRERNLRLQRINNIVSSINERLENDTTQRDRCY
                     QMGRSIGNLHGHLEKDEQRRMERTAKQRLAALKSNDEEAYLKLLDQTKDTRITHLLKQ
                     TNSFLDSLAQAVRVQQNEVRIKRGEEIPPITDEEREKIDYYEVSHRIKETVDKQPSIL
                     VGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEIKNERQPFL
                     VIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIKMGNFDVVLTTYEYIIK
                     DRPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWA
                     LLNFVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRR
                     LKKEVEKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGATKAGIKGLNNK
                     VMQLRKICNHPFVFDEVENVINPTRENSSILYRVSGKFELLDRVLPKFKASGHRVLMF
                     FQMTQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGG
                     LGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERA
                     MQKLDIDGKVIQAGKFDNKSTAEEQEEFLRRLLEGDTNKDDEYSGELDDEELNEILAR
                     TEDEKVLFKKIDEERVANEKREAIDLGLRKPLPRLITKEELPSVFTEDITDHLNVEPA
                     AIGRIRERKRVYYDDGLTEEQWLQAVDNDEDLDETIERQRAAREKRQRKQLGLESLEN
                     SVEPEESSSTSNTVISAEQAVTPARENGRTRSRRKVVATPSTTPEEESELGEEKEAKP
                     VKQDAGPLKKKIKLKLNMKKDDAPTKRKEEPPLKDKVEALLALLRELTDPTDEHSRTF
                     IFERLPSRKEYPDYYKVIEKPVALETITKKLNKKQYQSINEVKSDLETMFNNAKLYNE
                     EGSWVFNDAEALEEFAIDWFSKNE"
     gene            <440338..>440943
                     /locus_tag="KLLA0_F04543g"
                     /db_xref="GeneID:2894981"
     mRNA            <440338..>440943
                     /locus_tag="KLLA0_F04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455285.1"
                     /db_xref="GeneID:2894981"
     CDS             440338..440943
                     /locus_tag="KLLA0_F04543g"
                     /note="similar to uniprot|P40470 Saccharomyces cerevisiae
                     YIL127C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455285.1"
                     /db_xref="GeneID:2894981"
                     /db_xref="GOA:Q6CLA4"
                     /translation="MSSLAAAHATNAVNALLQSVLPGSASVNAERKKTSRDKGSKAQL
                     IDRNLKKRVEVQEKDVYRIKKREKKMLRKKISGRKEVQEDIEQKAKLQVLRKHQVDNS
                     LTDHEKSYLDKVVKKNVRNLKSWDYDDKEELLDLQKQILANSEDSKKVRKVKSRRQKK
                     KQFKEKLPQSIQDHRYKALTPGLAPVGASDEEESEDEDEDY"
     gene            complement(<441106..>444195)
                     /locus_tag="KLLA0_F04565g"
                     /db_xref="GeneID:2895894"
     mRNA            complement(<441106..>444195)
                     /locus_tag="KLLA0_F04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455286.1"
                     /db_xref="GeneID:2895894"
     CDS             complement(441106..444195)
                     /locus_tag="KLLA0_F04565g"
                     /note="similar to uniprot|P40469 Saccharomyces cerevisiae
                     YIL128W MET18 DNA repair and TFIIH regulator required for
                     both nucleotide excision repair (NER) and RNA polymerase
                     II (RNAP II) transcription possible role in assembly of a
                     multiprotein complex(es) required for NER and RNAP II
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455286.1"
                     /db_xref="GeneID:2895894"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA3"
                     /translation="MATDYTEDKLKADIVSFMANAKVNTSVADKLANTIADEVTRKSI
                     ELLRIVIFLREYLTSDDDSTRQNALSCLSCILEHISPAVLKKNDVSVIFDFYQSKMED
                     SGCMKETLQGINSLVLMDCFYVSHVEKLLKLLGNDYQPTNFLAATRYFGFRIMDNILI
                     KFKSQMLGNLKLNDLYIETFILVATGEKDPRNLLISFRLNSDISTGLRNIDSFKEELF
                     DILFCYFPIMFKPPSNDPYKITNNDLKLALRSAITATEKFEEDAFGNLLDKLAASSPT
                     VKNDTILTLKACVDTFSGTSSLKHWLPIWDALKFEILNGTDPEPSILDTAMDTENQNS
                     RPEGNISNYSDSLSIITSLSSKLIALDEHAFDKFFNHIFDEFVPNFEQDKDLKQCCDL
                     LASISKVSLQTFNKVMKKVIPVLFMDKDLDASKQKLLILNLAPFFSAYISLFGETGKE
                     ISKFHAKNELQNHKDSILMVFSKALTGTSKNEVTLRTLAIIQFTTLVKMSGFLDSEEI
                     AMIVQYFTETILTDENKNIYCACLEGLKFISVFNESIIYEVSLKYMLHLLPDNENMVP
                     ITLNNTDIVPIERVLKVILDFTTSRHHLVKESIVGLASKLNLIVMHPNCSDYCFLILS
                     CLFSLLQNNIDEFDQNVVQFLKESMEETFLQNSLKNDMIYLDDHSLSLAAGVLFQLNI
                     KSDVSTHQSELITYNKCFLDEERIFDSAQRSIVIYSRLLAALDKNTSFEAANDIFSKA
                     IELIKNNEALPTFESLNYLEFLALLSNKWVTESYIESVLDLTDTSIKNLEIICWINKG
                     LVMKNSVLATKLTDHLFSLLSDEKFGNKVAHLFEVLVLDLLIFQRFKKVSWNNNIRLI
                     YKQKFFNHIAQKMVNAFKSSDNMTIKSNYLTAVSLVLKNTPSNITISYITDLLPLLLQ
                     ALELENIEVRISSLETLKNTVNQMSQLVTEHVHSLVPLLLNLLVPSKYSNVNVRFLSL
                     EILQTLTTSVPLNYLIPMKNEIISKLQIGLDDSKRRVRKQCIDTKQAYLELGQVPFE"
     gene            <444673..>451449
                     /locus_tag="KLLA0_F04587g"
                     /db_xref="GeneID:2895895"
     mRNA            <444673..>451449
                     /locus_tag="KLLA0_F04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455287.1"
                     /db_xref="GeneID:2895895"
     CDS             444673..451449
                     /locus_tag="KLLA0_F04587g"
                     /note="similar to uniprot|P40468 Saccharomyces cerevisiae
                     YIL129C TAO3 Identified in a hunt for mutants that
                     activate OCH1 transcription Transcriptional Activator of
                     OCH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455287.1"
                     /db_xref="GeneID:2895895"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA2"
                     /translation="MNSGFMFPPVGKENRAHGTLLSDDMGNDFKFPSENVNQVEVEKQ
                     QQYPSTQIDQGAVQHSNTDYPQQTLNIIDIPPVDPNGVTPEQFHINALQLNKPGDNLS
                     NKITNNINYSINEVSQQPRPDPASANSTSSFPDEYVAGLRQKSATDWKSPSEYALHIL
                     FTKFVRFAEMKLNICLQYPRETEPPIIEILGEGKDIEFDKIIESLGFISKKNAKPVID
                     AMMFWRKTKSEVAALAAEKLDKIMQEYEQYVKNNEQVLAASRTHSKSSSSASSRLTHR
                     RNTSSKSSTSLNSHSDPKFASLENQVERTKEMAFQADRKSLITIYILCRVLIEIVKQN
                     PMDFDDELSTKLEGIVFTQLKTTDPSSLSSTLIKSANWNSFAELLGWMSEKKFISVSD
                     KFIADLEKIPPKVPRDQEPSVHLLILGMRYLRLKNYPLEMFEESAGFIKSISKFFAPS
                     QNTSIRLAYAEVLSQLLLPLAGAMTAEANHPTWIEAMTSILATCKKLQTDSKCWTLAF
                     KLTVAVLCVSDTELFSKNWLSLIEKNVTKIKSKSLEDRVAFSMGLSRLIWVYLFRCTE
                     TLNNTDKTLTKLFSLFLSSKKKENWITTDMDIINPLCDVFVTVGYVHPTFVFENVLLH
                     LMKSSFNGTNLENIAHEKLILVINTYRGLLMTKERPIFPDGERRFYEVDLNKISVHSS
                     DKNWANHEELVKYLYKLFMLLDSNIGSEVWSPENEHRRQPSTPFSNITNFGFGINNDN
                     SANYARSLNMALFATLIEVLPCCLSVSQSIPFKSTIEILSRNAVHADQLIATSAQNAL
                     KVLAAKKNPYTLITWFAKYSFDFDEKTQSRYSLYYLSSAEYRTLLALYVELLECWLED
                     FTKNDIQQSESDAALNGMKLPPKTLEANYHELEKIEWKNTQTVVEDVEGNGLFFLCSA
                     DASIRRLAIQILQLTSKFDKALMQKATTYDKGHSRSSSRLVAESGSRLIDMLPSYDIP
                     KLLEPEKQSLSVAEKSRLVKLTMKSKTNILVRLCESEYGVDAALWQRVFPKLLTYIFE
                     QSPVTMALCRSIVCIRLVQLYELILSIMSNSTEKFKDILPEAVVNQWKLYLIVACSSL
                     TSTNDQKLHIPAATGQHGRKKSQQIFTVQHQKIKSATSVFKMVLPLLNCNKNFIKSAV
                     ITGLSAMNINIYRAYIESIDQFMTSWNINSSNNVMRMEMVHILVILSPFLQDPLINSD
                     DWILQKLSHYLKEMKSFLEIDEVQKSFEFQPLRHYFSGFLSSFYFSIRTKVDCDTFFP
                     FEARASCFNFLKEWCGYGQYTSLSSQRYRYMAANSQKAYEDATFATALEFQKSKLETV
                     ALECMIVLCSGEVSKTIYDTNGLPIQMSFDIAGLLCWIDSLLHAPNDKIKILGVRALK
                     TILEANTSNVQLMRDVLHQIKLQTSDNLIHHAYYSLFCEAICRQDTLLLTEDELVAFG
                     LNGVVSNDKAMREHAIDLLIFIESKLYESSYARIFKERLSNQSKTVYKSTAQEISNIF
                     AELLPQEVRLKVFSRMSEYFHLLPTELKQNVLVMFVPWVNKFTLKSSEDLDTFMVLNN
                     TFALTIYSKNRYPMEVEQLWISLGKGNSFQNIHVVLEYIISTSINCRNPEFVKHAREI
                     VLFLANVPGGMGVIDTLFHSLEPKHIIPTSKILREEPQNNDKYSFIADIWTILDYRGK
                     DVVFSKAQLSMIFLVNLLIIPNESVKSRLPLLLHISVCLLDHHVPIIQDSASRILCGI
                     IYGLEPTNKNSDETVNLIKNRQMLWTYENLTKESGARSPKSMDTMIRNIISIFSEIET
                     LQEDWQRISLKWATTCSVRHIACRSFQIFRSLLTFLDQEMLRDMLHRLSNTISDENPD
                     IQGFAMQILMTLNAITAELNADKLIDFPQLFWSVVACLNTIHEQEFIEVLSSLSKFVS
                     KIDLDSPDTVQCLISTFPSNWEGKFDGLQQIVMIGLRSCNSWEISLQFLDRLNLLNDS
                     QIIANKESRILYALLANLPRFLYALDTNDMNDGVVRGANCLISLCMANDEPSLSRIID
                     SMVKNKFRSKKDFMSQIVNFISSNFFPNYAPQALVFLLGLLFNSMDWVKIQTMQLLKH
                     IFPLTELSRPEFIGVGADFISPLLRLLLGELESDALEVLNTIPKVSGSKMDKDVLRIS
                     MGNKDAKKVYNKTATLFGIPEESGWSIPMPALTAASTRHNVHAVFTTCAVMVGGEVDN
                     GDSGILEEIVEFHADGGYVQGTDEFGDVVSVTEDKDPSLSHMWAELDDLGSFFNKSDF
                     MEEEQEEDDV"
     gene            complement(<451579..>454329)
                     /locus_tag="KLLA0_F04609g"
                     /db_xref="GeneID:2895896"
     mRNA            complement(<451579..>454329)
                     /locus_tag="KLLA0_F04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455288.1"
                     /db_xref="GeneID:2895896"
     CDS             complement(451579..454329)
                     /locus_tag="KLLA0_F04609g"
                     /note="similar to uniprot|P40467 Saccharomyces cerevisiae
                     YIL130W ASG1 Proposed transcriptional activator member of
                     the Gal4p family of zinc cluster proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455288.1"
                     /db_xref="GeneID:2895896"
                     /db_xref="GOA:Q6CLA1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA1"
                     /translation="MELQNKRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYNQ
                     PTRRTVTGSNSSNSVGSSIAGTVTVSGKKSGVIGQSSDGFTGGNRSDSGTLSHSKRLG
                     SGFSNHGGVSNSSAASTQGHHKKYSASKNKQLQIRVSKYEELLRELIPDIPDIDSIDI
                     PTFAQLFHNTTKDINLNEMVQEYNLIAPTEVAPIVTRDRDMSDSFSGTGSISIGSHLQ
                     QNLQPIENVDGSIESHEGKEIKIILPPKPIAIQFIKSTWENCCVLFRFYHRPSFIKQL
                     DLLYETDPQNYTHEQMQFLPLCYAVMAVGTLFTKTVNRLNVNQQSPNNINDDDDSNTN
                     NNTNADINTDTNTPDSNTNNNTNNNTNNNTNNNNNNSSDASTKFLQDEGYKYFIAARK
                     LIDITNARDLNSIQTIVLLFLFLQCSARLSTSYSYIGVAMRSALREGLHRKIKPDPSK
                     TKTNFIEIEMRKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAI
                     YPEEQGDVLSSAGIANQHTKILMILDQIMADLYPIKKTNNLISHQMVTNLELKLRQWL
                     DQLPPELIPGLKDVPERYLRANCLLHLSFLQVQIILYRPFIHYLSPSAPQTDTLSIQR
                     AKNCISVARTVVKLAKEMMDAKILPGSYWFSIYTIFFSVAALIYYVRELTPTNSQDIA
                     TYDEIMNDVRNGKQVLLQLKETSMAASRTYNLLTALFNSFNAKTKQSVEMQKKVQQEQ
                     QAATTKFEDSSDFGGTFFDLPIDDSNENAVISPDRSVDTLERQIPTPNFLTNTFPVEP
                     NTSISGVNTLNTSQTANLFSSTNFGASLDPVENNMDRYLPVDSNQNKQSLQQTPQYIS
                     TTTPNQIPDSAVDGTYVPGMFDQLDVQLFGRYLPPYMSGVTANDSKTKEEPLDDTKTD
                     TI"
     gene            <455651..>457990
                     /locus_tag="KLLA0_F04631g"
                     /db_xref="GeneID:2895897"
     mRNA            <455651..>457990
                     /locus_tag="KLLA0_F04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455289.1"
                     /db_xref="GeneID:2895897"
     CDS             455651..457990
                     /locus_tag="KLLA0_F04631g"
                     /note="similar to uniprot|P40466 Saccharomyces cerevisiae
                     YIL131C FKH1 Transcription factor of the forkhead family
                     that regulates the cell cycle and pseudohyphal growth also
                     involved in chromatin silencing at HML and HMR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455289.1"
                     /db_xref="GeneID:2895897"
                     /db_xref="GOA:Q6CLA0"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6CLA0"
                     /translation="MMSQSHVQIQQGNGGSGAGGFYYRGDSNAVMNNVVNTGTGINAS
                     AGAGGVSLQQQQDFVNALISVLEVPKDATSVAAEYANDKNTASEVQAYAKIAGKDWTY
                     YLKDIVINIGRNTSPGDASVDIDLGPAKVVSRQHATIKFNSNSALWELHVTGRNGAKV
                     NFHRINSGPNSVPHPLSSGSILDIGGTQMMFILPDQGLYIDPNAVAHLTPKLFMAYYN
                     VTTNPLLRNLFQSNPDLIHSLELSSPSRNGQLGVSSQTQMLPQSSQSHLHSHGNGQPS
                     VRAFKMYDAPDSAMRSQLLSESTGQMYGSNGASNGHGMSHSNGSSDMSNGQLYGTIAN
                     TGFNIASTDVSTDLSRDENRNIKPPHSYATMITQAILSTEEGELSLSDIYKHIANHYS
                     YYRYTKAGWQNSIRHNLSLNKAFEKVPRKPGEPGKGMKWRISEETQRDFLEKWQNGKI
                     GKVRRGSSVTRQLQAHMYRFNSLPIQRETFSFNDQSKTNVKPQSSSSSHSDYSQTPKL
                     EKSLQSLQPHSQSSLHQTSPPVPHPPIPSYSQQDHTSSNYSTDHSHQSDLPAPKRQHL
                     NPPSQHSQHQQPALPPPSSGQTRSPNHQQMPSNVSSTGSLLHSPNKHFQVNAVEAYTP
                     ERGSNLQKSPQPILNLPSLPQATDMGQSTSRSDSNALQLPTKSSPGVMNLLQFSSVNN
                     TPSTNLQRTPVSHPQVTENLDGKDSKSNMLAVNNAFQESNSINEDDKTNLLSARNVQD
                     ENDEDEGRIMSSPIKVKDNRNNQLVVDPNENSVIVKTDQ"
     gene            <458393..>459034
                     /locus_tag="KLLA0_F04653g"
                     /db_xref="GeneID:2895898"
     mRNA            <458393..>459034
                     /locus_tag="KLLA0_F04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455290.1"
                     /db_xref="GeneID:2895898"
     CDS             458393..459034
                     /locus_tag="KLLA0_F04653g"
                     /note="weakly similar to uniprot|Q45U15 Saccharomyces
                     cerevisiae YIL132C CSM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455290.1"
                     /db_xref="GeneID:2895898"
                     /db_xref="GOA:Q6CL99"
                     /translation="MKIDIGVDNKCGDFVTYMKDEAFNSQLHYISAISSFPISKMMEL
                     LPLSGNETIYESVNVLSSVDLSDLNRCIRSLYQRIIFSPLPKQSDANTDDSNNSNNAN
                     MQMETGKIKTDRHWICIEGIQTMFQYSQLKDPVEAHASLNDTMLRLRLLQNKCPSIEI
                     LFLLPPHEAPEFIQSLQEHDISRNNIPHRRQGKRFKRDNTGILIGDYIWKYYI"
     gene            <459700..>460844
                     /locus_tag="KLLA0_F04675g"
                     /db_xref="GeneID:2895899"
     mRNA            join(<459700..459733,460279..>460844)
                     /locus_tag="KLLA0_F04675g"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_455291.1"
                     /db_xref="GeneID:2895899"
     CDS             join(459700..459733,460279..460844)
                     /locus_tag="KLLA0_F04675g"
                     /note="highly similar to uniprot|P26784 Saccharomyces
                     cerevisiae YIL133C RPL16A N-terminally acetylated protein
                     component of the large (60S) ribosomal subunit, binds to
                     5. 8 S rRNA; has similarity to Rpl16Bp, E. coli L13 and
                     rat L13a ribosomal proteins; transcriptionally regulated
                     by Rap1p and to YNL069C uniprot|P26785 Saccharomyces
                     cerevisiae YNL069C RPL16B N-terminally acetylated protein
                     component of the large (60S) ribosomal subunit, binds to
                     5. 8 S rRNA; has similarity to Rpl16Ap, E. coli L13 and
                     rat L13a ribosomal proteins; transcriptionally regulated
                     by Rap1p"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_455291.1"
                     /db_xref="GeneID:2895899"
                     /db_xref="GOA:Q6CL98"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:Q6CL98"
                     /translation="MSSFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATAFNKTRGPFHFRAPSRIFYKAVRGMISHKTARGKAALER
                     LKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEEK
                     RKARSAEYYLKKKAYNAVVANKSATVGTEVSEKLAALGY"
     gene            complement(<461126..>462049)
                     /locus_tag="KLLA0_F04697g"
                     /db_xref="GeneID:2895900"
     mRNA            complement(<461126..>462049)
                     /locus_tag="KLLA0_F04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455292.1"
                     /db_xref="GeneID:2895900"
     CDS             complement(461126..462049)
                     /locus_tag="KLLA0_F04697g"
                     /note="similar to uniprot|P40464 Saccharomyces cerevisiae
                     YIL134W FLX1 Protein required for transport of flavin
                     adenine dinucleotide (FAD) from mitochondria where it is
                     synthesized from riboflavin to the cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455292.1"
                     /db_xref="GeneID:2895900"
                     /db_xref="GOA:Q6CL97"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CL97"
                     /translation="MDATSNSVLSPLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAA
                     IDLKPSSYYNQVQRIIKDGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVV
                     YSLSSEPALQNKFMNDRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGY
                     TSILNAITRIYTEEGLKTFWRGLVPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERR
                     LNAVETIGIISLSKMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIA
                     GFYKGLFANLVRAIPSTCITFGVYEHFKHIS"
     gene            complement(<463107..>464528)
                     /locus_tag="KLLA0_F04741g"
                     /db_xref="GeneID:2895917"
     mRNA            complement(<463107..>464528)
                     /locus_tag="KLLA0_F04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455294.1"
                     /db_xref="GeneID:2895917"
     CDS             complement(463107..464528)
                     /locus_tag="KLLA0_F04741g"
                     /note="similar to uniprot|P12695 Saccharomyces cerevisiae
                     YNL071W LAT1 Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex which catalyzes the
                     oxidative decarboxylation of pyruvate to acetyl-CoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455294.1"
                     /db_xref="GeneID:2895917"
                     /db_xref="GOA:Q6CL95"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q6CL95"
                     /translation="MSALLSRVAPRMSVLACAARLQLRTYASYPPYTIIGMPALSPTM
                     VQGGLTEWSKNVGDRLEPGDVLAEVETDKAQMDFEFQEEGYLAKILVPAGTKDIPVNK
                     PLAVYVEEESDVPAFANFTAADAESATAAKEAAKNGAKQPAKEESKEESKEGAKPASK
                     PAAKKSSGSSASSGTRIFASPLAKSIALEHGVSLKEVEGTGPRGRITKDDVEAFLASA
                     PSRESSAAKAAPALAAPTPASATYEDVPISNMRQIIGDRLLQSTQNIPSYIVSSQISV
                     SKLLKLRQSLNATAKDQYKLSINDILIKAIAVAAQRCPDANAYWMPEQGVIRKFKNVD
                     VSVAVATPTGLLTPIVKNAESKGLVSISKEIKDLGKRAKDNKLKPEEFQGGTICISNL
                     GMNPAVSMFTSIINPPQSTILAIGTVNKVPVEDAGSEFGFTFDQKMNITGTFDHRTID
                     GAKGGEFMKELKKVIENPLELLL"
     gene            complement(<465362..>466276)
                     /locus_tag="KLLA0_F04774g"
                     /db_xref="GeneID:2895919"
     mRNA            complement(<465362..>466276)
                     /locus_tag="KLLA0_F04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455296.1"
                     /db_xref="GeneID:2895919"
     CDS             complement(465362..466276)
                     /locus_tag="KLLA0_F04774g"
                     /note="similar to uniprot|P53942 Saccharomyces cerevisiae
                     YNL072W RNH201 Ribonuclease H2 catalytic subunit removes
                     RNA primers during Okazaki fragment synthesis cooperates
                     with Rad27p nuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455296.1"
                     /db_xref="GeneID:2895919"
                     /db_xref="GOA:Q6CL93"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q6CL93"
                     /translation="MKLSNSTQALEYGMSVPPTVAGSLNSLHSKTYHSEVPKSILEST
                     DEIILGVDEAGRGPVMGPMVYGISYCTRQYEKDVICKYGFDDSKKLTDPVRQKLFAMI
                     YGGEIDGVGYATTSITACDISSGMFRFPPEKNYNLNEQAHDVTIALIDDVLKSGVKVG
                     HVYVDTVGPPISYQKKLESIFPQCKFTVAKKADSIYPIVSVASVVAKVTRDIILSQCK
                     KTEDEILGSGYPGDSKTVQWLRNEMKPLMGWSPYMVRFSWQTCATMLANSKSTIEIEW
                     EEDAMTKKKMQWAPEQKNRPITLDSWYQ"
     gene            complement(<466476..>468029)
                     /locus_tag="KLLA0_F04796g"
                     /db_xref="GeneID:2895920"
     mRNA            complement(<466476..>468029)
                     /locus_tag="KLLA0_F04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455297.1"
                     /db_xref="GeneID:2895920"
     CDS             complement(466476..468029)
                     /locus_tag="KLLA0_F04796g"
                     /note="similar to uniprot|P32048 Saccharomyces cerevisiae
                     YNL073W MSK1 Mitochondrial lysine-tRNA synthetase required
                     for import of both aminoacylated and deacylated forms of
                     tRNA(Lys) into mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455297.1"
                     /db_xref="GeneID:2895920"
                     /db_xref="GOA:Q6CL92"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6CL92"
                     /translation="MLRSYHILRGFQRLHSTEAGVLEYRTRNAEISKNLTKWYPSLSN
                     IPKPTIDVSRFIKEYDGLKVDDRSTTHTLRGKITNMRFSGKKIGFINLLNDEKSLQVI
                     VNLSNLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQKQGTLSLKVNSELKMLSPAQIP
                     IPPKLLDSSKRNSNKTLDYLVNGTEAIYIRHLVTKRIREWLYKQEFIEVETPIISSKS
                     NGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIGKVFRNEGIDSTH
                     NPEFTTLEFYQCYINMEQLIEMSESLLIYVCQGIDKPKAQELLDQIKANNGKFKRLEF
                     LPTLTQKTGIDFDNMDLNNAELLKEKLRKANISISESSVSPQQILDELCGKYIESQCD
                     TLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRKEYMNAYEEENCPDLQLEKFT
                     NQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGIDRLCMLLADTQRIEEVLSF
                     GTLDDVNRQ"
     gene            complement(468355..468471)
                     /gene="SNR68"
                     /locus_tag="KLLA0_F04807r"
                     /db_xref="GeneID:9487293"
     ncRNA           complement(468355..468471)
                     /ncRNA_class="snoRNA"
                     /gene="SNR68"
                     /locus_tag="KLLA0_F04807r"
                     /product="snR68"
                     /note="C/D snoRNA monocistronic SNR68"
                     /transcript_id="XR_002633606.1"
                     /db_xref="GeneID:9487293"
     gene            <469283..>470764
                     /locus_tag="KLLA0_F04818g"
                     /db_xref="GeneID:2895921"
     mRNA            <469283..>470764
                     /locus_tag="KLLA0_F04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455298.1"
                     /db_xref="GeneID:2895921"
     CDS             469283..470764
                     /locus_tag="KLLA0_F04818g"
                     /note="similar to uniprot|P20457 Saccharomyces cerevisiae
                     YKL045W PRI2 Subunit of DNA primase which is required for
                     DNA synthesis and double-strand break repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455298.1"
                     /db_xref="GeneID:2895921"
                     /db_xref="GOA:Q6CL91"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:Q6CL91"
                     /translation="MFRQTKKRVANRRNFVGDDQNRIDVTGYGNQDDGMQYDILYPTK
                     LTWYRLPPKGEITLEQFETWAIDRLKVLLELESLWQRNKSMKEIETTIKPVLSSKLNL
                     GNDNESRKKDYYSHFILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLNFISSL
                     DLPYVNSIDEEEKQSLSTELYQTVSHLLTFQLNLTEETQRRQFFNREKYYKLPMENVM
                     DLVGSRQIFIKKGWAYVPQFQQLNLISNEFSDCLQTELMGTYQMIPKLNEDDRILPIL
                     HHLSSGYVVTESQELNGAGVNDEFTHRSVKTKKVMEHFPLCAKQLMEQLQTNHHLRYQ
                     GRQQLSFFLKGIGLSVDEALQFWTESFTSGGKMTVDQFNKEYKYNFRHNYGLEGNRIN
                     YKPWDCRTILSKPRPSRGEYHGCPYRDYHPDKLVATLKEMSLTQQQVNSVVESCQQQD
                     YTIACTKVFEAVHKTTTADLQIVHPNQYFERSRQAAAAVTTTN"
     gene            <474544..>476454
                     /locus_tag="KLLA0_F04840g"
                     /db_xref="GeneID:2895922"
     mRNA            <474544..>476454
                     /locus_tag="KLLA0_F04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455299.1"
                     /db_xref="GeneID:2895922"
     CDS             474544..476454
                     /locus_tag="KLLA0_F04840g"
                     /note="some similarities with uniprot|P53438 Saccharomyces
                     cerevisiae YMR016C SOK2 Protein that can when
                     overexpressed suppress mutants of cAMP-dependent protein
                     kinase displays homologies to several transcription
                     factors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455299.1"
                     /db_xref="GeneID:2895922"
                     /db_xref="GOA:Q6CL90"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:Q6CL90"
                     /translation="MNYYGYWDYPYYGQGQGQAQGHAQVPPQAAPMSQIPAQVPQVPQ
                     VPQVAQPQQVQQVGQIPQVGQMPQVAQVSQLGGQPRQQQPNEDSTSGILQRLNPQNQY
                     LGYAQQQPIPQLQQQPQPQPQPQQQQQQQQQQQQQQPQQQAQQSPRQPQPQVQQQQQP
                     QQYDKGLPQLQPMSTNTQQMMYYPYSGYSHYYPYSGYSYYQQQVPQQMPQIVSQEEDS
                     ELKSQQPQQQQLQQQQTQQQPLAPPIISSAVNSHPAGYTQSPSSRYYQLPPTSTYQYP
                     RFQQYGLPMIQQQSQASISTPKSTNRNSSGSSTNISQFGTNSPLDSFSNASPNPKEFP
                     LKRRKSNKKSHLTPTQPNTTTFSQQGQRSKVTTTMWEDENTLCYQVEANGVSVVRRAD
                     NDMINGTKLLNVTRMTRGRRDGILKAEKIRHVVKIGSMHLKGVWIPFERALVMAQREK
                     IVDLLYALFVRDIQSIIQQESNGKYQQQTQQHQHHPLMSLPQQNPVPYANHQDDSSNH
                     LMVLTQAGVAMQQQGNYNPNPQIPHSNINESSDNNSHQQQQQQQQQQQQQQFATQSQV
                     QQQPQQLQTDQSLRPASVDNNQEKLHHPAGQLTEADQKRNDSTTSQLGASSKQHDEGN
                     SNTNANPSNLKD"
     gene            <476880..>477830
                     /locus_tag="KLLA0_F04862g"
                     /db_xref="GeneID:2895923"
     mRNA            <476880..>477830
                     /locus_tag="KLLA0_F04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455300.1"
                     /db_xref="GeneID:2895923"
     CDS             476880..477830
                     /locus_tag="KLLA0_F04862g"
                     /note="weakly similar to uniprot|P36094 Saccharomyces
                     cerevisiae YKL042W Spindle pole body component SPC42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455300.1"
                     /db_xref="GeneID:2895923"
                     /db_xref="GOA:Q6CL89"
                     /db_xref="InterPro:IPR021611"
                     /translation="MIHNGSTPRRFVFGNNDANERIVPEEYKYNSSMINELIKQNKDL
                     HKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKKMQRDQQEQQHNRHQSFESKPRYKA
                     EFTSESSSPVSNERDSEYLQIKKNNRHDENKIDDIYQKLELLTNLVNDAIHKQNNGEQ
                     REPSNFNSRIVSDDDIIISESQEFKQLQDQIDLLKRKLLIKKENELRKLSLNKELADL
                     MDELSMNSSPSANQNIDPYSELSSRPKSGQQRRTNEDQQSLHCEHCHLKSHTQSHPSE
                     PRFVNLKESLETPTPTPTQTPRKLKREKDTNVADKQYSLW"
     gene            complement(<478044..>481682)
                     /locus_tag="KLLA0_F04884g"
                     /db_xref="GeneID:2895924"
     mRNA            complement(<478044..>481682)
                     /locus_tag="KLLA0_F04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455301.1"
                     /db_xref="GeneID:2895924"
     CDS             complement(478044..481682)
                     /locus_tag="KLLA0_F04884g"
                     /note="highly similar to uniprot|P53622 Saccharomyces
                     cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
                     coatomer complex which surrounds transport vesicles in the
                     early secretory pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455301.1"
                     /db_xref="GeneID:2895924"
                     /db_xref="GOA:Q6CL88"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6CL88"
                     /translation="MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGV
                     LLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVF
                     FHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDET
                     VRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKT
                     VRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERPPTAINQ
                     NQLFFINREKQVQMFDYHKRITSLPYLSLKNIGKTWSSFRSMSYNPSQHSVLVNSSEK
                     EANRFSLCVLPKQPSGAVEASNVISDDGSFAIFVARNRFVVHNGSTNSLEVRSLDNKT
                     TKSIKLTDTVKDITLAAPGTVLILYSHSVVMMDVQQGKILHELSLKNIKYTVWSQDGQ
                     YVALMSKHTLTIANRKLEIVTSNHESIRIKSASWDETGVLIYSTLNHIKYCLLNGDSG
                     IIKTLERTLYINKVHGKFVYALNREGEVEILTIDPTEYRFKKTLVNKNFPEVLRIIKN
                     SNLVGQNIISYLQKSGYPEIALQFVEDPQTRFDLATQYGNLTVALEEAEKLNNELVWE
                     RLGKEALIQGNTDIAELVYQNTKQFDKLSFLYLLKGDNSKLAKMESIAEHRSDISGLI
                     QNTFYNNSVQKRANVFLNAGSAPLAYAVAKANGDDDLATSILESEEIDEQDISLPTEL
                     NSSTNVKTPVISAPLKNWPLKQAEVSFFEKALLGQIEDLEISDDKEENVSDTTQNVGQ
                     FDLGEQDNLDFDDEAVGEEEDAWDLDQNDLELDDELEIEESEVTEEQVDESELPMWVK
                     NSKLPAVLVAAGAFDAAAQALNKQVAVVNFEPLRTPFIDIYDGARTYMSATPNELPSI
                     IGYIRADADEEDKSKILPFVPGVSVVTTKLNEGFKAFKANKLEVAIEHFRDVIYAIAL
                     LAVTDKEDETTAQTALATAREYILGLSMELERRALPANDVKRNLELAAYFSRTKLLPV
                     HRSNALNVAMTQSFKNKNFVLASYFAGEFLKIITSGARADQAQKIKAKADSMAYDAIE
                     IDFDPYAEFDICAASHTPIYKGSPSVADPLTGANYHVSEKGKIDRIALISKIGAPASG
                     LRIQLSVN"
     gene            complement(<482183..>483673)
                     /locus_tag="KLLA0_F04906g"
                     /db_xref="GeneID:2895925"
     mRNA            complement(<482183..>483673)
                     /locus_tag="KLLA0_F04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455302.1"
                     /db_xref="GeneID:2895925"
     CDS             complement(482183..483673)
                     /locus_tag="KLLA0_F04906g"
                     /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
                     YLR213C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455302.1"
                     /db_xref="GeneID:2895925"
                     /db_xref="GOA:Q6CL87"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6CL87"
                     /translation="MLSTILLWISCCTISTLAQEATRYFPETPIGCSLENNCPAEWPC
                     CSQFGQCGTGPFCVGGCNPRLSHDPGSCLGQPALLPRMSPSFWLQSSLEQKPALKSSF
                     LPRVQPSMDVASNEGGEKDLNNRGIVNFANFLISPQERIIKKMLRDYHFTYSGFVKYD
                     APGQLTLAMPKHTSGSLISSTRSFLYGRATVKMKTARGRGVVTAVVLISTVGDEIDFE
                     FIGGELHHAQSNYYHQGELNHTRMEKLELSSDSFENTHIYEVDWDQDRINWIVDGVVA
                     RTLYKEDTWNEEKQRYEYPQTPMRLQVSVWPGGREDADPGTIMWAGGLIDWENSPDIL
                     EKGQFYATVESIAVTPYENKFWPSIVDELERLHLPIDANSLLDITYDYNYDKFNEHTW
                     FEDSVIWKKGKLPYLSSLDKNGLNPGRQQQSLLVGKQLKQEQGDGPDQSPSNRFIQDT
                     NKPSEKNHEEQDLLLRNALQSRDATTNGGSSHNNRNPIKRLLNMLH"
     gene            complement(<484158..>485249)
                     /locus_tag="KLLA0_F04928g"
                     /db_xref="GeneID:2895926"
     mRNA            complement(<484158..>485249)
                     /locus_tag="KLLA0_F04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455303.1"
                     /db_xref="GeneID:2895926"
     CDS             complement(484158..485249)
                     /locus_tag="KLLA0_F04928g"
                     /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
                     YDL144C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455303.1"
                     /db_xref="GeneID:2895926"
                     /db_xref="GOA:Q6CL86"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CL86"
                     /translation="MSSNIIPPSEQTSSALIIGAGGVGVITAYSLYHCGLSEVSLVTR
                     SDYDHVVEFGYKIDSCDYGEITNWRPHNVYKTVEDASSAEKFFDYIIITTKNIPDGPK
                     DSTVHAILKPVIEANYKLNDEKVTNVVLIQNGIDIEKEVLEHFNPATYNLCLLSGVQL
                     IASTKVGPGHIVQKGKDHVSFGSFDKDDDIAIGQAKKLVSIYHNEGHNTGVFDENVRK
                     TRWNKLLYNAAINTTTALVGLDVPRCFEFSVEKKATEFEVFRPAMQEIVSIAASEDVS
                     IDENLIEFFNDVTRNILYKPSMCVDLENGRLMELEIILGNPIRIAKANGVETPTLKLL
                     YNLLILVQNKLKEQKKLIEFDEEILKLVV"
     gene            <486258..>488345
                     /locus_tag="KLLA0_F04950g"
                     /db_xref="GeneID:2895927"
     mRNA            <486258..>488345
                     /locus_tag="KLLA0_F04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455304.1"
                     /db_xref="GeneID:2895927"
     CDS             486258..488345
                     /locus_tag="KLLA0_F04950g"
                     /note="similar to uniprot|P32791 Saccharomyces cerevisiae
                     YLR214W FRE1 Ferric reductase and cupric reductase reduces
                     siderophore-bound iron and oxidized copper prior to uptake
                     by transporters expression induced by low copper and iron
                     levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455304.1"
                     /db_xref="GeneID:2895927"
                     /db_xref="GOA:Q6CL85"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6CL85"
                     /translation="MRLSGLLIWILAWFQVHVQALVLIDSTLASACVYYELQYDWGCN
                     SHSNGMKAYACRCGNAAWLGSVTNCVYENTNSTRLRNHALRHISTRCLQKGGFEYSLA
                     DMQGFYKNATSYLREPTKMDLTMPVDLPLRVNESSYAYYHKGFKDFTFSVQRSQWFGW
                     GLVFYWATILVLASIFNLSKRVFGFTWETNWIRRTLTLPSTFGKYHNSPYTLWKCFQF
                     YFPTRLQSWVIAVFLIQTIVSCCVGYNTISMPHPYLTSRWYANLDLISYRTDLMAISL
                     FPIVYFFGIRNNPFTWVTGISFATFNLYHKWTAYVMVILAFIHSIIWTVWAKSKEGGG
                     YLAWWPDAYWQWGVFATMLSFFMVAHSHKWIRDLAYEFFLIFHKLFNVMFIVCMYYHL
                     NTLGWLGWVWSMVGIWGFDRVMRFAKIILCGGLQTATVTDCGNGVIRMKIKNPRLLKF
                     YPGSYAYVYFFSTSDPWIYSFQSHPFTVLSVPDEDESTLTIIFKAKKGITRNVLNRLL
                     KSGVDELKYKIFVEGPYGAAYPCHKNSTRKFIGLAAGLGISAVFPHIKSVIEQTSTNI
                     VHELKWISNDMNCLNWFSKELAWLASNNCKITFIYTKDIGSDTESVSDYSEKPKSIQD
                     QKISSKIEVLTFSTRPDMNQIVHEAISSSEEDISFVSCGPSSFIDVVRYSVKKELANT
                     KVDVDLEEESFTW"
     gene            complement(<488863..>489963)
                     /locus_tag="KLLA0_F04972g"
                     /db_xref="GeneID:2895928"
     mRNA            complement(<488863..>489963)
                     /locus_tag="KLLA0_F04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455305.1"
                     /db_xref="GeneID:2895928"
     CDS             complement(488863..489963)
                     /locus_tag="KLLA0_F04972g"
                     /note="similar to uniprot|Q05791 Saccharomyces cerevisiae
                     YLR215C CDC123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455305.1"
                     /db_xref="GeneID:2895928"
                     /db_xref="GOA:Q6CL84"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="InterPro:IPR016525"
                     /translation="MAAESYTPLVDIKVRSDDIRACSFSSWYDKFKKYTPKAKIIQPL
                     PEEFLRYLAQDGIRLSLEENDSTYNDHCLKRDDDNEYSDWEADDDGDNDSDSDDDKNG
                     KEEEMVPMVNFPDLHREIAEVIGEYGAVTPKLNWSAPRDATWILPNNTSKCMNVNDIY
                     LLLNASNYIAYDLDHAFDECEDRDNSDNQSIQFELVLRKWFDINPALEFRVFVRDSEI
                     WGISQRDLNYYNYLEPLQDTFTNLIEEFVYDIVLPNFDLKSFVLDVYLPRPFESCWLI
                     DINPWSRTTDPLLFSWNELASKDLDSDASPEIRLITEHNMGRFVTKEHSENQVPKDVV
                     QASLDPESMRELTYKWKEILKMQEAESDSDSN"
     gene            <490536..>492128
                     /locus_tag="KLLA0_F05005g"
                     /db_xref="GeneID:2895747"
     mRNA            <490536..>492128
                     /locus_tag="KLLA0_F05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455307.1"
                     /db_xref="GeneID:2895747"
     CDS             490536..492128
                     /locus_tag="KLLA0_F05005g"
                     /note="highly similar to uniprot|P39078 Saccharomyces
                     cerevisiaeYDL143W CCT4 Subunit of the cytosolic chaperonin
                     Cct ring complex related to Tcp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455307.1"
                     /db_xref="GeneID:2895747"
                     /db_xref="GOA:Q6CL82"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /translation="MVSQAKQPSNATFKNREKPQEVRKANIIAARAVADAIRTSLGPK
                     GMDKMIKTSRGDIIISNDGHTILKQMAILHPVAKMLVEVSGAQDVEAGDGTTSVVIMT
                     GALLGAAEKLLNKGIHPTIIAESFQRAAERSVEILLNMSTKISLDDKEALVRAASTSL
                     SSKIVSQHSSFLAPLAVDCVLSIASHDSTNVDLNDIRLIKKVGGTIDDTEMVNGVVLT
                     QNAVKTAGGPTRIEKARIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLNI
                     CKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLGIMVVRDIERDEVEFLSKSLGCKP
                     ISDVELFTEDRLGSADVVEEVESDGSNIVTITGVKTTNKNPTVSVVIRGANNMVLDET
                     ERSLHDALCVIRCLVKERALIAGGGAPEIEVSYRLMKEARTMEGVEAFVWQEYAEALE
                     VIPTTLAENAGLNSLNVVTELRLRHENGESNSGISVRRSGTSNTYEDHILQPVLVSTS
                     AIRLASECVKSILRIDDITFSR"
     gene            complement(<492389..>493285)
                     /locus_tag="KLLA0_F05027g"
                     /db_xref="GeneID:2895748"
     mRNA            complement(<492389..>493285)
                     /locus_tag="KLLA0_F05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455308.1"
                     /db_xref="GeneID:2895748"
     CDS             complement(492389..493285)
                     /locus_tag="KLLA0_F05027g"
                     /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
                     YDL142C CRD1 Cardiolipin synthase produces cardiolipin
                     which is an important constituent of mitochondrial
                     membranes required for normal mitochondrial membrane
                     potential and function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455308.1"
                     /db_xref="GeneID:2895748"
                     /db_xref="GOA:Q6CL81"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR025016"
                     /db_xref="UniProtKB/TrEMBL:Q6CL81"
                     /translation="MILNVLTISKQVNGLRRIVQKTNGISSNLQFSRSKALKQIIGIR
                     PFRHSQRFYSTDNRDLVKEPEKKQQQQQRTKSAITNGIWTLPNVLTMSRIATTPLIGY
                     YILTQNLAPAMSLFVYSCVTDFLDGYLARSYKMKSVAGTVLDPMADKILMMTTTAALC
                     VPSGPQIIPLAVAGLIFGRDLLLGLSAIYFRYASMKHRYGSVTWNSYWDIFHYPSAEV
                     KPTQISKWNTFVQMIYVGFGVVLLIINNTKDEEEGKEGLLKENSQFAFTLLGYLVSVT
                     TVWSGASYVFNKNAVRYLSKLK"
     gene            <494045..>496126
                     /locus_tag="KLLA0_F05049g"
                     /db_xref="GeneID:2895749"
     mRNA            <494045..>496126
                     /locus_tag="KLLA0_F05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455309.1"
                     /db_xref="GeneID:2895749"
     CDS             494045..496126
                     /locus_tag="KLLA0_F05049g"
                     /note="similar to uniprot|P48445 Saccharomyces cerevisiae
                     YDL141W BPL1 Biotin:apoprotein ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455309.1"
                     /db_xref="GeneID:2895749"
                     /db_xref="GOA:Q6CL80"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CL80"
                     /translation="MNVLVYNGAGTSPESVKNTIETLRLLLEPYYAVSPVTARVLETE
                     PWTTKTSVVVFPGGADLPYVRDCKKVIPKIRDFVSKDGGLYIGICAGGYFGSGRCEFA
                     KGDPCYEVTGPRDLKLFPGIARGPAFSGFKYNKEDGAKTVKLKVNGIENLQEAYSYYN
                     GGALFVDAEKYPNVEVLAEYEDSVDVPFSDDPNAANQDATAAAAAIVLSSFGKGKALF
                     IGPHPEISAKNLKPIGEEWYDNKVIKLLEEHDTSRFQLMKEVLRKAGLKCNSTESNPG
                     NPDLTPIFVATKDNMADLREFEENLRSNSAKTDDSGDAYHLTGENDSFDIYEGFSHAE
                     EASLKLQDVHPVDAVKQIIFPANEETVPGKPLISHFDMQKFFAHLNPSSKLGSILLYG
                     DVVTSTSMILDQNKTLLAALPENRAIHVGTIQLLGRGRGGNTWVNPRGVLASTTAINL
                     PAVSPSSGERTPIVFVQYLAMLAYCKAIRTFAPGYEDLPVKIKWPNDLYAMKPQYYYN
                     NNMKLLGKEFPNGLIPLDDVDPAFVKVSGLLVTTNFVSGKYSLLLGCGVNVTNEAPTT
                     SLATWVKILNNERDALGMPHLPPIDHEILLAKYLNELDTLLKKFLMYGPSPILPEYYK
                     YWMHSDQIVQLLDHNSVRAKLVGITEDYGLLIAKELIAGSNTHFTGNVYHLQPDGNTF
                     DIFKGLISKKA"
     gene            complement(<496371..>501533)
                     /locus_tag="KLLA0_F05071g"
                     /db_xref="GeneID:2895750"
     mRNA            complement(<496371..>501533)
                     /locus_tag="KLLA0_F05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455310.1"
                     /db_xref="GeneID:2895750"
     CDS             complement(496371..501533)
                     /locus_tag="KLLA0_F05071g"
                     /note="highly similar to uniprot|P04050 Saccharomyces
                     cerevisiae YDL140C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455310.1"
                     /db_xref="GeneID:2895750"
                     /db_xref="GOA:Q6CL79"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:Q6CL79"
                     /translation="MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDES
                     QMKAKIGGLNDPRLGSIDRNYKCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKV
                     CESVCMHCGKLLLDEYNEQMRQAIKIKDPKRRFNAVWTLCKAKMVCETEVPSPDDPTV
                     FLSRGGCGHIQPSIRKDGLSLVGTWKKDKNADDSDQPEKRIISAEEILNVFKHISPED
                     GWRLGFNEDFSRPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTYKLGDILKANINV
                     QKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV
                     RNGPNEHPGAKYVIRESGDRIDLRYSKRAGDIQLQYGWKVERHITDNDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGIIPTPAIL
                     KPVPLWSGKQVLSMAIPNGIHLQRFDDGTTFLSPKDNGMLIIDGKIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTIADEKTMREITEA
                     IAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNEEYALDPSLLE
                     SGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNIKRIIQNSQQTFR
                     IDQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQNAITLFCCLLRSRLATRR
                     VIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSV
                     TVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTD
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLK
                     KIENSMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTV
                     SGVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTS
                     QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAP
                     IGTGAFDVMIDDESLVKYMPEHKEVKTEGQEGGATPYSNESGLANAEINVKDELMFSP
                     LVESGGADALAGGFTAYGGADYGSATSPFSGYGNGPTSPGFGEVSSPGFSPTSPGYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
                     YSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPGSYSPAEPKQQESDEEKKENK"
     gene            complement(<502635..>503753)
                     /locus_tag="KLLA0_F05093g"
                     /db_xref="GeneID:2895751"
     mRNA            complement(<502635..>503753)
                     /locus_tag="KLLA0_F05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455311.1"
                     /db_xref="GeneID:2895751"
     CDS             complement(502635..503753)
                     /locus_tag="KLLA0_F05093g"
                     /note="similar to uniprot|P53691 Saccharomyces cerevisiae
                     YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues binds to
                     Hsp82p and contributes to chaperone activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455311.1"
                     /db_xref="GeneID:2895751"
                     /db_xref="GOA:Q6CL78"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /translation="MSETRPKTFFDISIGGKPAGRIVFELYSDVVPKTAENFLKLCEG
                     NSGFAKSKPDIPLSYKGSIFHRVIKSFMCQFGDFTNFNGTGGESIYGEKFEDENFTLK
                     HDKPFLLSMANAGANTNGSQCFITCVPTPHLDGKHVVFGEVIQGKRLVRTIENNATDE
                     ADKPAKEVKIEDCGVLPSDYTVPADAEATPTDAYGDNYEENITDDSKVDPNDVNSVLN
                     AVEAVKEIGTKQFKEKNFEVALVKYEKSSQMLKQYFPQDLPEEDVKKIDALRVSLFLN
                     IALVSLKSKNYSRTLSAATEALHADNTDDKSKAKALYRRGLAYYYTKNAEMAVTDLEL
                     ATTYQPHDTAIIKALQDAKKAKKELIAKQKKSLSKMFS"
     gene            complement(<504092..>504694)
                     /locus_tag="KLLA0_F05115g"
                     /db_xref="GeneID:2895752"
     mRNA            complement(<504092..>504694)
                     /locus_tag="KLLA0_F05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455312.1"
                     /db_xref="GeneID:2895752"
     CDS             complement(504092..504694)
                     /locus_tag="KLLA0_F05115g"
                     /note="similar to uniprot|Q12334 Saccharomyces cerevisiae
                     YDL139C SCM3 Suppressor of chromosome missegregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455312.1"
                     /db_xref="GeneID:2895752"
                     /db_xref="GOA:Q6CL77"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="PDB:2YFV"
                     /db_xref="UniProtKB/TrEMBL:Q6CL77"
                     /translation="MIKRPSNSKKKANLRRLTGALRDLLGEEEPKKEENLKQITRDGV
                     VYIMSKENRLIPKLSDEEVMERHKKADENMKRVWSQIIQKYESIDNQGDVIDLQTGEV
                     IEDNGHLRNLSNEKSVLHSSLPDGGSVSYKSVLNDIMDIKDSSYNSSVWQDHETNDSE
                     TGSESESGLEADGLDEGSGSEADNSNEVYMKKLRPNPESN"
     gene            complement(<504967..>505221)
                     /locus_tag="KLLA0_F05137g"
                     /db_xref="GeneID:2895753"
     mRNA            complement(<504967..>505221)
                     /locus_tag="KLLA0_F05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455313.1"
                     /db_xref="GeneID:2895753"
     CDS             complement(504967..505221)
                     /locus_tag="KLLA0_F05137g"
                     /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
                     YLR218C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455313.1"
                     /db_xref="GeneID:2895753"
                     /db_xref="UniProtKB/TrEMBL:Q6CL76"
                     /translation="MSAGESKYYKEALAEYQDMDKEDPDAWDKRISNTGCYVENLALQ
                     LCHAETNDWRQCLGEMKLFKDCWQSKGNDQRVGTVDAKEH"
     gene            <506007..>509702
                     /locus_tag="KLLA0_F05159g"
                     /db_xref="GeneID:2895754"
     mRNA            <506007..>509702
                     /locus_tag="KLLA0_F05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455314.1"
                     /db_xref="GeneID:2895754"
     CDS             506007..509702
                     /locus_tag="KLLA0_F05159g"
                     /note="similar to uniprot|P38968 Saccharomyces cerevisiae
                     YDL195W SEC31 involved in protein transport from
                     endoplasmic reticulum to Golgi Component (p150) of COPII
                     coat of secretory pathway vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455314.1"
                     /db_xref="GeneID:2895754"
                     /db_xref="GOA:Q6CL75"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021614"
                     /translation="MVKLAEYPRTATFSWSHDRVPVLATGPASGAIDADFSSTSTLEL
                     WSLLSFDGSKPSGSVVADGKFNDLDWSGDDKIIAGALENGVVEFFDPKALKSVAKIHK
                     HQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSL
                     SWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVDWHPTSSTI
                     IATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSSGRDNTS
                     VLWNPQEGSILTQFAPRGNWVFKSKFAPEAPDLFASASFDSKIVVQTLQNLSNTLDAQ
                     ANESKQHASEDEFWNNVTSNSVDDKPNTVKIQAPKWYGNKSPAAQWAFGGKLVRISDD
                     GKGVSVVKPCISGLEKNQLFDESLKSKDFVKLINKRLSQKINATNEDDWNLLENLSMD
                     GTALYLKDALSLDDAKEDIIKKSEEDGADFFNQLNDKFVPEGAFKLDFSESMKPLTNF
                     LIKGDLKSALNQALEKDLLLEALVIAITSNDALLADKAKNAYFSKHSEQSGLARTLFS
                     VAQRDVEDIVTNIDVSQWKDAVQFIFNYTKEDISKKNSLLVKLGDRLLHEGNRKDAIL
                     LYLSGQSLESIASIWLKEFPELENQLTSQKDTLYEAHLECLTEFVERFTVLSDYLDKG
                     TVKLTNQTLISKFLEFVNVTAANGDFELSLRFLETLPDDNEEVKSEKQRVLIASGKTS
                     TTRSTERTANSTLQSRQGRYGSTSVPTANGAPRLSNSGIPPPNPLAAPHQPPASTAPN
                     VVPRKPSFVPQTTSAIPTPNPYAPAAVNQQIPLSVVGSRPSYTPPVNPYAQTATSIPP
                     NPYAPLPVAAPVPLGSPVAPPPISGASGYSGQTPHLHDKPIDGWNDLPSVSKEKPTRA
                     KAVNTAPIGMSTPSYGTPDLAAVPLSRASTNSTLPPPPPNVRRTPKLTSPPEVASPPL
                     PLKKTNSYAPTVSAVQSSQMPQQISNPLMPPASPNPATNGRSFVPPVNPYSPAPSAVT
                     PTGIVPPKALVAAIPSPVPAPKAAAVPPPRKMNRKSTAVGDASAASNLLSSIQTKPTP
                     PIHSPAMVDPVAVQYDQSAVSPTNVEIAAEQGAGITESDRPIVEFLTAELQRVTPLIP
                     QEYTKQLKDCDKRIKILIKHLEHHDLLTQPTIDKLHQIVAFWKEGNYSEAMTIHQDLS
                     ANHSSEAGNWLTGIKRLMNIAEATSSQ"
     gene            <510384..>512747
                     /locus_tag="KLLA0_F05181g"
                     /db_xref="GeneID:2895755"
     mRNA            <510384..>512747
                     /locus_tag="KLLA0_F05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455315.1"
                     /db_xref="GeneID:2895755"
     CDS             510384..512747
                     /locus_tag="KLLA0_F05181g"
                     /note="uniprot|O13477 Kluyveromyces lactis RAG4 Putative
                     glucose sensor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455315.1"
                     /db_xref="GeneID:2895755"
                     /db_xref="GOA:Q6CL74"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CL74"
                     /translation="MTTDSVPRKNISQAIKLVFLRRKAQERNEAGSSEVPTGGKSNNA
                     SATSSPEEALENSGENFELTNFASLSEMESEIFLAPPAKQSKKISILVGMFVAVGGFL
                     FGYDTGLINNISEMPYVNQKFAPNKNHFTTPQISILVSFLSLGTFIGALLAPLISDSY
                     GRKTTMIFSTFVVFMIGNSLQVAAGSMTILVVGRVLSGMSVGLISAAVPLYQSEAAQK
                     SVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYIWSFLLGVGILFL
                     PESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEELVEIKATYDYEMSFGKISYLDC
                     FRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVSESYLVSFVTYAV
                     NVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLATDSMVANKVMIAFICLF
                     IASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLINFICALITPYIMHIDSSVR
                     QTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLEEIDELYKKSSSGINSIEWNKKI
                     KAFPDLFQRTRPNNEGDGEADDNIHTDENYNHTISSYNGTQNNEKYPIQVQMPQFGVR
                     NIEFLNTTGSSPQSDMTEPNFVDLGNGLGITTYQRGPPSVLTDSSEEEEEGQQQETDE
                     TEEGKSFKHQYTDARNKNRGERGSFNSNSSTSGTTRSSSHKASVQRMEEINLYMAQLM
                     HRGGTEDLSRNTTDNTHQPISHDIMSQWNSSSQNKGPSTQTDINSNT"
     gene            <513318..>514319
                     /locus_tag="KLLA0_F05203g"
                     /db_xref="GeneID:2895756"
     mRNA            <513318..>514319
                     /locus_tag="KLLA0_F05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455316.1"
                     /db_xref="GeneID:2895756"
     CDS             513318..514319
                     /locus_tag="KLLA0_F05203g"
                     /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
                     YDL193W NUS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455316.1"
                     /db_xref="GeneID:2895756"
                     /db_xref="GOA:Q6CL73"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:Q6CL73"
                     /translation="MSTESDLKSRVPPATKTPLDVSVSGLKKTVTQVMNTDVDDVLKR
                     KNINTNQKFSGKIEYAIYKTLLIFLYVIYAITRYFQREYNRIAIKLLDLAYNPSNSPQ
                     LIRQDVNKLQKIPKRLAAILESKPEGDIGGGLPGLINDASDVVCWTVSAGIKHLILYD
                     YDGKMKQNVHELRAGIHHKLAKYFGLDNVPKFAIKIPHTNQIFFDKDEDQKDLSPEKS
                     TTKHKVAVEISLLSKVDGRDTILELTKTMADLCAKGQLKVEDVDTKLVNQELTQLVGH
                     EPDLLLFFGPALDLQGFPPWHIRLTELYWETDNDQVSYYVFIRGLKQYADCKMNVGK"
     gene            <515391..>515936
                     /locus_tag="KLLA0_F05225g"
                     /db_xref="GeneID:2895757"
     mRNA            <515391..>515936
                     /locus_tag="KLLA0_F05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455317.1"
                     /db_xref="GeneID:2895757"
     CDS             515391..515936
                     /locus_tag="KLLA0_F05225g"
                     /note="highly similar to uniprot|P11076 Saccharomyces
                     cerevisiae YDL192W ARF1 ADP-ribosylation factor GTPase of
                     the Ras superfamily involved in regulation of coated
                     formation vesicles in intracellular trafficking within the
                     Golgi functionally interchangeable with Arf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455317.1"
                     /db_xref="GeneID:2895757"
                     /db_xref="GOA:Q6CL72"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CL72"
                     /translation="MGVSFSKLFSNLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAE
                     AREVLQRMLNEDEIRNAVLLVFANKQDLPEAMPAAEITEKLGLHSIRQRPWYIQATCA
                     TSGEGLYEGLEWLSTTLKNQS"
     gene            <517241..>518135
                     /locus_tag="KLLA0_F05247g"
                     /db_xref="GeneID:2895758"
     mRNA            join(<517241..517243,517776..>518135)
                     /locus_tag="KLLA0_F05247g"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_455318.1"
                     /db_xref="GeneID:2895758"
     CDS             join(517241..517243,517776..518135)
                     /locus_tag="KLLA0_F05247g"
                     /note="highly similar to uniprot|P39741 Saccharomyces
                     cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_455318.1"
                     /db_xref="GeneID:2895758"
                     /db_xref="GOA:Q6CL71"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="UniProtKB/TrEMBL:Q6CL71"
                     /translation="MAGIKAYELRTKSKDQLEQQLVELKKELAELKVQKLSRPSLPKI
                     NTVRKNIARVLTVISQNQRQAVRELYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
                     KQRKKQIAFPQRKYAIKA"
     gene            complement(<518381..>521254)
                     /locus_tag="KLLA0_F05269g"
                     /db_xref="GeneID:2895759"
     mRNA            complement(<518381..>521254)
                     /locus_tag="KLLA0_F05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455319.1"
                     /db_xref="GeneID:2895759"
     CDS             complement(518381..521254)
                     /locus_tag="KLLA0_F05269g"
                     /note="similar to uniprot|P54860 Saccharomyces cerevisiae
                     YDL190C UFD2 Ubiquitin chain assembly factor (E4)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455319.1"
                     /db_xref="GeneID:2895759"
                     /db_xref="GOA:Q6CL70"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:Q6CL70"
                     /translation="MTLMRDIFMVTLDPNDSKGCTYVGDIEDVSDLSADCVDPIVLYQ
                     LTENESLQEQPLKYLNSCFQRCQQSKRISKKNLDEQQTITLQEIDRLIVGYALVCFQI
                     EEFAIKGSFQQYISDILQDLDKFTDLLTAMINRSIQEGTAFDFVDNFFQTVQVYIGKV
                     DATEGFDLNNSTLYNKVLTLFELFVSFKPVATIFTKLTGFFADYSTAANQYEKVTLLG
                     PILSLSPLQTAVALKNYVDPDSQNQQQINMIHTSLHTEHNVVLQRLFYIVDKIIRASP
                     ESRSDLLSYLGQIVNKNHLRRGDHAQVNKLASNSFMTNITLMLIKFSLPFLDVSYKKI
                     DKIDVNYFNNLNLYIDLNQETRMNSDAKEADEFYDQNKKTNEEEPNFISHCFFLTLTY
                     LHYGIGGTILFDERYAPEVTKLKEHLTHLRQVINNSQNSMMARFGEIQLKQLEKRYHH
                     LSSVRSSCQGFFSNKTVHLEVFDFIAGASTFLMRVIDPYHQYPFKTIDLPLIPDQIGV
                     ENVDNAEYLRKNAPVPFKYYPEFVIEGSINYCQYVTKYVQNPLFRNPRLHSYIELATM
                     ILRCPELISNPHLKGKMVQVLSIGAMPMSDNSPGFMMEIFEHNDIVLKNLLYGLLDFY
                     VIVEKTGSSSQFYDKFNARYSISIILEALYEIPHYRNQLLWQSQNNSDFFVRFVARML
                     NDLTFLLDEGLTTLADVHNIQLELENRAKGLPPSREEETQELQNRLKSAERQAKSSCG
                     LSEKSLVLFNIFTKHIPKAFSTPEIVDRLAAMLDYNLESLVGSKCRELKVKDPSKYQF
                     NPKTLLQTLATIYINLADEQEFIAAVARDGRSFNKELFKKAVHILSVKTGLFSEEMCH
                     KLIYFADSAEKTRLLEEEEDLEMGDAPEEFLDPLMYTIMKDPVILPTSKVTIDRSTIK
                     AHLLSDSTDPFNRSPLKLEEVIPNVELKEKILEFRKSKRSKKE"
     gene            <522324..>523601
                     /locus_tag="KLLA0_F05291g"
                     /db_xref="GeneID:2895760"
     mRNA            <522324..>523601
                     /locus_tag="KLLA0_F05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455320.1"
                     /db_xref="GeneID:2895760"
     CDS             522324..523601
                     /locus_tag="KLLA0_F05291g"
                     /note="weakly similar to uniprot|Q870H2 Saccharomyces
                     cerevisiae YDL189W RBS1 Protein of unknown function
                     identified as a high copy suppressor of psk1 psk2
                     mutations that confer temperature-sensitivity for
                     galactose utilization proposed to bind single-stranded
                     nucleic acids via its R3H domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455320.1"
                     /db_xref="GeneID:2895760"
                     /db_xref="GOA:Q6CL69"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:Q6CL69"
                     /translation="MEELKVTPALLIALFQKPQDRVFLIDLENSVLDFVESSAYTYQL
                     KPMNSYYRLLSHQVAEYHGLQHTVSKDNDKCVIVYKQNDYEPNANLILLQELEPQVMY
                     QFPPEYYALASMAAANNQQQLIHKTIRQKPRQSSQHHTPVSAPEHVSDNQTTRDNAQV
                     TDDKSAEGVSPAAAALRMSIKKKVKILKREVETDSGQSRDLSHEATTSTSIENTLEEE
                     KGAGSNKDSTVIDLEEQRRIKEQQYNEEKEKIFSGSPSSLTPVSTPPATPVTLNSASG
                     SNGEADDSPQPHQFETSRFNLNHQNEMKYMKKTQYQHNNKRQNSHNNRYNKPLNRQPV
                     MHPYYGVPPPMAPMRPDSIPFGYQMVAPMEYMYYPIGAPMTNNRMMIPGQPMYAMPPP
                     VFQPYEKKNSGKNDSNGYKKNGKPINEARHFRC"
     gene            complement(<523845..>524444)
                     /locus_tag="KLLA0_F05313g"
                     /db_xref="GeneID:2895735"
     mRNA            complement(<523845..>524444)
                     /locus_tag="KLLA0_F05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455321.1"
                     /db_xref="GeneID:2895735"
     CDS             complement(523845..524444)
                     /locus_tag="KLLA0_F05313g"
                     /note="highly similar to uniprot|Q12434 Saccharomyces
                     cerevisiae YDL135C RDI1 Rho GDP dissociation inhibitor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455321.1"
                     /db_xref="GeneID:2895735"
                     /db_xref="GOA:Q6CL68"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:Q6CL68"
                     /translation="MSEEEEFKQFDEENDTYKVGEKKTVEEYKNLDADDEALRKWKDS
                     LGLGGDVLPLEHPGDERRVVIQKIQLIVDTEPAPITFDLTNEKTLKDLASKRYKIKEK
                     SIYHLKITFKVQHEIITGLRYVQYTKKAGIAVDKIDDHLGSYAPNTTKNPFYEVELPE
                     SEAPSGFLVRGNYSAVSKFIDDDKNNHLTLNWGVEIVKR"
     gene            <524979..>525563
                     /locus_tag="KLLA0_F05335g"
                     /db_xref="GeneID:2895736"
     mRNA            <524979..>525563
                     /locus_tag="KLLA0_F05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455322.1"
                     /db_xref="GeneID:2895736"
     CDS             524979..525563
                     /locus_tag="KLLA0_F05335g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455322.1"
                     /db_xref="GeneID:2895736"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="UniProtKB/TrEMBL:Q6CL67"
                     /translation="MTRLPSIDEFKSSSLNEQIDILDVLFEHSDSLVWFTLQNSRFMA
                     SGWNSYVELVNAIKDKLLKVCDDTEAEGISSRGVDHLANIVGAHPRLGDSKQKLSVHS
                     MKEQANLTGSTVDSLEILTWLKTLNDKYEKKYEGLKFVVFVNGRSYDRISKLMEQRIN
                     SNNTWFEECRIAINEMTDIAIDRLNKCSEIKGKI"
     gene            complement(<525923..>527005)
                     /locus_tag="KLLA0_F05357g"
                     /db_xref="GeneID:2895737"
     mRNA            complement(<525923..>527005)
                     /locus_tag="KLLA0_F05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455323.1"
                     /db_xref="GeneID:2895737"
     CDS             complement(525923..527005)
                     /locus_tag="KLLA0_F05357g"
                     /note="highly similar to uniprot|P23594 Saccharomyces
                     cerevisiae YDL134C PPH21 Catalytic subunit of protein
                     phosphatase 2A functionally redundant with Pph22p
                     methylated at C terminus forms alternate complexes with
                     several regulatory subunits involved in signal
                     transduction and regulation of mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455323.1"
                     /db_xref="GeneID:2895737"
                     /db_xref="GOA:Q6CL66"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6CL66"
                     /translation="MDVDTDVPMHDAVEDQLDSTLDEEAPGFDNGLASSSPGTSGIAD
                     NKATKPVELTGSSIGQLDAWLEKLSQCQCLSEEDVAKLCKMAVDVLQFEDNVQPVSVP
                     VTICGDVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVALKVRYPS
                     RITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLH
                     GGLSPMIETVDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDIS
                     EQFNHTNDLSLIARAHQLVMEGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEVDDTMN
                     RQFLQYNPSVRPGEPTVSRKTPDYFL"
     gene            <527893..>528615
                     /locus_tag="KLLA0_F05379g"
                     /db_xref="GeneID:2895738"
     mRNA            <527893..>528615
                     /locus_tag="KLLA0_F05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455324.1"
                     /db_xref="GeneID:2895738"
     CDS             527893..528615
                     /locus_tag="KLLA0_F05379g"
                     /note="some similarities with uniprot|P48568 Saccharomyces
                     cerevisiae YDL186W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455324.1"
                     /db_xref="GeneID:2895738"
                     /db_xref="UniProtKB/TrEMBL:Q6CL65"
                     /translation="MTETLDLSNSRWVFDQSLLQGDAQHAEKSQGQNLHHSEKSVREL
                     VISKQHTRVFPVDNQLMGRMEDQLVRWKRPASSHLGTVQVIEGTHPYQQEPISMSQTW
                     SQIRDAFSTRMQRNSINDTQEDEEEDLDGLDLGNTEIWNYKDKAFTTERIDTYRSNII
                     DEYNATTSMTAKAVPVTLKLPARTDDMTINSQYTYHYPIPQYYLPHSQQQQNNNNVTN
                     SRQMTQASQDASFSCSSWLCFT"
     gene            <529272..>532355
                     /locus_tag="KLLA0_F05401g"
                     /db_xref="GeneID:2895739"
     mRNA            <529272..>532355
                     /locus_tag="KLLA0_F05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455325.1"
                     /db_xref="GeneID:2895739"
     CDS             529272..532355
                     /locus_tag="KLLA0_F05401g"
                     /note="highly similar to uniprot|P17255 Saccharomyces
                     cerevisiae YDL185W TFP1 Vacuolar ATPase V1 domain subunit
                     A protein precursor is spliced to yield the extein Tfp1p
                     and the intein Vde (PI-SceI) which is a site-specific
                     endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455325.1"
                     /db_xref="GeneID:2895739"
                     /db_xref="GOA:Q6CL64"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004042"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR007868"
                     /db_xref="InterPro:IPR007869"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027434"
                     /db_xref="InterPro:IPR028992"
                     /db_xref="UniProtKB/TrEMBL:Q6CL64"
                     /translation="MAGALENARKELKRVTLEDHEESEYGAIYSVSGPVVIAENMIGC
                     AMYELVKVGHDNLVGEVIRIDGEKATIQVYEETTGVTVGDPVLRTGKPLSVELGPGLM
                     ETIYDGIQRPLKAIKDISQSIYIPRGIDAPALSRTIKWQFTPGKFKVGDHISGGDIFG
                     SIFENSLLDDHKILLPPRARGTVTWIASAGEYTVDEKILELEFDGVKYDYSMYHTWPV
                     RVPRPVTEKLSADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNS
                     DAIIYVGCFSKGTEVMMGDGKDELIENIQVGDEVMGRDGLPRQVVGLPRGHDDMYQVT
                     EKSEDNETAKISFQCNSSHKLVLVTPQDIRLTESKEKVTVAFNRLADISVGNGTESRT
                     VRLVERAEKSFANAESNQAIINAAEFVTTIDTTSIEWTLEARDMLLVDSSIREVTQQL
                     INPVLLEKEHLAGVLKSNDFQSSLAPQFSYLLGAFVGSSGKDNSEYLQQLSAQFDKKI
                     VAEKSIDVQSNGKTVGTASIVISQEPVQENKRRKVAQVSLVSKIVQESFSSGIPSFMM
                     SENINVRESFLAGIVDSQNQKLDDTVALKTLSVKTHDGIARLARSLGIRVSGKKQNQE
                     YTLTLSGDALKSVSNWTSTSNIEKVDVIHKAQPISFDLEKIESADYFGVTLAEESDHK
                     FLLSNMTLVHNCGERGNEMAEVLMEFPELFTEISGRKEPIMKRTTLVANTSNMPVAAR
                     EASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAK
                     LASFYERAGKAVALGSPDRIGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKL
                     AQRKHFPSINTSVSYSKYTNVLNKYYEKNYPEFPVLRDRMKEILSNAEELEQVVQLVG
                     KSALSDGDKITLDIASLIKEDFLQQNGYSTYDAFCPIWKTYDMMKSFISYHDEAQKSV
                     SNGANWAKLSEATRDVKHAVSSSKFFEPSRGEEEVHAEFEKLLTNIQDRFAESTD"
     gene            complement(<533977..>534867)
                     /locus_tag="KLLA0_F05423g"
                     /db_xref="GeneID:2895740"
     mRNA            complement(<533977..>534867)
                     /locus_tag="KLLA0_F05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455326.1"
                     /db_xref="GeneID:2895740"
     CDS             complement(533977..534867)
                     /locus_tag="KLLA0_F05423g"
                     /note="similar to uniprot|P48569 Saccharomyces cerevisiae
                     YDL183C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455326.1"
                     /db_xref="GeneID:2895740"
                     /db_xref="InterPro:IPR018786"
                     /db_xref="UniProtKB/TrEMBL:Q6CL63"
                     /translation="MIKIRSFSAYSKAYNKSSTIQQYVNDPVKLLVIPITNKQSFIYF
                     KYSNELLNKESALIRYETKLSQKAANLWYSVQASQKSYNKKIVSTVTKLLDQIPWTEN
                     SLRTIPSESYILKQIENGTKDNVTLNEYVKAKNDDSVISLKPKPIHVYFPRSVVDEST
                     IIAQLKQLSKKGQQYHKKHALLCALGIPISLPLILIPVVPNVPGIYLTYRLYCNLKAY
                     FGAKHLESLITSEEQKFEFINLEQYSDILKESKKEKHESDGEKLLLSEHDLDRVLDSL
                     EIHEMSTDLRKAIRQESVHK"
     gene            <535675..>537105
                     /locus_tag="KLLA0_F05445g"
                     /db_xref="GeneID:2895741"
     mRNA            <535675..>537105
                     /locus_tag="KLLA0_F05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455327.1"
                     /db_xref="GeneID:2895741"
     CDS             535675..537105
                     /locus_tag="KLLA0_F05445g"
                     /note="weakly similar to uniprot|Q12516 Saccharomyces
                     cerevisiae YDL133W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455327.1"
                     /db_xref="GeneID:2895741"
                     /db_xref="UniProtKB/TrEMBL:Q6CL62"
                     /translation="MTSDGINHLAVPKESNGKISRVSTKNSKDSLSTDVSNADSKQYP
                     EILNAYSLYPRTVPPFAVDTCANSGSKQYPKRSECDQMFKDTFLMSHSDKWSEFLQNA
                     GSNPSYTSRIILDKPKTESSGAGTRGQSTIVSNSSSSLGKNVDEKEIKGHGIVVDEET
                     NKHTDTHAVDTEDGTAYYYGHTTDSSYDEEVERVRQEIFQNLDGDWEGGKRLDAIFNA
                     PIPESYELSNQRDKNEWLKYVSQLKAFYYLNKDSAKQSSETHSSDDGRFHSILNKGRN
                     SVNSKKNSWATLEQRKKQQWLPRLRRLLLQSQYLPLSLRFLIVILCIISLGLASRIYQ
                     NSDSTVESFESSIPQQPSTIMALCVNSIAILYLVYIGYDEFSGKPLGIRDPMTKVRLI
                     MLDLLFIIFSSANLSLTFNTLYDNRWVCTSTGTSQVDPPHVGYICDKQRALAAFLFLV
                     LVTWVVTFSISILRVVERVSSGAPRP"
     gene            <537921..>540359
                     /locus_tag="KLLA0_F05467g"
                     /db_xref="GeneID:2895742"
     mRNA            <537921..>540359
                     /locus_tag="KLLA0_F05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455328.1"
                     /db_xref="GeneID:2895742"
     CDS             537921..540359
                     /locus_tag="KLLA0_F05467g"
                     /note="similar to uniprot|Q12018 Saccharomyces cerevisiae
                     YDL132W CDC53 Cullin structural protein of SCF complexes
                     (which also contain Skp1p Cdc34p and an F-box protein)
                     involved in ubiquitination SCF promotes the G1-S
                     transition by targeting G1 cyclins and the Cln-CDK
                     inhibitor Sic1p for degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455328.1"
                     /db_xref="GeneID:2895742"
                     /db_xref="GOA:Q6CL61"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q6CL61"
                     /translation="MADTLPRSDDLEATWNFVKPGIDQILDRDGTSDIKTNRVQKVLS
                     PRMYMEVYTAIYNYCVNKSRSTGHFQSDIIGKQMNQSSILVGGEIYENLKNYLKDYIS
                     NLKKDDNVTFLNFYVRRWERFTIGAIFLNRVFDYMNRYWVQKERSDGKRHIFDAHTLC
                     LMTWKEVMFETHKTELVTEIFDQLDLQRRGELVNKSAITIAIKSFVILGIDPSDLKKL
                     NLNVYIQNFEQPFLQKTKEYYTKMSNEFLDSHSVSEYIEKANECIIFEEKDMILYLDS
                     HTSAPLSTALNQVLIADHADKLKKEFILLLDKQDQRLIKLIYELMKRDYRMLPDLVDT
                     FDMYIKRVGNEEIDKLIDAHNKSAAQDSNAKRQPGLSPRDYLKCLIGVYKLFYNITIE
                     CFENHPAFAKALDYGCRCFINNNSFAIPPGSPKFATSRAPEMLAKYSDQLLKKSTKNN
                     EQVDLTVDDIMTVFKFLADKDAFEMHYRKNLAKRLIHGSSKSEADEEIIIQRLQSENS
                     LEYTSKITKMLQDVKLSKNLHDEFSTFISQDGNNTTSAATFRSKVPELEPLILADNVW
                     PFSYQPTEFALPPVLEHSKNKLETMYTDKHSGRILKWLWPMSRGEIKAHIGKPGKPPF
                     QFTVTIFQMAILTLFNDISTLTFEQIQERTNLKATQIASNMYPFVKMKLLIQSPEGVE
                     SMIKLDTKYTLNKPYRLSKTSVNFAAAVKNDLTFTATVNGSALDETEASEQKKAEKEL
                     NQQRLMFLRACIVRIMKAKRKLPHSSLMNECIAESQQRFNAKVSMIKKAVDNLIEQEY
                     LKRTDDGECYEYLA"
     gene            <541146..>542471
                     /locus_tag="KLLA0_F05489g"
                     /db_xref="GeneID:2895743"
     mRNA            <541146..>542471
                     /locus_tag="KLLA0_F05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455329.1"
                     /db_xref="GeneID:2895743"
     CDS             541146..542471
                     /locus_tag="KLLA0_F05489g"
                     /note="highly similar to uniprot|Q12122 Saccharomyces
                     cerevisiae YDL131W LYS21 and to uniprot|P48570
                     Saccharomyces cerevisiae YDL182W LYS20 homocitrate
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455329.1"
                     /db_xref="GeneID:2895743"
                     /db_xref="GOA:Q6CL60"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CL60"
                     /translation="MSSNQDFQPVTESASSVTKFQQNPYGPNPADYLSNVNNYQLIDS
                     TLREGEQFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSRRDCEAICKLGLKA
                     KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVK
                     SKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLK
                     SVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVAVLGIGERNGITPLGGLMARMIV
                     AAPEYTKSKYKLHKIRDIENLIAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPS
                     TYEILDPHDFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVTAKIKKLGDIR
                     PLNIDDVDSIIKDFHAEVSTPQLRAVRRDDNDVNDIDIQEPSNKKTKVE"
     gene            <543219..>543488
                     /locus_tag="KLLA0_F05511g"
                     /db_xref="GeneID:2895744"
     mRNA            <543219..>543488
                     /locus_tag="KLLA0_F05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455330.1"
                     /db_xref="GeneID:2895744"
     CDS             543219..543488
                     /locus_tag="KLLA0_F05511g"
                     /note="weakly similar to uniprot|P01097 Saccharomyces
                     cerevisiae YDL181W INH1 Protein that inhibits ATP
                     hydrolysis by the F1F0-ATP synthase inhibitory function is
                     enhanced by stabilizing proteins Stf1p and Stf2p has
                     similarity to Stf1p and both Inh1p and Stf1p exhibit the
                     potential to form coiled-coil structures"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455330.1"
                     /db_xref="GeneID:2895744"
                     /db_xref="GOA:Q6CL59"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="UniProtKB/TrEMBL:Q6CL59"
                     /translation="MLSRSTRSILTRASKVQPAALRMYSSSEGSVGSTRSDGSSDAFT
                     KREKAQEDFYVKQHEKEQLAQLREQLKQQQKKIDNLEEKLDNITK"
     gene            544290..544361
                     /locus_tag="KLLA0_F05533r"
                     /db_xref="GeneID:2895745"
     tRNA            544290..544361
                     /locus_tag="KLLA0_F05533r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2895745"
     gene            <544997..>545311
                     /locus_tag="KLLA0_F05555g"
                     /db_xref="GeneID:2895746"
     mRNA            <544997..>545311
                     /locus_tag="KLLA0_F05555g"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_455332.1"
                     /db_xref="GeneID:2895746"
     CDS             544997..545311
                     /locus_tag="KLLA0_F05555g"
                     /note="highly similar to uniprot|P10622 Saccharomyces
                     cerevisiae YDL130W RPP1B Ribosomal protein P1 beta a
                     component of the ribosomal stalk which is involved in the
                     interaction between translational elongation factors and
                     the ribosome accumulation of P1 in the cytoplasm is
                     regulated by phosphorylation and interaction with the P2
                     stalk component"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_455332.1"
                     /db_xref="GeneID:2895746"
                     /db_xref="GOA:Q6CL57"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q6CL57"
                     /translation="MSDAVISYASLILADAGLDVTADNLLTLTKAAGASIDNVWAETF
                     AKALEGKDIKEILSGFHAAGPAAPAAGAGAASGDSEAAAEEAPESEKEESDDDMGFGL
                     FD"
     gene            <546398..>547198
                     /locus_tag="KLLA0_F05588g"
                     /db_xref="GeneID:2895306"
     mRNA            <546398..>547198
                     /locus_tag="KLLA0_F05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455333.1"
                     /db_xref="GeneID:2895306"
     CDS             546398..547198
                     /locus_tag="KLLA0_F05588g"
                     /note="weakly similar to uniprot|Q07555 Saccharomyces
                     cerevisiae YDL129W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455333.1"
                     /db_xref="GeneID:2895306"
                     /db_xref="UniProtKB/TrEMBL:Q6CL56"
                     /translation="MRTLRSRSDKSESTCNSASSSVDTRGRMQTITPEEPGKLEYELD
                     AASAAGNNNVRSRSQSMALLSDELQTEYDVLQDTEHSLRNTRLLELDIAKAVSDLETI
                     EPRTEDTVRIIALLNRSLSAISHWSLQAQLSHWENRKEKDERFAVEKNLVKKEAEYFK
                     NKLLESEKLQKQTQSQLDLSSETSKLVSSAPITGGSPATEATLLSPRRVVKQRKIASP
                     RRNNTRAHTPVSTLKLVENTKPHPRLKRNLNDQTNQDLIRVFHLEKGR"
     gene            <548033..>549529
                     /locus_tag="KLLA0_F05610g"
                     /db_xref="GeneID:2895307"
     mRNA            <548033..>549529
                     /locus_tag="KLLA0_F05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455334.1"
                     /db_xref="GeneID:2895307"
     CDS             548033..549529
                     /locus_tag="KLLA0_F05610g"
                     /note="similar to uniprot|Q12301 Saccharomyces cerevisiae
                     YDL180W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455334.1"
                     /db_xref="GeneID:2895307"
                     /db_xref="UniProtKB/TrEMBL:Q6CL55"
                     /translation="MALLSYAADLYMPLFCSSRTSVVVLNLINLLAIYSLVYWSSDFL
                     QARYDVPDIFVPNSQDYFRTSLLGFLSPFLLHFIKSFLFNINPRYLAVDILINFTFND
                     WFMLLIIFSLAYPQLQESKPNEELVNLVRNNGHIPTVWHIIPKQCYIFGISWSFSEVI
                     ISVMETLYNYEEVSSISEQDAKAKATSANSDSSEDIRKEIELDKCVSVRMLRSKISKN
                     VYNSGYGATNVGTTLSNNGSVNQDSNSDESSMIINFNTDSMNFLKDIESHGNDLNTRH
                     GIPLRPRSFSYQQFPHRQIKMFPRIQNWKELIGKLLLSNLLHLDYIVSNIGQSLLMSI
                     YFIYVPSHPSLFTKVVICFGSKTFTNFLLCIIIPFITLHVVYHVFLYTWRDLVSNNVE
                     PSAIRAQTQMSDYTYGSIRSPLMLQSSNNVASVSSSPENILLYHSIHPPADTQFQTDD
                     GRLLRLSRTIVTYWQSLASKSWLIPIGLTVWSVTVFVLGIMATIKFNG"
     gene            <550145..>551365
                     /locus_tag="KLLA0_F05632g"
                     /db_xref="GeneID:2895308"
     mRNA            <550145..>551365
                     /locus_tag="KLLA0_F05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455335.1"
                     /db_xref="GeneID:2895308"
     CDS             550145..551365
                     /locus_tag="KLLA0_F05632g"
                     /note="similar to uniprot|O13581 Saccharomyces cerevisiae
                     YDL128W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455335.1"
                     /db_xref="GeneID:2895308"
                     /db_xref="GOA:Q6CL54"
                     /db_xref="InterPro:IPR004713"
                     /db_xref="InterPro:IPR004798"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:Q6CL54"
                     /translation="MDSSAPLLSSTGAGIRRSSSALVRCIEVSKVVFHSSPVNYLLVF
                     VPLGLIFGYGQLSTTWVFVFNFMAIIPLAAILAFATEQLSEKAGSTLGGLLNATLGNA
                     VELIVSIIALKEGQIRIVQASMLGSLLSNLLLVLGFCFLFGGYNRVQQKFNQTAAQTM
                     SSLLAISSASLLIPAAFKATLPHDKGTSHLVDDKILSLSRSTSIVLLVVYVLFLIFQL
                     GSHRVMFEEQTEETEEVLNIHQQHEQISESMSLRSSLIFLAITTILVSICADFLVGTI
                     DDIVVSTGLSKTFIGLIVIPIVGNAAEHVTSVIVAMKDKMDLALSVAIGSSLQIALFV
                     TPFMVLVGWAIDVPMTLNFSTFETVIMLVSVFLSNYLILDGESNWMEGSMSLAMYALV
                     ALAFFYYPDEQAVN"
     gene            <552056..>552991
                     /locus_tag="KLLA0_F05654g"
                     /db_xref="GeneID:2895309"
     mRNA            <552056..>552991
                     /locus_tag="KLLA0_F05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455336.1"
                     /db_xref="GeneID:2895309"
     CDS             552056..552991
                     /locus_tag="KLLA0_F05654g"
                     /note="weakly similar to uniprot|P25693 Saccharomyces
                     cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
                     cyclin-dependent kinase (Cdk) to contribute to entry into
                     the mitotic cell cycle essential for cell morphogenesis
                     localizes to sites of polarized cell growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455336.1"
                     /db_xref="GeneID:2895309"
                     /db_xref="GOA:Q6CL53"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q6CL53"
                     /translation="MSEHQALLQFNKQVVNLEMVHFLAATTASVISINDTDVRHGSTV
                     SLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAK
                     NLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNLNFSMQELVQALSHFLVPI
                     QYQLSTKKSIQNQGANKNCSHLLFNAPVSGQTKNFLNTEAHSRSSSHMSIPSLSSSNT
                     LSTIDSMASSSSSLAYSSSSGSSSSSGSSLSQSKLKVISEEPSAKVTPRKKFGLTKPI
                     MLNSKSCTDFKALPAHAVTNTNNISSKSGWASIFH"
     gene            complement(<553406..>555898)
                     /locus_tag="KLLA0_F05676g"
                     /db_xref="GeneID:2895310"
     mRNA            complement(<553406..>555898)
                     /locus_tag="KLLA0_F05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455337.1"
                     /db_xref="GeneID:2895310"
     CDS             complement(553406..555898)
                     /locus_tag="KLLA0_F05676g"
                     /note="highly similar to uniprot|P25694 Saccharomyces
                     cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane and
                     cytosol with homology to mammalian p97 in a complex with
                     Npl4p and Ufd1p participates in retrotranslocation of
                     ubiquitinated proteins from the ER into the cytosol for
                     degradation by the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455337.1"
                     /db_xref="GeneID:2895310"
                     /db_xref="GOA:Q6CL52"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q6CL52"
                     /translation="MPEEHKKLLDSSGTAADADDATATAILRRKKKQNMLLVDDAVND
                     DNSIIAINSNTMDLLQLFRGDTVLVKGKKRKDTVLIVMIDDELEDGVCRVNRVIRNNL
                     RIRLGDLVTIHPCTDIKYASRISVLPIADTIEGLTGNLFDVYLKPYFVEAYRPVRKGD
                     HFIVRGGMRQVEFKVVDVEPEEYGVVAQDTVIHSEGEPINREDEENNINEVGYDDIGG
                     CRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVANETGAFF
                     FLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRV
                     VSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVTGRLEVLR
                     IHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAE
                     VLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVL
                     HPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESE
                     SNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAK
                     KNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDETGRLSILSAQLRNTPLEPGLDL
                     KTIAQATQGFSGADLLYIVQRAAKFAIKDSIEAQKRAEVVKKEEGAEETEKVKTEEDV
                     EMSDVQQEDPVPFITKEHFTEAMKTAKRSVTDTELRRYEAYAQQMKASRGQFGNFSFG
                     DDSGAAATQAGAEGSGAAFGDAAGEDDDDLYS"
     gene            complement(<556540..>557134)
                     /locus_tag="KLLA0_F05731g"
                     /db_xref="GeneID:2895313"
     mRNA            complement(join(<556540..556934,557083..>557134))
                     /locus_tag="KLLA0_F05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455340.1"
                     /db_xref="GeneID:2895313"
     CDS             complement(join(556540..556934,557083..557134))
                     /locus_tag="KLLA0_F05731g"
                     /note="highly similar to uniprot|Q04344 Saccharomyces
                     cerevisiae YDL125C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455340.1"
                     /db_xref="GeneID:2895313"
                     /db_xref="GOA:Q6CL49"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q6CL49"
                     /translation="MSAVAHDAACIFCKIIKGEIPSFKLVETQYSYSFLDIQPTEENH
                     ILIIPKHHGGKLHNIPDEYLADLLPVTKKLVKAIGFDQDGPDGPGYNVLQNNGRIAHQ
                     EVDHVHFHLIPKKTKDAGLIVGWPAQETDFAKLSEMHKKLLAKLET"
     gene            <558009..>559640
                     /locus_tag="KLLA0_F05753g"
                     /db_xref="GeneID:2895314"
     mRNA            <558009..>559640
                     /locus_tag="KLLA0_F05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455341.1"
                     /db_xref="GeneID:2895314"
     CDS             558009..559640
                     /locus_tag="KLLA0_F05753g"
                     /note="highly similar to uniprot|P46681 Saccharomyces
                     cerevisiae YDL178W DLD2 D-lactate dehydrogenase located in
                     the mitochondrial matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455341.1"
                     /db_xref="GeneID:2895314"
                     /db_xref="GOA:Q6CL48"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="UniProtKB/TrEMBL:Q6CL48"
                     /translation="MIRASIRASSRVSSRLLACKNCYVPVSQRITSALVSGSAVNNNI
                     RFYSDKPQPKLTVENYPNIKRLESFKKLGKEDLDYFKTILSQQEILEANENEDLAFYN
                     EDWMRKYRGQSKLVLRPKTTEQVSKILKYCNEQNLAVVPQGGNTGLVGGSVPVFDEIV
                     LSLTQLNKIREFDEVSGILKCDAGVILEAADMFLAERGYIFPMDLGAKGSCHVGGIVA
                     TNAGGLRLLRYGSLHGTVLGLEVVLPNGEIVNSMNALRKDNTGYDLKQLFIGSEGTIG
                     VVTGVSILCPIRPNAFNVSFLGVESYEAVQKVFVQAKKELGEILSAFEFMDLKSQNLT
                     KIHLADMDHPLADDHPFYILIETSGSKKEHDDAKLEAFLESAMEDGLVVDGVVAQDET
                     ELKNLWQWREMIPESSQAGGGVYKYDVSLPLKDLYSLVDAANARLEEHGLLSIDDESK
                     PVISAVGYGHVGDGNLHLNVAVRRYTKEVEKCLEPFVYEFVSSKNGSISAEHGLGFQK
                     KNYIGYSKSEQEIKMIKQLKNLYDSNTILNPYKYV"
     gene            <560270..>561199
                     /locus_tag="KLLA0_F05775g"
                     /db_xref="GeneID:2895315"
     mRNA            <560270..>561199
                     /locus_tag="KLLA0_F05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455342.1"
                     /db_xref="GeneID:2895315"
     CDS             560270..561199
                     /locus_tag="KLLA0_F05775g"
                     /note="highly similar to uniprot|Q07551 Saccharomyces
                     cerevisiae YDL124W NADPH-dependent alpha-keto amide
                     reductase reduces aromatic alpha-keto amides aliphatic
                     alpha-keto esters and aromatic alpha-keto esters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455342.1"
                     /db_xref="GeneID:2895315"
                     /db_xref="GOA:Q6CL47"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6CL47"
                     /translation="MTTQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDI
                     VKKTLDTVPGVVHIDAAEIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKV
                     ALETSLKKLGVDYVDLYLLHSPIIKESKLDVEANWKYLEELYKSGKAKNIGVSNFAVK
                     DLEKLLAVAEVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDA
                     DKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLAN
                     EEVQKITQLGLQHPALRLYWTDVYSKYDSESQK"
     gene            complement(<561393..>561914)
                     /locus_tag="KLLA0_F05797g"
                     /db_xref="GeneID:2895269"
     mRNA            complement(<561393..>561914)
                     /locus_tag="KLLA0_F05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455343.1"
                     /db_xref="GeneID:2895269"
     CDS             complement(561393..561914)
                     /locus_tag="KLLA0_F05797g"
                     /note="similar to uniprot|Q12257 Saccharomyces cerevisiae
                     YDL177C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455343.1"
                     /db_xref="GeneID:2895269"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:Q6CL46"
                     /translation="MLRSYSYLRITRRYMTGIGWNESEVLVDRKSKFQARCHAIKNLS
                     EVDKLLEVLVEKNKAVQKATHKHMYAWRTADIIPPEHNKKGNKKRKRGSLTVPGELTG
                     PAMLKNIQQGSNDCGEAGAGQRLLTLLERSHIANVLVVVTRWYGGTALGPARFRHIST
                     TAVESLKKGKFLP"
     gene            <562259..>564289
                     /locus_tag="KLLA0_F05819g"
                     /db_xref="GeneID:2895270"
     mRNA            <562259..>564289
                     /locus_tag="KLLA0_F05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455344.1"
                     /db_xref="GeneID:2895270"
     CDS             562259..564289
                     /locus_tag="KLLA0_F05819g"
                     /note="similar to uniprot|Q12027 Saccharomyces cerevisiae
                     YDL176W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455344.1"
                     /db_xref="GeneID:2895270"
                     /db_xref="UniProtKB/TrEMBL:Q6CL45"
                     /translation="MQSNFTFLVSQPSCSKTTPSGYRAFQCKDDRIHPLKVNTKNRAA
                     DTNSIIQKFCYLRPRSMPIVPTSKYLHNQEHSDFLLVARNNGIIEIIKDYNFKVTNNV
                     PLRPDFLLFCVPMTSSITTNDTTIVGLEYKDKFLYVCSAVGDIFGFILNLPDDYVQDE
                     EFQASPSYKRYRDSFSWRSDIVQSSDATAAERSLKEITRFRKEHSCGHICYYCYPINE
                     DGFFHETIKQWYPDPVPTFSNCFVTFLRTDVSSFHINPMDRFSVITVAPQTPLTIHKI
                     LLPEVYTTFFSEFVKLKDEYFSKKHRRVSEPSSFDFMSRAVHGTAFQEYLKRDRSSFV
                     MEQDVRVWRGMLVCDMVCEFKCSSVWRQKQGNMKDGLHELFFYDKKQEANNRNESDSV
                     ARNETVVDLELDSQSFSLLGVSTEILDNHTQHQSNITQTERFLKFLRKQTFPINFQVV
                     KTVSLDGETNSTGYEAATSFLTDTYRDMDVVVVDKFLSVNAFRPKYVDEPLMKLDSIH
                     DYLEVNEEDRDAHVALNNLSSFIKFFMLTDSLCMIWDINGILLVDRFQLRSTRNLLHN
                     DVGAVKVINFRVGIVNDIGLVLNQFKQDGSDYYIEFYSILTTLTGDIALLRGEFKVGQ
                     RLGTMKILDSLRTQQSDNFVDQILITNYSLSNKRDAGMVIPEVFKMNKRSKT"
     gene            complement(<564453..>564866)
                     /locus_tag="KLLA0_F05841g"
                     /db_xref="GeneID:2895271"
     mRNA            complement(<564453..>564866)
                     /locus_tag="KLLA0_F05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455345.1"
                     /db_xref="GeneID:2895271"
     CDS             complement(564453..564866)
                     /locus_tag="KLLA0_F05841g"
                     /note="similar to uniprot|Q07549 Saccharomyces cerevisiae
                     YDL123W SNA4 Protein of unknown function localized to the
                     vacuolar outer membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455345.1"
                     /db_xref="GeneID:2895271"
                     /db_xref="GOA:Q6CL44"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:Q6CL44"
                     /translation="MCLCCICCTVSDLILYIVAIIFPPIAVGLRSGLCSSDLLLNVLL
                     TMFGFLPGMIHAFYYITVTSPLRTDTETRYYYEQGWNDGQRYGSPSAVTTVSHQPTGV
                     EDPLLPRTQIPLRYEPNNYAQDVPKGSPPPYTESV"
     repeat_region   565231..565675
                     /note="solo LTR"
                     /rpt_type=long_terminal_repeat
     gene            565690..565763
                     /locus_tag="KLLA0_F05874r"
                     /db_xref="GeneID:2895273"
     tRNA            565690..565763
                     /locus_tag="KLLA0_F05874r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2895273"
     gene            complement(<566005..>567054)
                     /locus_tag="KLLA0_F05896g"
                     /db_xref="GeneID:2895274"
     mRNA            complement(<566005..>567054)
                     /locus_tag="KLLA0_F05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455347.1"
                     /db_xref="GeneID:2895274"
     CDS             complement(566005..567054)
                     /locus_tag="KLLA0_F05896g"
                     /note="similar to uniprot|P40507 Saccharomyces cerevisiae
                     and similar to uniprot|Q12476 Saccharomyces cerevisiae
                     YDL175C AIR2 RING finger proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455347.1"
                     /db_xref="GeneID:2895274"
                     /db_xref="GOA:Q6CL42"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR016713"
                     /db_xref="UniProtKB/TrEMBL:Q6CL42"
                     /translation="MLSEVETADTLPFFKDSSPSYEITDRDKIIAPSITEVDSDPEKL
                     REIRGQGRYFGIEDGEDGIVEPLPKCNNCSQRGHLKKNCPHVICSYCGVMDDHYSTHC
                     PKTMRCSHCNEPGHYRQHCPVKWKRVFCTLCNSSKHSRDRCPSIWRSYCLKDSKQKRL
                     MPLHLIFCYNCGGKGHFGDDCMSARSSRVPNDDGSAFAGNNLPSSVRQDYGRNLKEYK
                     ERTANEYTYDDYDYDTYDFNYDGEDNYYYNNNKNKKQPAMDYGDAKPSNFYAPPYNKK
                     SKRSNYNHSNGSSNAPAPTVKGKVLPPKPTRSHPLDFPRNPNVNIPRYGSSSYQPSND
                     RYRKYNSYSGFKKRR"
     gene            <567803..>570037
                     /locus_tag="KLLA0_F05918g"
                     /db_xref="GeneID:2895275"
     mRNA            <567803..>570037
                     /locus_tag="KLLA0_F05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455348.1"
                     /db_xref="GeneID:2895275"
     CDS             567803..570037
                     /locus_tag="KLLA0_F05918g"
                     /note="highly similar to uniprot|P04801 Saccharomyces
                     cerevisiae YIL078W THS1 Threonyl-tRNA synthetase
                     cytoplasmic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455348.1"
                     /db_xref="GeneID:2895275"
                     /db_xref="GOA:Q6CL41"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:Q6CL41"
                     /translation="MSADNGVKVVAEQVQDLSLAGENKAVEAQAEKPLVNKKEKKKEK
                     HNGKNPLYLDPQPAFIDERIQMFDRLKKEYDDKVAAAPRVALTVVLKDGSTKEATAWE
                     TSPMDIAQQISKSFSERQCISKVNGELWDLERPLEGNEGDELKVEFFDFESDTGKKVF
                     WHSSAHVLGEACECNLGAHICLGPPTDDGFFYEFACRDSMDADSPERTVSQADFPNLE
                     SVSKNVIKQKQRFERLVMSKENLLKMFHYSKYKTYLVSTKIPDGGATTVYRCGSLIDL
                     CTGPHIPHTGRIKAFKLLKNSSCYFLGDNNNDSLQRIYGISFPDKKLMDAHLKFLAEA
                     SMRDHRKIGREQELFYFNEMSPGSCFWLPHGTRIYNTLVDLLRSEYRKRGYDEVITPN
                     MYNSKLWETSGHWANYKENMFSFEVEKETFGLKPMNCPGHCLMFKARERSYRELPWRV
                     ADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTQDQIENEIANIFDFLKYVYGVFGF
                     EFKMELSTRPEKYVGELETWNNAESKLETALKKWGGNWELNPGDGAFYGPKIDIMISD
                     ALKRWHQCATIQLDFQLPNRFELEFKTKELEGSDNYERPVMIHRAILGSVERMTAILT
                     EHFAGKWPFWLSPRQILVVPVGVKFQEYAQEVRDKMVEAGFYADVDLTGNTLQKKVRN
                     GQMLKYNFIFIVGEQEMTEKSVNIRNRDVMDLQGKNATVQVDAVINQLSKLKEEKRAD
                     NVLA"
     gene            complement(<570437..>571330)
                     /locus_tag="KLLA0_F05940g"
                     /db_xref="GeneID:2895276"
     mRNA            complement(<570437..>571330)
                     /locus_tag="KLLA0_F05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455349.1"
                     /db_xref="GeneID:2895276"
     CDS             complement(570437..571330)
                     /locus_tag="KLLA0_F05940g"
                     /note="weakly similar to uniprot|P40508 Saccharomyces
                     cerevisiae YIL077C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455349.1"
                     /db_xref="GeneID:2895276"
                     /db_xref="InterPro:IPR012470"
                     /db_xref="UniProtKB/TrEMBL:Q6CL40"
                     /translation="MQGDNAETQQNSQRSFPMGFGVDKAMQNPAVVNSPWFKKAYDNA
                     LEFYEKDKVLDPKDRLELSKTYLSVARAQLWSGWGAFAIVTGIPFVNQYMKTGAIKGT
                     KVTRAFALGFLSMFIGTQAGGSLAYKSKLKAAKPDILEDDPHLPKSSRQKQYEILKLL
                     NMGMPTRWANYYYMTYKNPERRIPDPRLVMDKLKEGNSGVRNSSVLFDNKDPMGLYTG
                     PQYDKKEGVPKTGVSQTTPPSQVTPRDDYDPFNDTETQEPTLSSWDKIRKENTAVDTK
                     NGKSWEEIRKHDYDNSDTNYK"
     gene            <571896..>572699
                     /locus_tag="KLLA0_F05962g"
                     /db_xref="GeneID:2895277"
     mRNA            <571896..>572699
                     /locus_tag="KLLA0_F05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455350.1"
                     /db_xref="GeneID:2895277"
     CDS             571896..572699
                     /locus_tag="KLLA0_F05962g"
                     /note="highly similar to uniprot|P25627 Saccharomyces
                     cerevisiae YCR047C BUD23 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455350.1"
                     /db_xref="GeneID:2895277"
                     /db_xref="GOA:Q6CL39"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CL39"
                     /translation="MSRPEDLAPPEVFYNDSESKKYSGSTRVQHIQAKMTLRALELLN
                     LPHTSYILDIGCGSGLSGEIITEEGHIWCGLDISPSMLAEALEREVEGDLMLHDIGQG
                     IPFRAGVFDAAISISVIQWLCNADTSYNDPKRRLMRFFNTLFASLKKGGKFVAQFYPK
                     NDDQIDQILGAAKVAGFSGGLVIDDPESKKNKKYYLVLSSGSTEQNEQVNLDGVKMDA
                     DLMVKRERKKKLVESSKDYINRKKEVMKKRGRKVALDSKFTGRKRRPRF"
     gene            <573009..>573524
                     /locus_tag="KLLA0_F05984g"
                     /db_xref="GeneID:2895278"
     mRNA            <573009..>573524
                     /locus_tag="KLLA0_F05984g"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="XM_455351.1"
                     /db_xref="GeneID:2895278"
     CDS             573009..573524
                     /locus_tag="KLLA0_F05984g"
                     /note="similar to uniprot|P25626 Saccharomyces cerevisiae
                     YCR046C IMG1 Mitochondrial ribosomal protein of the small
                     subunit required for respiration and for maintenance of
                     the mitochondrial genome"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="XP_455351.1"
                     /db_xref="GeneID:2895278"
                     /db_xref="GOA:Q6CL38"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:Q6CL38"
                     /translation="MLKRLLPTVIRQSVRSYQLPAKSGRKIIPVYPPVERISSPLVVK
                     TLADHDLKQLDPTGVKTEMVSKKNPNRLRAGDVLRVVYDSKKCNYDSFTGYVLSVDRK
                     PIVQDTSILLRDYIYKTCVEMRVPIFSPLVERIDLIRRADGKRRRSKHYYIRNTRLDV
                     GDLEASMRKKK"
     gene            complement(<574421..>575086)
                     /locus_tag="KLLA0_F06006g"
                     /db_xref="GeneID:2895279"
     mRNA            complement(<574421..>575086)
                     /locus_tag="KLLA0_F06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455352.1"
                     /db_xref="GeneID:2895279"
     CDS             complement(574421..575086)
                     /locus_tag="KLLA0_F06006g"
                     /note="similar to uniprot|P53721 Saccharomyces cerevisiae
                     YNR018W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455352.1"
                     /db_xref="GeneID:2895279"
                     /db_xref="GOA:Q6CL37"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:Q6CL37"
                     /translation="MKILTREEIDAHRHYTLMGGVKGAAAGLLISAAMFRFLPHRYPK
                     FNPKAMTWSVKTALFITPPTLLASIVAEESSNSFDKKMYGDSSSSDILAEHNRWKNLP
                     MSEKLVEGLSNNKYKIIVGAWAASLYGSWKLVDRDLYMTKAQKAVQARMYAQGITVIL
                     LLASIGLSMYEEKLHPDQKKEARDRRWQAALEHAEKEEEMAATAGYRSNEDRVKAKIF
                     KYD"
     gene            <576687..>578213
                     /locus_tag="KLLA0_F06028g"
                     /db_xref="GeneID:2895280"
     mRNA            <576687..>578213
                     /locus_tag="KLLA0_F06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455353.1"
                     /db_xref="GeneID:2895280"
     CDS             576687..578213
                     /locus_tag="KLLA0_F06028g"
                     /note="some similarities with uniprot|P25036 Saccharomyces
                     cerevisiae YOR003W YSP3 subtilisin-like protease III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455353.1"
                     /db_xref="GeneID:2895280"
                     /db_xref="GOA:Q6CL36"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:Q6CL36"
                     /translation="MRGILTLFVIWLHFVYPVICTEYLVSLKTPRALRYVFNFKIGGS
                     SVKELIESKIHREFSFGKFNAISVDIPPVLADKLKDVPFISDVVANVKISLFDEFPQI
                     ASGLNNDQYDFETEDEEEAEEDEGSDTYEDDDNYDEDTDNGDTDFSDDFISQSRAPRH
                     LARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEGRAMKG
                     IDTTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNIIEGLEY
                     VVNQCIGKKRKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGNSGLNACWYSPA
                     KVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGRGTFVLSGTSMASP
                     IVAGAAAIYLDQGADPAEVRKILSKTATRGVFKKRAIAVRPRTPNKVLYTGNNQEDDE
                     FAYAVYPMIDEIKFMDQLKQATSRVKPPSGEMINLVTHDRKILKPRLSKFLKKVSNNS
                     "
     gene            complement(<578912..>579571)
                     /locus_tag="KLLA0_F06050g"
                     /db_xref="GeneID:2895281"
     mRNA            complement(<578912..>579571)
                     /locus_tag="KLLA0_F06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455354.1"
                     /db_xref="GeneID:2895281"
     CDS             complement(578912..579571)
                     /locus_tag="KLLA0_F06050g"
                     /note="similar to uniprot|P32897 Saccharomyces cerevisiae
                     YNR017W MAS6 Essential protein of the mitochondrial inner
                     membrane component of the mitochondrial import system"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455354.1"
                     /db_xref="GeneID:2895281"
                     /db_xref="GOA:Q6CL35"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005681"
                     /db_xref="UniProtKB/TrEMBL:Q6CL35"
                     /translation="MSWLFGGKKSSTDSQENTTPVEQNDDKLKQTLGFDPSSISNVSN
                     VISVPGGLSPSQLHPLAGLERGVEYMDLEEEQLSSMEGSQGLIPSRGWTDDLCYGTGA
                     VYLVGLGLGGSYGFIEGLKNIPPNSPGKLQLNTVLNHITRRGPFLGNNAGVLALTYNL
                     INSVIDSFRGKHDVAGSVAAGALTGAIFRSSRGLKPMGYASALMAAAAAGWCGIKSVI
                     L"
     gene            <580713..>580970
                     /locus_tag="KLLA0_F06061g"
                     /db_xref="GeneID:9487364"
     mRNA            <580713..>580970
                     /locus_tag="KLLA0_F06061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999380.1"
                     /db_xref="GeneID:9487364"
     CDS             580713..580970
                     /locus_tag="KLLA0_F06061g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999426.1"
                     /db_xref="GeneID:9487364"
                     /db_xref="UniProtKB/TrEMBL:B5FV97"
                     /translation="MAERSARVQFDLFESEKVLLRHKWIRILEEIDSEVSVTLGFDLY
                     NTKKEDTKLHHCELKKVNQMRVGYDEFLLKKIKEAGIQNAK"
     gene            <583276..>589971
                     /locus_tag="KLLA0_F06072g"
                     /db_xref="GeneID:2895282"
     mRNA            <583276..>589971
                     /locus_tag="KLLA0_F06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455355.1"
                     /db_xref="GeneID:2895282"
     CDS             583276..589971
                     /locus_tag="KLLA0_F06072g"
                     /note="highly similar to uniprot|Q00955 Saccharomyces
                     cerevisiae YNR016C ACC1 Acetyl-CoA carboxylase biotin
                     containing enzyme that catalyzes the carboxylation of
                     acetyl-CoA to form malonyl-CoA required for de novo
                     biosynthesis of long-chain fatty acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455355.1"
                     /db_xref="GeneID:2895282"
                     /db_xref="GOA:Q6CL34"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6CL34"
                     /translation="MSEENLSEVSISQSKQYEITEYSDRHSKLASHFIGLNTVDKADD
                     SPLKEFVKSHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPE
                     DLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLL
                     PERLAASHRKIIFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKET
                     NLVSVEDKVYQEGCCSSPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLY
                     QQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAP
                     VTIAKPDTFTEMEKAAVRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTT
                     EMVTGVNLPSAQLQIAMGIPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPT
                     PKGHCTACRITSEDPNEGFKPSGGALHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFG
                     HIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDL
                     ISQKMTAEKPDRTLSVICGAATKAHIASQKAREDYISSLKRGQVPNKSLLQTMYPIEF
                     IHDGMRYRFTVAKSADDRYTLFINGSKCEVGVRKLSDGGLLIAVGGKSHTIYWKEEVA
                     ATRLSIDSKTTLLEVENDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMP
                     LISQENGVVQLLKQPGSTLAAGDILAILTLDDPSKVKHAKPYEGMLPELGAPIVEGTK
                     PAYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRQPELPYSEWKLQVSALHSRLP
                     PKLDEMQEQLVTRSFKRNADFPARQLEKMLEAALNDPNVDPLFSTTIEPLVDITTRYS
                     KGLAAHEHFVFATFLENYYNVEKLFSGPNIREEDVILKLRDENPDDLEKVVLTVLAHS
                     RVSARNNLILAILKHYQPLCKLSSEVAAAIEQPLKHIVELESKATAKVALQAREILIQ
                     GALPSIKERTDQVQYILKSSVLSTSYGSSETKRTKPDLEVLKDLIDSNYVVFDVLAQF
                     LTNPDDAVSAAAAEVYIRRAYRAYTIGDLKHQKSSGSPVVEWKFQLPSAAFTSLPQVK
                     SKLGMNRAISVSDLTYVSDGENQPLRTGLLIPARHLDDVDGILSSALSLIPSHHMSTG
                     PVPDRSGSSASLSNVANVVVSSTEGFESESDVLKRLREILDLNKQSLVDSAIRRITFV
                     FGYSDGTYPKYYTFRGPNYNEDETIRHIEPALAFQLELGKMSNFNIRQIFTENRNIHV
                     YEAVGKNSPVDKRFFTRGIIRTGRISDDISIHEYLTSEANRLMSDILDNLEIIDTSNS
                     DLNHIFINFSAVFDISPEAVEAAFGGFLERFGRRLLRLRVAAAEIRIIIKDPQTGTPV
                     PIRALINNVSGFVVKTELYTEIKNAQGEWIFKSLDKPGAMHLRPIATPYPAKEWLQPK
                     RYKAHLMGTTYVYDFPELFRQATVAQWKKHSPKTKLSDDFFIANELIEDENGELTEVD
                     RELGANNIGMVAFKVTAKTPEYSHGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYAR
                     KRGIPRIYLSANSGARIGIAEELVPLFQIAWNDEKDPAKGFQYLWLSDESLEELKSKG
                     KDNAVVTECVVEEGKVRNVITAIIGSEDGLGVECLKGSGLIAGATSRAYKDIFTITLV
                     TCRSVGIGAYLVRLGQRAIQIEAQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNN
                     GVSHLTAPDDLAGVEKIMDWLSYIPAKRDLPVPILESEDKWDRKIDYAPSLNEQYDVR
                     WMIAGRESADGFEYGLFDKGSFQETLSGWAKGVVTGRARLGGIPLGVIAVETRIVENL
                     IPADPANPDSTEMLIQEAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQ
                     RDMYNEVLKYGSFIVDALVDYKQPIITYIPPTGELRGGSWVVVDPTINADQMEMYADI
                     NSRAGVLEPEGMVGIKYRREKLLATMARLDDKYRELKAKLADSTLTPEEHQEVSKQLA
                     IREKQLLPIYHQITVQFADLHDRSGRMLAKGVIKKELDWPEARRFFFWRLRRRLNEEY
                     LMRRLNNELGSASRLEKMARIISWYPASVSQDNDREVATWIEENYQFLDEQVKSLKLE
                     AFAQNLAKSIRNDRENSINGLAEVLKLLSAKDKEKLQKALE"
     gene            complement(<590298..>591377)
                     /locus_tag="KLLA0_F06094g"
                     /db_xref="GeneID:2895019"
     mRNA            complement(<590298..>591377)
                     /locus_tag="KLLA0_F06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455356.1"
                     /db_xref="GeneID:2895019"
     CDS             complement(590298..591377)
                     /locus_tag="KLLA0_F06094g"
                     /note="similar to uniprot|P53720 Saccharomyces cerevisiae
                     YNR015W SMM1 tRNA dihydrouridine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455356.1"
                     /db_xref="GeneID:2895019"
                     /db_xref="GOA:Q6CL33"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q6CL33"
                     /translation="MVQYAGKLVLAPMVRAGELPTRLLALKHGADLVWSPEIIDKKLI
                     QCQRQVNDTLKTVDFIIPAKREGTEPGVVFRTVPEVEHGKLIFQIGTSTPSLAVEAAL
                     KVIEDVAGIDVNAGCPKHFSIHSGMGAALLQTPDKLCSILIELVEKVGKIYGKPISVK
                     IRILKDEEDTLTLVEKLCATGITNLTVHCRTTPMRNRESPIRAYIPKIYEICERNKVS
                     LIMNGAIRDKEHFEQLRSDLNLPKTIGGMMADCAERNPTVFSESPLPWFKAVKEYLDI
                     ANQYNHHPANVKYMMNRMTPGKSPFYQYFTQCRKLSDFAHVCQQLGSSGGALNDPIPF
                     LIQEREKEMAEKQRLNNLKSTKTSD"
     gene            <592103..>595960
                     /locus_tag="KLLA0_F06116g"
                     /db_xref="GeneID:2895020"
     mRNA            <592103..>595960
                     /locus_tag="KLLA0_F06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455357.1"
                     /db_xref="GeneID:2895020"
     CDS             592103..595960
                     /locus_tag="KLLA0_F06116g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455357.1"
                     /db_xref="GeneID:2895020"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:Q6CL32"
                     /translation="MLKVLRKISGHSSDAGSEKPASARRKDVNKDLRKPYDPQTSQYP
                     RQAPGKAPLRPGKPQGGNGAKPETGVTGPSSISYNKQRQNYSVLGSSNDSNASSHGSM
                     SYMGKDTHESLIKQNRVNRKRSEHYYIYDFEKYRGPTDETIASDPDYDIFQIKDGISA
                     SSARYVIHYLTNNFKEQLLNRFSHQNNNLDTDVLKASMEIFKPNLSHFSSSEIHHCKK
                     IIRSFFPWQGCSLTGTALEKAIAEHYGDYSNPKHWTRLILSLRIIWSHLSHGIVPWKC
                     YQDFCQLESRNNYPTMSFYNLLPQCLPNHDYTCSTFEFLEVLVAIISKIDLVVDKNAQ
                     MDLIFTAGQVCFVKDQNLQRHLQDNSKNDPDLISLGKLYYARGTALLHLFVAYLRSLA
                     EEGKIKDFYLIDNFHIDNYPPHPYKPVAQTALTLTVPSFIDGENDFNTLLKNAAKAQS
                     RIYSSNHSFSKQENAFLDKFEEGPYKVFDTLFSRSSKRYLYKFDKKFDPNSLKLSSES
                     GMQQGLGTIGENDQYAVATWIEHCKGQDFSEFLNVLDDSGLGEGTLAFDHTSFNFAAK
                     KQSQKENFSPVRVSKMALSEWFISSWKYETFLHKVHNTLLIKLTKRVGDCDWLVLSTD
                     ERVGKSSYLTPPSSSDSAKALENVKIPAIDSDNASIKSRPPPPNLLGDKSSSPLLDSP
                     SSSLYSSVLRKPVKEGMGSEQKNPSAYNRNSKMSVVTAAPPSSVSRREIMTPVEDNTQ
                     SVFQHDYPNNHHLPPVMVKINNPSLVDLDANGKTYTPSRSRTLAPAATPEQNMNIDKF
                     GSMLSDQQRLVKPLDFSVKIKSTVIEEEDSHSTLPEDDGLEVDEDDSLITTNTIQKLK
                     AQLSNISSDEEEEDAVDAELETGQEDEEEQEQEDSTQHMDSLEVQNVVDNVIETKENP
                     CTDRQFSVSDANSKSDVPALQNEEVSVDTASIAINSVEIPSTPANDTETSLSSKEANI
                     EESKPEKILEQGFESAKPLSQDEQKRVSCDTAGSFQDASSVLIRDDSSLNSETHNTGQ
                     EDHNQSSVATTAGSAVTEKQNVDTEIGSDRNSKAISESDKNDEATSKSISLTPNNRLM
                     RASALIEPQSSPNDILNDLIDNYNAESLVTVSSEGATLFERIKSQMERVSNGKDLPPI
                     PATRPVLHKLKMDVVNEEDNDDSPSSESLPLVTPTKGTATIMSGFSYNATPPMKQEEF
                     KYNGKLTFPQDSVNTFYSSLDHDTDTNDHDGQESAGNGDEFLSIESADETTDINEENK
                     AFRNVMLKTKKSFKSLKNKSLRA"
     gene            complement(<596318..>597241)
                     /locus_tag="KLLA0_F06138g"
                     /db_xref="GeneID:2895021"
     mRNA            complement(<596318..>597241)
                     /locus_tag="KLLA0_F06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455358.1"
                     /db_xref="GeneID:2895021"
     CDS             complement(596318..597241)
                     /locus_tag="KLLA0_F06138g"
                     /note="some similarities with uniprot|Q03695 Saccharomyces
                     cerevisiae YMR206W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455358.1"
                     /db_xref="GeneID:2895021"
                     /db_xref="UniProtKB/TrEMBL:Q6CL31"
                     /translation="MDQHRTNRPITAQLEVHYSKNGKPGDSKIVGTLLRVQQHPDGVD
                     DFEPLNACAFGEESQNPSLQTEISKNMKVCDLYQCVHSRHYHHHDDWFVHVPACARRF
                     SESNLTRLPGHYLELREQQQGHHQNSIQRPASESTLSSPSLKCRSRRTASCSSAGLGF
                     GSEVLPTLMESETSEFTPENPFRKHYSMENSVDNTSYSENTGSLTLADNQDNDDKQKT
                     SNEYYDYNYDYDYNDEYNSNSPSESRSITEKQPVSPRNSMHACKIDFPTKCTEDDSSQ
                     CSLDLSSPCTNHHHRRNSLAVKFQKPRYRSV"
     gene            <598549..>601128
                     /locus_tag="KLLA0_F06160g"
                     /db_xref="GeneID:2895022"
     mRNA            <598549..>601128
                     /locus_tag="KLLA0_F06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455359.1"
                     /db_xref="GeneID:2895022"
     CDS             598549..601128
                     /locus_tag="KLLA0_F06160g"
                     /note="similar to uniprot|P27514 Saccharomyces cerevisiae
                     YNR013C PHO91 Low-affinity phosphate transporter deletion
                     of pho84 pho87 pho89 pho90 and pho91 causes synthetic
                     lethality transcription independent of Pi and Pho4p
                     activity overexpression results in vigorous growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455359.1"
                     /db_xref="GeneID:2895022"
                     /db_xref="GOA:Q6CL30"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6CL30"
                     /translation="MKFSHSLQFNAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSES
                     SDLESTPLTTAVTRDSYEQRFIDALDKELDKIDSFYTMQETSILANYSEVYEDVTTFQ
                     NELMNRSIHNTSTGDLNRQGTRRSSSISEYNSQPEMDLYSEEDDDEDGFSIGNQEQSD
                     GQNKQIQARRARTGSVGSRLMHSITSEILPTLSRVTDFTTTDPIMEQQITLKKRIVAC
                     FTQLSELKSFIELNQTGFAKICKKFDKSLDSNIKTDYLKSLSKKSHVFNEHTIENLSN
                     DINEVIVMYAKAIGLMDPQHEVFNFQEAERELSLHLREHVVWERNTVWKDMMNLERKA
                     QNVKAEKALKKASTVTFRSITKDTEGNIELLDSNELQFPQTVSEVFKLSPLQFISLLI
                     SSTQLIKLIIITSIFVTLLFISPMRDTLQKNCLAILIYASLLWATETIPLFVTSLLVP
                     LLIVVFPVLKDTTDGHILNPTESSQYILSTMWSSVIMLLLGGFTLAAALSKYNIAKVL
                     STHILSSAGTNPKIILLTNMGVALFASMWVSNVAAPVLCYSIIQPLLRTLPKGSTFAK
                     SLILGIALASNIGGMASPIASPQNIISIGMMDPPPSWGQWFIVSLPVCVICIVVIWCL
                     LLLTFPPDSNLKILKYHPISDPFTVQQWYITIVTILTIVLWCLANQLKDVFGEMGIIS
                     VIPMLLFFGTGILDSDDFNNFMWTIVILAMGGTTLGKAVTSSGLLSTIASIIKESIET
                     KPVFQIVLIFGIVILTMATFVSHTVAAMIIVPLMKEIGSNLPGGDHSRLLIMVAAFLC
                     SAAMGLPTSGFPNVTAISMIDDVGDRYLSVNNFITRGVPASIVAYSVIVTVGYALMKV
                     IGY"
     gene            complement(<601351..>602730)
                     /locus_tag="KLLA0_F06182g"
                     /db_xref="GeneID:2895023"
     mRNA            complement(<601351..>602730)
                     /locus_tag="KLLA0_F06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455360.1"
                     /db_xref="GeneID:2895023"
     CDS             complement(601351..602730)
                     /locus_tag="KLLA0_F06182g"
                     /note="similar to uniprot|P27515 Saccharomyces cerevisiae
                     YNR012W URK1 converts ATP and uridine to ADP and UMP
                     Uridine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455360.1"
                     /db_xref="GeneID:2895023"
                     /db_xref="GOA:Q6CL29"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6CL29"
                     /translation="MNSSGYIPPWTTPYVIGIGGSSGSGKTSVATKLVTRINTPWTVL
                     ISLDNFYKPLTVEERKQAFENNYDFDKPDSIDLDLAYQCILSLKEGKKVKIPTYSFTD
                     HDRIPNKFLTIYGASVIVIEGIYALYDQRLLDLMDLKVYVDADLDICLARRLTRDIIS
                     RGRDLHGCIRQWEKFVKPNADRFVKPTMKAADAIIPSMSDNSIATEMLLNHIQSKLQL
                     KSQQHLAELQKLESYAVSIDSLNIIHKLRQTNQVKALQTILLDKSVSRDDWVFYFDRL
                     ATILLSFALDDIPTKLKTTKVITPTGKQLDNPVFVDFDRVTAINIVRSGDCFMRSLRK
                     TIPSVAVGKLLIQSDSRTGEPQLHSLFIPPMIENYNQVLLMDAQIISGAAIIMAIQVL
                     TDHNVDLKKIKVVVYLATETGIRRIVNATNNQVEIYAGEIISDDKIRTNQCNWARKRF
                     VASNYFGCK"
     gene            <602989..>605622
                     /locus_tag="KLLA0_F06204g"
                     /db_xref="GeneID:2895024"
     mRNA            <602989..>605622
                     /locus_tag="KLLA0_F06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455361.1"
                     /db_xref="GeneID:2895024"
     CDS             602989..605622
                     /locus_tag="KLLA0_F06204g"
                     /note="similar to uniprot|P20095 Saccharomyces cerevisiae
                     YNR011C PRP2 RNA-dependent ATPase in the DEAH-box family
                     required for activation of the spliceosome before the
                     first transesterification step in RNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455361.1"
                     /db_xref="GeneID:2895024"
                     /db_xref="GOA:Q6CL28"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CL28"
                     /translation="MGTSGDENGTKLTGSGQRRAKRTYESIESVNANTNSFSPADQVL
                     DSSPDPSLKDGKAHYSVNSIKSMVEQKVLTKRQRSQLHWLVKDLQILEDDIKRYGWNN
                     LTVSEREEISLKRELLKLLNETGKDYAENGDTSGFKMQDEVASKKQLLTAKLRNKTDR
                     VNWEEEQMKKSVIKADADEIKVKDSDNYEFVFDPESMIDFTDDTTDILEPVEDGRLAE
                     ALEEQINKMKSIKETRKSLPVYQYRQEILDSIRQHQILIVVGETGSGKTTQLPQFLVE
                     DGYTNDGKCVVCTQPRRVAATSIASRVADEMDVILGKEVGYNIRFDDRTTPDKTILKY
                     TTDGMLLREFLNDPQLSSYSAIMIDEAHERTLSTDILLGLLRGILQDRKDLRLIISSA
                     TMNATKFSKFFFDCPIFNVPGRRFPVDIHYTLQPEGNYINAAITTIFQIHTTQKLPGD
                     ILVFLTGQEEIESMQTKLLEILSKLDNTKFPDLLVVPIYANLPQEQQSKIFEPTPKNC
                     RKVVLATNIAETSLTIDGIKFVVDPGFVKEQSYSGGVSKLVTVPCSRASVDQRAGRAG
                     RLGPGKCFRLFTKWSYYNELEKVPKPEILRTKLNQVVLLLLSLGINDLLHFPMLDKPK
                     TIQLSEALENLYAIGALNSRGAITKVGQVMCDFPCDPEYAKVIYSSVFEESCNGVLPE
                     IVTIVSMLQESNSIFVPGLNSEEKTKLFGSLMQSSDHMLYLWIYEQWEENGYSRRWCQ
                     DFKLQHKTMKRVLRIRQQLWKYCRKQDFLLKHDQNLTQLKENMPRSVIEAKIIKCFIS
                     GFPTNIAKLSKQGYTNIKQDLSVSVHPSSVIFNRMKQEGKPMKYILYQSLMLTSKEFI
                     RDCITFDKYEWLTETMPHIYK"
     gene            <606977..>607993
                     /locus_tag="KLLA0_F06226g"
                     /db_xref="GeneID:2895025"
     mRNA            <606977..>607993
                     /locus_tag="KLLA0_F06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455362.1"
                     /db_xref="GeneID:2895025"
     CDS             606977..607993
                     /locus_tag="KLLA0_F06226g"
                     /note="similar to uniprot|P50107 Saccharomyces cerevisiae
                     YML004C GLO1 Monomeric glyoxalase I catalyzes the
                     detoxification of methylglyoxal (a by-product of
                     glycolysis) via condensation with glutathione to produce
                     S-D-lactoylglutathione expression regulated by
                     methylglyoxal levels and osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455362.1"
                     /db_xref="GeneID:2895025"
                     /db_xref="GOA:Q6CL27"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q6CL27"
                     /translation="MFKERLLNILKHIRPMSTETTAKYYPKIVESAQADQSLKLNHTC
                     FRVKDPKVTVAFYQEQFGMKLLDHKKFPDMKFDLYFLSFPNKQFSNNSQGAIDVFREN
                     GILELTHNYGTESDPAYKVNNGNEEPHRGFGHICFSVSNLEAECERLESNGVKFKKRL
                     TDGSQRNIAFALDPNGYWIELIQNNESGEGNNYKFNHTMVRVKDPIKSLEFYQNVLGM
                     KILDVSDHSNAKFTLYFLGYENDQKGIARGSRESILELTHNWGTENDPDFAYHTGNTE
                     PQGYGHICISNKDPATLCAEIEKLYPDIQWSPKFNQGKMKNLAFIKDPDGYSIEVVPY
                     GLGV"
     gene            <608680..>611496
                     /locus_tag="KLLA0_F06248g"
                     /db_xref="GeneID:2894998"
     mRNA            <608680..>611496
                     /locus_tag="KLLA0_F06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455363.1"
                     /db_xref="GeneID:2894998"
     CDS             608680..611496
                     /locus_tag="KLLA0_F06248g"
                     /note="uniprot|Q03216 Kluyveromyces lactis KLLA0F06248g
                     PFK2 6- phosphofructokinase subunit beta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455363.1"
                     /db_xref="GeneID:2894998"
                     /db_xref="GOA:Q03216"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /translation="MTQSLPLLNGTEAYKLVTTQGLYDKTVKFYEKYLQLVHDKRVGT
                     LTNSLITLKLVVDNSFKPLDVVNDKDWRAIVSSALVFSCTNIQHFRDLAAGETIQAYP
                     NETNPIEIYLKDPNGYIIGITETKNAISIKPTLPKQSVEASLISSRSSRIDIASSGVS
                     TDSSYPAIPKTAKAQKSIAVMTSGGDAPGMNANVRAIVRTAIFKGCNAFVVMEGYEGL
                     VKGGPNYIKQVYWETVRNWSCEGGTNIGTARCKEFREREGRLLGALHLIEAGVDALIV
                     CGGDGSLTGADLFRSEWPSLIRELLDQGRINKVQFDRYQHLNICGTVGSIDNDMSTTD
                     ATIGAYSALDRICQAIDYIEATANSHSRAFVVEVMGRNCGWLALLAGISTSADYILIP
                     EKPASSREWQDQMCDIISKHRSRGKRTTIVIVAEGAISADLTPISSKDVHKVLVDRLG
                     LDCRITTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESTPDTPSPLIAINENKITRK
                     PLVESVQLTKSVAEAIHSKDFKKAMQLRDSEFVEHLDNFMAINSADHIEPKLPEHTHM
                     KIAIVNVGAPAGGMNSAVYSMATYCMSQGHKPYAIYNGWTGLTRHESVRSLNWKDLLG
                     WQSRGGSEIGTNRHTPEEADIGLIAYYFQKYGFDGIIIVGGFEAFVSLHQLERARENY
                     TAFRIPMVLIPATLSNNVPGTEYSLGSDTALNSLMQYCDIIKQSAASTRGRVFVVDVQ
                     GGNSGYLATHAAVAVGAQVSYVPEEGISLEQLTQDIENLTESFSEAEGRGKFGQLILK
                     STNASKVLTPEVLAEVITQEAEGHFDAKCAIPGHVQQGGLPSPIDRTRGTRFAIRAVG
                     FIESQHKVLAAEANLDDDDFDFDTPKIIATASVLGVKGSDIVFSSIRQLYDFETELNK
                     RTPKTIHWQSTRTIADHLVGRKKL"
     gene            <611896..>612927
                     /locus_tag="KLLA0_F06270g"
                     /db_xref="GeneID:2895026"
     mRNA            <611896..>612927
                     /locus_tag="KLLA0_F06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455364.1"
                     /db_xref="GeneID:2895026"
     CDS             611896..612927
                     /locus_tag="KLLA0_F06270g"
                     /note="some similarities with uniprot|Q03694 Saccharomyces
                     cerevisiae YMR204C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455364.1"
                     /db_xref="GeneID:2895026"
                     /db_xref="GOA:Q6CL25"
                     /db_xref="InterPro:IPR024758"
                     /translation="MAIMGSPKKKSSGPFQSLKNSFLRNKGQPPQLQPWNPQVRTDNT
                     KRKSVQRTTLFRHDYVKVRSWPSDNPKNINVILSKTSFEIYEIDMGNSKERMNYLSLG
                     KKDQFVHPILPKLKVGRVPSDQKQEFKIIISLFNPERFWEVTFLSINHGRVPRKVIND
                     LEQVLSKICQYNNKDPDNASLKDTKNDTKAIPSPKIDILEEVDDLEYLLAENVPDQEQ
                     IPEAESLELNESSTISSISMEHSLVQSGDVVNKTFKQALGRIKPIDFNTRAESSRYKR
                     FSSFHSAFLDVPRISAEYQHSLQDKRRSISVPTAIDYKSVSNHDMRKGVDFDKVSWMD
                     VTFEDFPEI"
     gene            complement(<613470..>614633)
                     /locus_tag="KLLA0_F06292g"
                     /db_xref="GeneID:2895027"
     mRNA            complement(<613470..>614633)
                     /locus_tag="KLLA0_F06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455365.1"
                     /db_xref="GeneID:2895027"
     CDS             complement(613470..614633)
                     /locus_tag="KLLA0_F06292g"
                     /note="highly similar to uniprot|P23644 Saccharomyces
                     cerevisiae YMR203W TOM40 Essential component of the
                     preprotein translocase of the mitochondrial outer membrane
                     (TOM complex) in which it constitutes the core element of
                     the protein conducting pore"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455365.1"
                     /db_xref="GeneID:2895027"
                     /db_xref="GOA:Q6CL24"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:Q6CL24"
                     /translation="MSNSPVPLGDFSKISTLPGISPITPEQRGESFWSSNPISSYLID
                     TYNNIHAHRKTLSLVNPGTVENLNKEVSRDVFLTQYFFTGLRADLNKTFAFNPAFQTS
                     HTFSMGSESLPNYAFSALFANDNLFMQGNVDNQMSLSGRLQYGWDKNNVTKVTLQISE
                     GQPTMCQLEQDYQASDFSLNFKTLNPSAASDGSFTGVAVGSILQSITPQLAIGLEAIY
                     SKGQAMSPADAAVSYMTRFVSAKQDWIFSGQLQANGAAVASFWRKVSPNMEAGLETSL
                     QASMLPIMDPVIGQPIGFQPAIEGATTLGCKYEYRQSVFRGSIDSNGKVGCFLERKIL
                     PTLSVLFCGEIDHFKNESKLGAGLQFETAGSEELLMMQQGLDINGNPLQAPPA"
     gene            complement(<615122..>615493)
                     /locus_tag="KLLA0_F06314g"
                     /db_xref="GeneID:2895028"
     mRNA            complement(<615122..>615493)
                     /locus_tag="KLLA0_F06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455366.1"
                     /db_xref="GeneID:2895028"
     CDS             complement(615122..615493)
                     /locus_tag="KLLA0_F06314g"
                     /note="similar to uniprot|P33308 Saccharomyces cerevisiae
                     YNR010W CSE2 Component of the Med9/10 module which is a
                     subcomplex within the RNA polymerase II Mediator complex
                     required for regulation of RNA polymerase II activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455366.1"
                     /db_xref="GeneID:2895028"
                     /db_xref="GOA:Q6CL23"
                     /db_xref="InterPro:IPR011425"
                     /translation="MTGDTEKEQEPSSGEQQLNVLKRIHEILTKHSSTQTEFIPLLYH
                     SLKQISKHPNNSSNSLDAATSSIRHRLKTAKTLLQQDPAAIELVSKTPEQWQLHIQEK
                     KIELEKKTKHLQRLRESIQKQ"
     gene            complement(<615776..>616447)
                     /locus_tag="KLLA0_F06336g"
                     /db_xref="GeneID:2895029"
     mRNA            complement(<615776..>616447)
                     /locus_tag="KLLA0_F06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455367.1"
                     /db_xref="GeneID:2895029"
     CDS             complement(615776..616447)
                     /locus_tag="KLLA0_F06336g"
                     /note="highly similar to uniprot|P32352 Saccharomyces
                     cerevisiae YMR202W ERG2 C-8 sterol isomerase catalyzes the
                     isomerization of the delta-8 double bond to the delta-7
                     position at an intermediate step in ergosterol
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455367.1"
                     /db_xref="GeneID:2895029"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:Q6CL22"
                     /translation="MKLLKIALLLGTAYYLLNSLLYTWLPTNYIFDAKTLNEISNSVI
                     SKYDAESETFDVKVMLKDLRDALAKHYGDDYINQWVDEEWVFNNAGGAMGQMIILHAS
                     ISEYLIIFGSAVGTEGHTGVHFADDHFTILYGEQRASLPYNMEPEIYKPGQTHHLKKG
                     YAKQYSMPSGSFALELAQGWIPAMLPFGFLDTFSSTLDIYTLYRTVYLTARDMIKNLI
                     QNHKF"
     gene            complement(<616922..>617587)
                     /locus_tag="KLLA0_F06358g"
                     /db_xref="GeneID:2895030"
     mRNA            complement(<616922..>617587)
                     /locus_tag="KLLA0_F06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455368.1"
                     /db_xref="GeneID:2895030"
     CDS             complement(616922..617587)
                     /locus_tag="KLLA0_F06358g"
                     /note="weakly similar to YNR009w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455368.1"
                     /db_xref="GeneID:2895030"
                     /db_xref="GOA:Q6CL21"
                     /db_xref="InterPro:IPR013734"
                     /translation="MSVRLPLGQISSSKLNVLSQENKLHQGKRSVRPQLNTPSNSPST
                     ESFNNSEISLASVLNTQTSSSQFYSTPPQALHDVKERINNELTEKNSKLTDENILRLR
                     SRVQLAYYKYRTKQVHLKFSEIVSRKKQSANKIRKPENDRKSRKLAGLNPAIEATSRT
                     NNNNNGTSNLAVCSQQHIQCITPEKRYPAKPYASTSAISSGYTPVSVKAAKSLLQMFS
                     TGA"
     gene            complement(<618296..>620266)
                     /locus_tag="KLLA0_F06380g"
                     /db_xref="GeneID:2895031"
     mRNA            complement(<618296..>620266)
                     /locus_tag="KLLA0_F06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455369.1"
                     /db_xref="GeneID:2895031"
     CDS             complement(618296..620266)
                     /locus_tag="KLLA0_F06380g"
                     /note="similar to uniprot|P40345 Saccharomyces cerevisiae
                     YNR008W LRO1 Acyltransferase that catalyzes diacylglycerol
                     esterification one of several acyltransferases that
                     contribute to triglyceride synthesis putative homolog of
                     human lecithin cholesterol acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455369.1"
                     /db_xref="GeneID:2895031"
                     /db_xref="GOA:Q6CL20"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CL20"
                     /translation="MLRTKRRSHSLRKENSPTRNDGSSESRGSRSRRSSITDVSSGVR
                     GELKRRNSVKHGADDSETERSWKDSRRLIFIFGAMLGLLLALWFGSSTDKYRNDIFEN
                     FYVLESVQNYVGDWKGLLPQSVSSLIDDFQFDNTQADLTESFAVGKQLRKDLNLTDKH
                     PLVIVPGVISTGIESWGLYKDEECDSEPYFRKRLWGSFYMLKTMVLEKSCWLKHIKLD
                     PETGLDPPNYKLRAAQGFEAADFFMAGYWLWNKVLQNLGAIGYESNKMVTAAYDWRLS
                     YLDLEVRDRYFTKLKMQIELQLEQTGEKSVLVGHSMGSQVVFYFLKWIEASGEGYGNG
                     GEGWVDKHIAAFVDIAGTLLGAPKCVPALISGEMKDTIQLNTLAMYGLEKFFSRRERL
                     EMIQTWGGIPSMLPKGGELIWGDLDFSVEDNATANNNTDTYGNFIRFADVDGNFLAKE
                     NSTWTNFTMSSAVQYVRDTSPSWLQKRITDQYSFGYAKSEQEMKNNELYHSYWSNPLD
                     VPLPNAPNMKIYCLYGINNPTERAYTYKKDSESSYLNMTIAYDSPQPVFFADGDGTVP
                     LMTHAMCHKWKQGVSAYNPAGIEVKIVEMRHQPDRFDIRGGAKSAEHVDILGSAELNE
                     YILKIAGGKGDTIEERILSDLPEWINQIQFPL"
     gene            <621021..>621929
                     /locus_tag="KLLA0_F06402g"
                     /db_xref="GeneID:2895032"
     mRNA            <621021..>621929
                     /locus_tag="KLLA0_F06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455370.1"
                     /db_xref="GeneID:2895032"
     CDS             621021..621929
                     /locus_tag="KLLA0_F06402g"
                     /note="similar to uniprot|P40344 Saccharomyces cerevisiae
                     YNR007C ATG3 Protein involved in autophagy E2-like enzyme
                     that plays a role in formation of
                     Atg8p-phosphatidylethanolamine conjugates which are
                     involved in membrane dynamics during autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455370.1"
                     /db_xref="GeneID:2895032"
                     /db_xref="GOA:Q6CL19"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /translation="MLRSTLSNWREYLTPISHTSTFETSGQLTPEEFVKAGDYLVHMF
                     PTWKWNGNDFQNVHHKDFLPNDKQFLVTKKVPCKLRANNYLELDDTETKDVGDGWALQ
                     EEHSQDSERKSTNNADDSELPEELEELHIVDDGDDEEYDDQLYDNEFADDDIVDIRPS
                     TLRFYDLYITYSTSYRVPKMYLCGYDNDGTPLSPDQMFEDIAADYRSKTATIEPLPFL
                     KGNNISVSIHPCKHANVMKVLMEKVRSSRSRARKVDPQTTDEDWEDLQSDVDDGLRVD
                     QYLVVFLKFITSVTPGIEHDYTMEGW"
     gene            <622190..>623333
                     /locus_tag="KLLA0_F06424g"
                     /db_xref="GeneID:2895033"
     mRNA            join(<622190..622225,622299..>623333)
                     /locus_tag="KLLA0_F06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455371.2"
                     /db_xref="GeneID:2895033"
     CDS             join(622190..622225,622299..623333)
                     /locus_tag="KLLA0_F06424g"
                     /note="similar to uniprot|P28519 Saccharomyces cerevisiae
                     YMR201C RAD14 Protein that recognizes and binds damaged
                     DNA during nucleotide excision repair subunit of
                     Nucleotide Excision Repair Factor 1 (NEF1) contains zinc
                     finger motif homolog of human XPA protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455371.2"
                     /db_xref="GeneID:2895033"
                     /db_xref="GOA:Q6CL18"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR022656"
                     /db_xref="InterPro:IPR022658"
                     /db_xref="UniProtKB/TrEMBL:Q6CL18"
                     /translation="MMNLSEQQKQQIELNRQKALARLKQRGIIKTPQQLPVSSTKQNA
                     LPAENGNNKRSFEPTPEQKQAIQVNREKAQERLKQRQQNLRDASSNENSTIEQQKKPL
                     EKIRPSVRRQDYIEYDFSTMKNSYGGFINSEEMLDGGDSKRAKTLEDWQEEQKNRRML
                     FEEEMPAFNMSSAPRCDECGINIEMDPLMKKVFHLQICKTCVKNHPEKYSLLTKTECK
                     EDYFVTDPELSDVSLLDRLDKPNPHSGTFSRMQLFVRCQVEQYAFKKWGGEEGLDKEW
                     QRREEGRSVRKEKKYQQKLKEMRLKTRAQEYTTRLKEFKHGKKHVHDFSDARDGGVNM
                     DGVKVQIRRCLDCGLEIEEIGL"
     gene            complement(<623443..>625254)
                     /locus_tag="KLLA0_F06446g"
                     /db_xref="GeneID:2895034"
     mRNA            complement(<623443..>625254)
                     /locus_tag="KLLA0_F06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455372.1"
                     /db_xref="GeneID:2895034"
     CDS             complement(623443..625254)
                     /locus_tag="KLLA0_F06446g"
                     /note="similar to uniprot|P40343 Saccharomyces cerevisiae
                     YNR006W VPS27 hydrophilic protein has cysteine rich
                     putative zinc finger esential for function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455372.1"
                     /db_xref="GeneID:2895034"
                     /db_xref="GOA:Q6CL17"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017073"
                     /db_xref="InterPro:IPR017455"
                     /translation="MALPSMSVSEFDALIEQCTNEKIPNGEIDLSAALELSDMIRSRR
                     LPPKDAMRCLKKRVLQTRNNQNLQFSVWRLVEVCMKNGGVPFLKEVCSREFMDCLEQV
                     ILAESTDYELEQFCSRLVGELYLAFKNDSQLSYVVKVYQKLVSRGIDMENLKPTENLN
                     AMFDAKTPADWIDSDACMICSTQFTLLNRKHHCRSCGGVFCQLHSSKFIPLPDLGIFE
                     PVRVCDNCFEDYDLKRKSSKGKKSKGKKRFTRSEDDDEDLRRAIELSLKENGRDADTF
                     IPDTAKLEPLKKDPDEEDPDLKAAIEASLREHQQEEMRRKSQAKNMYNTSSPSVAPPI
                     ENNYDLSSNEEEDIHLFASLVERMKTQPPTAVLEDTQLQQLYQKVLGVRPKLNYALSD
                     TVSKYNTVYEMNSKISDIMNMYDSMLEMQLRNISLSQQYAIPESGRNSYGYHQNMPQY
                     DQPNSPQIIAQPQIHSPQQNERTILNYASPVSQHLSNGATTNTYQQGSALQNQQPAAP
                     EPQPVSFEKPSTTSQLEGLILEEPSEPPYPDENTTIENPKIEQASERPYPDDHLKQEN
                     ITSFDFPTVPLRKLSIHGSEQEVKEEPVQQEQLLIEL"
     gene            complement(<625692..>626417)
                     /locus_tag="KLLA0_F06468g"
                     /db_xref="GeneID:2895035"
     mRNA            complement(<625692..>626417)
                     /locus_tag="KLLA0_F06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455373.1"
                     /db_xref="GeneID:2895035"
     CDS             complement(625692..626417)
                     /locus_tag="KLLA0_F06468g"
                     /note="similar to uniprot|Q03691 Saccharomyces cerevisiae
                     YMR200W ROT1 Protein that may be involved in cell wall
                     function mutations in rot1 cause cell wall defects
                     suppress tor2 mutations and are synthetically lethal with
                     rot2 mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455373.1"
                     /db_xref="GeneID:2895035"
                     /db_xref="GOA:Q6CL16"
                     /db_xref="InterPro:IPR019623"
                     /translation="MRVLIPLSLFAVAVSGQNSDLEGTWSSKSNQVFTGPGFYDPIEE
                     LLIEPALPGISYSFTADGYFEEAMYQVSGNPQDPKCPVAVLIFQHGTYEVKDDGQLVL
                     TPIEVDGRQLLSQPCDDEGVSTYSRYYQAESFKSYLVQLDTYYGKQSLQLYGSDGAPL
                     QPLFLAYKPPVMLPTITLNPTASDDAQPTSNAKRDLISHVRRSIENRHKTNAVKKTAP
                     NIEKYWWGSLALIGVGSIAFLLS"
     gene            complement(<626983..>628569)
                     /locus_tag="KLLA0_F06490g"
                     /db_xref="GeneID:2895036"
     mRNA            complement(<626983..>628569)
                     /locus_tag="KLLA0_F06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455374.1"
                     /db_xref="GeneID:2895036"
     CDS             complement(626983..628569)
                     /locus_tag="KLLA0_F06490g"
                     /note="similar to uniprot|P20437 Saccharomyces cerevisiae
                     YMR199W CLN1 role in cell cycle START G(sub)1 cyclin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455374.1"
                     /db_xref="GeneID:2895036"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:Q6CL15"
                     /translation="MNQFSGSRESSLGLVVTAKQTYYPIELSNAELLAHYETVQDYHQ
                     EISLNCITQSCRLKPDSKLIDQQPELGPSKTRHVVVNFFFELALKTRVTNGIFYQAVR
                     LYDRYCSKRIVLREQVKLVVATCLWLAAKTWGGCNHIINNVSVPTGGRFYGPNPRARI
                     PRLSELIHLCNDSQTFDESMFTQMERHILNTLGWEIYEPMINDYILNADENCAIQYEL
                     YRRQLEHNRKWLNRNKEESSSINKESDSTDDEDLQNEEENEDDEDLTQKIQLINIKKF
                     LIDLTSWQYQLLKFEQFEVTHGMFQLINKFTNQELGPLLQTPIPTGSTSDAIVDIYID
                     AILDCPEQLWESYKEFDGIVQFVGEVRDYQRQMEYLSQQRQIQYSTPTRIYQVPSAQQ
                     NFPSPPYSQQTFSPSSRKISTQSDNSLFSTYGVTHSSPLTPQLHSFTHNKLTPNSANG
                     SHISLHSTSSMKRSYDDKENIDPASMANCHKVNSYIVPPRAKFVGQSSSVFSSGGGSI
                     SNGNSNRSSLISLPLGNAVV"
     gene            complement(<629870..>630685)
                     /locus_tag="KLLA0_F06512g"
                     /db_xref="GeneID:2895037"
     mRNA            complement(<629870..>630685)
                     /locus_tag="KLLA0_F06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455375.1"
                     /db_xref="GeneID:2895037"
     CDS             complement(629870..630685)
                     /locus_tag="KLLA0_F06512g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455375.1"
                     /db_xref="GeneID:2895037"
                     /db_xref="UniProtKB/TrEMBL:Q6CL14"
                     /translation="MSLEAAGEKRYDVAATASRLYIYENDELKLQYEVNSMKSLLWEN
                     YETRLIILVNHGQDIKIYTIEKQNLNLEQDLVVDVGYQIDSFYAIWSLSTLLVYDKVR
                     ASLNIYNIDKREDLGYITIDSENSKVHVLKDRGFQLIAVNYDNQLKTVCRFCNTYEFN
                     QSGQVDLLTTVVLPIGYHKYHIVRSYMSAETEEVFYPVYGIVMTNIAEDKSLIYLMFN
                     NAKCPFKVRTVIYSKGATNIQDKWVDPETECLYIKTAHELVSVPFFHETDRTL"
     gene            <631051..>632247
                     /locus_tag="KLLA0_F06534g"
                     /db_xref="GeneID:2895038"
     mRNA            <631051..>632247
                     /locus_tag="KLLA0_F06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455376.1"
                     /db_xref="GeneID:2895038"
     CDS             631051..632247
                     /locus_tag="KLLA0_F06534g"
                     /note="weakly similar to uniprot|Q12365 Saccharomyces
                     cerevisiae YPL255W BBP1 Protein required for the spindle
                     pole body (SPB) duplication localized at the central
                     plaque periphery forms a complex with a nuclear envelope
                     protein Mps2p and SPB components Spc29p and Kar1p required
                     for mitotic functions of Cdc5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455376.1"
                     /db_xref="GeneID:2895038"
                     /db_xref="GOA:Q6CL13"
                     /db_xref="InterPro:IPR029328"
                     /db_xref="InterPro:IPR029330"
                     /translation="MGSDDTGGLFKWTIDALFNRDTSPSTMYDKQLQQDSFDEEIYSR
                     PRASSFSDPDIYSKYELLRDEDEPDLLRPVSMNGLPYEKQDTNTFHARRARERRVQET
                     PNIRRAPNPNDPIISKLFQVDEDDSQLNTNEMRSQREKFNTGRLPGKFPSPTKQYNAR
                     ISNRDAFTGAERKAASTAPAIPPVAPSVQNLDYTPEYVKLMDKLSLNNKELRDLKVDV
                     RERQKHGMEKETELKKKYLQIRQELIQELKQSKMIYDNYCKLYYKYKGVKRSIQLPTQ
                     TLASNSSMLDKIASLEKQIVDLSIEKDRLKKKSEERILSVELQKKELENKFEVERMIY
                     ERRIKDLEEKLYVHEHPIRPATDTSPVSSSSFMPHTQETSDSTASPYKEYNNTIDTQF
                     LRNLVK"
     gene            <633167..>634261
                     /locus_tag="KLLA0_F06556g"
                     /db_xref="GeneID:2895039"
     mRNA            <633167..>634261
                     /locus_tag="KLLA0_F06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455377.1"
                     /db_xref="GeneID:2895039"
     CDS             633167..634261
                     /locus_tag="KLLA0_F06556g"
                     /note="highly similar to uniprot|P32449 Saccharomyces
                     cerevisiae YBR249C ARO4
                     3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP)
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455377.1"
                     /db_xref="GeneID:2895039"
                     /db_xref="GOA:Q6CL12"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CL12"
                     /translation="MSQTPTPMFHEQEDVRILGYDPLVSPALLQAQVPASQECLETAQ
                     KGRKESIDIITGKDDRVLVVVGPCSIHDLKEAQDYAKGLKALSDELKGDLCIIMRAYL
                     EKPRTTVGWKGLINDPDVDNTYNINKGLQVSRQLFVNLTSLGLPIGSEMLDTISPQYL
                     ADLLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVALDAVQAASHSHHFMG
                     VTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSVSVAEAKKALPPTGVLMIDYSHGNS
                     NKDFRNQPKVNDAVCEQIANGEDKIIGVMIESHINEGKQSIPAEGKAGLKYGVSITDG
                     CISLETTAEVLRKLAAAVRARRELKKKNTE"
     gene            <634720..>636378
                     /locus_tag="KLLA0_F06578g"
                     /db_xref="GeneID:2895040"
     mRNA            <634720..>636378
                     /locus_tag="KLLA0_F06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455378.1"
                     /db_xref="GeneID:2895040"
     CDS             634720..636378
                     /locus_tag="KLLA0_F06578g"
                     /note="highly similar to uniprot|P33734 Saccharomyces
                     cerevisiae YBR248C HIS7 Imidazole glycerol phosphate
                     synthase (glutamine amidotransferase:cyclase) catalyzes
                     the fifth and sixth steps of histidine biosynthesis and
                     also produces 5-aminoimidazole-4-carboxamide ribotide
                     (AICAR) a purine precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455378.1"
                     /db_xref="GeneID:2895040"
                     /db_xref="GOA:Q6CL11"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014640"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CL11"
                     /translation="MTVVHIIDVESGNLQSLQNAINHLGYETRLIKSASDPELQTAER
                     IILPGVGNFGHFVDNLTSRGFEQPIKDYIASGRPLMGICVGLQALFDGSSESPSSRGL
                     GLIPGTLSKFDISEGKSVPEIGWNTIIPQDDLSFGLDPYKRYYFVHSFAMIVDDVQLD
                     DLHSKGWKVALTRYGNERFVAAIHKDNVFSTQFHPEKSGKAGLEIIDNFLKGIHPVTE
                     YTDEQKSLLGNDYTNFGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKTEGGNVRNL
                     GKPVELAQRYYEQGADEVTFLNITSFRNCPLKDTPMLDVLRLAAKTVFVPLTVGGGIK
                     DVVDVDGTKVPALDVAGMYFRSGADKVSIGTDAVFAAEKYYANGEKGDGKSPIETISK
                     AYGAQAVVISVDPKRVYVNNRNETPNKCFQTLSPNPEGQNWCWYQCTIKGGRESRDLG
                     AWELAHACEALGAGEILLNCIDKDGSNSGYDLELIDHIKSAVSIPVIASSGAGNPGHF
                     EQGFTKTKADACLGAGMFHRGEYTVNQVKDYLISKGLKVRIDNE"
     gene            complement(<636501..>637943)
                     /locus_tag="KLLA0_F06600g"
                     /db_xref="GeneID:2895041"
     mRNA            complement(<636501..>637943)
                     /locus_tag="KLLA0_F06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455379.1"
                     /db_xref="GeneID:2895041"
     CDS             complement(636501..637943)
                     /locus_tag="KLLA0_F06600g"
                     /note="similar to uniprot|P21827 Saccharomyces cerevisiae
                     YGL097W SRM1 Nucleotide exchange factor for Gsp1p
                     localizes to the nucleus required for nucleocytoplasmic
                     trafficking of macromolecules potentially phosphorylated
                     by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455379.1"
                     /db_xref="GeneID:2895041"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q6CL10"
                     /translation="MSKRSSSVANTPVKRKHLHSTLNHKFVSINSQDDYKHLYRSVVP
                     LDIFVWGTGSMCELGLGPLAKNKEVKRPRLNPLLPRDEAKIVSFAAGGMHTLALDADN
                     NIWSWGTNDSGALGRDTSGAVEKLKDMDANDSDDDEDGDLNEIESTPTKIPRDSLPLD
                     ELRCVQIAATDNLSAALFENGDVYAWGTFRCNEGILGFYRDEITVQKTPWIIPNFSKK
                     AKIVQMAAGKDHILFLDETGIVYAWGNGQQQQLGRRILERSRLRTLDPRPFGLDNIKY
                     ISSGENHSFALSTDGKLYSWGLNQFGQCGISTELEDGSLVSVPTEVILPEGVEIDSVS
                     AGEHHTLILAKSGDLYSCGRLDMFEVGISKDKLPEYTYKDVHGKARSIPLPTKLEDVP
                     SFKAIAAGSHHSLAIAKNGIVYSWGFGETYAVGLGPSGDDIETPTRIKNTATQDHSIV
                     FIGCGGQFSISGGVKLSDEEAEKRADEMDD"
     gene            <638611..>640047
                     /locus_tag="KLLA0_F06622g"
                     /db_xref="GeneID:2894767"
     mRNA            <638611..>640047
                     /locus_tag="KLLA0_F06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455380.1"
                     /db_xref="GeneID:2894767"
     CDS             638611..640047
                     /locus_tag="KLLA0_F06622g"
                     /note="similar to uniprot|P38333 Saccharomyces cerevisiae
                     YBR247C ENP1 Protein associated with U3 and U14 snoRNAs
                     required for pre-rRNA processing and 40S ribosomal subunit
                     synthesis localized in the nucleus and concentrated in the
                     nucleolus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455380.1"
                     /db_xref="GeneID:2894767"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:Q6CL09"
                     /translation="MGKVMGGSGRKQRHDPLLNDLDSQHGKLKRQGKKKIDAKDQKGH
                     EDEEFVDAQQSRKILQLAREQQEELEEEDEQSLQTSSQGINRFCVANYADEDDVAEEE
                     EAQGNNISDFEPEDEDDFEGYEEEEVVEIDEEDAEMFDQYFKTSADFNSANGSYNLAD
                     KIMASIREKEMELQYNEEEAGDASAVAEPAAPVDRTEGVALPPKVIQAYLAVGTIMQT
                     WRHGKLPKLFKVLPSLNNWQDVLYVTNPEEWSPHAIYEGTKLFVSNLSSKEAQKFVIA
                     VLLPRFREEIEFNEDHNLNYHVYRALKKSLYKPAAFFKGFLFPLVESGCNVREATIAA
                     SVLSKVSVPALHSAAALSYLLRLPFSPATTVFIKILLEKKYALPYQTVDECVFYFMRF
                     REVTDGSTGQDAVRVLPVVWHKAFLAFAQRYKNDITQDQRDFLLETVRQRGHKEIGPE
                     IRRELLAGDSREFVSDVGNKADLMFDVL"
     gene            complement(<640261..>641043)
                     /locus_tag="KLLA0_F06644g"
                     /db_xref="GeneID:2894768"
     mRNA            complement(<640261..>641043)
                     /locus_tag="KLLA0_F06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455381.1"
                     /db_xref="GeneID:2894768"
     CDS             complement(640261..641043)
                     /locus_tag="KLLA0_F06644g"
                     /note="similar to uniprot|P53146 Saccharomyces cerevisiae
                     YGL098W USE1 Use1p is a SNARE and forms a complex with the
                     SNAREs Sec22p Sec20p and Ufe1p. The protein is localized
                     to the ER and use1 mutants show defects in retrograde
                     traffic from the Golgi to the ER Protein required for cell
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455381.1"
                     /db_xref="GeneID:2894768"
                     /db_xref="InterPro:IPR019150"
                     /db_xref="UniProtKB/TrEMBL:Q6CL08"
                     /translation="MTTDLDTLSDQLRKNYYRDLSLFQDDEDPFYHYLISTKLATNLN
                     TVRKLAIKDNLDDPSSDAIDRYQKNFSRLEESVSSISFSKASKLQQKYDAYQESQKKR
                     RYSVDFDATPDVPIGDEDDVDIISNVEAINDNDSLKELRQRLMGKRRDSADTEGESFD
                     KQMQIQDDLQKELVEDMSQLVSGLRQGAEAFQNAIEHDSTVLKAAEIGLHVTSKSLSS
                     LGSRLKKYHNEKIGFLMKLGLLSFIIIGLLVTYLVIKVFPDL"
     gene            complement(<641931..>643877)
                     /locus_tag="KLLA0_F06666g"
                     /db_xref="GeneID:2894769"
     mRNA            complement(<641931..>643877)
                     /locus_tag="KLLA0_F06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455382.1"
                     /db_xref="GeneID:2894769"
     CDS             complement(641931..643877)
                     /locus_tag="KLLA0_F06666g"
                     /note="highly similar to uniprot|P53145 Saccharomyces
                     cerevisiae YGL099W LSG1 Putative GTPase involved in 60S
                     ribosomal subunit biogenesis localized to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455382.1"
                     /db_xref="GeneID:2894769"
                     /db_xref="GOA:Q6CL07"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CL07"
                     /translation="MPPKETTKKWKPPKGPKPIQRKNKNTIGLGKAIQTARRKENEVQ
                     YLPDGEERFTTDKHEANWVKLRSVTQESALDEFLSTAELADKDFTADRHSNVKIIRMD
                     NGADAATSQGFSLTNEQKSKINEKQRLHARELIVPRRPKWNESMTRFELERLEKEAFL
                     EWRRKLAYLQEDNEDLLLTPFERNIEVWRQLWRVVERCDLVVQIVDARDPLLFRSTDL
                     EKYVKEVDDRKQNLLLINKADLLTRKQRIIWAKYLLSRGISFTFFSAAKANEILERQE
                     ELGDEYVEEEDDEEILATEEEIEELDGEEVNKEILDKINILKIDQLEELFLDKAPNDP
                     LLPPLPGQEPIIQIGLVGYPNVGKSSTINALVGAKKVSVSSTPGKTKHFQTIKLSDKV
                     TLCDCPGLVFPNFAYNKGELVCNGVLPIDQLRDYIGPSTLVAERVPKYFLEAIYGIHI
                     QTKSVEEGGNGEVPTAQELLVAYARARGYMTQGFGAADESRASRYILKDYVNGKLLYI
                     NPPPHMDDDTPYTREECKEFNKDLYTFSKLPINRQEQLAEAAKHKGIQDLDLARDLSR
                     LTFSAHIGGDGDKVQAKSVNHGGKQAALYNVADELDKNFFHLNGVQGRLTNPFHKQTV
                     ANENGKKHNKKNKKSKKKASMFSD"
     gene            <644040..>645299
                     /locus_tag="KLLA0_F06688g"
                     /db_xref="GeneID:2894770"
     mRNA            <644040..>645299
                     /locus_tag="KLLA0_F06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455383.1"
                     /db_xref="GeneID:2894770"
     CDS             644040..645299
                     /locus_tag="KLLA0_F06688g"
                     /note="similar to uniprot|P38332 Saccharomyces cerevisiae
                     YBR246W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455383.1"
                     /db_xref="GeneID:2894770"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6CL06"
                     /translation="MAQQSLQKHPHDEDAEYDSNIGIAYHLRGATKLEVKSFCRMEET
                     AADKRVTTRLPPCCLCILREKFIIVGTYLLHKDSGNRTGSIEVYDKELNLLSSIKTYG
                     AILDLKLNPFDDTLLATAHSTGNMILWTISVDDDNSSIDIKLLNNLQVFDPTCLITSL
                     QFSPLLDNLVLLTTTNGDFATVDIIHGEICFIEEVEPSYFDSSTINYIEVPNADIKVI
                     NVQNDHEQIFHFKHSLECWTGEFGCLAPLKDVVFTGGDDSAIAAHDLNSGKKIWSNSK
                     IHQAGVTAIKAARETFRGNKPTSLITGSYDDHIRSFDLRMLSETTIYPGTDVPVVNKW
                     EDNLQGGVWRFSEAPTNDGLSNNRLMVCCMYNGAKVVNVQNDHFVTEQFIKEGHESMC
                     YGGDWSKETVATCSFYDKSLQLWKSPN"
     gene            <645650..>648940
                     /locus_tag="KLLA0_F06710g"
                     /db_xref="GeneID:2894771"
     mRNA            <645650..>648940
                     /locus_tag="KLLA0_F06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455384.1"
                     /db_xref="GeneID:2894771"
     CDS             645650..648940
                     /locus_tag="KLLA0_F06710g"
                     /note="similar to uniprot|P38144 Saccharomyces cerevisiae
                     YBR245C ISW1 Member of the imitation-switch (ISWI) class
                     of ATP-dependent chromatin remodeling complexes ATPase
                     that forms a complex with Ioc2p and Ioc4p to regulate
                     transcription elongation and a complex with Ioc3p to
                     repress transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455384.1"
                     /db_xref="GeneID:2894771"
                     /db_xref="GOA:Q6CL05"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CL05"
                     /translation="MDSPEYLEKLKPFQEGIPNSIAEKKERYLLPLRDLASGKRKFDE
                     QGTVKRFEHLLGLSTLFRHFIERKAAKDPRFREVLDTIDNVNGKANGKGKKHTDARRR
                     KTEKEEDAELMKDEEEEEEELADVDFQFRESPAYVNGQLRPYQIQGLNWLVALHKNQL
                     AGILADEMGLGKTLQTIAFLGYLRYIEKKNGPFLVIAPKSTLNNWLREINRWTPEVSA
                     FILQGDKEERSKLCHDKLLACDFDICVASYEIIIREKASFKKIDWEYVVIDEAHRIKN
                     EESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFADSATFDEWFSSES
                     SEEDKEKVVKQLHTVLSPFLLRRIKNDVEGSLLPKKELNVYVGMSSMQKKWYKQILEK
                     DIDAVNGSNGQKESKTRLLNIVMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLK
                     VLDKLLKKFKEQGSRVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDD
                     YNAPDSKKFIFLLTTRAGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQV
                     RVFRFVTDNSVEEKILERATQKLKLDQLVIQQGRVTNKKKENKNDSKEGLLSMIQHGA
                     VDVFKSNDSSAMTSQTGTPHPDDGKDKDEDVDLDALLAQSEDKTRSLNAKYATLGLDE
                     LQRFNQDSAYEWDGQNFKKKVEKDIINPLFIPPTKRERSTNANYSVDNYYKDVLNPGR
                     NNQYTVPPKMPKLQPLNSHQLLRPQLKAIYEKERMWIAKKNNYVPNLDDVVTTYGDVK
                     DEAEKKDKLELLKLSIANAEPLTEEETNNKIEWEKEGFHNWNKLDFRKFITASGKHGR
                     NSIQAIAAEFGGSKTEEEVRAYAKAFWANLERVEDYERYVKNIETEEERVRRVKMNQE
                     ALRRKISQCANPLFELKLKFPPSTNNKRTFSEEEDRFILLMLFKYGLDRENVYEMIRD
                     EIKHHPLFELDFFFQSRTPIELQRRTITLLQCLEKEFNTGIQKTDELNDRLKKEDEEG
                     ERLREKLKEENKARRQEEEEQEEEEEEKEEEVNGTATQRKDEATEVDTEVNGNSLNEP
                     EQKKVKTE"
     gene            complement(<649269..>649754)
                     /locus_tag="KLLA0_F06732g"
                     /db_xref="GeneID:2894772"
     mRNA            complement(<649269..>649754)
                     /locus_tag="KLLA0_F06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455385.1"
                     /db_xref="GeneID:2894772"
     CDS             complement(649269..649754)
                     /locus_tag="KLLA0_F06732g"
                     /note="highly similar to uniprot|P40581 Saccharomyces
                     cerevisiae YIR037W HYR1 Thiol peroxidase that functions as
                     a hydroperoxide receptor to sense intracellular
                     hydroperoxide levels and transduce a redox signal to the
                     Yap1p transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455385.1"
                     /db_xref="GeneID:2894772"
                     /db_xref="GOA:Q6CL04"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6CL04"
                     /translation="MSKFYELAPKDKKGEPFPFTQLEGKVVLIVNVASKCGFTPQYKE
                     LEALYKKYEDKGFIVLGFPCNQFGHQEPGTDEEISQFCQLNYGVSFPILKKVDVNGSE
                     ADPVYDFLKNEKSGLLGFKGIKWNFEKFLVDKKGTVVERYSSLTKPSSLEEPIEKLLN
                     E"
     gene            complement(<650475..>651509)
                     /locus_tag="KLLA0_F06754g"
                     /db_xref="GeneID:2894773"
     mRNA            complement(<650475..>651509)
                     /locus_tag="KLLA0_F06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455386.1"
                     /db_xref="GeneID:2894773"
     CDS             complement(650475..651509)
                     /locus_tag="KLLA0_F06754g"
                     /note="similar to uniprot|P53011 Saccharomyces cerevisiae
                     YGL100W SEH1 Nuclear pore protein homologous to Sec13p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455386.1"
                     /db_xref="GeneID:2894773"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CL03"
                     /translation="MKPFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNE
                     WELSESWKAHDSSIVSLDWAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLC
                     TLNDATGPLFSVKFAPSHLGLRLAALGNDGKLRLYDALESSDLRSWTLTSEITVLNTP
                     PASHLQSDFCLSWCPSRFSTERLVISAMDQATIYQRNKQGKLVPAGHLKGHTGLIRSI
                     AWAPSVGRWYQLIATGCKDGKLRIFKVTESRNNGTNIINEENDNNANIERDGPPIDSS
                     AIDADGSVANLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASYSNEF
                     RCMSVVQAAR"
     gene            <651801..>653144
                     /locus_tag="KLLA0_F06776g"
                     /db_xref="GeneID:2894774"
     mRNA            <651801..>653144
                     /locus_tag="KLLA0_F06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455387.1"
                     /db_xref="GeneID:2894774"
     CDS             651801..653144
                     /locus_tag="KLLA0_F06776g"
                     /note="similar to uniprot|P07286 Saccharomyces cerevisiae
                     YBR243C ALG7 UDP-N-acetyl-glucosamine-1-P transferase
                     transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in
                     the first step of the dolichol pathway of protein
                     asparagine-linked glycosylation inhibited by tunicamycin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455387.1"
                     /db_xref="GeneID:2894774"
                     /db_xref="GOA:Q6CL02"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:Q6CL02"
                     /translation="MLSYFLLLFAIAIIVYFKDVSPIGSAVGFSVIGYVAVDVLIPQV
                     GDSFIKIGLFGKDMSKPGRPVIPETIGSVSATVYLFIMFFSIPFMFYKYLVITSGGGN
                     RDLVSQESTEEQLFPHSKLSEFLSALLCLESTILLGAADDLFDLRWRHKFFLPAIAAI
                     PLLVVYYVDFSVTHVLIPKFVQELIGTSKTSIDLGAFYYCYMASVAIFCPNSINILAG
                     VNGLEVGQSIVLGLIFMINDVLYLTMGVNGHARESHLFSLLLIVPFLGVSLALFKWNR
                     WPAKVFVGDTYCYFAGMVFAVVGILGHFSKTTLLFFLPQIFNFIYSAPQIFGLVPCPR
                     HRLPKFNESDWLMYTSRADLIKEKPKPVMQPILRLLHKLRLIDLNIDPKTNTILDCSN
                     MTLINLMIVWFGPMREDKLCYSILALQFIIGISAICLRHLIGSLLFGNDNLWNIV"
     gene            complement(<653398..>654159)
                     /locus_tag="KLLA0_F06798g"
                     /db_xref="GeneID:2894775"
     mRNA            complement(<653398..>654159)
                     /locus_tag="KLLA0_F06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455388.1"
                     /db_xref="GeneID:2894775"
     CDS             complement(653398..654159)
                     /locus_tag="KLLA0_F06798g"
                     /note="similar to uniprot|P38331 Saccharomyces cerevisiae
                     YBR242W Hypothetical ORF or YGL101W uniprot|P53144
                     Saccharomyces cerevisiae YGL101W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455388.1"
                     /db_xref="GeneID:2894775"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q6CL01"
                     /translation="MYRTFSYFSKQSSITFRLTHQKGNLFDSSCRFFSSRPLPTSKMT
                     MEWNPRDHVPAEVKELLSEPQPNYVLAFLHIVEQLKLQKRTGWIDHDIIPCESIADHM
                     YRMGVTTMLIKDPNVDVKKCVRIALVHDIAESLVGDITPFDPVTKEEKHQRELDTITY
                     LCEEIIKPYNSVAADEILSDWLAYENISSLEARYVKDIDKFEMLVQCFEYEKRHSGTK
                     DLSQFYGAVSSIKTEEVKSWVSHLVKRRTEFFQQL"
     gene            complement(<654656..>655849)
                     /locus_tag="KLLA0_F06831g"
                     /db_xref="GeneID:2894777"
     mRNA            complement(join(<654656..655056,655801..>655849))
                     /locus_tag="KLLA0_F06831g"
                     /product="60S ribosomal protein L28"
                     /transcript_id="XM_455390.1"
                     /db_xref="GeneID:2894777"
     CDS             complement(join(654656..655056,655801..655849))
                     /locus_tag="KLLA0_F06831g"
                     /note="uniprot|Q8J287 Kluyveromyces lactis RPL28 protein"
                     /codon_start=1
                     /product="60S ribosomal protein L28"
                     /protein_id="XP_455390.1"
                     /db_xref="GeneID:2894777"
                     /db_xref="GOA:F2Z696"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:F2Z696"
                     /translation="MPTRLTKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGLHHHRTN
                     LDKYHPGYFGKVGMRYFHKQQAHFWKPVLNLDKLWTLVPEEKREEYLKSASKSAAPVI
                     DTLAAGYGKVLGKGRIPDVPVIVKARFVSKLAEEKIKAAGGVVELIA"
     gene            <656373..>657959
                     /locus_tag="KLLA0_F06853g"
                     /db_xref="GeneID:2894778"
     mRNA            <656373..>657959
                     /locus_tag="KLLA0_F06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455391.1"
                     /db_xref="GeneID:2894778"
     CDS             656373..657959
                     /locus_tag="KLLA0_F06853g"
                     /note="similar to uniprot|P38142 Saccharomyces cerevisiae
                     YBR241C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455391.1"
                     /db_xref="GeneID:2894778"
                     /db_xref="GOA:F2Z638"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:F2Z638"
                     /translation="MSTNNRLLPHGRADELNNLENASSNNKGVTFTPHLLLSMLVACL
                     GSLQYGYHMGELNAPEDYITCKAELNPGYADSFLGRLGLAQCIPLTDSQFGLITSVFS
                     VGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVCLFSSNNYLGMLFGRLLAGISCG
                     SLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILVTQSLAMLWANMLQWRWILLFGG
                     LISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQEIDGWLQGSQPV
                     RTFSDLEAHTNSQMNLGSNLNLERPSSTRSSLRDSESITVVEYWKDPKYKYPRRVITT
                     ILMAQQFCGINSIVFYGVKVIKKAFPDTAIIINFAISIVNVLMTFFSSPLVDHWGRKP
                     LLISSSTLMSICSFMICFGIVGNAPMILVIFVILYITAFAGGLGPIPFLIISELSHPE
                     TVGVAQSYGTTMNWIATFMVGYGFPALNSVMDGYVFLLFSAVAICFSFYVYRFVPETK
                     GKLDYTDIWKSHDPRIAYTQ"
     gene            complement(<658475..>658900)
                     /locus_tag="KLLA0_F06875g"
                     /db_xref="GeneID:2895682"
     mRNA            complement(<658475..>658900)
                     /locus_tag="KLLA0_F06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455392.1"
                     /db_xref="GeneID:2895682"
     CDS             complement(658475..658900)
                     /locus_tag="KLLA0_F06875g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455392.1"
                     /db_xref="GeneID:2895682"
                     /db_xref="UniProtKB/TrEMBL:F2Z6E3"
                     /translation="MASSMNSNNNNNNISNTSENERCSRAVQFQSQGMEESMDYNVLQ
                     QYQTHLNNTLTLKQHLLKQLTLLYGQLDECRNMQELMDVLMTQRQLLQSIFTLEKNTG
                     VSQEAPTVKWSKYGLDVEQYLVETGRADLVERSGYPFHD"
     gene            <659764..>661596
                     /locus_tag="KLLA0_F06897g"
                     /db_xref="GeneID:2895683"
     mRNA            <659764..>661596
                     /locus_tag="KLLA0_F06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455393.1"
                     /db_xref="GeneID:2895683"
     CDS             659764..661596
                     /locus_tag="KLLA0_F06897g"
                     /note="similar to uniprot|P53735 Saccharomyces cerevisiae
                     YNR039C ZRG17 Endoplasmic reticulum protein of unknown
                     function transcription is induced under conditions of zinc
                     deficiency mutant phenotype suggests a role in uptake of
                     zinc"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455393.1"
                     /db_xref="GeneID:2895683"
                     /db_xref="GOA:Q6CKZ6"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="UniProtKB/TrEMBL:Q6CKZ6"
                     /translation="MQNFNSQAAMDREFSPSIVGSAPHTPIRMNSIEEEEDAISPPFL
                     AQQDSAITGTTVNSPMHVTKPLVFSTETPPGRRPNSFYSVQGGNDSSSSLVATKGFTF
                     GGGSDNSTNDTQLINGPTSDYHTHSKKPSFKYVPAPKLPPMSRNRSPVRHNRSPSPER
                     KSKRNSLLFEAPFNFSSSALQPPPLSGSSNNSGPSSGGTNGGSRSAMFRKGHRYKHSS
                     VSMNFFQEPEVKEPLNIIKSLPVPDFKDLRNNLTWPLTHIQISICIVELLISIFIFNL
                     GHQKGWNLLGTLCHFLTYDVLGGIFAILTELLAKFEIWKTGTITLPFGLNRIDVLLSF
                     AFAISICFAGLDLIFHVLEEIAVLFAESSTADHHEEINQTIPHSHHTHLHQEQLISWY
                     SVIILAATISFLSYSFIFKTTQYKIKNPLITLSYLFYMSLYPILSHYHRGWDMLATAV
                     ISSFIMSYGIQVAKWTSTILLMGFSTASINNTLLMDIASSDSNPNEVSERVLLKRSKS
                     TLPIAAVQTENNQSASVQLDPSFVKSKIYDAILSLPLFKRTCSLKNNDLLFAKVNFQM
                     FIVLIKIEMKNGSNDDELDLRLTIEKLVSDYVPNAETTIEIERM"
     gene            complement(<661670..>665638)
                     /locus_tag="KLLA0_F06919g"
                     /db_xref="GeneID:2895684"
     mRNA            complement(<661670..>665638)
                     /locus_tag="KLLA0_F06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455394.1"
                     /db_xref="GeneID:2895684"
     CDS             complement(661670..665638)
                     /locus_tag="KLLA0_F06919g"
                     /note="similar to uniprot|P25648 Saccharomyces cerevisiae
                     YCR081W SRB8 RNA polymerase II mediator complex subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455394.1"
                     /db_xref="GeneID:2895684"
                     /db_xref="GOA:Q6CKZ5"
                     /db_xref="InterPro:IPR019035"
                     /translation="MSPSKYLLTPPEELHPLTDSNPQIYPDFDPWIHTKEEDKILKEF
                     VAKGYYTASRVNFETISARSALQGSLPKVSSLLGDELSKIIEIREQEINRISTLDIED
                     STRFTKWSGQDFHLPNRVTLTDQKRNLWLQELSSSNTSLRKLTKSVPHGFRKRHILEQ
                     CYTQFVPIYRVIWLIKSCYAIEWKGMISKAKGETTHEELLSTLYKDWTDNMVLILEKL
                     VFEVSKYYNDPGQLKYWKLRIAHYLKILGNCYEMELLNRSTLHQWLVDFLSKIESFEF
                     YPMTLHILSIFWSGILGTTEEDTEIESSFLIIKLSEILLRKYHIISESKCMINDSKYI
                     INDVQRNSKLKESVLLRLRQFISHIFHTQSLEAFIMPKQNWNIYKNYLYQILLQNVSD
                     EETPKLKKKLKLISYRNESLRLGSLDVEPSRETSPFSTELTLDNVFSGNILNLKNVSP
                     ELLGVLDSGLSGSEWSLFIDQKITKMEQVIEIILWAINPSRKHRYDSCHLVAKILVLK
                     INSQESFQEYSIEDVIWSLIFHFSKLSKLELQKIVWLPKLHQLLNVFIGYGIIKVPTY
                     IRRLISSGVLYLPESENKNFHCKLLINLKISPIMKSQYNMVLKNVMEYAPHFYEKYNF
                     DKLVSIFESLKPKLLSGDFERLEEYPGSIRIMCSEWYLSQICFNQGELQKVNNHKIIK
                     TFQLFCINLGELHHFFGWAEYIVYHQLIDDLENLEVFTDILLYLDKAFLLLINDHILF
                     MKTLLHSYMRDLRIKDKAAFELINFKSFWKFFVKNCANMIEMDSSLQNQIAEVFELER
                     HRKDHFTKMPNETVSLYLEITGNKNTKFEEQNFPSVIQQNIKKVLHNPEDESNCRKLL
                     LLCKASHASEYNKFLSIFVKRGDFTVHELLKLISLKLLSFEVIQKTSHFDLLCELVSQ
                     VSFNYGLNFENEKNAFVKRNFKQITLQLFSRPTFRDTLVRMLVEYGPNSNLSEKSAQV
                     VSHILREEKNMSIIRDMLIYGMNIENEAIDNTIDLYRYLNFTNTWLFQILTEFNVKNS
                     NAEDLSDFFSSIVGAIGYNSLLPKIFSNISDKKQVSTLLTVIERQFLARVLETEKSAL
                     VFLHIMMDTEIVLSRHLVNMSSLGMDSEVLELFKNTIATFAKMPNDTLKKYDENLNEL
                     LKIVIIHEKFILRHCFESIELRDHYMVDNFYTLFHNTGKDLKLKLLLYDLLTSLKSYI
                     LNETKDQALHSIKMPSVLNQLPKFAISSFLDSEGTEDEFLDKDEPSLIRLGICDKQAK
                     TNSALKYFVFNKKSSQFDCIFKIEPFQYLVNYQEPLEGELNNTSLSLGLFDARLEKTN
                     PS"
     gene            complement(<665970..>667862)
                     /locus_tag="KLLA0_F06941g"
                     /db_xref="GeneID:2895685"
     mRNA            complement(<665970..>667862)
                     /locus_tag="KLLA0_F06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455395.1"
                     /db_xref="GeneID:2895685"
     CDS             complement(665970..667862)
                     /locus_tag="KLLA0_F06941g"
                     /note="similar to uniprot|P53734 Saccharomyces cerevisiae
                     YNR038W DBP6 Essential protein involved in ribosome
                     biogenesis, putative ATP-dependent RNA helicase of the
                     DEAD-box protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455395.1"
                     /db_xref="GeneID:2895685"
                     /db_xref="GOA:Q6CKZ4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /translation="MFAARFDPTKVTENVLTAEVTQIKEPTVPQKRKRDAETDDEGSG
                     EDDASSSEDDASSSEDDSDTISEQDENKVASVAPTETSQQSVDAKHSSVLNRFQQTLS
                     LQGALSASDKVSSDNDVHDEDVSMKDVHSLTPIPQPAKVTNEALKLLDPSTYKSTAWD
                     AATKIHYDSKMVKQFDSYEGELDARLLKNITSNFSSETFPIQTILFDKVLPLLNSSFK
                     ANRKLFTRRVGDILVNASTGSGKTLAYSVPLVQILRSRTVNKVRAIILVPTKILIHQV
                     YDCLSKLSQGTSLNVSMSKLENSLKEEHNKFLYNSPDILIITPGRLVDHLQMESFDLK
                     TLKFLVLDEADRLLNQSFQNWNQVLFHHLTNDKQDKRPGNVIKMVFSATLTTNAEKLY
                     NLYLHNPKIFLTDSVKLYSIPKKLQELNVNIPTAKSLFKPLLLLRIIHDIKSSASRNA
                     KILVFVKSNEASIRLESLLHAMLGSGIIEDEYNMFLSSIHSNISKGSSRKLIQEFASS
                     EQKKSVLISTDIMARGIDINEITHVINYDLPISSQQYVHRCGRTARANTEGIAINLLV
                     GKGEQKFWSQHIDTDLSRDIDGYQPSAYLDEEKLSELFSIEDTLKDTYKGCIKQLQTS
                     KEADSK"
     gene            <668130..>668405
                     /locus_tag="KLLA0_F06963g"
                     /db_xref="GeneID:2895686"
     mRNA            <668130..>668405
                     /locus_tag="KLLA0_F06963g"
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /transcript_id="XM_455396.1"
                     /db_xref="GeneID:2895686"
     CDS             668130..668405
                     /locus_tag="KLLA0_F06963g"
                     /note="highly similar to uniprot|P53733 Saccharomyces
                     cerevisiae YNR037C"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /protein_id="XP_455396.1"
                     /db_xref="GeneID:2895686"
                     /db_xref="GOA:Q6CKZ3"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q6CKZ3"
                     /translation="MFPSLRLLSRSVWKGPNIVPLPIKEALAKGTPIRTNARSATILP
                     QFVGLKFQVHNGKEYVAFEVTEDMVGSKLGEFVPTRKRFSYTQTKNK"
     gene            complement(<668701..>670158)
                     /locus_tag="KLLA0_F06985g"
                     /db_xref="GeneID:2895687"
     mRNA            complement(<668701..>670158)
                     /locus_tag="KLLA0_F06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455397.1"
                     /db_xref="GeneID:2895687"
     CDS             complement(668701..670158)
                     /locus_tag="KLLA0_F06985g"
                     /note="similar to uniprot|P25646 Saccharomyces cerevisiae
                     YCR079W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455397.1"
                     /db_xref="GeneID:2895687"
                     /db_xref="GOA:Q6CKZ2"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6CKZ2"
                     /translation="MGKTQSFIHLRPADLLQKTAGRSTLQTTAASHAASKETKPHMLR
                     VHLNKYPGFIGHATSRINRLYNEDSYSMNILKLPTTIAESSLLNSKKSIATKMKLWKE
                     LPPQRNVLNISIFDGHGGDRVSKMLASGLHDHITAMVPIRQEFDAVLKKYQDLVGGKY
                     WSRIYKGRKEYYERYIKKCNTKVEQVLLTDGVAPKNGARMIFDKWGNIIDKTSLLSEY
                     ERLRLYISYLNYDLNEICGFSSDLEPEEAMKIFTGGSTASSLFLTSYNEEECYDESFF
                     IAPQGLLKLAVTQIGDTKIILCDKNGIAHSLAKVHHPSSSRESRRLGGQFQTDSFGDT
                     RFLNNFANTRSFGDRIGKRDGLTCEPDIYSYLIGPTKMLPHAERSKLQFGGDECFLCL
                     VTDGVTELMSDQELCDLITSTVNNRGLKTASPHFCAQEVLQYVMAISSKHSDNATCVI
                     LRLPNWGNWPVIDRTGAIREEKLLSGVSGGERSSG"
     gene            <671210..>671713
                     /locus_tag="KLLA0_F07007g"
                     /db_xref="GeneID:2895688"
     mRNA            <671210..>671713
                     /locus_tag="KLLA0_F07007g"
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /transcript_id="XM_455398.1"
                     /db_xref="GeneID:2895688"
     CDS             671210..671713
                     /locus_tag="KLLA0_F07007g"
                     /note="highly similar to uniprot|P53732 Saccharomyces
                     cerevisiae YNR036C"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /protein_id="XP_455398.1"
                     /db_xref="GeneID:2895688"
                     /db_xref="GOA:Q6CKZ1"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CKZ1"
                     /translation="MFKQVFGLSSSLTRLSLRNVRSSIAFAPPLQQRSFSYTSPIQAT
                     LNQIKRGVKPPGRKKITESPDLEVCPIRKGVVLRVMVLKPKKPNSAQRKACRVRLTNG
                     NIVSAYIPGEGHNAQEHSIVYVRGGRCQDLPGVKYHVVRGAGDLAGVVNRISSRSKYG
                     VKKPTKE"
     gene            <672114..>673094
                     /locus_tag="KLLA0_F07029g"
                     /db_xref="GeneID:2895689"
     mRNA            <672114..>673094
                     /locus_tag="KLLA0_F07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455399.1"
                     /db_xref="GeneID:2895689"
     CDS             672114..673094
                     /locus_tag="KLLA0_F07029g"
                     /note="similar to uniprot|P53731 Saccharomyces cerevisiae
                     YNR035C ARC35 Subunit of the ARP2/3 complex which is
                     required for the motility and integrity of cortical actin
                     patches required for cortical localization of calmodulin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455399.1"
                     /db_xref="GeneID:2895689"
                     /db_xref="GOA:Q6CKZ0"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="UniProtKB/TrEMBL:Q6CKZ0"
                     /translation="MLHLKPYNLLVQKTLTEALEAYNNGSPLTLDRIISDFDYTTLHI
                     TNDGTDKSNLLVSIRTKATQSCNESGNDLQGFLQAKFDEVPGLALSSAKKEAGYDFTI
                     TVDLSQITAQSIVQASLFKILVMSYPFYLAFGQSNALSQLNEIDQVEKSKEARAMVIK
                     YRDDENIYIKPSFDRITVIFETIFQDETDKVFGKVFLQEFVDARKRNRSIQSAPQVLF
                     SHEPPLEIQEVAQQHAHVAGAKKSTRRFITFVLFPRHYSSDELMFTSVSQLALFRNYF
                     HYHIKCAKAYMHSRMRYRVDTFIKVLNRAKLDEETESDSRRTITGRKMVY"
     gene            <675221..>676897
                     /locus_tag="KLLA0_F07073g"
                     /db_xref="GeneID:2895691"
     mRNA            <675221..>676897
                     /locus_tag="KLLA0_F07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455401.1"
                     /db_xref="GeneID:2895691"
     CDS             675221..676897
                     /locus_tag="KLLA0_F07073g"
                     /note="some similarities with uniprot|Q7LH06 Saccharomyces
                     cerevisiae YDL048C STP4 Protein involved in pre-tRNA
                     splicing and in uptake of branched-chain amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455401.1"
                     /db_xref="GeneID:2895691"
                     /db_xref="GOA:Q6CKY8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY8"
                     /translation="MDVLSHSSVNGSDHVQMIQLPPISSFDSLIRAASVTDNNSITSS
                     NSNFNAGTPSPGVTNGQVQFTVGSGTVNIAPRTSRTSVPNSLMASTLVSVSPRASASV
                     NAAYTNANTPSTHHNGNYNADHAESFSSSVSFNDNNNNNIQHNQHHHHNLQQQLQQHQ
                     RHPQQIQRQESNNHSVPVVVSSGKTFTDSLMSYQFGSTGSSGSSPNGQQYRPSSYFQS
                     SLSNGNGSHTQSPFAGNPVSQPHHQIIPKLNSGISNMNSLMDQQTSPTSDNNNSNVHH
                     QQLHTHYGQGHGSSCNHTHSHSQGSLHHMISPISTTNNHATSPTNSIATVLSPTTSTP
                     SSTVSSTSKLSSLSTSSDLNTHLMDNSKSAKMKIENNANMVSKKQPRKKKQCPLCGLF
                     FSNLSTHKSTHLSPETRPFKCEVCSRGFARSNDLIRHKKLHWKDDLNQESMDFVEKLK
                     CLHELKGTYKCPFNSNLINLDLKLKGSDMKTADLPFETSNCHSTGVFSRCDTFKNHLK
                     ALHFEYPPGTKKKDRANVAGHCKHCGQKFESIETWLKDHVGKECGYNYTG"
     gene            complement(<677773..>679005)
                     /locus_tag="KLLA0_F07095g"
                     /db_xref="GeneID:2895692"
     mRNA            complement(<677773..>679005)
                     /locus_tag="KLLA0_F07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455402.1"
                     /db_xref="GeneID:2895692"
     CDS             complement(677773..679005)
                     /locus_tag="KLLA0_F07095g"
                     /note="highly similar to uniprot|Q765N3 Saccharomyces
                     kluyveri Sk Delta 12-fatty acid desaturase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455402.1"
                     /db_xref="GeneID:2895692"
                     /db_xref="GOA:Q6CKY7"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY7"
                     /translation="MSQSQYVTDAETTTESCKVAIDTHGNVFKVPDYTIKDILSAIPP
                     ECYNRKLAVSLYYVFRDIAIMAGIGYFANVFAYPYVKDLHVAARFVYWAFYGYVQGLF
                     GTGLWVLAHECGHQAFSDYGAVNDFVGWVLHSYLLVPYFSWKYTHSKHHKATGHITRD
                     MVFVPKTKEDFVKSRGILADIDEFSEDSPIRTLIELLTQQLGGWIYYLLTNVTGQPYP
                     DVPKWKWNHFWPSSPVFDDKDYIYILLSDLGILTQSLVLKIWYDKFGGWSVFINWFVP
                     YIWVNHWLVFITYLQHTDASMPHYEADQWSFAKGAAATIDRQFGFIGPHIFHDIIETH
                     VLHHYCSRIPFYNARPASEAIKKVMGEHYRFNDENMWVSLWKSARTCQYVDDADSKGV
                     YMFRNVNNVGVGTGKKKN"
     gene            <680589..>681044
                     /locus_tag="KLLA0_F07117g"
                     /db_xref="GeneID:2895693"
     mRNA            <680589..>681044
                     /locus_tag="KLLA0_F07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455403.1"
                     /db_xref="GeneID:2895693"
     CDS             680589..681044
                     /locus_tag="KLLA0_F07117g"
                     /note="weakly similar to uniprot|P38985 Saccharomyces
                     cerevisiae YDL092W SRP14 Signal recognition particle
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455403.1"
                     /db_xref="GeneID:2895693"
                     /db_xref="GOA:Q6CKY6"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY6"
                     /translation="MSDKDGTASGLKETPDFIKKPLSHDEFFVKLEKAFRMSKVSHNQ
                     LKVSLKRDLGSHHVQKPNELDVTSNPTGDISKMSESKRLKQNAQPDTKPYRLIVLVSM
                     PYDGKRTKFFTLVDSKTLDKFWKDYVNVVKTSMSGLIKKKKKKKGGKKN"
     gene            complement(<681163..>682401)
                     /locus_tag="KLLA0_F07139g"
                     /db_xref="GeneID:2895694"
     mRNA            complement(<681163..>682401)
                     /locus_tag="KLLA0_F07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455404.1"
                     /db_xref="GeneID:2895694"
     CDS             complement(681163..682401)
                     /locus_tag="KLLA0_F07139g"
                     /note="similar to uniprot|Q12229 YDL091c Saccharomyces
                     cerevisiae UBX3 UBX domain-containing protein that
                     interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455404.1"
                     /db_xref="GeneID:2895694"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY5"
                     /translation="MVFNIFSRPSQQNQPAVSFTPLPGSFPEDNDNTEQPEQETILNA
                     GVPRILKMCLYIPLTLLYYLLNILLTSVEVFKPIGKIFHFYTRKDNHFSDDLGNQFVN
                     VIDVLSSSADTNEQSGYTFDTLYNVENGMLSKNMIKGGYTDILRRCSSDGKFAIISFF
                     NPILYDPFEYVRKILTSNEFVECVTKYNCVVWFCDVTTPQGLQTANSLKIRQFPFLGA
                     LGPQRNNKMKLLARVEGQLFDYDFSHFEAKLASYYSVLVEIRRQRQYQEMQRLLREQQ
                     DSRYQESLERDQERDRVIEESQLKKKWLAWRKSVLVPEPSGDGCRVSIRLENERIIRR
                     FDASLTIEEIYAYVALYRAGLLSDTSSENDITQEKPNYEYQYDFQLYSPVPRTRLEPT
                     TVIKEERTIYPSGTIVVEFE"
     gene            complement(<682786..>684075)
                     /locus_tag="KLLA0_F07161g"
                     /db_xref="GeneID:2895695"
     mRNA            complement(<682786..>684075)
                     /locus_tag="KLLA0_F07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455405.1"
                     /db_xref="GeneID:2895695"
     CDS             complement(682786..684075)
                     /locus_tag="KLLA0_F07161g"
                     /note="similar to uniprot|P22007 Saccharomyces cerevisiae
                     YDL090C RAM1 essential for processing of ras proteins beta
                     subunit of farnesyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455405.1"
                     /db_xref="GeneID:2895695"
                     /db_xref="GOA:Q6CKY4"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY4"
                     /translation="MAINSATRAIKKMSYLRTNVLGRKRETIEQEVVDEEEVMEIRTS
                     NTGLITETLVEREELINECLELYEKAPEKFNHLQKDSHKMFLEYWLNNPLPSGFKSLD
                     ASQPWLLYWIGNAFKTMNPTWLTNDYQKRILDKLWYISPTGGPFSGGKHQLPHLAATY
                     AAINSIALCHNLDDNREINKKAIYDWLISLKTPSGAFMTARPVGEQDVRGVYTALSIA
                     SLLGIVDSKLTSNVTEFLTRCQSYEGGFGGCPNDEAHGGYTFCAVASLAMLNALDKVN
                     IDALLSWCSSRQTKEEKGLNGRSNKLTDGCYSFWVGGTAAILEAYGYGVCIDKDALKQ
                     YILKCCQSEESPGLRDKPGTQADFYHTNYVLAGLSICEHSFMVRNNSPFDFVATPLVP
                     EPEVEPIHPIFGLAILDVNNFINRRGEPSMSNLSMKV"
     gene            <684265..>686322
                     /locus_tag="KLLA0_F07183g"
                     /db_xref="GeneID:2895973"
     mRNA            <684265..>686322
                     /locus_tag="KLLA0_F07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455406.1"
                     /db_xref="GeneID:2895973"
     CDS             684265..686322
                     /locus_tag="KLLA0_F07183g"
                     /note="weakly similar to uniprot|Q03792 Saccharomyces
                     cerevisiae YMR154C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455406.1"
                     /db_xref="GeneID:2895973"
                     /db_xref="GOA:Q6CKY3"
                     /db_xref="InterPro:IPR001300"
                     /translation="MPRGAQAMLEKQADSVWNQLYEICWNFYVKNVWDINTFKAIVDK
                     IEKSDDKQLIRFLIWFNDARKRSNFNDKFQWMTSFLYGRRYPPLGDDLVVKEPWNDLQ
                     QLDSIIKYGNEPIDLVKMQPDFTTEERIVQNRRVNNCSLICSLTNAREENQIKSYSVH
                     NVFNVILHFNGSNRLVSVLRDSNFPKCSKDGAALTLFSHNIEDMLIELAYFEIKNNRN
                     YAYGGSNTATDTYLLTGWIPEILNLGDVSFSEIRKCYQFNAMLALGTDSVKGKEVTEN
                     HDFVVTSVNWKKEQFTILNPHGTENPTVYTWDDLIKEFKWLYVNWDPYSKYTQRVKLH
                     DRYPDKFNAYPTWTQKPLMCIENKSNSIQNCHLYLERHLLDDSILESNLTIGEIPRSG
                     FTAVSAEGNNSGFCNMQLRLNPHETRLIFYHSDKKCNLTFHLLSNSGLVSMSKCKSDI
                     LTAESSWNITNNQWTIGTSEYFKSPVFKLKSDGFDDTYLDFELVSQLPAKVNFQIFES
                     DDYALQRPIFKNDTYSPQIFSKHGVRLLKGREYFIVCSIAHHITSPFIFTLRNPETKQ
                     SKFELSPYSLGFGGLRYNEVLRCKTRITISVSNFTRLFVLLFTSASKTNGRLTLRLYE
                     KETEEILFEQIETRYDLSVKPFPIPNIELKPASYVLEIFYNADVVICNLGTSHRAIFE
                     SDL"
     gene            <686532..>688172
                     /locus_tag="KLLA0_F07205g"
                     /db_xref="GeneID:2895974"
     mRNA            <686532..>688172
                     /locus_tag="KLLA0_F07205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455407.1"
                     /db_xref="GeneID:2895974"
     CDS             686532..688172
                     /locus_tag="KLLA0_F07205g"
                     /note="weakly similar to uniprot|Q12066 Saccharomyces
                     cerevisiae YDL089W Protein of unknown function interacts
                     with meiotic division protein Csm1p green fluorescent
                     protein (GFP)-fusion protein localizes to the nuclear
                     periphery potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455407.1"
                     /db_xref="GeneID:2895974"
                     /db_xref="GOA:Q6CKY2"
                     /db_xref="InterPro:IPR018819"
                     /translation="MAFWRNRHESPAISQERSPSPDRFQNSEDIREDNNNYNEDEKLG
                     WFASFMGMFSLPYDWYLSINEDIAVIDWDSKSNSVAWPLGNVLTFLFFSVRLLQDNVI
                     APNINKLTHSDDAFDFSKSKNLQKYDYFQQYGGSASSSENLYYKMLRQLHRLFYLLTV
                     LLLITNISVTYRYLFAHFQTYSIFYWKTVPKSKNVTKKSLHDLNHTYVEDAKRDSLWG
                     MIKYLLFNGSHDDETNRAHYYELRKWTPSRFLTSFFVSFSPIAFCFLWMTDVTFKTLI
                     PIIIHQYVLWFIVIDRYEQKLKDEQILSMSSVAELNSKVIQPKMNVLKQDAMVDATPY
                     NDGIVYFYPAYTTTRSHVFATHTLSGKLSKEKYNPRTDSFEDANSQRTENYVRFSYHH
                     PKSINGAYVRESYPSRQHSPRLSPSRYSHLQSGNTPSAPSTPLLIPSQQPHFDHSMLA
                     NASRNHNISERRNSHSPIKQHFANRLLNYPDETNDSIPDVSDDRFRMDDRFRRGRQGY
                     FNRSPDINSGTLHYDDGDDDDNRISKSPFRNSSSSPFR"
     gene            complement(<688282..>689526)
                     /locus_tag="KLLA0_F07227g"
                     /db_xref="GeneID:2895975"
     mRNA            complement(<688282..>689526)
                     /locus_tag="KLLA0_F07227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455408.1"
                     /db_xref="GeneID:2895975"
     CDS             complement(688282..689526)
                     /locus_tag="KLLA0_F07227g"
                     /note="some similarities with uniprot|Q05166 Saccharomyces
                     cerevisiae YDL088C ASM4 Nuclear pore complex subunit part
                     of a subcomplex also containing Nup53p Nup170p and Pse1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455408.1"
                     /db_xref="GeneID:2895975"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY1"
                     /translation="MSSVFGQQAQQENRFANLQINYPQQQQQNQQQQNSSQSLVQSSA
                     TNGKEENWYNIARKRNIPQSVIKRSSKPSSSGDGSSNDNSSQRSGFNSVQFGTKKPTF
                     SSTQPAQPTDIATYVESNEAPPTKSLYDWQREDEFGSVPTNVNAMPSSNQIPLTQEYT
                     KSTRNAFDRDASKSPVKPTADQTNDISRQKSQESAVIVFGYPESISNQIILHFSKFGN
                     ILEDLEVLRGVTGNNISSATIRIRAQNKDSKIPHKKYPIFTGDGWIKITYDSPSAALR
                     ALQENGTVYGGCLIGCVPYSKTAVEQLASCKIDKTDDIGEIPFSLSMKPNGPESSDIQ
                     NGTQESADNNKHGFTFSTRKLDVKDGKQLFVHNANPPHGGPNFLRNLENKLREQEQHG
                     NNQQPTNLIGRVNNWLFGWNDL"
     gene            complement(<689786..>690556)
                     /locus_tag="KLLA0_F07249g"
                     /db_xref="GeneID:2895976"
     mRNA            complement(<689786..>690556)
                     /locus_tag="KLLA0_F07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455409.1"
                     /db_xref="GeneID:2895976"
     CDS             complement(689786..690556)
                     /locus_tag="KLLA0_F07249g"
                     /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
                     YDL087C LUC7 Essential protein associated with the U1
                     snRNP complex splicing factor involved in recognition of
                     5' splice site"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455409.1"
                     /db_xref="GeneID:2895976"
                     /db_xref="GOA:Q6CKY0"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:Q6CKY0"
                     /translation="MSAILEQRKLISQLMSSAATSHGLTSPSTCKSFIIGHCPYDLFQ
                     ETKQPMGHCPRIHSVSHKMQYERDVKKGKKYPEFDLEHYSILKKILSDCDVQIEMAHK
                     KLQHHEEHSKLAALLQAVNQLESKCALMLSEIDMLIQNEEVMKAMIQSCKYNKLQTER
                     DTLSEKCRQMNENTGQSAQQKLQVCRVCGAYLSRLDTDRRLADHFMGKLHLGYVTMRK
                     ELDMVKKRLHEQGTDLHTYLPQTRRHQKAVYRGKSYRS"
     gene            <690795..>691490
                     /locus_tag="KLLA0_F07271g"
                     /db_xref="GeneID:2895977"
     mRNA            <690795..>691490
                     /locus_tag="KLLA0_F07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455410.1"
                     /db_xref="GeneID:2895977"
     CDS             690795..691490
                     /locus_tag="KLLA0_F07271g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455410.1"
                     /db_xref="GeneID:2895977"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX9"
                     /translation="MIIPILGDPFEIICSTIRTCKLETMEPVFSALVIGGNGNDSAIR
                     ICRELIFKYGIKVINADYWDARDDILYGLEEYYRSDDVRSDKWILTFDSHINLINDRK
                     KNYEFVNINTQNWKPILSGVNVVINLTQYYEPTIGGLLSTPIQEVDPLIDLWCHMIEI
                     METVRLTTHCTIAYLINKDTSFNRGWGIFANSTIQLLDGKLSVCQEDYDVYFSPKELF
                     QQFENGTYADIMR"
     gene            <691582..>692085
                     /locus_tag="KLLA0_F07293g"
                     /db_xref="GeneID:2895978"
     mRNA            <691582..>692085
                     /locus_tag="KLLA0_F07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455411.1"
                     /db_xref="GeneID:2895978"
     CDS             691582..692085
                     /locus_tag="KLLA0_F07293g"
                     /note="similar to uniprot|P28627 Saccharomyces cerevisiae
                     YMR150c IMP1 protease, mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455411.1"
                     /db_xref="GeneID:2895978"
                     /db_xref="GOA:Q6CKX8"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX8"
                     /translation="MSWLNIGSYVVRTVCLIHITHTHFYEFTETRGESMLPTLNRVND
                     YVHVLKWYKDGRDLKMGDCIVAMKPTDPQSRVCKRITGMEGDLILVDPSQEDDEEAYE
                     TFIRVPKGHVWVTGDNLSHSLDSRTYNSIPKGLIKGKIVAANDFSKPLSTFWGFREIT
                     NSYFDEK"
     gene            complement(<692238..>693035)
                     /locus_tag="KLLA0_F07315g"
                     /db_xref="GeneID:2895979"
     mRNA            complement(<692238..>693035)
                     /locus_tag="KLLA0_F07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455412.1"
                     /db_xref="GeneID:2895979"
     CDS             complement(692238..693035)
                     /locus_tag="KLLA0_F07315g"
                     /note="similar to uniprot|Q02795 Saccharomyces cerevisiae
                     YMR149W SWP1 oligosaccharyl transferase glycoprotein
                     complex delta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455412.1"
                     /db_xref="GeneID:2895979"
                     /db_xref="GOA:Q6CKX7"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX7"
                     /translation="MRVQSLILSALTFVQYCIATEIVLKDAVVAFDSERPVVQLNNID
                     SKYDSKGVNVPVSLSETLKLSFVVDQELEQANVLVGLPSENLEAGYTLKKQSGSSDKF
                     SLAIPLPKLAHAFNDRAELQVNLLVSTEENSLVKELFILSIVDPVTNTRDTARNFVRL
                     NPKEEIHHIFQSSPKTVNAFIAQLFALVITTTLFVLFVSWVSFGAVNFNLKNVSSYLF
                     VALVSGFEFIFYKYYSGTSIFDTVFSTGLLFLPALLLGSATLKSLKQ"
     gene            complement(<693418..>693804)
                     /locus_tag="KLLA0_F07337g"
                     /db_xref="GeneID:2895980"
     mRNA            complement(<693418..>693804)
                     /locus_tag="KLLA0_F07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455413.1"
                     /db_xref="GeneID:2895980"
     CDS             complement(693418..693804)
                     /locus_tag="KLLA0_F07337g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455413.1"
                     /db_xref="GeneID:2895980"
                     /db_xref="GOA:Q6CKX6"
                     /translation="MTPWSLPQFAFHLVTFLSIAFIASIFVLPFLTFSFVLSSATVGL
                     SFASRTSFEIGLFFYDRFVILLQGQLRGMIDQLPSNQPAKEEKKVKAQQQGDELFTQQ
                     EQAAPSQTLGSTIPLQSIEESLLDST"
     gene            complement(<694278..>694541)
                     /locus_tag="KLLA0_F07348g"
                     /db_xref="GeneID:9487413"
     mRNA            complement(<694278..>694541)
                     /locus_tag="KLLA0_F07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999381.1"
                     /db_xref="GeneID:9487413"
     CDS             complement(694278..694541)
                     /locus_tag="KLLA0_F07348g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999427.1"
                     /db_xref="GeneID:9487413"
                     /db_xref="UniProtKB/TrEMBL:B5FV98"
                     /translation="MSLTSEKFEEKFNEQFQQGMIDQFKCIQDSDFIHGSEYLDEYYD
                     RIYDIYQRQLHAAAQQHPNIAAYVNKYYKMISNQVNQYIGTSA"
     gene            complement(<695133..>696101)
                     /locus_tag="KLLA0_F07359g"
                     /db_xref="GeneID:2895981"
     mRNA            complement(<695133..>696101)
                     /locus_tag="KLLA0_F07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455414.1"
                     /db_xref="GeneID:2895981"
     CDS             complement(695133..696101)
                     /locus_tag="KLLA0_F07359g"
                     /note="some similarities with uniprot|Q03083 Saccharomyces
                     cerevisiae YPL034W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455414.1"
                     /db_xref="GeneID:2895981"
                     /db_xref="InterPro:IPR018306"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX5"
                     /translation="MRTQCVGTTQKGSQCRLKAIEGEKFCRHHSTQNNGTSIATKAPH
                     MPHDAPECVGTTRKGSKCKLKAIEGGKFCRHHINQNNGTSSPTKTPYIPEDTPEYIYI
                     YTYATLHENAVVEKKNRKEITWLVTDNSKMKPSKNQALILRNNRFDPWQHNKDEILIK
                     IGMTRRSDVSKRINEWQKQCKRDIILITPEIVRQWIVSSTTKPKSINSMSNVIQKLCR
                     LALNNHSNIVKHTTITSTTITDTGRSRNKSDRCFTENGFRCKDSGHVEREIHEWLWKE
                     YGKGNIICEVCQKTHREWVKVPIGQMEYIVNTIDRICSDSFSLKRT"
     gene            <696302..>697114
                     /locus_tag="KLLA0_F07381g"
                     /db_xref="GeneID:2895931"
     mRNA            <696302..>697114
                     /locus_tag="KLLA0_F07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455415.1"
                     /db_xref="GeneID:2895931"
     CDS             696302..697114
                     /locus_tag="KLLA0_F07381g"
                     /note="similar to uniprot|Q07505 Saccharomyces cerevisiae
                     YDL086W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455415.1"
                     /db_xref="GeneID:2895931"
                     /db_xref="GOA:Q6CKX4"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX4"
                     /translation="MLIEQCHQDLPTSFDSEIRIHIVKPTVKGYPNAKFPAVLVFSEI
                     YQVTGPVLRFAQTIAAEGYIAILPSSYHNFVDSTPLAYDTEGTDLGNKFKIEKPLESY
                     DEDVTLCLDVLENLPQWNGRVGATGMCLGGHLAFRAQLDSRIKATTCFFPTDIHSHSL
                     GLGKNDDSLEKVTANWKKDQECFLIFGTKDTHVPWEGRDQIRNAVKDKSVTFLEINGA
                     QHAFIRDEFSKGRFDSAVTKACLGFMFELFDRKLKSELGEFVDDNAPVEHVC"
     gene            <697593..>698636
                     /locus_tag="KLLA0_F07403g"
                     /db_xref="GeneID:2895932"
     mRNA            <697593..>698636
                     /locus_tag="KLLA0_F07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455416.1"
                     /db_xref="GeneID:2895932"
     CDS             697593..698636
                     /locus_tag="KLLA0_F07403g"
                     /note="similar to uniprot|P40217 Saccharomyces cerevisiae
                     YMR146C TIF34 Subunit of the core complex of translation
                     initiation factor 3(eIF3) which is essential for
                     translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455416.1"
                     /db_xref="GeneID:2895932"
                     /db_xref="GOA:Q6CKX3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /translation="MRPIVLKGHERPLTQVKFNRDGDLVFACSKDSVASIWYAINGER
                     LGTLDDHSGTIWSIDVDESTTYALTGGADFCFKIWKVATGVAVHSVSTRSPVLRVEFS
                     PDGSKLLIVLDAVMGHIGSIVVYSLIRNENGEIVNVKEEPDYEITTIEQATKVFVASW
                     SYNGKYIIAGHEDGQISAYYGENGEFVQAKKIHEKSIKDIQFSPDRTYFITSSRDSVA
                     SLVDVDTFEVLKTYKADCPLNSASITPLKEFVILGGGQDAKDVTTTSAREGKFEARIY
                     HKVFQDEIGRVKGHFGPLNYVAVSPTGTSYASGGEDGYIRLHHFDKSYFDFKYDVEKT
                     FEVERRQQLQKQE"
     gene            complement(<699177..>699380)
                     /locus_tag="KLLA0_F07425g"
                     /db_xref="GeneID:2895933"
     mRNA            complement(<699177..>699380)
                     /locus_tag="KLLA0_F07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455417.1"
                     /db_xref="GeneID:2895933"
     CDS             complement(699177..699380)
                     /locus_tag="KLLA0_F07425g"
                     /note="similar to uniprot|Q3E7B7 Saccharomyces cerevisiae
                     YDL085C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455417.1"
                     /db_xref="GeneID:2895933"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX2"
                     /translation="MARGNQRELARQKNLKKQQESGKNQKKQGDPKKRMESDAEILRQ
                     KQQAANERKEKERLEKLAAEKRR"
     gene            <700685..>703612
                     /locus_tag="KLLA0_F07447g"
                     /db_xref="GeneID:2895934"
     mRNA            <700685..>703612
                     /locus_tag="KLLA0_F07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455418.1"
                     /db_xref="GeneID:2895934"
     CDS             700685..703612
                     /locus_tag="KLLA0_F07447g"
                     /note="similar to uniprot|P38995 Saccharomyces cerevisiae
                     YDR270W CCC2 copper-transporting P-type ATPase with
                     similarity to human Menkes and Wilsons genes;
                     Cu(2+)-transporting ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455418.1"
                     /db_xref="GeneID:2895934"
                     /db_xref="GOA:Q6CKX1"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006122"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:Q6CKX1"
                     /translation="MADTQALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEEC
                     HVLFDKGRTTTSEILETIDECGFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACV
                     KTVTGQVLKLSGVLECDVSLVTEECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSS
                     SVPSNEKRLCLKIFGMLSESDRADIESKVSELKGVISIDTSLQSEEATVIHDANEIGN
                     RDIIDCIEEMGFQTFISNTLDNSTQLSLLSKTKEIQFWKKNCIRGGISSILIMGLYMC
                     VPMLFPAVLTHFPFVQTPIIGLFYRDIIGIIITTYVQIYVGSYFYKAAWISLKHGSGT
                     MDTLIGLSTVCAYIFSCYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKS
                     ETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRNE
                     TEVDESLITGESMLVEKIVGSQVIGGSVNGPGHFYFRAIRVGEDTKLANIIATMKKAQ
                     LSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMKTPPLIFNSENGKFFMCMQ
                     MSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDVLEKCSALQTFLFDKTGT
                     LTTGRMSVENFINYNSDVSDLHWKMISLCESIGEHPVAKAIVNYADSHVNKSSIFDLD
                     LSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFPDESLSDIASSTLTESYVSIDGS
                     LVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDVFSEV
                     TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSGTDIAIEAADIVIL
                     DSDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMIPIAMGLLAPWGITLHPM
                     LSSAAMALSSVSVVCSSLMLKRWTPPSLNIKSMEASGGLSWLRFGRNSNRGDDIELQE
                     RLM"
     gene            <703955..>706933
                     /locus_tag="KLLA0_F07469g"
                     /db_xref="GeneID:2895935"
     mRNA            <703955..>706933
                     /locus_tag="KLLA0_F07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455419.1"
                     /db_xref="GeneID:2895935"
     CDS             703955..706933
                     /locus_tag="KLLA0_F07469g"
                     /note="similar to uniprot|Q02792 Saccharomyces cerevisiae
                     YOR048C RAT1 Nuclear 5' to 3' single-stranded RNA
                     exonuclease involved in RNA metabolism including rRNA and
                     snRNA processing as well as mRNA transcription
                     termination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455419.1"
                     /db_xref="GeneID:2895935"
                     /db_xref="GOA:Q6CKX0"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR017151"
                     /db_xref="InterPro:IPR027073"
                     /translation="MGVPSFFRWLSRKYPKIISPVLEEYPVIEDGVQLPLDYSSANPN
                     GELDNLYLDMNGIVHPCSHPENKPPPETEDEMLLAVFEYTNRVLNMARPRKVLMIAVD
                     GVAPRAKMNQQRARRFRSARDAKLQNEAREQVLREREDYGETIDENVKSKKTWDSNAI
                     TPGTPFMDKLATALRYWTSFKLATDPGWKNLQIIISDATVPGEGEHKIMNFIRSQRAD
                     TQYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFANNNYKKPKPQDMINLSEEE
                     KQQLIQQDSEKPFLWLHISVLREYLSAELAIPHLSFQFDFERAIDDWVFMCFFCGNDF
                     LPHLPCLDVRENSIDILVDIWKTVLPKTKTYLTCDGTLNLEPVEALLEQLGDRETDLF
                     KKKYIQEVRKQEAHDRRKKLKSNPNVSQGKVDRNFMIPLENMPVYDVDGNAAEGSLNL
                     SNKDFANMRKEINLANEGDGEAAKALKLKSEKNSGVVEFSSEELKNSVQLSKTANYDA
                     ATSLQEKLIAKKMAMRDEENAEELSLKRKSEDVDSAEKETSNEPEDDEADYDEDEGST
                     VPPAVIHTGIVKSGFIDTDESVRLYEPGYHDRYYQHKFHVPAKDIPALQKDVIRCYVE
                     GISWVLLYYYQGCASWTWYYPYHYAPFAQDFKNIKNLDIHFDLGEPFLPYEQLMSVLP
                     AASGHALPEIFRPLMSDPNSEIIDFYPEEFPVDMNGKKMAWQGIALLPFIDETRLLKT
                     VREQYSKLSDSEKARNVRKKDALLISNKNVNYDLFMKNLYGENPVNVIEFRHFKSGLS
                     GFVTQAEEGFELNSKLICPINGGGLPDLSTNLFLKLSYTQPVVAGRCKSLVLNGYIPP
                     QPMLTPQDRDCIIYKYSNRWNPSMMKYNIVPVGPSGITQYQPRVGGYRSFFFHKEQTA
                     YAQQPQQNREYMHSQQRQPQGSRYQQSRYNNGNYNNSNNGYSDNNNGNTGKYNRHYNN
                     SRGNSNRYSNSNDRRREFRR"
     gene            707161..707232
                     /locus_tag="KLLA0_F07491r"
                     /db_xref="GeneID:2895936"
     tRNA            707161..707232
                     /locus_tag="KLLA0_F07491r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2895936"
     gene            <707516..>710662
                     /locus_tag="KLLA0_F07513g"
                     /db_xref="GeneID:2895937"
     mRNA            <707516..>710662
                     /locus_tag="KLLA0_F07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455420.1"
                     /db_xref="GeneID:2895937"
     CDS             707516..710662
                     /locus_tag="KLLA0_F07513g"
                     /note="similar to uniprot|P31380 Saccharomyces cerevisiae
                     YAL019W FUN30 Protein whose overexpression affects
                     chromosome stability potential Cdc28p substrate homolog of
                     Snf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455420.1"
                     /db_xref="GeneID:2895937"
                     /db_xref="GOA:Q6CKW9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW9"
                     /translation="MDLPIPKSPQNKQDEVQVPSSSPLLQTNEESSPLRPETGTRIDE
                     SPISSNSTSSLLRDKFTYQPATKARNGYSQNDLSHEQALKVLVQEYKDLSPTLINAIF
                     KQNSMSISSSRKRLDHIVASRTGGSWRFQSKTNVNPTLNLNKPNSPMDLSKSRLISLK
                     EGGSSGNSIKSNPAINLPSRNVSTSKITIEKQKTSIFDRYSHVMKVSQPSPARSMADR
                     TTMSTIKNLSSKKGKLVRGDAIKKKQKIKLSDDEEDEITDQSNDDGELDTEPEYEEKV
                     TESNFDQVLKFLNEADPKDLADLGEISIEKAALVIKERPFEDLEQFQQLDFQSKSPSP
                     APGKARKSQQKKDGLKILDKIEQSIKGYNAIESLIRKCSKYGDVIANQMTNWGVDFSS
                     SKDTELNILDVDTYSDDEANETITNDSANVQIIKSSTTSRENSLGPSKRKRNDDEEEF
                     SDVDYEESDDDDFDVKPRARTKQKKTSITQLRNNQMKFIRQKPKLLSSDVELKDYQQT
                     GINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYLKQTHHNGPHLVVVPSSTLENWL
                     REFNKFCPHLKVEPYYGSQQERAELRDILEENEGQYDVIVTTYNLAAGTKYDVSFLRN
                     RNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPN
                     LFVSKKDDLATVFKQKTRTSDADKGYNPLLAEHAIERAKTMMKPFILRRKKDQVLKHL
                     PRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNLIMALRKA
                     SIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKLCCKFP
                     SLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNI
                     KFLRLDGQTQVNDRQSLIDRFYEDDTIPVFLLSTKAGGFGINLVCANNVIIFDQSFNP
                     HDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHISQEDKKNEEA
                     LENKVTDLLEDIIFDENQ"
     gene            complement(<711607..>713070)
                     /locus_tag="KLLA0_F07557g"
                     /db_xref="GeneID:2895939"
     mRNA            complement(<711607..>713070)
                     /locus_tag="KLLA0_F07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455422.1"
                     /db_xref="GeneID:2895939"
     CDS             complement(711607..713070)
                     /locus_tag="KLLA0_F07557g"
                     /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
                     YOL049W GSH2 Glutathione synthetase catalyzes the
                     ATP-dependent synthesis of glutathione (GSH) from
                     gamma-glutamylcysteine and glycine induced by oxidative
                     stress and heat shock"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455422.1"
                     /db_xref="GeneID:2895939"
                     /db_xref="GOA:Q6CKW7"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW7"
                     /translation="MSSTESYPKFPAISTKKLQDGLQSEIFRWALTNGLAMYPPNFKP
                     ELATVAPITLFPTPLPNEAFQKAIDVQTIYNALYASISQNKNDWLAKETEKLAKSDPE
                     FTGRLWTLYKRAKEYGIVQDLALGVFRSDYLINSDNNQIKQVEFNTVSVSFGGLSTKV
                     GELHDYLNKSGNYSDNGEVFYDQDIPISPSAELLATGLATAINKYQPADKNKRPIVAF
                     IVQNGERNVFDQSILALNLLSKYDTKSVRLTIHEIHEATRLDPETKRLYHKTTGQEIG
                     LVYFRSGYAPSDFVSEQDWENRLTLEISYAIKAPNLLTQLSGTKKIQQLLTDPKILKE
                     FLSDTESLDHLLPTFVKIYPLDSSVLGEIGKKLALTEPENYVLKPQREGGGNNIYKED
                     IPGFLESVDEDEWSAYILMELITPKSTEENFVIRGQELFNVPILSELGIFGTILFDHN
                     NIYSNEYAGWLLRSKFSSSNEGGVAAGFGCVDSVVLY"
     gene            complement(<713403..>716507)
                     /locus_tag="KLLA0_F07579g"
                     /db_xref="GeneID:2894954"
     mRNA            complement(<713403..>716507)
                     /locus_tag="KLLA0_F07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455423.1"
                     /db_xref="GeneID:2894954"
     CDS             complement(713403..716507)
                     /locus_tag="KLLA0_F07579g"
                     /note="uniprot|P32257 Kluyveromyces lactis KLLA0F07579g
                     GAL11 Transcription regulatory protein GAL11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455423.1"
                     /db_xref="GeneID:2894954"
                     /db_xref="GOA:P32257"
                     /db_xref="InterPro:IPR003101"
                     /db_xref="InterPro:IPR008626"
                     /translation="MDDWRSTISTQERSQFVTELAQILADMSRINGGEKANFNLEKLK
                     KSAEQFESSLYASCNSKDLYLDAMRKRIAAMDSAKRKSIEAQRQKLAQAQAQAQAVQR
                     QQQQQQQQHHMQQQGSGQQQANGIPANINAQMFLNQQAQARQQAQRQIRSTLTGQQQQ
                     QPMPQQPQPQQQQPNMMRPQLTLQQQQQLANELKVTEIPRELLQKIPNLPPGITTWPQ
                     ITFWAQKNRPSQNDLIITKKVYQLHQQLLNKSKLQQSNVNRMNTSVQQPGMGVQQSPN
                     QRMNMNQVPQQQQQVRQQQQQQQQQQQQQHKQQPQHQEPPAVLGRLNQVFTQAEQKML
                     YEAGKKMIENLQRSGKLPPNLDSQQQLLYIKKYMNQMVLKKMQQLGIPIPMPGSAQQQ
                     SQLLQQQQQQQQQQQQQQRQQQIPQVQQAPLQQPQVQPPQSQQAQSRRQAMGMKPTPV
                     IPNAGVMKPQPQQTPQNIQQPMMQQQSSPPPQQQQQQQQQSKISVPRPTEQDMLALKK
                     LNAEVTKNPVKLNDITNRLTNDQKQQIRSKLHANQQLFSSVESFIPTLYMLTRNEEHI
                     RQLLQIRMLTREIMEKAVRGVFLVEPNVVDKVIFRYQKYYEYTKEQLLRRQQQLMTMR
                     QMQNNNPNLTANDLLNQQQLLQNRKLNLAMQSQTQEPPQIAAQQQQPQQPISGVNNNS
                     NMGIVLDSSLNATSRSGTNTMEFLNSPEFSAISPAVPSPNKDKKNPATRAVKGKKNSQ
                     SGIPTSNPQSNSNASVVNSRTATPTVIPGSSPMFNNKSLASGQQNSPSPKTMINSPPQ
                     QDNPYKNDELALKKMAIRTAELMSRYKHRKEVFVMSSIDLFLSTFADCLDIKDDAVDL
                     VHKTPQPILDQINGTGKKKLSKAAQKARDQDPVEISVRNNKLLMPSKSEKTLRSFKIP
                     IADITACFKPFADPKQLILNSTPKHDEKKRKFDDLEISPTDSSSELMSESKKVKFDSP
                     DDMFLNDPSSVQETKPLVPSELGMYSINSKPSIPSSAGNMPAPNESTDSGMNIWDWNY
                     WESL"
     gene            complement(<717689..>718606)
                     /locus_tag="KLLA0_F07601g"
                     /db_xref="GeneID:2895940"
     mRNA            complement(<717689..>718606)
                     /locus_tag="KLLA0_F07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455424.1"
                     /db_xref="GeneID:2895940"
     CDS             complement(717689..718606)
                     /locus_tag="KLLA0_F07601g"
                     /note="similar to uniprot|P31379 Saccharomyces cerevisiae
                     YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455424.1"
                     /db_xref="GeneID:2895940"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW5"
                     /translation="MSFAGTLICCAFGGLVYKYGDQRHTLLEPPEELGVQDYTVRFAK
                     TKIKILKRRFKDAVASLVPGLSTPGIYLYPLVSYWELLSTPEYWKSSVPIMVVYLLLY
                     ALVTFVYLLTILPVYTPLSVFLGPIGLIVAWIHMFLHTNMLTMMTIRMSQMNSFTMYQ
                     GMAIRSMDVNIIDAGNDQPIKYYYPLASTYFFFNHLPWKLTEYFAGFVVLCGLLLISS
                     IPILGPFIFHTLISPFITRLYWAPYLRYLKVDNLQRETRFYKMMGQYIAFGLVAGQLE
                     SWPIVSALAYSAHAIAICQWAQDLPTLLN"
     gene            <720246..>723935
                     /locus_tag="KLLA0_F07623g"
                     /db_xref="GeneID:2895941"
     mRNA            <720246..>723935
                     /locus_tag="KLLA0_F07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455425.1"
                     /db_xref="GeneID:2895941"
     CDS             720246..723935
                     /locus_tag="KLLA0_F07623g"
                     /note="similar to uniprot|P31374 Saccharomyces cerevisiae
                     YAL017W PSK1 One of two (see also PSK2) PAS domain
                     containing S/T protein kinases coordinately regulates
                     protein synthesis and carbohydrate metabolism and storage
                     in response to a unknown metabolite that reflects
                     nutritional status"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455425.1"
                     /db_xref="GeneID:2895941"
                     /db_xref="GOA:Q6CKW4"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW4"
                     /translation="MPFIGASTDSRSGFHTLMEKHSRASTPVSSTSSFKRAATGTSTA
                     ELSSADDDTQSLASFSRLPTTSDIIEQPEPINQLRKSSTISTISSISSSSNGSIFTDS
                     DIRELLRFPNSSTHAYSYNPLSPYSLSVRLTILKRSIEIMINNPSLLSDSDEPHTFVN
                     IDEAKKLIPQKSQLQTPVPPKVLRNASSAALSAFFTNKNQDLSPVKTLVSLNSKNSAS
                     SNQLDNQQQKGLPTSVNIIRSSSNPLATTWEIGSGQTSENTSASSSRRNSLVSNLQSS
                     LNDHLTNKAPPYYGDTATVDYEEKKKSDLEALLDLLNKALQNNTDDAASSLHEMSLFN
                     INKLAIPSPPNNGNGSGKYVDNGATTKYDINYDAHDTAIKKQLLESLAQPFHEIYNTR
                     EALMDEKDLEFKVEEYSRDPNSLITGNRILHTFTSQKNSSPKAIFTCSQQHPWKFRAA
                     NDLACLIFGISMNAMRALTLLDLIHSDSRNFVLNKIMTTEGQEQVFTGEIVGIKQPGH
                     ASSGLIWSSIWAKRKNGLIVCVFEKVPCDYMDVLLNLEDYSIENVVGGEGLQYDTKNF
                     SMKEPQEVDGTGKKSVKFEHQLPDVESISKSLWQVVKDVTSGKLMGPDDDLLPMPLRV
                     ANTINDIRYYTLNYLEYNIPCAVSCSILDTELKLKIHSLPYQTGVFILNLHTYEMVSF
                     NKSISKNMFGLHYAELVGKSIEEVIPSFPSMIAYIKRNYPQWDIALPTNKGLVLTEHF
                     FRKIDCEMRGKGEEFYHSIGLNALHRDGSFIKVDVQLRVISWNYMVLWITYSRDLFGK
                     NYSSNPSQLKILNENNINVVTSASSEGSSKTNSEKISVTDFKQMHDDLEKMNLSLEGS
                     TVGSHLEKNPMEEKKEENKEVEETEEVPDDDLELKAKLEVAKRFHQDKSQFVKDDNFK
                     LDKELIVNITSASPPAQDDQYNMDSTASDSSIQTSNTSKSYVIGSQKHTKKFSDFLVL
                     QKMGEGAYGKVDLCMHKKDKYIVVIKRIYKERILVDTWVRDRTLGTIPSEIQIMVTLN
                     RKPHENILRILDFFEDDDYYYLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVA
                     SGIKHLHDNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVFVGTIDYAAPE
                     VLGGEPYEGKPQDIWAIGVLLYTIIYKENPFYNIDEILDGDLRIQSTHEVSAECVALI
                     RKILNRSVSKRPTIDDIMEDSWLQL"
     gene            complement(<724204..>725763)
                     /locus_tag="KLLA0_F07645g"
                     /db_xref="GeneID:2895942"
     mRNA            complement(<724204..>725763)
                     /locus_tag="KLLA0_F07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455426.1"
                     /db_xref="GeneID:2895942"
     CDS             complement(724204..725763)
                     /locus_tag="KLLA0_F07645g"
                     /note="similar to uniprot|P50276 Saccharomyces cerevisiae
                     YGR055W MUP1 High affinity methionine permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455426.1"
                     /db_xref="GeneID:2895942"
                     /db_xref="GOA:Q6CKW3"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW3"
                     /translation="MSSPNEDRREIASTDEPIQDLFLISEDYIINPHEHKLNTFHTIS
                     LIVNRIIGTGIFSTPALIFTLSQQSIGISLILWVLGGIFTFAGLSVYLEFGLKIPKSG
                     GEKNYLSRTLPKPKHLIECIYAFTIVLLGFSSGNSYAFGKYIIYVLGFNSSLSETVID
                     KASRYIGSLVIISCTLWHIFFPTGAKRVILYLGLVKVLILGVIVFLGSIAIIAPNLIE
                     PHWDNFHNSFSNGSQPLDWYSISVALLQVIYSFKGWENANYVLEELEDPRRTLMIAAP
                     VSVGLTTFLYIAIVFSYYVVIPKAEISDTGILISGVFFERIFERYSKSLAMQIVSRVL
                     PFCIILSNYGNVMAVSFSNARVNQELAKEGIFPLTHLFSKLNYALFLHCFITIVVLLL
                     PPNGNIYQLIIDLYAYPSGWFNLIIGIGLIYIHWTNDGGWNDIYTPWSSWYLVTVIFI
                     ISNLFLAVIPFVPPNGSVENDGYSYWVFPVTGISIMGVGALYWLLVVRKSYSRYSSAT
                     HNNEVDDYTVR"
     gene            <726241..>727314
                     /locus_tag="KLLA0_F07667g"
                     /db_xref="GeneID:2895943"
     mRNA            <726241..>727314
                     /locus_tag="KLLA0_F07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455427.1"
                     /db_xref="GeneID:2895943"
     CDS             726241..727314
                     /locus_tag="KLLA0_F07667g"
                     /note="some similarities with uniprot|Q08215 Saccharomyces
                     cerevisiae YOL044W PEX15 Phosphorylated tail-anchored type
                     II integral peroxisomal membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455427.1"
                     /db_xref="GeneID:2895943"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW2"
                     /translation="MMSQKSFQVVDTTRLEQLLDDDRFRLNLQPVDIEKEHAQECLDL
                     YVKGDLKECLELMYEYGLLNSNKMQTSLKSWQLMMDCVSQMNNVGVIGTSLDKRLKEW
                     FTNEELLLRLIKMKPLSDQLIITYQFFYSSLKFWKRNVKQNYEHIDELSISCKELLLQ
                     TSRRCQTVTEIQNLSQILDFLIFDVQIETLQKKASITMYTRFCQLDDKLQSKLKANKV
                     KHAQSVDIDTYFREKLQPKPKPKPKSKSRSLKPKNQVQIGAATTSTSTTAVIAPASTQ
                     RMNLSYIRRLTTYLPRWLPVWAQSVQWSPQLLASLIIFAISMVLPLARRSKTFNIIWM
                     HSKDKASTIVRLFIHAVNTLASL"
     gene            <727832..>729664
                     /locus_tag="KLLA0_F07689g"
                     /db_xref="GeneID:2895944"
     mRNA            <727832..>729664
                     /locus_tag="KLLA0_F07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455428.1"
                     /db_xref="GeneID:2895944"
     CDS             727832..729664
                     /locus_tag="KLLA0_F07689g"
                     /note="highly similar to uniprot|P31383 Saccharomyces
                     cerevisiae YAL016W TPD3 protein phosphatase 2A regulatory
                     subunit A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455428.1"
                     /db_xref="GeneID:2895944"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW1"
                     /translation="MGDNSDSKVNLYPLALLMDELKHDDISNRVEAMKKLDTIALALG
                     VQRTRDELIPFLTEVAQDDEDEVFAVLAEQLGNFVPFVGGRKYATLLLPALEILASTE
                     ETLVREKAVDSLNMVAEQLTEEQLLHDFVPLIENLATNEWFSSKVSACGLFKAVFVRI
                     QDDKFRKDLLSLFLQLIQDDTPMVRRAAGRNLPTLVDQLTEHPELSTDDEWDYISSMF
                     QRLVNDSQDSVKFLAVDVLISILKFFNKKKDFTHTKDLLQSSIQLIGDEAWRVRYMAA
                     DRFEELASQFVSNPQYVSELLEPFLALCQDNESDVRKAIAKQIPGYAKLLNDPSVILN
                     RIIPAAQNLSIDETECVRASLALEITNLAPLLPKQDSMDSLVPILLHMLKDEFPDVRL
                     NIIAKLKIVNESVGIEFLSENLLPAITELAKDPNWRVRLAIIEYIPLLAEQLGMEFFD
                     SKLSDLCLSWLWDGVYSIRSAAITNLSKLTEIFGSDWAQEEIISRLLKSDTQLLENFN
                     YRITLLFALTGLVPVVSTDVVVEKILPFVNHLSTDNVPNIRFNVAKFYAVIVEALTKN
                     TNKNHIELINNTIIPTLEKLCQDPDVDVRFFSAQSLEKCKSFLS"
     gene            complement(<729829..>731004)
                     /locus_tag="KLLA0_F07711g"
                     /db_xref="GeneID:2895057"
     mRNA            complement(<729829..>731004)
                     /locus_tag="KLLA0_F07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455429.1"
                     /db_xref="GeneID:2895057"
     CDS             complement(729829..731004)
                     /locus_tag="KLLA0_F07711g"
                     /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
                     YOL043C NTG2 DNA N-glycosylase and apurinic/apyrimidinic
                     (AP) lyase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455429.1"
                     /db_xref="GeneID:2895057"
                     /db_xref="GOA:Q6CKW0"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6CKW0"
                     /translation="MTRAKRPRVNVEVELETVSKYFKKEPEDQVVVKVEGNHDIKTDP
                     EIEAIKTMGTDEYFKYVQKFTNDDISLNRKLQIEDNPNMPSNFVSIYSKVRFMRSMIK
                     TPVDNVGCAMLPITINGVFGISKSNMQPKNYRLQLLVSLMLSSQTKDEVNAKAMHNIM
                     EYCMEELGDPEGITLGSLLKIEEKILDKEIYSVGFHTRKASYIKKAAVMLRDQFDGDV
                     PTTIEGFMSLPGVGPKMGYLALQKSWAKIDGIGVDVHVDRLAKMWKWVDPKVCKTPEH
                     TRKQLESWLPRSLWYEINPVLVGFGQVLCMPRSKRCELCLVNDICPGVDKKLLKLVGL
                     ELEDTVKNSNRGDYTEWINYLRKERAAELSQNEIDDVDRSAETTSTESNTEVKTEDN"
     gene            <731317..>732432
                     /locus_tag="KLLA0_F07733g"
                     /db_xref="GeneID:2895058"
     mRNA            <731317..>732432
                     /locus_tag="KLLA0_F07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455430.1"
                     /db_xref="GeneID:2895058"
     CDS             731317..732432
                     /locus_tag="KLLA0_F07733g"
                     /note="similar to uniprot|Q08213 Saccharomyces cerevisiae
                     YOL042W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455430.1"
                     /db_xref="GeneID:2895058"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV9"
                     /translation="MFGRKLLPVLKKLPGKTKIKTPSSSIQGPFNDRFTMLTYNMLSP
                     YYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYNEFWKKQMMN
                     RMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVGTFDQQEL
                     HYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVINTHLYWK
                     YDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNSSRDSLVIKFLNGK
                     IIKHGDINLQNPMRAYLSHSIYDDIPEDAYVHTCYSGKLKGIFDYIWFHPGDFEVEKV
                     LSGQEVSKELTHLNDFGLPNKYHPSDHIPVLTELRIL"
     gene            <732874..>733497
                     /locus_tag="KLLA0_F07755g"
                     /db_xref="GeneID:2895059"
     mRNA            <732874..>733497
                     /locus_tag="KLLA0_F07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455431.1"
                     /db_xref="GeneID:2895059"
     CDS             732874..733497
                     /locus_tag="KLLA0_F07755g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455431.1"
                     /db_xref="GeneID:2895059"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV8"
                     /translation="MNHILLQTLNKDVSTPQIQQQQLKPLQQQAGTSNRVGSGVAFLM
                     GDPVVRDARMRLDIKKSFCDDHMFYPESKFGWSTVASNTNASAYIPVGVRSYGLSTYN
                     QRVSQHTNLGGGVDISDTNSNGLAGPVPHNTRHVYTGQNFNSMEQHKQQQQVNPYLLS
                     NNVQQSFNINDNQQSYYGRSMKNGSSNSSNNYNTNSLGGSHTINNKW"
     gene            complement(<733753..>734535)
                     /locus_tag="KLLA0_F07777g"
                     /db_xref="GeneID:2895060"
     mRNA            complement(<733753..>734535)
                     /locus_tag="KLLA0_F07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455432.1"
                     /db_xref="GeneID:2895060"
     CDS             complement(733753..734535)
                     /locus_tag="KLLA0_F07777g"
                     /note="similar to uniprot|P31377 Saccharomyces cerevisiae
                     YAL014C SYN8 Endosomal SNARE related to mammalian syntaxin
                     8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455432.1"
                     /db_xref="GeneID:2895060"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV7"
                     /translation="MNGLKVEYEIDKLIEIVDERDRLMDVLHMQPSKNDNIKLKKHIN
                     HTLDLLKDYEDDVPFSEDDRFNHQIKTYNDIIEGLPETVIDKELYRFKRKPNLRETKK
                     VRFKDGLVEEHKEPEQKFKPYKDDESSSTVVDDLLEVKRKELFGNQETGTPKYNISPQ
                     VSNQDIFIQQQQQLMEQESHLENLSSSINRTQGISIEINDEVEQQNEHLLTDIERQVD
                     RSESHLQRAGRRLNAYEATAREKGPCFLIVILSIILFLLVII"
     gene            complement(<734889..>736277)
                     /locus_tag="KLLA0_F07799g"
                     /db_xref="GeneID:2895061"
     mRNA            complement(<734889..>736277)
                     /locus_tag="KLLA0_F07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455433.2"
                     /db_xref="GeneID:2895061"
     CDS             complement(734889..736277)
                     /locus_tag="KLLA0_F07799g"
                     /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
                     YOL041C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455433.2"
                     /db_xref="GeneID:2895061"
                     /db_xref="GOA:Q6CKV6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSALNNLFGNSKSDAAGTSSIAALFSKPNHVDERKVKSKARTVL
                     TEPEQDKDEQEEENVQESASTVSEGVEKEQEEQEEQPKKKKKKTKKNDEENDNLEVQY
                     YSKVLGDSKSKDEPKDEPKDDSSDSDNEDEATAVDKSSITGTESESAKVINLKEKELA
                     KAERTIFIGNVPNEVITSKKVYKEFKKLLSKDPRSENDDHDDGEEDEEEEESKTKDVK
                     FNVESIRFRSIAFEEALPRKVAFVHQKLHKSRDSINAYAVYGSSNPVKIMCQYLNGKV
                     FNDHHLRVDSVTHPSPHDKRRSVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKT
                     NMGKGFAYVQFKDFQSVSKALLLHEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNN
                     KLNDQQRTKLGRAKKVLGKADRAKLGEELTIEGLRASKGETTPVLKRTKNRSKTGRVT
                     KRSIAFKKQNAQ"
     gene            <737054..>738874
                     /locus_tag="KLLA0_F07821g"
                     /db_xref="GeneID:2895062"
     mRNA            <737054..>738874
                     /locus_tag="KLLA0_F07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455434.1"
                     /db_xref="GeneID:2895062"
     CDS             737054..738874
                     /locus_tag="KLLA0_F07821g"
                     /note="similar to uniprot|Q758U6 Ashbya gossypii AEL344W
                     and some similarities with YAL013W uniprot|P31385
                     Saccharomyces cerevisiae YAL013W DEP1 Transcriptional
                     modulator involved in the regulation of structural genes
                     involved in phospholipid biosynthesis also participates in
                     regulation of metabolically unrelated genes as well as
                     maintenance of mating efficiency and sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455434.1"
                     /db_xref="GeneID:2895062"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV5"
                     /translation="MEPERNKNNSVEAASEIDDHNTRSAPTTKLTKEVLEKIASDSDS
                     VNFNANSYSRKSKSGSPSKVGTLEYDDNSTSGLSKVTSPEHPNSVSLSDIYISSDAET
                     EKMDLEEDESRVKLSEMASNSIESNGNDKSKQNDDNLSKTVKQEYINNGVGSYIQESA
                     PKLATPSKDEGPIVQQDKPAETEPEPVPYEDDAVADTDHTTEPNKLALSQNQDEVSVP
                     AEGGSQEETIANDEQEQHAPVVEEQANDNEIKSQEESEVSLKHNREEEQQSLENGSEH
                     VKSEQVFKKPKLPTESKSGHYEDEHETHENGDHDVDIDADAEAEDDGTLESEVEDNNE
                     DEEEELEPEMDAVEEDNDEKQQTDTPGVDSTDNGLSPMEKERIRQDALAELTNIEVEF
                     AQLRQSLYENKLSKLQNELQMCLDGSHPQLQTYYQKIASIRDFKLKRMYQRQKYELEC
                     IDTETRATRTFIHQDFYRKVSDLKHKLLGNTTQKWYDINKERREMDVVVPEVNYHVPI
                     KISNKSLSCITGYAAPANLRRPGDLLSEDLLCENINFRYHNNPVDKLEVIVDRMRFNN
                     ELSDLDGIRKFYGGFPGAPELGGLKDSEIHEDLAGIQHQQ"
     gene            complement(<739661..>740089)
                     /locus_tag="KLLA0_F07843g"
                     /db_xref="GeneID:2895063"
     mRNA            complement(<739661..>740089)
                     /locus_tag="KLLA0_F07843g"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_455435.1"
                     /db_xref="GeneID:2895063"
     CDS             complement(739661..740089)
                     /locus_tag="KLLA0_F07843g"
                     /note="highly similar to uniprot|Q01855 Saccharomyces
                     cerevisiae YOL040C"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_455435.1"
                     /db_xref="GeneID:2895063"
                     /db_xref="GOA:Q6CKV4"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV4"
                     /translation="MSEAAAPRKRSFKTYSYKGVDLEKLLEMPTEDFVKLAPARVRRK
                     FARGLSEKPAGLMKKLRAAKLSAPENEKPAVVRTHLRNMIIVPEMIGSVVGVYNGKVF
                     NQVEIRPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
     gene            <741097..>741417
                     /locus_tag="KLLA0_F07865g"
                     /db_xref="GeneID:2895064"
     mRNA            <741097..>741417
                     /locus_tag="KLLA0_F07865g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_455436.1"
                     /db_xref="GeneID:2895064"
     CDS             741097..741417
                     /locus_tag="KLLA0_F07865g"
                     /note="highly similar to uniprot|P05319 Saccharomyces
                     cerevisiae YOL039W RPP2A Ribosomal protein P2 alpha a
                     component of the ribosomal stalk which is involved in the
                     interaction between translational elongation factors and
                     the ribosome regulates the accumulation of P1 (Rpp1Ap and
                     Rpp1Bp) in the cytoplasm"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_455436.1"
                     /db_xref="GeneID:2895064"
                     /db_xref="GOA:Q6CKV3"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV3"
                     /translation="MKYLAAYLLLNAAGNTPSSDNVKAVLESVGIEVEEEKVSSLLSA
                     LEGKSVEELIAEGTEKLASVPASSGAAASGAAASGASEAAAEEAPESEKEESDDDMGF
                     GLFD"
     gene            <741965..>742273
                     /locus_tag="KLLA0_F07887g"
                     /db_xref="GeneID:2895065"
     mRNA            <741965..>742273
                     /locus_tag="KLLA0_F07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455437.1"
                     /db_xref="GeneID:2895065"
     CDS             741965..742273
                     /locus_tag="KLLA0_F07887g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455437.1"
                     /db_xref="GeneID:2895065"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV2"
                     /translation="MSSGAHFFSMKICGALLMISHVHVQLYRHTGSSSDRQGGNLQKW
                     IQRPREFDSNCGFGKAALAASFWVSNDKRIFPTEFSHFFPAFELASARTGTSGGTVDL
                     "
     gene            <742468..>743643
                     /locus_tag="KLLA0_F07909g"
                     /db_xref="GeneID:2895066"
     mRNA            <742468..>743643
                     /locus_tag="KLLA0_F07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455438.1"
                     /db_xref="GeneID:2895066"
     CDS             742468..743643
                     /locus_tag="KLLA0_F07909g"
                     /note="highly similar to uniprot|P31373 Saccharomyces
                     cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
                     catalyzes one of the two reactions involved in the
                     transsulfuration pathway that yields cysteine from
                     homocysteine with the intermediary formation of
                     cystathionine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455438.1"
                     /db_xref="GeneID:2895066"
                     /db_xref="GOA:Q6CKV1"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CKV1"
                     /translation="MGLLPTDKFATKAIHAGTHVDVHGSVIEPISLSTTFKQSAPAQP
                     IGEYEYSRSQNPNRKNLEDAIAALENGKYGLAFSSGSATTAVILQSLPQGSHAVSIGD
                     VYGGTHRYFTKVANAHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIEL
                     VAKTAKSINKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATN
                     DKVIYEKLQFLQNAIGAIPSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNENV
                     IAVNYPGLPTHESYAVVKKQHRDALGGGMISFRIKGGAEAASTFSSSTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQALASASN"
     gene            <744157..>745629
                     /locus_tag="KLLA0_F07931g"
                     /db_xref="GeneID:2895067"
     mRNA            <744157..>745629
                     /locus_tag="KLLA0_F07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455439.1"
                     /db_xref="GeneID:2895067"
     CDS             744157..745629
                     /locus_tag="KLLA0_F07931g"
                     /note="similar to uniprot|Q6B1H9 Saccharomyces cerevisiae
                     YOL031C SIL1 ER-localized protein required for protein
                     translocation into the ER interacts with the ATPase domain
                     of the Kar2p chaperone suggesting some role in modulating
                     its activity homolog of Yarrowia lipolytica SLS1 GrpE-like
                     protein in the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455439.1"
                     /db_xref="GeneID:2895067"
                     /db_xref="GOA:Q6CKV0"
                     /db_xref="InterPro:IPR016024"
                     /translation="MRVKCVNRAIYVLTVLLFSRLVVSQVVLTPSNSNADPKQKDTAN
                     TVAAVEANNDANIAKKDAESDLVIGDHLVCNTKECYPIGFVPSTEWKEIRPGQRLPPG
                     LDIRVSLEKGVREAKLPEPGSENIGNEEEDVKGLVLGAEGSTLSESELKETSEDLENE
                     QSGFKLNNAEKESDILQQETDLKIAVSDNAEATSNEPAGHEFSEDFAKIKSLMQSPDE
                     KTWEEVETLLDDLVEFAHDYKKGFKILSNEFELLEYLSFNDTLSIQIRELAARIIVSS
                     LRNNPPSIDFVNEKYPQTTFKLCEHLSELQASQGSKLLIKRFLSILDVLLSRTEYVSI
                     KDDVLWRLYQIEDPSSKIKILEIIAKFYNEKNEQVIDTVQQDMKTVQKWVNELTTIIQ
                     TPELDELHLRSFFHCISFIKTRFKNRVKIDSDFLNWLIDEIEVRNEKSKDDIYKRDVD
                     QLEFDNQLAKSRHAVFGNPNAARLKERLFDDDDTLIADEL"
     gene            complement(<745723..>746451)
                     /locus_tag="KLLA0_F07953g"
                     /db_xref="GeneID:2895068"
     mRNA            complement(<745723..>746451)
                     /locus_tag="KLLA0_F07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455440.1"
                     /db_xref="GeneID:2895068"
     CDS             complement(745723..746451)
                     /locus_tag="KLLA0_F07953g"
                     /note="similar to uniprot|Q08202 Saccharomyces cerevisiae
                     YOL032W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455440.1"
                     /db_xref="GeneID:2895068"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU9"
                     /translation="MFAAIASGNPLQLSTEVPNSNGLQHTIVLSSTKPKSYSHITLFI
                     LPNVTFPQEFLATVYFKLNPAEDFKLFGYLGNEKPSAIFKVKLPQANVGNGVTANPSD
                     GLGEIDMEDDVMTDDLNGANANHNISQLIIGISIEPRNDATAKLEQWKAEQAALSSSA
                     GAGAMVLSKNSVQILTAGALAKQYPVVTQELAAKIVQHAYNYLTGFVDAQGNVSIKRF
                     DTWWEKFRVRLQNDATFLDEVTKD"
     gene            complement(<746708..>748336)
                     /locus_tag="KLLA0_F07975g"
                     /db_xref="GeneID:2895069"
     mRNA            complement(<746708..>748336)
                     /locus_tag="KLLA0_F07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455441.1"
                     /db_xref="GeneID:2895069"
     CDS             complement(746708..748336)
                     /locus_tag="KLLA0_F07975g"
                     /note="similar to uniprot|P48525 Saccharomyces cerevisiae
                     YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
                     encoded by a nuclear gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455441.1"
                     /db_xref="GeneID:2895069"
                     /db_xref="GOA:Q6CKU8"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU8"
                     /translation="MFRASVLGSIEKCTRKYSSLSKGKLEGILNKSKKSLFVKKPVKD
                     VHPKYPVRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAE
                     QSLYDALKWCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKER
                     LDALRESAQKLQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLL
                     HGKLDIQPQVNPLDIRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTP
                     KHTALYEAYGWTPPHYVHIPLLTTTSDKKLSKRKGDADVRAMRAKGILPEALINFSAL
                     FGWAPPRELASANHECFSLEELVHIFDLNHLTKGNAKVDDKKLYYFNKHYLTQRLQNP
                     DQFEELLDIAYDFMKPNYKSLSKDHLREVLKSIGTHLTTIYDIDSSFYNLFKDPTYVN
                     ENATNFLENHNTDDVCRVLSFLKDKISESNISDLIKTAVEELSVPKKLIFESVRFALV
                     GSMPCVKLPVLVKILTPDESNRRIGNALTLIKSR"
     gene            complement(<748561..>751920)
                     /locus_tag="KLLA0_F07997g"
                     /db_xref="GeneID:2895070"
     mRNA            complement(<748561..>751920)
                     /locus_tag="KLLA0_F07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455442.1"
                     /db_xref="GeneID:2895070"
     CDS             complement(748561..751920)
                     /locus_tag="KLLA0_F07997g"
                     /note="similar to uniprot|Q08204 YOL034W Saccharomyces
                     cerevisiae YOL034W SMC5 Structural maintenance of
                     chromosomes (SMC) protein, interacts with Rhc18p and Nse1p
                     to form a large complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455442.1"
                     /db_xref="GeneID:2895070"
                     /db_xref="GOA:Q6CKU7"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU7"
                     /translation="MAPSQSAMTSVINFGDYVDDTADSLLNDDINPCTNNSKNLSTKR
                     LRIQHSELNEFQPGAVVKLKLTNFVTYALTEFHLSPSLNMIIGPNGSGKSTFVCAICL
                     GLAGKPEYIGRSKKVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHVKRV
                     LSMEKKKSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLN
                     ETIRSIEAGLLEKLSELKSLQAEGNELQIDLGAKENKLKELTSSRAALESQAHALELY
                     EEKARELDIHQKLLNYTYLKEHKEKIRGLKDKRNALRNEVKTMENESKPFNLLGVRLT
                     ADENNCKSDIDDLSRRRYSAKTSFNSSTENIQKTSKYLSECESKVNFLTTRNKSLKED
                     IKVNEEKIKALEEERNKVVLPDPEKIHEVDENLSTASAKRLKLNDDIADLKEKKAKIL
                     FIRQAKEADMRKKQNDLSSNDNLNILDGLQKKNNSTVFSKLKNAILYLRSVKDAKGRV
                     FEPALLSVSAVDETFAAYLQSCIDFHTSTALTMIDKHAYAKFSDYLVEKFNVNIRELS
                     DQPVKPRMTREELRGFGFEGYLVDFIKGDENVIKMLCQQQKIHMIPVTRRPLGKSHLE
                     ALKKVDRNGRILFPKFIEGSYIHNINQSEYGRKQIYSKSVRIKMHADFYKASSMGRSD
                     IDAINLSIKKLHEEVVKLDENLKSLSTDIAKKEKEIVESRHVTDHLKTQRYELGKSSR
                     LLQQYDVKISRYRQKVNDNNEKLRVDIRDSIKEASNKLQEARESERKALLRLHPITIQ
                     MQEFDIEMATKNMYLLELRTKIDSISQVCRSMEEARNLKKEEFIDVSEQYKSIKNTDE
                     FIKCSNAIENFPEEEKDVLNEIAVKYNQENQFSSIHIESIINRLSSELSMINNDTSVI
                     DILKKTNEDISILEKTLPHLRAKLASNAQTILEIRNSLEPRLDDIVKQISKKFSHLFA
                     YVGSAGQVELKKPDSFNDWCIEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQ
                     QFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLITPKLLTNLFYHERM
                     RIHCVFAGSWIPDPATDPQRTHFGETTSYIL"
     gene            <752184..>754460
                     /locus_tag="KLLA0_F08019g"
                     /db_xref="GeneID:2894793"
     mRNA            <752184..>754460
                     /locus_tag="KLLA0_F08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455443.1"
                     /db_xref="GeneID:2894793"
     CDS             752184..754460
                     /locus_tag="KLLA0_F08019g"
                     /note="some similarities with uniprot|P31376 Saccharomyces
                     cerevisiae YAL011W SWC3 Protein of unknown function
                     component of the Swr1p complex that incorporates Htz1p
                     into chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455443.1"
                     /db_xref="GeneID:2894793"
                     /db_xref="GOA:Q6CKU6"
                     /translation="MSKKRGRRHTAKEDSNSDYETDTYGLADGDDKSRPYYLVEDLPC
                     SLEPPRYDTFTYPLSVKDSAVLYSSLLSSRRTWVKGEMFQLYWAKQYMNTKEKEELKK
                     EGIDPDSIDQSAAREKMNKLCDCMMQGGPHQFPIRLFILKNDEVERAWNEAKEAKKRD
                     REVRKKQQEEEKRLKKERKLLRKKLKQEALEKEKEKNKDKVKKPRKPYKKSAKRLEAE
                     RLKKEEKAKAAANTSGVKKKISKTSNVKKKKMKAVVRPKPYEEQVMILNLNKMARNDK
                     QLNDLMIKVAGGQASLAEITQFKKYIEKAKAMPPPSGTWKPMLEEVEVTDDGESDEDV
                     KELEVTEKSEDVTPTEVALPKAAVAAKEVKDVVVTPNLPPGTENSGNGKPPSLDESNA
                     QESTDVNKNQPIQRLNISKNVQSVKNDITENTDLASNEHMNEKQVQKTPESTTEHKPD
                     EKPKDAAMSKSNEKKPDEDTAQDTSKDDENKSDKSDSDSDSDSDSDNDSSSSDESDNE
                     DNTSQTKNSIDNTDDGVTSEKADTNTDVSSDKPPDDIKSEGEVAAPRVKRKYRRRSKV
                     KTEEEEEEEKAMQLTTFQQKYSNGADMVFEYVENANVRFLLPKYSILEQLEGEESYLL
                     SFIVVHNRREVALFTTRKLKELNKKKNKEDHIKPEDYNPFEDARCPDPLFSSITLKLT
                     GIPKKFSNIILNSFHPQERVQLYMKSIIDRGSRLSGYNLWYQLDAYDDKELAERLRVG
                     LKEYEQTFKSKRQKKQIL"
     gene            complement(<754518..>755876)
                     /locus_tag="KLLA0_F08041g"
                     /db_xref="GeneID:2894794"
     mRNA            complement(<754518..>755876)
                     /locus_tag="KLLA0_F08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455444.1"
                     /db_xref="GeneID:2894794"
     CDS             complement(754518..755876)
                     /locus_tag="KLLA0_F08041g"
                     /note="similar to uniprot|P18409 Saccharomyces cerevisiae
                     YAL010C MDM10 Subunit of the mitochondrial sorting and
                     assembly machinery (SAM complex) has a role in assembly of
                     the TOM complex which mediates protein import through the
                     outer membrane required for normal mitochondrial
                     morphology and inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455444.1"
                     /db_xref="GeneID:2894794"
                     /db_xref="GOA:Q6CKU5"
                     /db_xref="InterPro:IPR022197"
                     /db_xref="InterPro:IPR027539"
                     /translation="MLEYMDYVLRQFEECTSWNKDNSYENIVGTSRNILQFDIPTALK
                     VQVSNRATPYSYNTLELTNNKTINGSLTYLYTNCENLDQFIEGSSSVHLQQMTQSFRY
                     IEPYYHHYKNNSKLEVPKVPELPISLAYGRMFYPSSSLEAMYIRRFPNYYQFILKCSS
                     SKSGSSILTMYLQKNTGINCQELIFSTNEALLGYRFVHNFVSAGSKSNLSLYNNSSLS
                     IGSEIWCALLNLSPGCSTTLRYCSHATNTGKPLIFTLSLNPLYGHVSSTYSIKTHENL
                     TFCTKYDFNIYSIQSNLTLGMELWKNSSSIPVERPSEPVETIEDWPQLSHDKTPMYYH
                     LLTRTENSGASSQRLLKDLNLTFQSSLQKINKERNVIENFNERYSEANFTQVFKVSTS
                     LRDMNLRLLWEGKIRGFLISAGAELTQPPEISTNGLDSLEHQNWSLISPSKFGIQLQY
                     SA"
     gene            <756362..>757231
                     /locus_tag="KLLA0_F08063g"
                     /db_xref="GeneID:2894795"
     mRNA            <756362..>757231
                     /locus_tag="KLLA0_F08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455445.1"
                     /db_xref="GeneID:2894795"
     CDS             756362..757231
                     /locus_tag="KLLA0_F08063g"
                     /note="similar to uniprot|P18410 Saccharomyces cerevisiae
                     YAL009W SPO7 Integral nuclear/ER membrane protein of
                     unknown function required for normal nuclear envelope
                     morphology and sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455445.1"
                     /db_xref="GeneID:2894795"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU4"
                     /translation="MGDGDDDSVPELKLSLTSTPVHTTTSYGGSLSSEYTDSPWGKRG
                     HISFSGTPTTNRRRRSSSRASSKNVKSSEISPISMIFRNLLILEDDLRHQSKEQRMLK
                     WQFTLFLAGLAGIAAFSFYELYFSNDQVTGLYRIGLQFLLIFISVTIVLFHLSGEYKR
                     TMVIPRRFLVNANKGMRQFNVKLVKVKSTWLQNYADTIRIIIRRVSKWNMKLLITMGA
                     TNTSIYAFWSSLSIRCLPRLGAVDVKLVLNAKAFSAEIREGWEIYRDEFWKRETVRRR
                     KQESQNNTHLKRD"
     gene            complement(757326..757426)
                     /gene="SNR50"
                     /locus_tag="KLLA0_F08074r"
                     /db_xref="GeneID:9487300"
     ncRNA           complement(757326..757426)
                     /ncRNA_class="snoRNA"
                     /gene="SNR50"
                     /locus_tag="KLLA0_F08074r"
                     /product="snR50"
                     /note="C/D snoRNA monocistronic SNR50"
                     /transcript_id="XR_002633607.1"
                     /db_xref="GeneID:9487300"
     gene            <758631..>760640
                     /locus_tag="KLLA0_F08085g"
                     /db_xref="GeneID:2894796"
     mRNA            <758631..>760640
                     /locus_tag="KLLA0_F08085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455446.1"
                     /db_xref="GeneID:2894796"
     CDS             758631..760640
                     /locus_tag="KLLA0_F08085g"
                     /note="similar to uniprot|P38903 Saccharomyces cerevisiae
                     YOR014W RTS1 B-type regulatory subunit of protein
                     phosphatase 2A (PP2A)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455446.1"
                     /db_xref="GeneID:2894796"
                     /db_xref="GOA:Q6CKU3"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU3"
                     /translation="MMRGFKQKLIKKTTGSTSSSSNQKRKDKEKEEKKEKEHSKRSPS
                     TSGSSSARSSLDKTSHRSGSTGSNAGSSRRVDSKSGSNNHNNHGSSNSNASGSGSSAN
                     NNQNDGVPRTPSVNITKADSNAVGKPTLIGAAAQVTPPPTSPKAQPASLNTPSSATGS
                     TTVLKDSQRSPTSIEIPRSSHSFERLPTPTKLNADSDLEMIKTPQRHSSSRFEPSRYT
                     QIVKLPRFEEVLPEEQIPLFITKVDQCNTMFDFNDPSFDIQGKEIKRVTLQELIEFIV
                     TNRFTYTEEMYEHVVNMFKINLFRPIPPQVNPVGDVFDPDEDEPVNELAWPHMQYVYE
                     FFLRFVESPDFNHQIAKQYIDQNFILKLLELFSSEDIRERDCLKTTLHRIYGKFLSLR
                     SFIRRSINNIFLQFTYETERFNGIAELLEIMGSIINGFALPLKEEHKVFLVRVLIPLH
                     KVRCLSLYHPQLAYCIVQFLEKEPLLTEEVIMGLLRYWPKINSTKEIMFLNEIEDIFE
                     VIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIF
                     PPLYKLTSQLDKNDPLSLEDGDNGEDPYLMVEQAINSGSWNRAIHAMAFKALKIFLET
                     NNVLYENCNALYISSLKENNRRQKEREMNWKQLEDYVSKLKIAES"
     gene            <761242..>761748
                     /locus_tag="KLLA0_F08107g"
                     /db_xref="GeneID:2894797"
     mRNA            <761242..>761748
                     /locus_tag="KLLA0_F08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455447.1"
                     /db_xref="GeneID:2894797"
     CDS             761242..761748
                     /locus_tag="KLLA0_F08107g"
                     /note="some similarities with uniprot|P18411 Saccharomyces
                     cerevisiae YAL008W FUN14 Mitochondrial protein of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455447.1"
                     /db_xref="GeneID:2894797"
                     /db_xref="InterPro:IPR007014"
                     /db_xref="UniProtKB/TrEMBL:Q6CKU2"
                     /translation="MFRTAARNLGVPLRRSVYVGFSGSLLVGGGSLLHSMQPSSYIMN
                     DSIVDVKQRTNLPQELGLPSRVDISSKQRRVNYRQMCYGSILGLVFGVIFGKISSLLV
                     FITGVGFVGLQFLQNRGVISSDSTRSLSKYVVTIGRERIDLNTLIWDKPSFKVSFILT
                     FVLAALNV"
     gene            <761965..>762597
                     /locus_tag="KLLA0_F08129g"
                     /db_xref="GeneID:2894798"
     mRNA            <761965..>762597
                     /locus_tag="KLLA0_F08129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455448.1"
                     /db_xref="GeneID:2894798"
     CDS             761965..762597
                     /locus_tag="KLLA0_F08129g"
                     /note="highly similar to uniprot|Q06102 Saccharomyces
                     cerevisiae YPR107C YTH1 Essential RNA-binding component of
                     cleavage and polyadenylation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455448.1"
                     /db_xref="GeneID:2894798"
                     /db_xref="GOA:Q6CKU1"
                     /db_xref="InterPro:IPR000571"
                     /translation="MSIVHPDTSKYEFNFEPFLRKEYSFSLDPDRPVCQYYNSREGIK
                     SCPNGARCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFTKNG
                     YCTQSPECQYLHVDHKSQLEECEDYNMGFCPSGPACTKKHVKKVLCPRYLVGFCPLGK
                     DCDWSHPKFKVPSEHSKLRIKKDEHINTRKMDEERERRLNAIINGDILVT"
     gene            <763454..>764377
                     /locus_tag="KLLA0_F08162g"
                     /db_xref="GeneID:2894800"
     mRNA            <763454..>764377
                     /locus_tag="KLLA0_F08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455450.1"
                     /db_xref="GeneID:2894800"
     CDS             763454..764377
                     /locus_tag="KLLA0_F08162g"
                     /note="highly similar to uniprot|P53252 Saccharomyces
                     cerevisiae YGR086C PIL1 Long chain base-responsive
                     inhibitor of protein kinases Phk1p and Phk2p acts along
                     with Lsp1p to down-regulate heat stress resistance via
                     regulation of the Pkc1p and Ypk1p pathways phosphorylated
                     by Phk1p and Phk2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455450.1"
                     /db_xref="GeneID:2894800"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT9"
                     /translation="MHRTYSLRTTRAPTASDLQNPPPPPSSTKSRFFGKGGLAYSFRR
                     NAAGAFGPELSRKLSQLVKIEKNVLRSIELAANERRDAAKQLSLWGLENDDDVSDITD
                     KLGVLIYEMSELDDQFIDRYDQYRLTLKSVRDIEGSVQPSRERRAKIADKIAYLKYKD
                     PQSPKIEVLEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSVIEHSEKLALIAG
                     YGKALLELLDDAPVTPGETRPAYDGYEASKQIIIDAESALNQWTLDSAVVKPSLSIRN
                     FDDAYLDEEDQEQWNDEEAEAEAQEEHPVAA"
     gene            <765209..>767512
                     /locus_tag="KLLA0_F08184g"
                     /db_xref="GeneID:2894801"
     mRNA            <765209..>767512
                     /locus_tag="KLLA0_F08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455451.1"
                     /db_xref="GeneID:2894801"
     CDS             765209..767512
                     /locus_tag="KLLA0_F08184g"
                     /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
                     YPR105C COG4 component of oligomeric Golgi complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455451.1"
                     /db_xref="GeneID:2894801"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT8"
                     /translation="MEIDEFQLDSKLSKFENLSGKLSTKSQLPKLLHLIEADYSQTSN
                     ALNNYIKGSNNKINKSVRSLELGKTNLTSTLSFFHEALESLSNSNVQSISISNRLNSI
                     KDEADHINQLADFVDSVKLLKNNLKIINDALDTKEPNYPMIAQCIYEIDQLPDSIIHS
                     QFVQRCVPTSELPDPPVQLIDKWKTHLCKVFSDRFTRATRDVDVGTLTECFKLFPKIG
                     ASDLGIDLYSKYICDNIAQQSRTLMTHTSGDPLFYSKSTLHLFKIVSTMINDHSKIIL
                     QSYSTDFMLEIMQKVQLETDLQACLIWDTFTDDVSLDKVFASLQDNNDMRTLQAIILQ
                     FSNFLQNWSMYCQFFSMKWLQFTNGSVDPIKIVPCLTSGKFNSKLQDNIDTFHALTIH
                     YTTYCFKSSLKTSCMPNLNDSLDITLSQNTESNQQIISPVLEDLAILIKSYLVWTLNS
                     GQTELVTKSLDSISQMIQNEYLISFVQSSLTKLIPRLTPALRLQKYISAPNYPMDTQS
                     KFTSQFAAFNLKETDMESVLHLHHYIVYLNTISTNESIFKDLFENEIIKINPHFLIDN
                     FKFNNEHELVKGKLLSVLQYILDNNKKLWNWAIMMLYQNVLQENLHRLLSVLFQRNTE
                     FLSTLQDFEDFEKLHKFVEEWNKLLTPYKQVLSAASFNNLLTTIVKDVCPIIENKFLS
                     LQFNELGSIKIEKQLSIVIKTISMDNYQLREWFKKLTQMCLLLGFEDDQFDSSTQDLK
                     DDVLNSLNWLLTSSERISIRQQRIDKR"
     gene            <767745..>770261
                     /locus_tag="KLLA0_F08206g"
                     /db_xref="GeneID:2895785"
     mRNA            <767745..>770261
                     /locus_tag="KLLA0_F08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455452.1"
                     /db_xref="GeneID:2895785"
     CDS             767745..770261
                     /locus_tag="KLLA0_F08206g"
                     /note="similar to uniprot|P39521 Saccharomyces cerevisiae
                     YPR104C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455452.1"
                     /db_xref="GeneID:2895785"
                     /db_xref="GOA:Q6CKT7"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT7"
                     /translation="MDTDRSSVGISPAEHSVPLEASKRDADATGTIVPEEDLKLEHIP
                     DNLEHADFSKLLELDEKNDDDLFHGIDILDQQMKSDQGKEDIELRVEEPKREMKEDES
                     SNVRNEDKQKLEAPESPKSMPAIHNDEKSVKQVYPLVKHEENTPAAIIQERLAHNLQR
                     HNSLTPMMFPLKQLNELKSDMQNLKLKTEDGAKNSPQSDQNTSQKNAESPENGQQVTQ
                     LHPQLLQAADVNTPTSNTVPGASDEQSKISAYARLDFQDFTFYVQTLQVIIGRRSEND
                     YSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSIMGKNGAFVDDNFVERGSTVPLKN
                     KTKIQIGQIPFQFVLPDHEGNISKELASKSKNSTANASQPPKKKNKKEKEVKEVKEKK
                     APKPPKPPKKVYTLQEIPPEYRTKPTCSYSNLITSCLRKFSTEKGMSLSEIYSGIREL
                     FPYYKYCPDGWQSSVRHNLSLNKSFCKVSKEGKGWLWGLDEEYIAERERQKKKQAEAQ
                     AAKAKVAELKQQQQQEQRLKKQQQQSSNSKQPNMAQTLAANRSDKKTTSMDDNQRTMK
                     YLQEQLMILTKDRKGLDKSLMAQILTQALAMTINQVTQAAKQKGISGNPLTALIDKNP
                     QHLNLILAAAVNAATAKVTKGKVNQLVNMPPPTVKDQQPSAKKEIPIKRAVTPKPPTP
                     SVVNPVHANSSNKDQSFDPTSLSKFFQPKQQQGSRPSSGMAKTPTPPVTVGTPKSGVV
                     SNGSSVPATSPQATSTVVPKKRPASDTESSDSDDSNSSDSDEQNKNGDSSGESSGDSS
                     SSSDSDGDSGSESETDGSDSDSNSDDSDNNGHDNDDGQSD"
     gene            complement(<770578..>771435)
                     /locus_tag="KLLA0_F08228g"
                     /db_xref="GeneID:2895786"
     mRNA            complement(<770578..>771435)
                     /locus_tag="KLLA0_F08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455453.1"
                     /db_xref="GeneID:2895786"
     CDS             complement(770578..771435)
                     /locus_tag="KLLA0_F08228g"
                     /note="highly similar to uniprot|P30656 Saccharomyces
                     cerevisiae YPR103W PRE2 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455453.1"
                     /db_xref="GeneID:2895786"
                     /db_xref="GOA:Q6CKT6"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT6"
                     /translation="MQAIADDFSRSSVFTELNDEQTLRENFVLGDSQFKQLAPSLSMP
                     PISTPQQFLRAHTDDSKNPDCKIKIAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQT
                     VKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVY
                     EYKGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRW
                     DLSVEEALYIGKRSILAAAHRDAYSGGSINLYHVTENGWVYHGNHNVDTLFWEIKEKE
                     KSFNNVVSQ"
     gene            <772179..>772703
                     /locus_tag="KLLA0_F08261g"
                     /db_xref="GeneID:2895788"
     mRNA            <772179..>772703
                     /locus_tag="KLLA0_F08261g"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_455455.1"
                     /db_xref="GeneID:2895788"
     CDS             772179..772703
                     /locus_tag="KLLA0_F08261g"
                     /note="highly similar to uniprot|P06380 Saccharomyces
                     cerevisiae RPL11A and to uniprot|P06380 Saccharomyces
                     cerevisiae YGR085C RPL11B component of the large (60S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_455455.1"
                     /db_xref="GeneID:2895788"
                     /db_xref="GOA:Q6CKT4"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT4"
                     /translation="MSAKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVQSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRNRNFSATGNF
                     GFGIQEHIDLGIKYDPGIGIYGMDFYIVMGRPGARVTRRKRCQSKIGNSHKTSKEDTI
                     AWFKQRYDAEVLDK"
     gene            complement(<772816..>773331)
                     /locus_tag="KLLA0_F08283g"
                     /db_xref="GeneID:2895789"
     mRNA            complement(<772816..>773331)
                     /locus_tag="KLLA0_F08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455456.1"
                     /db_xref="GeneID:2895789"
     CDS             complement(772816..773331)
                     /locus_tag="KLLA0_F08283g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455456.1"
                     /db_xref="GeneID:2895789"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT3"
                     /translation="MNSVLKMNTELGYQEYLEKITLEANGVTSDETTLHSKVADIFRE
                     EIEVNGCLRESFNVYEDVDGNIEKWRSQIWLERPEMSAEVRYAYLKHQELCLERLISK
                     TLPKQLIVQEEMLKSVTEQIRGVLETQKQQLEQLSQYRTNMEESHRQEIDSLNNRWRL
                     TLNDNLEKATI"
     gene            <773720..>774685
                     /locus_tag="KLLA0_F08305g"
                     /db_xref="GeneID:2895790"
     mRNA            <773720..>774685
                     /locus_tag="KLLA0_F08305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455457.1"
                     /db_xref="GeneID:2895790"
     CDS             773720..774685
                     /locus_tag="KLLA0_F08305g"
                     /note="similar to uniprot|P12686 Saccharomyces cerevisiae
                     YGR084C MRP13 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455457.1"
                     /db_xref="GeneID:2895790"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT2"
                     /translation="MFSRFFTRSVSTGVESRAVFDNFLQFVKTPQTLRPYIYRKKNAN
                     RLLAMDLKDPETKLPIQPRPSVLRPSASVLNSVILNASSAEELENMVRDWKNITPRRK
                     EFWSYLIPQHLQNMLLTSTFKFGALGAVLNVLYQIQPLLVKAKQLEAYNVDVWYNTVL
                     MCQLHRNAFQNVQDSGMVERGLRKLSSTVTKREDTTGLTKEIVQALGRQQNVEVKLPN
                     FARNIEINLPSIDVSTASQNQLRTFLTKNTTQYLLSRTALDFGSTEAKLQQFVENYQA
                     VLAQNSVADIYDKYVSQYKQLLTQKATESETTEEAHADAQAEETK"
     gene            <775125..>776933
                     /locus_tag="KLLA0_F08327g"
                     /db_xref="GeneID:2895791"
     mRNA            <775125..>776933
                     /locus_tag="KLLA0_F08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455458.1"
                     /db_xref="GeneID:2895791"
     CDS             775125..776933
                     /locus_tag="KLLA0_F08327g"
                     /note="similar to uniprot|P12754 Saccharomyces cerevisiae
                     YGR083C GCD2 Delta subunit of the translation initiation
                     factor eIF2B the guanine-nucleotide exchange factor for
                     eIF2 activity subsequently regulated by phosphorylated
                     eIF2 first identified as a negative regulator of GCN4
                     expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455458.1"
                     /db_xref="GeneID:2895791"
                     /db_xref="GOA:Q6CKT1"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT1"
                     /translation="MTGGAKEASGKETNTEKTANAQEGEKPLSNKELKELKKKEKAAK
                     RAASKQASGISIEKQQQQAAAKREKKQQQRDLLAAKKNKAADPVKHDTKKSTLFGHLE
                     TAEERRASLLAVSSAITSTGTSRITANGLVLPLLATTPAVAVSQPMSASPLSSNLSGS
                     NTNLAGLAHSEDFEAHQMLNSLSLDESSSFVPGISSVIPNTMTSQFTNQQSIASVKEL
                     IANREMLHPAITSLTLDYAFYKIIGSIPRCIAMLEAFQLVVRDYKTPEGTTLSRNLTS
                     YLSHQIDFLKKSRPLSVTMGNAIRWLKQEISLIDPSTPDSKAKKELCDKIAQFARERV
                     QLADQLIIETASQHIEEGSTILTYGCSKVLTDLFLHNAINFGKNFQIVIVDSRPLFEG
                     RKMAESLRNQGLNVLYVPITALGTVFNMDIKYVFLGAHSILSNGFLYSRVGTAQIAML
                     ASRRNIPVLVCCESLKFSQRVQLDSVTSNELADPNDLVTIDSANPVQRRNNNGFLLQQ
                     FIKEREAQQKEVENSSKQNNKSGSANTNNATADEGKNVKDKPILAEWEKSPNLHIFNI
                     MYDLTPPDYIKKIITEFGSLPPSSVPVVLREYKASA"
     gene            complement(<777144..>777572)
                     /locus_tag="KLLA0_F08349g"
                     /db_xref="GeneID:2895792"
     mRNA            complement(<777144..>777572)
                     /locus_tag="KLLA0_F08349g"
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /transcript_id="XM_455459.1"
                     /db_xref="GeneID:2895792"
     CDS             complement(777144..777572)
                     /locus_tag="KLLA0_F08349g"
                     /note="highly similar to uniprot|Q06090 Saccharomyces
                     cerevisiae YPR100W MRPL51 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /protein_id="XP_455459.1"
                     /db_xref="GeneID:2895792"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CKT0"
                     /translation="MVVKVLRQTSIARNGVGAFVLPCKKITLQYCNWGGSSQGLRDFL
                     TSNRMIQWAEKYPTIQFEIVRKSGHPVIKGDYVNGRNKAICVKNLNIDNVENKLKLIR
                     DASGEQLRHRTKNDNVDTLNDSVRGIWSPLHLSPAIRHKV"
     gene            <779264..>781009
                     /locus_tag="KLLA0_F08371g"
                     /db_xref="GeneID:2895793"
     mRNA            <779264..>781009
                     /locus_tag="KLLA0_F08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455460.1"
                     /db_xref="GeneID:2895793"
     CDS             779264..781009
                     /locus_tag="KLLA0_F08371g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455460.1"
                     /db_xref="GeneID:2895793"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS9"
                     /translation="MEQYLNLSDDGEAQPNLDLELKSFFDFSQDSSINQDPSAVGPNN
                     TAYSEQVFPEFTFETESSGKEFQFGSIAELLQDTPMSRDLDYSTATETSTPHFTYMAD
                     NFLASNYSLDEIAALPNTNEQITISNTNNNKGNLMHFSVGQSMLCFNNDIFDGRRESF
                     VSDTVTPISSNTNSPRSNSVNNNKINRINNMRAQKPNNVRFSFNHVNSSPFAVGSSSS
                     IAEVSMDSMFPPSPTKTPTKMLPKTKRRKSSSSSSSSVSSLTQDLLSMKDRRCIFKPA
                     PKKKSELYLRPERRCPKFEFGIRSEDNVINVTFQGGFIRNTIMDWYFPSDSALPSNFQ
                     DVTIEYDHDYYAKMLNHINTQIAMQNDPNISSFRTYWKILKCQTGPHIKLQFISETLD
                     CDVNFSNTQYYFNIVSRIVRPKSFGPIESGARYRAKMVNDMKSDDSTGKPRWCHFITS
                     AEMKGILDFIFDGLDYIANDDTLPDKLSKGIKPNPFKQHESRIRSHMVGYVSGKKCMK
                     DAKNVLTGERKVFAEEMYKQVIGYDDKRRPYNTLKEFAVMEVKYMMDNIEDLFGKFYW
                     VDPGTVPTGGYKVRF"
     gene            complement(<781508..>783019)
                     /locus_tag="KLLA0_F08393g"
                     /db_xref="GeneID:2894951"
     mRNA            complement(<781508..>783019)
                     /locus_tag="KLLA0_F08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455461.1"
                     /db_xref="GeneID:2894951"
     CDS             complement(781508..783019)
                     /locus_tag="KLLA0_F08393g"
                     /note="uniprot|P09608 Kluyveromyces lactis KLLA0F08393g
                     GAL1 Galactokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455461.1"
                     /db_xref="GeneID:2894951"
                     /db_xref="GOA:P09608"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /translation="MSVPIVPTDFAHAPKLEQLKNEFVECYDTDDSRKFFITRSPGRV
                     NLIGEHIDYCQFSVLPMAIENDLMLACRLTSESENPSITLTNHDSNFAQRKFDLPLDG
                     SLIEIDPSVSDWSNYFKCGLLVAQQFLQEKYNFKGPVHGMEIYVKGDIPSGGGLSSSA
                     AFICAVSLAIIYSNVPAGTPILKDELTKTTAVAEHHVGVNNGGMDQAASICGIEGHAL
                     YVEFKPELKATPFKFPEDLPISFLIANTLVVSNKAETGPVNYNLRVVEVTVAANVLAQ
                     KFGVTLQTEGNLGKGTLRNFMDSYYTKYDKSCRKPWDGEIQTGIERLNKMLQLVEETL
                     DPNGYTLDHAVELCGCESISQFTELYLTNFPVRFQRLKLFQRAKHVYSEALRVLKALQ
                     LFQKGESNFFEEFGALMNESQESCDKLYECSCPETDSICEIALKNGSFGSRLTGAGWG
                     GCTVHLCSTDTVDSVKSALTEQYYNLRFPELTAEELEDAIIISKPSLGSVLYE"
     gene            <783785..>785851
                     /locus_tag="KLLA0_F08415g"
                     /db_xref="GeneID:2894953"
     mRNA            <783785..>785851
                     /locus_tag="KLLA0_F08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455462.1"
                     /db_xref="GeneID:2894953"
     CDS             783785..785851
                     /locus_tag="KLLA0_F08415g"
                     /note="uniprot|P09609 Kluyveromyces lactis KLLA0F08415g
                     GAL10 GAL10 bifunctional protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455462.1"
                     /db_xref="GeneID:2894953"
                     /db_xref="GOA:P09609"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR025308"
                     /translation="MSEDKYCLVTGGAGYIGSHTVVELCEAGYKCIVVDNLSNSSYES
                     VARMELLTGQEIKFAKIDLCELEPLNKLFDDYKIDSVLHFAGLKAVGESTQIPLTYYF
                     NNIVGTINLLECMKSHDVKKLVFSSSATVYGDATRFENMIPIPETCPTGPTNPYGKTK
                     LTIEDMMRDLHFSDKSFSFAILRYFNPIGAHPSGVIGEDPLGIPNNLLPFMAQVAIGR
                     RPKLYVFGDDYDSVDGTPIRDYIHVVDLAKGHLAALKYLEKYAGTCREWNLGTGHGTT
                     VLQMYRAFCDAIGFNFEYVVTARRDGDVLNLTAKCDRATNELEWKTELDVNKACVDLW
                     KWTQDNPFGYQIKGVDSKFFGDKGDFSSRVVSLGKGTSFEVKLANLGATIVDIVVNGC
                     SVVASLDNETEYKDQSNPFFGATVGPYANRIANGTFEINGKRIQLTVSKEDGNVVHSG
                     INSYHSKKFLGPIVKNPEAHIWTADFKYVDEETEFPARLSTLVRYKVDSEKKTLTVEY
                     ESKVAGQGSTGANITNHTYFNLNKFNEATIKGSKVQLIDNTGLEVNNKLLPTGNLKKY
                     TQVATFNDSPTEITEKEPVLDFCFVSGLPAKLDTRSSPLTPVFKLSNEDAKLEVEVAT
                     TEPTFQVYTGDYVDVKDKYENRAGICCEPGRYIDAVNNPEWKSSVVLPAGETYGHKLS
                     YTFRTL"
     gene            <786742..>787854
                     /locus_tag="KLLA0_F08437g"
                     /db_xref="GeneID:2894952"
     mRNA            <786742..>787854
                     /locus_tag="KLLA0_F08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455463.1"
                     /db_xref="GeneID:2894952"
     CDS             786742..787854
                     /locus_tag="KLLA0_F08437g"
                     /note="uniprot|P09580 Kluyveromyces lactis KLLA0F08437g
                     GAL7 Galactose-1-phosphate uridylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455463.1"
                     /db_xref="GeneID:2894952"
                     /db_xref="GOA:P09580"
                     /db_xref="InterPro:IPR001937"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019779"
                     /translation="MSFDLTDHSHARYNPLTDSWILVSPHRAKRPWLGQQEKPGRNDA
                     PDHDDKCYLCPGTTRATGEQNPDYESTYVFTNGYPAVKLEQPDPELTVSNCDALKERL
                     FKLKGVKGNCYVICFSPKHNLSFPQMAQSEIMNVVKTWTNLFQTLEKEALEENKPYKY
                     LQIFENKGTAMGCSNLHPHGQAWCLDSIPSEPAKEFDHFEKYEHQHGAHLLEDYVNLE
                     LREKERIVCENDSFLVVVPYWAVWPFETMVLSKRRIPSLNQFTDKEREDLASIIRNLT
                     IRYDNLFETSFPYSMGLHQASLNATEGELKAAWFHMHFYPPLLRSATVRKFLVGFELL
                     GQPQRDLTAEQAADRLKALSGEVHYLAKLEQEESKT"
     gene            complement(<787966..>790479)
                     /locus_tag="KLLA0_F08459g"
                     /db_xref="GeneID:2895794"
     mRNA            complement(<787966..>790479)
                     /locus_tag="KLLA0_F08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455464.1"
                     /db_xref="GeneID:2895794"
     CDS             complement(787966..790479)
                     /locus_tag="KLLA0_F08459g"
                     /note="similar to uniprot|P12945 Saccharomyces cerevisiae
                     YDL040C NAT1 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455464.1"
                     /db_xref="GeneID:2895794"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS5"
                     /translation="MYKKKGLSHGKVGLPIGRSKDDSNMLEALQLYEGKNYKKSLKIL
                     DTILKKNSSHVDSIILKGLNLQFCSTPEEAASYIDKALSKIKGTLVSPIGGHLLGIYY
                     RQVKNYSDAVKWFKAALENGSTNTQIYRDLATLQSQIHDFKGALESRKKYWENYRGYR
                     ANWTSLAIAQDLNGRTQDAINTLSTFEELAEGKLGEPEMYENNECIMYKNDLLYKKAG
                     NDKESLERVLEHLEKISDDVYDRYGWLERKASILMKLGRSKEASIVYRTLIKRSPDNF
                     RYYRLLEVSLGIQGNEKLRKALYEKLAIFYPKSEPPKFIPLTFLKDKVELTAKLNDYI
                     ITQLNRGVPATFNNIKPLYKKEGIPDIVESIVLPYYAELSSTDQPIQFVWTTYFLALH
                     YLHRKQFEQANAYADKAMNHTPTLVEVYILKSRVLKHLGLLEEASEVIDKGRELDLQD
                     RFINAKTVKYMLRADKIDEATKIVSLFTKNDQSPNGVPDLHLLEASWFIIEQAESFFR
                     LYKKSCKELIGLKNKDITALTVDEIESHGKLLKELEFNVNKFEGLSLKRYMAIPKIYK
                     QFEDDQLDFHSYCMRKGTPRAYVNMLEWGNHLYTLPMFIRAMEGASRIIFGRFDSLQL
                     TASVEQEHDDSSIKKKTNKKAKKEAAALNKKKEEEKAKYLAYLDDKDPFGETLLNDPN
                     PLELFENQFLKLYLSQTTDDTRRHLLEFEFHLRTGKLALALGALTKYVKLNGKDSVAA
                     SMALVLLENTKDSYPHDVIAKKVAIKGIEKEFPDLLSESGDKVQFVTCTYGKTLPSLL
                     ILYHHSSESIPEPEIKEDIISVLDNEDPVVQHSILEYEF"
     gene            complement(<790859..>792310)
                     /locus_tag="KLLA0_F08481g"
                     /db_xref="GeneID:2895795"
     mRNA            complement(<790859..>792310)
                     /locus_tag="KLLA0_F08481g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455465.1"
                     /db_xref="GeneID:2895795"
     CDS             complement(790859..792310)
                     /locus_tag="KLLA0_F08481g"
                     /note="similar to uniprot|Q02554 Saccharomyces cerevisiae
                     YMR240C CUS1 Protein required for assembly of U2 snRNP
                     into the spliceosome forms a complex with Hsh49p and
                     Hsh155p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455465.1"
                     /db_xref="GeneID:2895795"
                     /db_xref="GOA:Q6CKS4"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS4"
                     /translation="MVKKAKANKRRSKNKNGSVKEDAEERKKRLSSLLQQVSSENGNT
                     SQQVINEPLVIKDESLNKVLQRFKASATGADEDDDSKREQAIVRKERADIDDEDAEGS
                     DSFEDQADEVLQNISERQKRLANKPSIAVLKASVPYPELIEWFDCDAQWPYFNAAIKT
                     THNTVGIPRHWQMKRGYLSGRSMMERKPFQLPEIIRQTDIETMRETVPSGNEKQAEKL
                     KDITRAKVQPKLGVLDLDYKRLYEAFFTLGKNWKPELLSFGDLYYENRSLDSELEWKQ
                     IKTRYRPGYLSETLREALNLTEGMLPPWCHEMNRLGLPKSYPGMKVCGINWEISNLTG
                     TQYGYYPEDTLRIPKQNLFGAMFSFEELEDQDAHIDPDPLNESISDDEVSSDANEAEA
                     TKTESETHENNNSGLVPIDGGSVVNQHYDENRPLFTVLTEAKSNEVDGSTIISSTTSY
                     NITNKRSTSVEEKDDDNVLHKKQKVEEEPDFRF"
     gene            complement(<792545..>792775)
                     /locus_tag="KLLA0_F08492g"
                     /db_xref="GeneID:9487351"
     mRNA            complement(<792545..>792775)
                     /locus_tag="KLLA0_F08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999382.1"
                     /db_xref="GeneID:9487351"
     CDS             complement(792545..792775)
                     /locus_tag="KLLA0_F08492g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999428.1"
                     /db_xref="GeneID:9487351"
                     /db_xref="UniProtKB/TrEMBL:B5FV99"
                     /translation="MQSSLQKMISTQPIVTPEPKGSENSGNSNEDVPTVFEIASDIQQ
                     KLQDLLRKVNDDDVQFNKFADSINDRLKNLEE"
     gene            <792967..>793668
                     /locus_tag="KLLA0_F08503g"
                     /db_xref="GeneID:2895796"
     mRNA            <792967..>793668
                     /locus_tag="KLLA0_F08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455466.1"
                     /db_xref="GeneID:2895796"
     CDS             792967..793668
                     /locus_tag="KLLA0_F08503g"
                     /note="similar to uniprot|Q08774 Saccharomyces cerevisiae
                     YOR305W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455466.1"
                     /db_xref="GeneID:2895796"
                     /db_xref="GOA:Q6CKS3"
                     /db_xref="InterPro:IPR018828"
                     /translation="MSWKGVFASSFPKDTLQKYIAANESIANSTVFQGTLYELTVVRE
                     LMNKLRLEDMQVVGGSYDGGIDIRGKWNVLPLTKAIEMQIQFDELPKRLKLPTTSIKP
                     WKHRVKPDKYLDCYIQCKAFNSDKVTGRQVRELIGSFSMQVPARKRNSSIMIMSSPTL
                     FTKDGIRLFNEAAIPMVFTKVDMIQRLADGSFDVKNSGKLQHYYENDYASKLLANCGI
                     KEWLKLKGYESLAQK"
     gene            complement(<793929..>795410)
                     /locus_tag="KLLA0_F08525g"
                     /db_xref="GeneID:2895797"
     mRNA            complement(<793929..>795410)
                     /locus_tag="KLLA0_F08525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455467.1"
                     /db_xref="GeneID:2895797"
     CDS             complement(793929..795410)
                     /locus_tag="KLLA0_F08525g"
                     /note="similar to uniprot|Q08777 Saccharomyces cerevisiae
                     YOR306C MCH5 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455467.1"
                     /db_xref="GeneID:2895797"
                     /db_xref="GOA:Q6CKS2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS2"
                     /translation="MSEEVTIEKISRPAMLSPQSSRQLLMRKEVDVDNKFADLEATQT
                     YNEQTRPVESGVKRPSFIQDDGLFYPEGGFAAWLVIFGCFCGFIPVFGMLNTIGVMEN
                     FIERNQLSSTSSSTVGWIFSIFSFVNFASCIFSGTYFDRNGAKGPLIVGSVLHVGGLF
                     GMANSTELWQFILSFSIVTGLGNGILMSPLISVPSHYFLVKRGTATAIATTGGSIGGV
                     IFPVILRKFFAMEKDSDPFYGFVWGLRTLGFVNLFLLIVALVLAKERLPHKKLNERER
                     AIPTWRRVFNTYILQSFDIFGFKDLKYTFCVMGTVFGEISIISGITYFTSYAMKQGLS
                     QSDSYLLVMVVNLAGIPGRWLPGFFSDIFGRFNVAMITLVFLGIITFVMWLPFATTRA
                     VLFAFSAIYGFSSGSIFSILPVCCGQISKTEEFGRRYSTMYFVVAFGTLVAVPITGAI
                     IGPEKSFKGYDHYVIWCGVTSFVSAICYMISKTLAVGFNMKRF"
     gene            <796328..>797254
                     /locus_tag="KLLA0_F08547g"
                     /db_xref="GeneID:2895761"
     mRNA            <796328..>797254
                     /locus_tag="KLLA0_F08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455468.1"
                     /db_xref="GeneID:2895761"
     CDS             796328..797254
                     /locus_tag="KLLA0_F08547g"
                     /note="highly similar to uniprot|Q04013 Saccharomyces
                     cerevisiae YMR241W YHM2 Yeast suppressor gene of HM mutant
                     (abf2) DNA-binding protein mtDNA stabilizing protein
                     mitochondrial inner membrane protein with low homology to
                     RIM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455468.1"
                     /db_xref="GeneID:2895761"
                     /db_xref="GOA:Q6CKS1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS1"
                     /translation="MSSQPVELKKKPISFSNILLGAGLNMCEVTTLGQPLEVVKTTMA
                     ANRQFTFFQAINHIWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGL
                     NNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKE
                     GIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAI
                     GGGLSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRIG
                     LGIWQTVFMVGCGDIAREFVGKLTGETPVAKH"
     gene            complement(<797808..>799151)
                     /locus_tag="KLLA0_F08569g"
                     /db_xref="GeneID:2895762"
     mRNA            complement(<797808..>799151)
                     /locus_tag="KLLA0_F08569g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455469.1"
                     /db_xref="GeneID:2895762"
     CDS             complement(797808..799151)
                     /locus_tag="KLLA0_F08569g"
                     /note="similar to uniprot|P22215 Saccharomyces cerevisiae
                     YOR307C SLY41 multicopy suppressor of ypt1 deletion
                     homolog of chloroplast phosphate transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455469.1"
                     /db_xref="GeneID:2895762"
                     /db_xref="GOA:Q6CKS0"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q6CKS0"
                     /translation="MIVTSKSVTSKRRPSINKTFSDVNFVNQVQIPFQENYRSHKHST
                     SFNEVRRLQNQTWKEQFVNLFPKDVQEYLPEVNVHISILCLIWYMTSSVSSNLSKAIL
                     SRFPHPVGLTELQFLLSASLCLAFVTFANYLHAPQVSSSKLKNTVLNFPEGILPTYLN
                     GSFSRCILNTFLVPSKVIWYTTFPMGIFQFVGHITSHKSTSLIPVSLVHSVKALSPIA
                     TVCYYRFAKGRQYNNMTYYTLIPLILGVIITCWTSQNNKSKLTETDKTTFSMGLSFAF
                     ISMVIFVSQNIFAKGILTVKSKDVLPCKNKSQLNLVELKSQKDSPIQLDKITILFYCS
                     CVGFILTFPIFVSNEVFSSSTSVFADLSPSVMTLVLIHGVAHFFQAMLAFQLIGMLSP
                     VTYSIANIMKRIVIIGVAFIWESNLSINQLFGLILTISGLYGYDKWGNKKVNCSL"
     gene            complement(<799590..>801263)
                     /locus_tag="KLLA0_F08591g"
                     /db_xref="GeneID:2895763"
     mRNA            complement(<799590..>801263)
                     /locus_tag="KLLA0_F08591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455470.1"
                     /db_xref="GeneID:2895763"
     CDS             complement(799590..801263)
                     /locus_tag="KLLA0_F08591g"
                     /note="weakly similar to uniprot|Q12420 Saccharomyces
                     cerevisiae YOR308C SNU66 66kD U4/U6.U5 snRNP associated
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455470.1"
                     /db_xref="GeneID:2895763"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR9"
                     /translation="MGKITSISLEETNRIRASLGLKTIPRPTETSTESKEGASDTNRK
                     VRRSSQLSSRPSEKDCASGKINGSAQDRDKKIGQLKQRIYESKEAVDQRATTDKESID
                     DWLSKIGKPITHKESSAENATVHDDITHHHIPVSDELKSIAEQKAVIFTLKETSVTND
                     EENIDDENILENEKLVHDKQDAKNLKLRQLNKDRKLNKISIFDYSDEANDTNSRSDIP
                     LHDSLVNDKPLPVHQSLPKRVKIESDSDDEQPYQDYAPVKIKRRKKKSNQNQKPRRID
                     TARMVKVDLLEDDEDFSDRPIQAVVKVKQKRSNEEITGIKNSLELEKLEGQQRSKGIH
                     MLNNSDKGILLDETDEFLDSLKANVLDREPVNDDLPIKIDLKPVQKDKTGTIPATLVT
                     DNDITQPDFSGGVAGMLNFLKERNIIKQDDRPNMGSDSKKHGTDVRKEFEILNGIVNS
                     LKTVDEKLDSNDVNFSEDELRKIKAAQAEEMALKIQRIQEEKLRDYNPTVELAYQDSE
                     GNELKTKEAYKQLSQAWHGTKSSKKTLERQRKKMADRKKQLERDSYLGL"
     gene            complement(<801623..>803158)
                     /locus_tag="KLLA0_F08613g"
                     /db_xref="GeneID:2895764"
     mRNA            complement(<801623..>803158)
                     /locus_tag="KLLA0_F08613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455471.1"
                     /db_xref="GeneID:2895764"
     CDS             complement(801623..803158)
                     /locus_tag="KLLA0_F08613g"
                     /note="similar to uniprot|Q12499 Saccharomyces cerevisiae
                     YOR310C NOP58 Protein involved in pre-rRNA processing 18S
                     rRNA synthesis and snoRNA synthesis component of the small
                     subunit processome complex which is required for
                     processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455471.1"
                     /db_xref="GeneID:2895764"
                     /db_xref="GOA:Q6CKR8"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /translation="MAYVLTETSAGYALLKASDKKIYKSSSLIQDLNSSDKVLNQFKI
                     AAFSKFSSAANALEEANSVIDGKVSSQLEKLLEECKTDKKATLVVSETKLANAINKLG
                     LNFNVVSDAVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNA
                     AETDMSEILPEEIEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYL
                     SSRMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRA
                     KVESRLSQLEGRDLRTTPKVVREHKKTEITEARAYNADADTVSSAAAPADSDDESEDE
                     EETKEEKKSKKDKKDKKRKRDDDEESKESKKSKKEKKDKKEKKEKKEKKEKKDKKSKK
                     EKK"
     gene            complement(<803832..>804683)
                     /locus_tag="KLLA0_F08635g"
                     /db_xref="GeneID:2895765"
     mRNA            complement(<803832..>804683)
                     /locus_tag="KLLA0_F08635g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455472.1"
                     /db_xref="GeneID:2895765"
     CDS             complement(803832..804683)
                     /locus_tag="KLLA0_F08635g"
                     /note="similar to uniprot|Q12382 Saccharomyces cerevisiae
                     YOR311C HSD1 Endoplasmic reticulum (ER)-resident membrane
                     protein overproduction induces enlargement of ER-like
                     membrane structures and suppresses a temperature-sensitive
                     sly1 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455472.1"
                     /db_xref="GeneID:2895765"
                     /db_xref="GOA:Q6CKR7"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR7"
                     /translation="MVDYNSNDSGNEAELKQRLSTPNGVNTKKQKETVVLGKSLSDVH
                     LPLTEIHLKSHEWFGDFITKHEIPRKLFHSSIGFITLYLYTQNVDYKKVKFPLIVGFT
                     VVFILDFIRLRSPFFNKMYCRCVGALMRKKEIHTYNGVLWYLLGLTFAFSFFSKDIAL
                     ISLFLLSWSDTAASTFGRKYGHLTPKLARNKSLAGSIAAFSVGLITCYSFYGFFVPHY
                     NWVNKPGEISWTEETSKLNLLQLSLLGGFVAALSEGIDLFNWDDNFTIPVLSAIFMTA
                     VIRIFKN"
     gene            complement(<805298..>805738)
                     /locus_tag="KLLA0_F08657g"
                     /db_xref="GeneID:2895766"
     mRNA            complement(<805298..>805738)
                     /locus_tag="KLLA0_F08657g"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_455473.2"
                     /db_xref="GeneID:2895766"
     CDS             complement(805298..805738)
                     /locus_tag="KLLA0_F08657g"
                     /note="highly similar to uniprot|P47913 Saccharomyces
                     cerevisiae YOR312C RPL20B and highly similar to
                     uniprot|P47913 Saccharomyces cerevisiae YMR242C RPL20A
                     Protein component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_455473.2"
                     /db_xref="GeneID:2895766"
                     /db_xref="GOA:Q6CKR6"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR6"
                     /translation="MRIFAPNDVVAKSRYWYFLQKLHKVKKASGEIVSLNVISEAHPT
                     TVKNFGVWVRYDSRSGTHNMYKEIRDVTRVGAVESLYQDMAARHRARFRSIHILKVVE
                     LEKTADVKRQYVKQFLTKDLKFPLPHRVQKSTKVFAYKRPTTFY"
     gene            complement(<807369..>808451)
                     /locus_tag="KLLA0_F08679g"
                     /db_xref="GeneID:2895767"
     mRNA            complement(<807369..>808451)
                     /locus_tag="KLLA0_F08679g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455474.1"
                     /db_xref="GeneID:2895767"
     CDS             complement(807369..808451)
                     /locus_tag="KLLA0_F08679g"
                     /note="weakly similar to uniprot|P09937 Saccharomyces
                     cerevisiae YOR313C SPS4 Protein whose expression is
                     induced during sporulation not required for sporulation
                     heterologous expression in E. coli induces the SOS
                     response that senses DNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455474.1"
                     /db_xref="GeneID:2895767"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR5"
                     /translation="MSIFRKKHNQPTGEEQTTVQPHEDNQNTEESQNPVENQITSYKT
                     VDHINGYPLVQQTKEILDGISVARVVKANTLPTATAILTSKPVKFVEPVTKIVDTVAD
                     TGLTVTEKVIPSLKTKTYQRLGEEAMIPYNLTSKAVNKTVDTTVSFAENYIYEPTHNQ
                     ILKFRQYYNEKVYDTHGKPLIRGSLDPLVSPCNKWYESLINSSFPEGKEVPTNGFSNE
                     LDRSFALTFNAIQRAASVFNKRSKETILAPCNYVKHVNDVLNVNLDNQEDLSLPKSWV
                     ATKDSFQELNQETIDYIKSFSPLASIPGFKKKGTTSNDEVTAAAAITEEPTESEQQEN
                     GIVAEQANDQQVPSLEIQHAEPIEAN"
     gene            <811112..>812152
                     /locus_tag="KLLA0_F08701g"
                     /db_xref="GeneID:2895768"
     mRNA            <811112..>812152
                     /locus_tag="KLLA0_F08701g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455475.1"
                     /db_xref="GeneID:2895768"
     CDS             811112..812152
                     /locus_tag="KLLA0_F08701g"
                     /note="weakly similar to uniprot|Q12507 Saccharomyces
                     cerevisiae YOR315W Protein of unknown function found in
                     the cytoplasm and the nucleus potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455475.1"
                     /db_xref="GeneID:2895768"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR4"
                     /translation="MKQEMLQTPCTPKHNITRVDNTLPFNGPRFGSKPKFQFPPQNTN
                     SESPCKSHFEMMRSQQLLANQLDSKYKSKDGLRLSPHISIPLIRTEDGDIEDDDYDFN
                     GDVEDELESCEDDSVASSILSSLSDIESPTPSSSPVFDDTSFRNALKPNAMKNVVDPA
                     TVAMFTLPLPTKIKFKPNKALKPLASILKRTAGLNFIMNSLNGNYKDATIFATEVNSY
                     LSENVPYPTCTIERVTIPVNSEIKRKYKQDRNEMLGGYYNSSDEDQDNLVYERNDDTN
                     EQNSKQANDKASSDAAVIRAYDFNFEDSTILNKSDRVTTHLGIYSQNQLMSRKQTPST
                     AKKVRWCEFLEW"
     gene            complement(<813012..>814322)
                     /locus_tag="KLLA0_F08723g"
                     /db_xref="GeneID:2895769"
     mRNA            complement(<813012..>814322)
                     /locus_tag="KLLA0_F08723g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455476.1"
                     /db_xref="GeneID:2895769"
     CDS             complement(813012..814322)
                     /locus_tag="KLLA0_F08723g"
                     /note="similar to uniprot|P20107 Saccharomyces cerevisiae
                     YMR243C ZRC1 and to uniprot|P32798 Saccharomyces
                     cerevisiae YOR316C COT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455476.1"
                     /db_xref="GeneID:2895769"
                     /db_xref="GOA:Q6CKR3"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR3"
                     /translation="MLSGKEARIVTLLVIDTTFFFIELISGYMVHSLALIADSFHMLN
                     DIISLVIALWAVNVAKNKNPDAKYTYGWKRAEILGALVNAVFLIALCVSILIEAIQRF
                     FQPQEITNPKLVLIVGCFGLVSNFIGLALFHSDGGHGHGHSHGGAPDLEHGEEEDDDN
                     EHGHGHSHGHSHQTNGLDEGSDYEPETIEDMMPHSIVERTFSPKSTPVDSSYDDEDDE
                     STGLLTEQHLNKTLAKVKKQKKSKQRSMNMHGVFLHVLGDALGNVGVIATALFIWKTD
                     FSWRFYTDPAVSLLISLIIFSSAIPLSLKASRILLQATPSNVSADDVKHDILSLPGVV
                     SVHDFHIWNLTESLYIASVHVEIQSNPEEFMNIAQVIRSIFHRYGIHSATVQPEFVGS
                     GAVTEDIARRFSRIAGGGVYGSTTNLTGCTIDENAQCNSETCLQ"
     gene            <815922..>816983
                     /locus_tag="KLLA0_F08745g"
                     /db_xref="GeneID:2895770"
     mRNA            <815922..>816983
                     /locus_tag="KLLA0_F08745g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455477.1"
                     /db_xref="GeneID:2895770"
     CDS             815922..816983
                     /locus_tag="KLLA0_F08745g"
                     /note="similar to uniprot|Q04018 Saccharomyces cerevisiae
                     YMR244W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455477.1"
                     /db_xref="GeneID:2895770"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR2"
                     /translation="MPSVKFIVLLCVLPVFFSQGSCKDSDSYHNVHSLKHAKAQGKQI
                     EGKEVAHLFRRGGTCKFPNGDGMVAVQTSGKNAGWAMHNDQECSYGSWCPYACESGQL
                     MNQWDPEVTSYTYPGSQYGGLYCDDSGNLQKKRSGGYCYEGKGTVVANNKAGSGVAFC
                     QTVLPGNEEMMIPTLVDGGSQETLAVPGTEYWAGTAAHYYINPPGTSVSDGCQWGSTA
                     KAIGNWAPYVAGANMDDSKNTFVKIGWNPVYLESGSPFKNTKPSFGVKITCDDESNCE
                     GLPCSIDPSKQDVNEVESNEKSTGDGATFCVVTAKNGAKANIEVFESGSSSQKKREHH
                     AHRENVQTTTEYKTVTVKV"
     gene            complement(<817541..>817837)
                     /locus_tag="KLLA0_F08767g"
                     /db_xref="GeneID:2895771"
     mRNA            complement(<817541..>817837)
                     /locus_tag="KLLA0_F08767g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455478.1"
                     /db_xref="GeneID:2895771"
     CDS             complement(817541..817837)
                     /locus_tag="KLLA0_F08767g"
                     /note="similar to uniprot|Q3E846 Saccharomyces cerevisiae
                     YMR244C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455478.1"
                     /db_xref="GeneID:2895771"
                     /db_xref="GOA:Q6CKR1"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR1"
                     /translation="MGWFSKQKEMDDPTKAPSRSSRKQCWESRDLFFGCLDKISVVNA
                     LDPKHQKAIKASCSAEEAKFEQDCATSWISYFKEKRVVDFKREKFLKEMEEQQK"
     gene            <818541..>819731
                     /locus_tag="KLLA0_F08789g"
                     /db_xref="GeneID:2895772"
     mRNA            <818541..>819731
                     /locus_tag="KLLA0_F08789g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455479.1"
                     /db_xref="GeneID:2895772"
     CDS             818541..819731
                     /locus_tag="KLLA0_F08789g"
                     /note="some similarities with uniprot|P43570 Saccharomyces
                     cerevisiae YFL027C GYP8 GTPase-activating protein for
                     yeast Rab family members Ypt1p is the preferred in vitro
                     substrate but also acts on Sec4p Ypt31p and Ypt32p
                     involved in the regulation of ER to Golgi vesicle
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455479.1"
                     /db_xref="GeneID:2895772"
                     /db_xref="GOA:Q6CKR0"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6CKR0"
                     /translation="MSLEWEDTAFDMASLSFISDLNQSKLKRVIVANALQNEDLASLE
                     HLGTSRFGFVNSQLRSQAWLSILQSRVKGSHACGSLKEPHKDEYQVNLDVNRSFSFIK
                     DSSEKLQLRDLLYDTIVKTLRKFPQLNYYQGYHEVVSVFVLVCDRDSLNETVELFTLL
                     YLRDYMMDSLQCTLEQLEVLSQFIMERDADLAKILQLNQKKPIFAIASVLTLLIHNFE
                     NFEEDSPIFSIFDIVITTNNLSNLFVVYTELLIYFKVPILKQVEAYEIDFENDMDLIH
                     SVVQQTLLKFLTRSSWDEILTQARLRLNNSTVRVAKYVNKYSSLISVSNIEFSELINV
                     LSKEIEWDASRKIVKASPKIPLFVKWSLVIGIIAAVIKVGSSHTNTIHSSSLIDSLKK
                     VLSP"
     gene            complement(<819834..>821744)
                     /locus_tag="KLLA0_F08811g"
                     /db_xref="GeneID:2895773"
     mRNA            complement(<819834..>821744)
                     /locus_tag="KLLA0_F08811g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455480.1"
                     /db_xref="GeneID:2895773"
     CDS             complement(819834..821744)
                     /locus_tag="KLLA0_F08811g"
                     /note="similar to uniprot|P38915 Saccharomyces cerevisiae
                     YLR055C SPT8 Subunit of the SAGA transcriptional
                     regulatory complex but not present in SAGA-like complex
                     SLIK/SALSA required for SAGA-mediated inhibition at some
                     promoters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455480.1"
                     /db_xref="GeneID:2895773"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ9"
                     /translation="MDDDVDEILNQNNVQNTQDDDVDMDDELEDVDVDVPNAEEDEPM
                     DEEEQDEDAEDADDDDDEDEDRSDDEDAEDRSEDDDDDDDDDDERSDDDDDDDDEEED
                     EEQTENGEEGTRTGEIKQSNTHEIGDDDAESAEKESATSEKDSPSSSDGKSTEMSKLD
                     KIHQYYTTLYRSASVAESYNILPTAAIPIQTNVQALTMSKGLRYLFLGGSDGFIRKFD
                     FLNTVDGKLSLTIQQKNALVDSIVNAGILTSYWENEVPQPPSKVKWVKQKSEYLPLVS
                     PVHSLAVQNECLFILAGQETGGIVMQGVRYFEGRTAHYFKGHKSIVNHLVLNDEETRF
                     LSGSWDKTVIEWDLETGTDITKFNATSQLSSLEFRPTNAAYELPEPNLSGHNPDVDSN
                     NVVGNGDAADIDDVDTNSLFGDDDDDDDQDDQHVATNDNTEKAEDNTQQENKDKNEIQ
                     EHTSEKKVESETISKNTLALKTDENLFLTSCIDGNIQIWDRRQPSSEIIKLGRNVSTP
                     PWCMSACWSVDGGKVIAGRRNAVVEIYDLRKPEVVESKLKLPSISGPVSKVKAMPNNS
                     HVVAASNDNIRIFDINHIDKTPLIIPGHHGGCISNLYVDPTCRFMISTSGNRGWQGTA
                     TDVTLIYDIELN"
     gene            <822039..>822860
                     /locus_tag="KLLA0_F08833g"
                     /db_xref="GeneID:2895774"
     mRNA            <822039..>822860
                     /locus_tag="KLLA0_F08833g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455481.1"
                     /db_xref="GeneID:2895774"
     CDS             822039..822860
                     /locus_tag="KLLA0_F08833g"
                     /note="similar to uniprot|P43569 Saccharomyces cerevisiae
                     YFL028C CAF16 Part of the evolutionarily-conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation elongation and degradation
                     putative ABC ATPase interacts with Ssn2p Ssn3p and Ssn8p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455481.1"
                     /db_xref="GeneID:2895774"
                     /db_xref="GOA:Q6CKQ8"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ8"
                     /translation="MASNDLAVEVHDLTYAFPGSKRSAIHDLSLSVEWNKKVLVVGNN
                     GAGKSTLLKLLSGKHLCLGGNIKVGNKNPFAPNNDQESVILTTYLGTEWASMAIVHRD
                     IGVLELLESIGLSHYRARGEELVRILEVDINWRMFKLSDGQKRRVQLCMGLLKPFKVL
                     LLDEVTVDLDVVARDRLFQFLDRETRDRQCSVVYATHIFDGLAPWADEIIHLQDGTIT
                     RTLDYQRDIHFTKEIEGVQERKDNGRHTVILGYMKSLYPLALHWLTRDQVEDQKL"
     gene            <823595..>824656
                     /locus_tag="KLLA0_F08855g"
                     /db_xref="GeneID:2895982"
     mRNA            <823595..>824656
                     /locus_tag="KLLA0_F08855g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455482.1"
                     /db_xref="GeneID:2895982"
     CDS             823595..824656
                     /locus_tag="KLLA0_F08855g"
                     /note="similar to uniprot|P32353 Saccharomyces cerevisiae
                     YLR056W ERG3 C-5 sterol desaturase catalyzes the
                     introduction of a C-5(6) double bond into episterol a
                     precursor in ergosterol biosynthesis mutants are viable
                     but cannot grow on non-fermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455482.1"
                     /db_xref="GeneID:2895982"
                     /db_xref="GOA:Q6CKQ7"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ7"
                     /translation="MDLLLEVCDTYLLDYVYGKVFPVNMLPSSVTNSVGQFLDLNTGN
                     LNGTAAKPAGDVYGYEPFLLEFTDYTFQSIFPRYNLFRETLTMFVLMTIFGWALYFSV
                     ATMSYLFVFDKAVFNHPRYLKNQMSLEMKQAFSAIPVMVLLTIPWFLFELNGYSKLYL
                     DIDYKSWAGIRQLAFEVISFIMFTDCLIYLVHRWLHWPRVYRALHKPHHKWLVTTPYA
                     SHAFHPVDGYMQSVPYHLYPMIFPLQKISYLILFTFVNFWTVMIHDGEYLANDPVING
                     AACHTVHHLYFNYNYGQFTTLWDRLGGSYREPDQELFNKSLKKSKQTWEIQVEKMEAI
                     KQEVEGDCDDRVYVTTKAS"
     gene            <825217..>826182
                     /locus_tag="KLLA0_F08877g"
                     /db_xref="GeneID:2895983"
     mRNA            <825217..>826182
                     /locus_tag="KLLA0_F08877g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455483.1"
                     /db_xref="GeneID:2895983"
     CDS             825217..826182
                     /locus_tag="KLLA0_F08877g"
                     /note="uniprot|Q8J0L1 Kluyveromyces lactis cak1
                     Cyclin-dependent kinase activating kinase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455483.1"
                     /db_xref="GeneID:2895983"
                     /db_xref="GOA:Q6CKQ6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ6"
                     /translation="MTNKTNMTTPIKIQTGCADLELFPDIVVKRIDLELQRPPHNAHT
                     ELEILKTLSNKHVIPLLGSETSPRYVTFKFKRYQCDLNQFMDQHWKAKYNPYLLDNST
                     KTYSNTIPLDHSTVIIRQIIEGLVYIHGNGIIHRDVKPQNIMLNSYNEVVLGDFGISY
                     NRNLDNEAKTCDCSTSIYKAPELLFSVSNYKFEIDIWALAVLISQLWNDKTQSKSKSS
                     KVIDIDFDECSDIKLVLTLFDKFGKPSNEDWPQVTKNESFNGMFGNVSSDNFLHRRPI
                     DEQLIQVYKWMPLITDNPKLAKMWLRMVKFDGNLRISAEQLLVSI"
     gene            <826574..>828685
                     /locus_tag="KLLA0_F08899g"
                     /db_xref="GeneID:2895984"
     mRNA            <826574..>828685
                     /locus_tag="KLLA0_F08899g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455484.1"
                     /db_xref="GeneID:2895984"
     CDS             826574..828685
                     /locus_tag="KLLA0_F08899g"
                     /note="weakly similar to uniprot|Q7LGY1 Saccharomyces
                     cerevisiae YLR057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455484.1"
                     /db_xref="GeneID:2895984"
                     /db_xref="GOA:Q6CKQ5"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ5"
                     /translation="MFLRLLLHTWRKCRSILLLLITASVLFYYTFENEIEHLNSFAYT
                     DSLPLIQNQDSHNAPVAGSADKITHDEISKELTDKSSLSEKNKYFPILLENSDEALKY
                     RSENYDSKEPFHPFHPFYEKKTVIPYKQISKQYPQLNRVSSIHSNALIKDELLYHWTA
                     RINRITDHAYLDLQTNISILSTDSLLQRNESLLTVTAVLNKFDDPMDQRVWSSEILGS
                     LLAVIGNRKEKNPELLQLITIIGEMLLRSYDTPNYLPQIPFFWKTSVPNRYAFKKTKT
                     SMLATNILEFLTLSHITNDPQFDSVVSHSLQTMSRSVLLFDIDYLFPSFVDASGCKPL
                     SDEKIAKGDHLRESNVLKSMQNGKYIHCVIKESLLPQHNVDGNPITLDTIDLYLTVLK
                     AYHLNNGNLFEKREAEKSITKSLLHSIKMINDTMLFQPWLPSDLEDLLLPTSIKTNIH
                     FDVLEDRNEVSIGKEYKVTPDGAKMSSLLSISSVLFNDSSLIEQAKAITKGYYELYKL
                     LDQIPDVVALDRKLPTFGMFDPTAKIALIKSGHYKSNTMQQGVKITETTEDKSKHYTN
                     TDAHSFSPNVKDINEEQLCWKLHTWPFYVNDMVVSTRPPFELIESLIYLYKITEDYQW
                     KLIGEDLMHSIEWSQLTVADTGKLVRLFYALFEDHVNIDEYVINSKYHFIARQFEVNP
                     TSKRIYHTFDDIKETNKLMNP"
     gene            complement(<829001..>830410)
                     /locus_tag="KLLA0_F08921g"
                     /db_xref="GeneID:2895985"
     mRNA            complement(<829001..>830410)
                     /locus_tag="KLLA0_F08921g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455485.1"
                     /db_xref="GeneID:2895985"
     CDS             complement(829001..830410)
                     /locus_tag="KLLA0_F08921g"
                     /note="highly similar to uniprot|P37291 Saccharomyces
                     cerevisiae YLR058C SHM2 serine hydroxymethyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455485.1"
                     /db_xref="GeneID:2895985"
                     /db_xref="GOA:Q6CKQ4"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ4"
                     /translation="MPYALSDSHKNLVSAHLSESDPEVEQIIKDEIDRQKHSIVLIAS
                     ENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMELLCQKRALEAFNLTADKW
                     GVNVQTLSGSPANLQVYQALMRPHERLMGLFLPDGGHLSHGYQTENRKISAVSTYFES
                     FPYRVDPKTGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKVGAYLMV
                     DMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSVNPKTGKEIP
                     YDLEGPINFSVFPGHQGGPHNHTISALATALKQANTPEFKEYQTQVLKNAKVLEESFK
                     KLGYRLVSDGTDSHMVLVSLREKGVDGARVEYVCENINIALNKNSIPGDKSALVPGGV
                     RIGAPAMTTRGFGEPEFARIVDYIDKAVQFAAKTQQSLPKEANKLKDFKAKVNEGSEE
                     LTQLKNEIYQWAGEFPLPV"
     gene            complement(<831232..>832335)
                     /locus_tag="KLLA0_F08954g"
                     /db_xref="GeneID:2895987"
     mRNA            complement(<831232..>832335)
                     /locus_tag="KLLA0_F08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455487.1"
                     /db_xref="GeneID:2895987"
     CDS             complement(831232..832335)
                     /locus_tag="KLLA0_F08954g"
                     /note="similar to uniprot|P43567 Saccharomyces cerevisiae
                     YFL030W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455487.1"
                     /db_xref="GeneID:2895987"
                     /db_xref="GOA:Q6CKQ2"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ2"
                     /translation="MSDLLLIPGPIMVSSAVEEAASIQSLAHTSPEFVKIFQGALQKL
                     RTVFQTSNAGDQPIVISGSGTLGWDIVGNNLLKSGDSALTISTGFFSDSFAECLKTYG
                     ADVDVLKSEPGKVVALDKIESQLKSKKYQLITLTHVDTSTATLLDLPSITSLVKKVSP
                     ETFIIVDGVCSIGCEEFKFSEWSVDFVLTASQKALSCPSGLSVSLISERALSYALSNE
                     STHGFYANLKKWIPIMKAYEAGVGQYFATPSIQLVNALNVSLGEILSYGLEARIAKNK
                     KTSDQFKNNLKQLGLTLVSEDSNSAHGLTAVYVDQPGKVISSLKSKGIVIAGGILPGI
                     KDKYIRIGHMGISAIDDNLHHIDKVFEAIKESI"
     gene            complement(<833390..>834211)
                     /locus_tag="KLLA0_F08976g"
                     /db_xref="GeneID:2895988"
     mRNA            complement(<833390..>834211)
                     /locus_tag="KLLA0_F08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455488.1"
                     /db_xref="GeneID:2895988"
     CDS             complement(833390..834211)
                     /locus_tag="KLLA0_F08976g"
                     /note="some similarities with uniprot|P41546 Saccharomyces
                     cerevisiae YFL031W HAC1 bZIP transcription factor
                     (ATF/CREB1 homolog) that regulates the unfolded protein
                     response"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455488.1"
                     /db_xref="GeneID:2895988"
                     /db_xref="GOA:Q6CKQ1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ1"
                     /translation="MTGKNSVSDIPVNFKPTLPPRKRAKTQEEKEQRRIERILRNRRA
                     AHQSREKKRLHVQRLEEKCHLLEGILKMVDLDILSENNAKLSGMVEQWREMQVSDSGS
                     ISSHDSNTGMLDSPESLTSSPDKKDHYSHSSHSTSISSSSSSSSPSNLPHGMVTDNGM
                     LDEDNNSLNYILGQQNYQLSSTPVVKLEEDHSMLLENNGDADLNDVGISFIAEDGTNS
                     DNKNIDMRNQETGEGWNLLLTVPPELNSDLSELEPSDIISPIGLDTWRNPAVIVT"
     gene            complement(<834717..>835637)
                     /locus_tag="KLLA0_F08998g"
                     /db_xref="GeneID:2895989"
     mRNA            complement(<834717..>835637)
                     /locus_tag="KLLA0_F08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455489.1"
                     /db_xref="GeneID:2895989"
     CDS             complement(834717..835637)
                     /locus_tag="KLLA0_F08998g"
                     /note="similar to uniprot|P54964 Saccharomyces cerevisiae
                     YLR059C REX2 RNA exonuclease required for U4 snRNA
                     maturation functions redundantly with Rnh70p in 5.8S rRNA
                     maturation and with Rnh70p and Rex3p in processing of U5
                     snRNA and RNase P RNA member of RNase D family of
                     exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455489.1"
                     /db_xref="GeneID:2895989"
                     /db_xref="GOA:Q6CKQ0"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q6CKQ0"
                     /translation="MFTGIGTRLRQRILLPTRRFYNPYLKKRPIWSQPTTIMTTLHDS
                     NNDTTLNPPAALIPGALKQPIVWIDCEMTGLDHINDKIIEVCCIITDGQLNVADEDGY
                     ESVIHYDKSIMDNMNEWCINQHGFSGLTQKVLDSVKTREQVEEELLNYIKKWIPDQRQ
                     GVLAGNSVHMDRLFMLNEFPKVIDHLFYRIIDVSSIMEVARRHNPQLASVTYKKKGAH
                     TAKADILESIEQLKFYENHYFKNDTETKEFVDRRKAEIQREAENAKEKEDNKRDSEGN
                     PELETSSQPEKKIKLDSADDSSNNVITSAR"
     gene            <842591..>843949
                     /locus_tag="KLLA0_F09053g"
                     /db_xref="GeneID:2895992"
     mRNA            <842591..>843949
                     /locus_tag="KLLA0_F09053g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455492.1"
                     /db_xref="GeneID:2895992"
     CDS             842591..843949
                     /locus_tag="KLLA0_F09053g"
                     /note="similar to uniprot|Q00362 Saccharomyces cerevisiae
                     YGL190C CDC55 Non-essential regulatory subunit B of
                     protein phosphatase 2A has multiple roles in mitosis and
                     protein biosynthesis found in the nucleus of most cells
                     but also at the bud neck (large-budded cells) and at the
                     bud tip (small-budded cells)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455492.1"
                     /db_xref="GeneID:2895992"
                     /db_xref="GOA:Q6CKP7"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP7"
                     /translation="MSQHGFDFKFSQCFGDKADIVVTEADIITASEFDHTGDYLATGD
                     RGGRVVLFERNNTKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSHFL
                     LSTNDKTIKLWKIYEKNIKLVSDNNLSEGNKDYHRRSAGNGSARAVLSLQTLKLPKLS
                     LHDRIIAAAPKKIYSNAHTYHINSISLNSDQETFISSDDLRINLWNLDIPDESFNIVD
                     IKPANMEELTEVITSAEFHPQQCNAFMYSSSKGTIKLCDMRQNALCDYRAKVFEEYLD
                     PISHNFFTEITSSISDVKFSPDGRYIASRDYLTVKIWDINMDNKPLKTINIHEQLEER
                     LNDTYENDAIFDKFEVAFSGDSSSVMTGSYNNNFMIYPNVVKTGDYQAPTGMDEIVLQ
                     ADKTAFKSKRLSSLQQQSARNKEWGDEIDFKKSILHFSWHPRENSVAIAATNNLFIFS
                     AL"
     gene            complement(<844701..>845084)
                     /locus_tag="KLLA0_F09075g"
                     /db_xref="GeneID:2895993"
     mRNA            complement(<844701..>845084)
                     /locus_tag="KLLA0_F09075g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455493.1"
                     /db_xref="GeneID:2895993"
     CDS             complement(844701..845084)
                     /locus_tag="KLLA0_F09075g"
                     /note="highly similar to uniprot|P32799 Saccharomyces
                     cerevisiae YGL191W COX13 Subunit VIa of cytochrome c
                     oxidase which is the terminal member of the mitochondrial
                     inner membrane electron transport chain not essential for
                     cytochrome c oxidase activity but may modulate activity in
                     response to ATP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455493.1"
                     /db_xref="GeneID:2895993"
                     /db_xref="GOA:Q6CKP6"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="InterPro:IPR018507"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP6"
                     /translation="MFKQAIRRASTLPKYALEPAFGKPDLAAAQAYKDYMKHSTEHAK
                     QTSNLWVKISIFVAAPAIALTAVNTYFVEAEHAEHREHLKHVPDEEWPRDYEFQNLRQ
                     KPFFWGDGDKTLFWNPVINRHVSHD"
     gene            complement(<846171..>847745)
                     /locus_tag="KLLA0_F09097g"
                     /db_xref="GeneID:2896028"
     mRNA            complement(<846171..>847745)
                     /locus_tag="KLLA0_F09097g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455494.1"
                     /db_xref="GeneID:2896028"
     CDS             complement(846171..847745)
                     /locus_tag="KLLA0_F09097g"
                     /note="similar to uniprot|P41833 Saccharomyces cerevisiae
                     YGL192W IME4 Probable mRNA N6-adenosine methyltransferase
                     that is required for IME1 transcript accumulation and for
                     sporulation expression is induced in starved MATa/MAT
                     alpha diploid cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455494.1"
                     /db_xref="GeneID:2896028"
                     /db_xref="GOA:Q6CKP5"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP5"
                     /translation="MSLNWGLVDFMLDNYASITASPINGSLHDIYVIYSMFMQNFLWK
                     NNECGETYYQFCEDLNKISEVCGGCMNFEDDSGGNIFGQKISFVDGDSLKILQKVHYD
                     QAIKLSLSHTGNKAKQIAIDKDSVQVKERKIESEPILLNKLMGILDQSEIVTPNAKCL
                     RHLNQILSLELGSTKLSKEQAKLNTKRSPFIPICSDPKHVSLLSTVINTVNNKIMSLQ
                     GEKLKKIEADCPDIIECSNTHIHFIPNLKPQTDLSLGDCSYLDTCHKLSTCRYVHYLQ
                     YYPESLQKQKIEEQKEQRKQYSFYTHGECCSSSFKKLLPPQWIKCDVRKFDFDILGKF
                     SAVIADPAWNIHMNLPYGTCNDNELLQLPFDLLQEEGLLFLWVTGRAIEVGKESLQNW
                     GYEVINEISWIKTNQLGRTIVTGRTGHWLNHSKEHLLVGVKGNPEWLNRKIDIDLIIS
                     ATRETSRKPDELYGIIERLVGTHARKLEIFGRDHNIRPGWFTIGNQVTGSSIHEVDVK
                     RKYERFMEKSKNSKTN"
     gene            <848467..>849825
                     /locus_tag="KLLA0_F09119g"
                     /db_xref="GeneID:2896029"
     mRNA            <848467..>849825
                     /locus_tag="KLLA0_F09119g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455495.1"
                     /db_xref="GeneID:2896029"
     CDS             848467..849825
                     /locus_tag="KLLA0_F09119g"
                     /note="highly similar to uniprot|P53096 Saccharomyces
                     cerevisiae YGL194C HOS2 Histone deacetylase required for
                     gene activation via specific deacetylation of lysines in
                     H3 and H4 histone tails subunit of the Set3 complex a
                     meiotic-specific repressor of sporulation specific genes
                     that contains deacetylase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455495.1"
                     /db_xref="GeneID:2896029"
                     /db_xref="GOA:Q6CKP4"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP4"
                     /translation="MSSDTLKFDEKTEAEKPLFDCDFGTSYSPRVSYHFNSKVSQYHY
                     GVKHPMKPFRLMLTDHLVSAYGLHKVMDLYETRSATKDELTKFHSEDYVNFLAKVTPD
                     TLNKLPRGSLEKFNIGDDCPIFQGMFDYAALYAGASLDASRKLLNGQSEIAINWSGGL
                     HHAKKNNPSGFCYVNDIVLAIVNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVS
                     FHKYNGEFFPGTGDLDEIGCSRGKHFALNVPLQDGIEDDSYINLFKSIIDPVITSFRP
                     SVIIQQCGADSLGHDRLGCFNLNIKAHGECVRFVKSFGVPMLVVGGGGYTPRNVSRLW
                     TYETGLLNGVLLQPKLPEGIPFRDWFGPDYSLHPTLDDLYENKNSKKFLENIRIRCLE
                     NIKYLQGAPSVRMDAELIPTQDITGLTEEEEELIKELNVEEDKARLAQMEKDDFKVGE
                     LY"
     gene            complement(<850288..>851358)
                     /locus_tag="KLLA0_F09141g"
                     /db_xref="GeneID:2896030"
     mRNA            complement(<850288..>851358)
                     /locus_tag="KLLA0_F09141g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455496.1"
                     /db_xref="GeneID:2896030"
     CDS             complement(850288..851358)
                     /locus_tag="KLLA0_F09141g"
                     /note="uniprot|Q8J0C9 Kluyveromyces lactis KLLA0F09141g
                     gdp1 NADP glyceraldehyde 3-phosphate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455496.1"
                     /db_xref="GeneID:2896030"
                     /db_xref="GOA:F2Z641"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:F2Z641"
                     /translation="MPDMTNESSSKPAQINIGINGFGRIGRLVLRAALTHPEVKVRLI
                     NNPSTTPEYAAYLFKYDSTHGKYRGEVEFDDERIIIQNDHVSAHIPLSHFREPERIPW
                     ASYNVDYVIDSTGVFKEVDTASRHKGVKKVIITAPSKTAPMYVYGVNHVKYNPLTDHV
                     VSNASCTTNCLAPLVKALDDEFGIEEALMTTIHATTASQKTVDGTSSGGKDWRGGRSC
                     QGNIIPSSTGAAKAVGKILPELNGKITGMSIRVPTINISLVDLTFRTAKKTSYDDIMK
                     ALEQRSRSDMKGVLGVTKDAVVSSDFTSDSRSSIVDAKAGIELNDHFFKVLSWYDNEY
                     GYSSRVVDLSIFMAQKDFEAGV"
     gene            complement(<852529..>853803)
                     /locus_tag="KLLA0_F09163g"
                     /db_xref="GeneID:2896031"
     mRNA            complement(<852529..>853803)
                     /locus_tag="KLLA0_F09163g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455497.1"
                     /db_xref="GeneID:2896031"
     CDS             complement(852529..853803)
                     /locus_tag="KLLA0_F09163g"
                     /note="similar to uniprot|P53100 Saccharomyces cerevisiae
                     YGL185C Putative hydroxyacid dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455497.1"
                     /db_xref="GeneID:2896031"
                     /db_xref="GOA:Q6CKP2"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP2"
                     /translation="MDRPWILFIAEPEYSLQEYKLLQKEFNTVNYTLERDVDGTGKEA
                     FLTFLDQHSKQKGPIVGIFGGYPQFAPLGGLSAEILDDHRWPGSIKCICLCSVGYNWL
                     DLKSLREKGIQLYNYDDMIQDSGIVANDVADCVLWHVLDGFRKFSSQAHALRSARNTI
                     KARSEIVLEHGENNSPRFEFGHRWKRGTFNESCRNKRCLIMGLGRIGIQCGRKLDSGL
                     GMEIHYTQRNPVTKEQISSDTYIQKWQFHPISELLESDFQDAHGSSPCLETFDCIVIC
                     LPGNASTHHMINKTFLSRCKFGVVICNVGRGSIIDDDALQHIMAQEPGRVRHVAMDVF
                     HDEPIVEQWLSEDCHYNTITPHIASSTRAVWEASNRLALQVLSHVCASSSSEPSKNSV
                     PGRFGSKPDSEPFSKAPAPARKTSLSQLPRVL"
     gene            <854314..>855651
                     /locus_tag="KLLA0_F09185g"
                     /db_xref="GeneID:2896032"
     mRNA            <854314..>855651
                     /locus_tag="KLLA0_F09185g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455498.1"
                     /db_xref="GeneID:2896032"
     CDS             854314..855651
                     /locus_tag="KLLA0_F09185g"
                     /note="highly similar to uniprot|P39958 Saccharomyces
                     cerevisiae YER136W GDI1 GDP dissociation inhibitor
                     regulates vesicle traffic in secretory pathways by
                     regulating the dissociation of GDP from the Sec4/Ypt/rab
                     family of GTP binding proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455498.1"
                     /db_xref="GeneID:2896032"
                     /db_xref="GOA:F2Z5X0"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:F2Z5X0"
                     /translation="MDENYDVIVLGTGLTECILSGLLSIEGKKVLHVDRQDHYGGESS
                     SVTLTQLYSKFKQHPLSKEDIESKFGKDRDWNVDLIPKFLMANGELTNILVHTDVTRY
                     IEFKQVAGSYVYNRGKVYKVPANEMEAISSSLLGIFEKRRMKKFLEWISAYNEEDIAT
                     HQGLNLDQNTMDEVYYKFGLGNSTREFIGHAMALWTNDDYLQQPARPSVERIILYVQS
                     ISRFGKSPYIYPMYGLGELPQGFARLSAIYGGTYMLNTPIEKVLYSDDGKFEGIVTKE
                     GTAKAPIVIADPTYFPEKCKTTGEKVIRAICITKQPVPNTSNADSCQIIIPQSQVGRK
                     NDIYIATVSDAHKVTSKGHYLASVSTIIETDKPHIELEPAFKMLGPIEERFMGISEIF
                     EPIEDGTKDNIYISKSYDSSSHFESMTDDVKDIYFRITGHPLVLKKREDVAEE"
     gene            <856056..>856343
                     /locus_tag="KLLA0_F09207g"
                     /db_xref="GeneID:2896033"
     mRNA            <856056..>856343
                     /locus_tag="KLLA0_F09207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455499.1"
                     /db_xref="GeneID:2896033"
     CDS             856056..856343
                     /locus_tag="KLLA0_F09207g"
                     /note="highly similar to uniprot|P38203 Saccharomyces
                     cerevisiae YBL026W LSM2 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455499.1"
                     /db_xref="GeneID:2896033"
                     /db_xref="GOA:Q6CKP0"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:Q6CKP0"
                     /translation="MLLFSFFKTLVDHEVKVELKNGIELTGTLKSVDQFLNLKLDNIS
                     SNNNEKYPHLSSVRNMFIRGSTVRYVHLKKSMVDTNLLQDATRRELMSERK"
     gene            complement(<856467..>856856)
                     /locus_tag="KLLA0_F09229g"
                     /db_xref="GeneID:2896034"
     mRNA            complement(<856467..>856856)
                     /locus_tag="KLLA0_F09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455500.1"
                     /db_xref="GeneID:2896034"
     CDS             complement(856467..856856)
                     /locus_tag="KLLA0_F09229g"
                     /note="similar to uniprot|P40083 Saccharomyces cerevisiae
                     YER137C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455500.1"
                     /db_xref="GeneID:2896034"
                     /db_xref="GOA:Q6CKN9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN9"
                     /translation="MADADKIIKQSEALDQLAKLVLSQSQKKQSTLPSLKEEYENKLK
                     NVDELISMITSVELDKEKFSKMISKQIEIIQKDGQEYALIPVQRTPKQAKFGKRKSKA
                     NNIKCSYCNETGHLRSKCEKKLLGVPP"
     gene            complement(<857154..>857921)
                     /locus_tag="KLLA0_F09251g"
                     /db_xref="GeneID:2896035"
     mRNA            complement(<857154..>857921)
                     /locus_tag="KLLA0_F09251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455501.1"
                     /db_xref="GeneID:2896035"
     CDS             complement(857154..857921)
                     /locus_tag="KLLA0_F09251g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455501.1"
                     /db_xref="GeneID:2896035"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN8"
                     /translation="MSGFSCEDELHSHNHDHGHSHGDDHGHGHNHDHGHSHEPPAETF
                     SNQSLYTHIDMTKVQVLNGVSNDRSSLVSKSFLKPQDEKYNTSLYLESDADCQVLLQI
                     PFTASVKIFAIILRVNKGGSGYSTPRHIQLYKNYNKNLDFDTINDLKAEYTVEFPDNV
                     GIEPDYNNESLFDDDTFIKFDLPRNIFQNCENLTVLVKDNWSGDEDDLNRLYFCELRG
                     EATGKLRNSGVPIVAVYEAAPNPADVKLESQTINYAS"
     gene            <858627..>859655
                     /locus_tag="KLLA0_F09273g"
                     /db_xref="GeneID:2896036"
     mRNA            <858627..>859655
                     /locus_tag="KLLA0_F09273g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455502.1"
                     /db_xref="GeneID:2896036"
     CDS             858627..859655
                     /locus_tag="KLLA0_F09273g"
                     /note="highly similar to uniprot|P05373 Saccharomyces
                     cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase
                     a homo-octameric enzyme catalyzes the conversion of
                     delta-aminolevulinic acid to porphobilinogen the second
                     step in the heme biosynthetic pathway localizes to both
                     the cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455502.1"
                     /db_xref="GeneID:2896036"
                     /db_xref="GOA:Q6CKN7"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN7"
                     /translation="MVHVARFLDERPTDIPSILAGGYNHPLLREWQNERQLTKNMFIF
                     PLFVSDQDDEETIIPSLPNIKRFGINRLKDYVAGLVAKGLRSVILFGVPLKDGAKDQV
                     ATSADDPEGPVIQAIKLLRKEFPDLYIICDVCLCEYTSHGHCGVLYEDGTINREKSVQ
                     RIAAVAVNYAIAGAHCVAPSDMIDGRIREIKMGLIEHGLAHKTFVMSYSAKFSGNLYG
                     PFRDAACSQPGKGDRKCYQLPSGGRGLARRALKRDLQEGSDGIIVKPSTFYLDVMSDA
                     AEICRDLPVCAYHVSGEYAMLHAAAEKGVVDLKSIAFESHYGFLRAGARLIISYFTPE
                     FLEWLDEN"
     gene            complement(<860011..>860676)
                     /locus_tag="KLLA0_F09295g"
                     /db_xref="GeneID:2895240"
     mRNA            complement(<860011..>860676)
                     /locus_tag="KLLA0_F09295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455503.1"
                     /db_xref="GeneID:2895240"
     CDS             complement(860011..860676)
                     /locus_tag="KLLA0_F09295g"
                     /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
                     YMR077C VPS20 vaculolar protein sorting (putative)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455503.1"
                     /db_xref="GeneID:2895240"
                     /db_xref="GOA:Q6CKN6"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN6"
                     /translation="MGQQGSRIKVTESDKAMLQLKMAKDELHRYSRRTENLIGVERAE
                     LRTLCIKLKGKQLKQDNRARLLLKRIHYQERLLEQCSDQIINLETMVQSIEFKLIEKK
                     FIDGLQKGNQLLKKLNVELNLEKVESIMDTAAEQIEIQREIDDALSNAVVGSTINDEV
                     DRELEQLDREVNGTKETAPGVQDRLDQLPSTKELGELKASEPEKENGESQKETPKEEP
                     LLA"
     gene            <861757..>863238
                     /locus_tag="KLLA0_F09317g"
                     /db_xref="GeneID:2895241"
     mRNA            <861757..>863238
                     /locus_tag="KLLA0_F09317g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455504.1"
                     /db_xref="GeneID:2895241"
     CDS             861757..863238
                     /locus_tag="KLLA0_F09317g"
                     /note="similar to uniprot|P32582 Saccharomyces cerevisiae
                     YGR155W CYS4 Cystathionine beta-synthase catalyzes the
                     synthesis of cystathionine from serine and homocysteine
                     the first committed step in cysteine biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455504.1"
                     /db_xref="GeneID:2895241"
                     /db_xref="GOA:Q6CKN5"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005857"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN5"
                     /translation="MGYDTRHDVIDLVGNTPLIRLQKLPKAIGIKPKVYAKLELYNPG
                     GSIKDRIAKSMIEAAEEEGIIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEK
                     MSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVALRLEKEIPGGIILDQYNNMKNPE
                     AHYFGTGKEIHHQLEDLSLFSKLKAVVAGAGTGGTISGISKYIKEQNDKIAIVGADPV
                     GSILAVPEKLNETDVTEYKVEGIGYDFVPKVLNRDSVDHWVKTDDKSSFKYARQLISN
                     EGVLVGGSSGSAFTALVDYCNEHPELTEDDVIVVIFPDSVRSYLTKFVDDEWLKTNGL
                     WDDAIATPIVQKETDVFEDATVKDLNLKPVVSVEEDASVATVIKILRDNSFDQLPVLT
                     KDGKLCGLVTLSQLLKKLSTSKDVSSIKSLFFDFRKLNNFDDISSYNADKSHKKIFVR
                     FDVNTTLSELNSFFEKNSAAIITEGLNPVHIVTKVDLLSYLAK"
     gene            complement(<863495..>863920)
                     /locus_tag="KLLA0_F09339g"
                     /db_xref="GeneID:2895242"
     mRNA            complement(<863495..>863920)
                     /locus_tag="KLLA0_F09339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455505.1"
                     /db_xref="GeneID:2895242"
     CDS             complement(863495..863920)
                     /locus_tag="KLLA0_F09339g"
                     /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
                     YGL041W-A Identified by expression profiling and mass
                     spectrometry"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455505.1"
                     /db_xref="GeneID:2895242"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN4"
                     /translation="MLSRSVFRSGLRAATFGAVTAQRSCRTIIPLLQNKRYASSWDKS
                     PEDLDAHVKVQKLMDEIHSHPSIVESLENLNSIMREKKLIDPESNEPPSIMQMVKLMM
                     DKDIREAMQKFKSEMDKSGINLGPDQLGPLMKVLGIEKK"
     gene            complement(<864425..>865303)
                     /locus_tag="KLLA0_F09361g"
                     /db_xref="GeneID:2895243"
     mRNA            complement(<864425..>865303)
                     /locus_tag="KLLA0_F09361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455506.1"
                     /db_xref="GeneID:2895243"
     CDS             complement(864425..865303)
                     /locus_tag="KLLA0_F09361g"
                     /note="similar to uniprot|P07273 YGL043W Saccharomyces
                     cerevisiae DST1 General transcription elongation factor
                     TFIIS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455506.1"
                     /db_xref="GeneID:2895243"
                     /db_xref="GOA:Q6CKN3"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR016492"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN3"
                     /translation="METKDVLEAVKGLEKNKNNNDVVFKILQSLDKDLKDVNEKLLRE
                     TKVGVVVNQFKKSSNPDIVKLVKKMILSWKDAVAREKKSKLSSNSSSTSNNNGTSGGE
                     AVKKEKYVSKAPRNAKNDGVKTDIYGVKIRDMAIRALYDALAKESEHPPVAILDTVMS
                     IETEMANLFNPESDEKGYRDKYRIIYSNIISKNNPDLKHRITNGEVSAKHLVTADPKD
                     LAPEHLKKKIEEIEKQNLFNAQGATVERSVTDRFQCGKCKQRKVSYYQLQTRSADEPL
                     TTFCTCENCGNRWKFS"
     gene            <865710..>866486
                     /locus_tag="KLLA0_F09383g"
                     /db_xref="GeneID:2895244"
     mRNA            <865710..>866486
                     /locus_tag="KLLA0_F09383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455507.1"
                     /db_xref="GeneID:2895244"
     CDS             865710..866486
                     /locus_tag="KLLA0_F09383g"
                     /note="similar to uniprot|P25299 Saccharomyces cerevisiae
                     YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of mRNA
                     3' ends interacts with the A-rich polyadenylation signal
                     in complex with Rna14p and Hrp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455507.1"
                     /db_xref="GeneID:2895244"
                     /db_xref="GOA:Q6CKN2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="InterPro:IPR026896"
                     /db_xref="PDB:4EBA"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN2"
                     /translation="MNRGNPSRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPT
                     TGKSKGYAFIEFKDLATSASAVRNLNGYTLGSRSLKCGYTTGSGINGSGSGPGDEEEN
                     GNMVEDVKFPWLPVGVDVNINMTTPAMCISSELGKLQKDQQMALLKVIQHFCKDDKET
                     FVALLEEAPQLSYAIAELLLSNGVCSVDQLTQLAMASKQRPEEQTDNTVEDGLDEEKV
                     DLLRQVLQLQDSDIAMLPQDEKMAVWELKQRAMKGEFGHL"
     gene            <867882..>869513
                     /locus_tag="KLLA0_F09405g"
                     /db_xref="GeneID:2895245"
     mRNA            <867882..>869513
                     /locus_tag="KLLA0_F09405g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455508.1"
                     /db_xref="GeneID:2895245"
     CDS             867882..869513
                     /locus_tag="KLLA0_F09405g"
                     /note="similar to uniprot|P40445 Saccharomyces cerevisiae
                     YIL166C Hypothetical ORF, member of the Dal5p subfamily of
                     the major facilitator family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455508.1"
                     /db_xref="GeneID:2895245"
                     /db_xref="GOA:Q6CKN1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN1"
                     /translation="MVDFEKQRVDSDVKRISLSSYDVELRSQDSLDSDNPFSDPLIAE
                     YYRALYEESKYESRSAFDPAFTWTKEEEKKLLWKLNFRVAFVACFLFIALQLDRGNLS
                     QAVADNLLEDLHMDTNDFNLGNQLFYLSFFLAELPSQLISKRLGPDIFIPIQICAWSV
                     VAMAQAAMHNKAGFLICRCLIGALEGGFIADLVLWLTYFFTSKELSIRLSWFWTSLSI
                     VQVVSALLAYGILRMRGIGGLAGWQYLFLLEGILTFLIGLSGFYLMVPGAVQTKNWMH
                     PKGWFTEREEKIVVNRVLRDDPSKGDMHNRQPISFKLLWSAISDYDLWPIYLIGLIAY
                     VPMNTVSTYLTLTLKSVGFSTLNVQLLSIPYQVIHITLLIGVTWYAERIDQRAYMGVI
                     ASIWNALFLGVLRWWKGSLVEAWPTFALCTLLLGGPYVHAICVSWVSRNSNSIKTRAL
                     SSALYNMAVQVGAIYSTQIYRKNDAPLYHTGNTVLFAISIAGIPVFLFAKWYYRTRNK
                     RKEAIWSQMSEDERVEYIQTTSDQANKRLDFRFAE"
     gene            complement(<869664..>871307)
                     /locus_tag="KLLA0_F09427g"
                     /db_xref="GeneID:2895246"
     mRNA            complement(<869664..>871307)
                     /locus_tag="KLLA0_F09427g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455509.1"
                     /db_xref="GeneID:2895246"
     CDS             complement(869664..871307)
                     /locus_tag="KLLA0_F09427g"
                     /note="weakly similar to uniprot|P25568 Saccharomyces
                     cerevisiae YCL038C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455509.1"
                     /db_xref="GeneID:2895246"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024671"
                     /db_xref="UniProtKB/TrEMBL:Q6CKN0"
                     /translation="MNEMLESTPLKPNSTGCSTLSGSKKLTADASVQELVCEHDETFQ
                     QEQISSASCNFKDSQLSKWDTRKTYLVWLLICFSTGPTAAMMRSYVPATIQTTAHALG
                     HPKGSSGPCLATGDDCYVTFSYGTVQYTSFSLYLKAIYTSLEGAIAILMMAFADYSDY
                     RKWLMIGATASYGIFAIPFYWLSDTKKYQTLVQQSVLYCLMLCFGTIYQITESSYIPV
                     FMNARKLALQDEHNSKQGGVMLRGVNVSTWGLVVGNIGGIIASLVGVIITHASSHPSN
                     KDFLLAVTVAGFVTTFISIICANLIPSLKGKEFQNKGVRDLIIMPLVRFKEIFMDLLD
                     YREAFKFCVAWVLWNIAYSNFLSVFGLLFRSTMGIGSSDAEFAIWQFMNLIVACLGPL
                     CWMAFYSYACSNKPSFYSITYMKRSLYGMLLVGTFTNFWGCLGTNFNSKVGFKYRWEF
                     WLFQILFVSTSSGIRTINRVAYSAMLPTGKENQYFGFEVMLGLCTGWSESLIVALLQD
                     KTGNSRMPFIPNTLLYLVALLLFFSVDVEKGMKQAGKCG"
     gene            <872881..>874605
                     /locus_tag="KLLA0_F09449g"
                     /db_xref="GeneID:2895247"
     mRNA            <872881..>874605
                     /locus_tag="KLLA0_F09449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455510.1"
                     /db_xref="GeneID:2895247"
     CDS             872881..874605
                     /locus_tag="KLLA0_F09449g"
                     /note="highly similar to uniprot|P19882 Saccharomyces
                     cerevisiae YLR259C HSP60 Tetradecameric mitochondrial
                     chaperonin required for ATP-dependent folding of precursor
                     polypeptides and complex assembly; prevents aggregation
                     and mediates protein refolding after heat shock; role in
                     mtDNA transmission; similarity to groEL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455510.1"
                     /db_xref="GeneID:2895247"
                     /db_xref="GOA:Q6CKM9"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM9"
                     /translation="MLRSTVKPGNLTLKRSTQLLSRRLYSSHKELKFGVEGRAALLKG
                     VETLAEAVSATLGPKGRNVLIEQPFGAPKITKDGVTVARAITLEDKFENMGAKLLQEV
                     ASKTNEAAGDGTTSATVLGKAIFTESVKNVAAGCNPMDLRRGTQAAVEKVIQYLSENK
                     KEITTSAEIAQVATISANGDAHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGM
                     RFDRGFISPYFITDAKSGKVEFEKPLILLSEKKISSIQDILPSLELSNQTRRPLLIIA
                     EDIDGEALAACILNKLRGQVQVCAVKAPGFGDNRKNTLGDIAILSGGTVFTEELDLKP
                     ENATIQHLGSCDSVSITKEDTVILNGNGPKENIETRIEQIKNSIDLTTTNSYEKEKLQ
                     ERLAKLSGGVAVIRVGGSSEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKASR
                     VLDEVATENFDQKLGVDIIRKAISRPARKIIENAGEEGSVIVGKIIDEYGQDFTKGYN
                     AAKGEYTDMLAAGIIDPFKVVRSGLVDAAGVASLLATTEVAIVDAPKPAGAAPAMPGG
                     MPGMPGMM"
     gene            complement(874920..875041)
                     /locus_tag="KLLA0_F09482r"
                     /db_xref="GeneID:2895249"
     tRNA            complement(join(874920..874956,875005..875041))
                     /locus_tag="KLLA0_F09482r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2895249"
     gene            <875250..>876263
                     /locus_tag="KLLA0_F09526g"
                     /db_xref="GeneID:2895250"
     mRNA            <875250..>876263
                     /locus_tag="KLLA0_F09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455512.1"
                     /db_xref="GeneID:2895250"
     CDS             875250..876263
                     /locus_tag="KLLA0_F09526g"
                     /note="similar to uniprot|Q75EB2 Ashbya gossypii AAR165W
                     AAR165Wp and weakly similar to YGL126W uniprot|P53012
                     Saccharomyces cerevisiae SCS3 Protein required for
                     inositol prototrophy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455512.1"
                     /db_xref="GeneID:2895250"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM7"
                     /translation="MKRVFWLLCPVLFLAPYVLPISLGTADKDGILNVYFVKFGWFWT
                     SVISCLCVIRYSNIVNHWKRYLLLTLWWMIFTQEVFGLTPLMDLVFLNSGGICSFDIF
                     STDGNEQTLNLQFHDNEFRRLRGIRRMLNWLGNVHGSETLLSALNSIISEDSSEYTPE
                     LAAELSELSKLVKSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQSRAFR
                     HLQNTYKRFLNRAGSQLLQLLDNSALANLWIHDDHDDDSQWWFKFLFQPPLSCYQTLM
                     TLIYLILRFIIWENPILLLFTLTALWSYSFVVTVMLFHTFWEQLSGFVAAYLVCILVY
                     QFF"
     gene            complement(<876719..>878695)
                     /locus_tag="KLLA0_F09559g"
                     /db_xref="GeneID:2895252"
     mRNA            complement(<876719..>878695)
                     /locus_tag="KLLA0_F09559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455514.1"
                     /db_xref="GeneID:2895252"
     CDS             complement(876719..878695)
                     /locus_tag="KLLA0_F09559g"
                     /note="some similarities with uniprot|P35995 Saccharomyces
                     cerevisiae YKL222c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455514.1"
                     /db_xref="GeneID:2895252"
                     /db_xref="GOA:Q6CKM5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM5"
                     /translation="MSKGPLEGQNSNETQTACKKSTNDDAISDFATEMSVLYNKNEAA
                     QDIGTGNSEESAGIGSHNNDEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDR
                     KRPMCTGCKMRGLSECVYTDGYNFDISHDDVYNKSPNLQLLNEIESLKQQLKVEGTEK
                     HLEPETLKRLSIYGLIKKEANPLVRCKYVMKKHDRIIRYGCTSTRTIIRLSSENVTNY
                     FQEVLMVHKKERLKLKARTGTSMLYELQRIETPWSLGMVISDLPKYSELCTAVMHSFG
                     YKGFHLHNIFSEDKIMQYLTDCFKVVDDRIIELIPHSKLNYYPIAIVLHLYTILKDQM
                     PHSFISFFVMLIGQNTAKICYIERVQFLLLHYIWKSSRHQSGGDNSHLLAVVELMVMS
                     ALDVGLNDSIDALQGDERILKNLWNWILFYDITIAFDIGRPLLVSAEMFDTESLWKES
                     EPLSDEPNQEFGAAFMRKLRKFIFYGRSILNGLHTRDKIPDLDLYTNFMETLLDEIWP
                     ENIDYFAADKTLSRPLPLAEMVLSFPILSIICTLRNLKRLWFKDTSASNSNAFGKYTM
                     MSTDLVFGSIVKCYQLDYEESHGNVMQSSSLASNLRFLIGAISSHWIRALMQGYELLY
                     SMALSAKFINAERTTFCSESGTPSENSNFLHVIL"
     gene            complement(<879983..>881536)
                     /locus_tag="KLLA0_F09581g"
                     /db_xref="GeneID:2895253"
     mRNA            complement(<879983..>881536)
                     /locus_tag="KLLA0_F09581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455515.1"
                     /db_xref="GeneID:2895253"
     CDS             complement(879983..881536)
                     /locus_tag="KLLA0_F09581g"
                     /note="similar to uniprot|P38318 Saccharomyces cerevisiae
                     YBR220C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455515.1"
                     /db_xref="GeneID:2895253"
                     /db_xref="GOA:Q6CKM4"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM4"
                     /translation="MALPPHDRKQFYLLVVLYLLQGIPVGLTFGTIPFILKSSQRQTS
                     FVTIGLFSMATYPYSFKILWSPIVDSWYSQKVGRRRSWIIPVQFVTGITLLTLGYCIS
                     KDKILPKDVSKVDMKALTSVFLFLVILCSTQDIAVDGWALNILSKESLSYASTAQTIG
                     LNIGYFMSFTIFLSLSSDEFMQKYFHRDRLFQLSSYLTFTGLLYLAVTFYVSLFTSEK
                     VHVETHSHIKKDDDEKMIEYQPDEEEDNESHDLINIYRLFIKVMKLPSVQTLAIVHLI
                     SKFAFQCNDAATNLKLLEKGLKREDLAITVLINFPFELLFGFYVARLSRAGYSFNNKI
                     IRAVAGDARTLTPWIIGFIGRLSAAILGNVVVYLFPEDESEISMSFFLLVLCQHLLGS
                     FMSTFQFVSMSAFHTQVADPVIGGTYMTLLNTLSNLGGTWPRLLIMSMIDFFSKYDCT
                     GVPLIQGQSLTKEQCVSIGGQLNTIRDGYYITNLFCIVSGLLIFTTYLKPTAIKLCKV
                     PLDQWKVSN"
     gene            complement(<882778..>883842)
                     /locus_tag="KLLA0_F09603g"
                     /db_xref="GeneID:2895254"
     mRNA            complement(<882778..>883842)
                     /locus_tag="KLLA0_F09603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455516.1"
                     /db_xref="GeneID:2895254"
     CDS             complement(882778..883842)
                     /locus_tag="KLLA0_F09603g"
                     /note="highly similar to uniprot|P32473 Saccharomyces
                     cerevisiae YBR221C PDB1 E1 beta subunit of the pyruvate
                     dehydrogenase (PDH) complex which is an
                     evolutionarily-conserved multi-protein complex found in
                     mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455516.1"
                     /db_xref="GeneID:2895254"
                     /db_xref="GOA:Q6CKM3"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM3"
                     /translation="MMMLSNTFKRAVPSVVQSMRFASTKTMTVREALNSAMAEEMDRD
                     DDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLAVGAALKGLKPIV
                     EFMSFNFSMQAMDQVINSAAKTYYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAWY
                     GSVPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGQSFEVSEESLSTDFTLP
                     YKAKVEREGSDISIISYTRNVQFSLEAAEILSKQYGVSAEVINLRAIRPLDVEAIINT
                     VKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYLDAPIQRVTGAEVPTPYAKELED
                     FAFPDPDTIVRAAKSVLSIE"
     gene            complement(<884902..>886395)
                     /locus_tag="KLLA0_F09625g"
                     /db_xref="GeneID:2894955"
     mRNA            complement(<884902..>886395)
                     /locus_tag="KLLA0_F09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455517.1"
                     /db_xref="GeneID:2894955"
     CDS             complement(884902..886395)
                     /locus_tag="KLLA0_F09625g"
                     /note="weakly similar to uniprot|P38319 Saccharomyces
                     cerevisiae YBR223C TDP1 Tyrosine-DNA Phosphodiesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455517.1"
                     /db_xref="GeneID:2894955"
                     /db_xref="GOA:Q6CKM2"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM2"
                     /translation="MGVRDTVRSHWATLGTKSDSKPVVPTTIGSGRNVSTAAPVAATA
                     PVYSPFKVVKSVIFDGDSRQPDMFELNDVLSDPSLNEVWLFSFGFQINLIMSPIKDHV
                     KVHIVGQLNTINSEQPISHYANLKVHRVDIPSPWGCHHSKIIFSFHQNGTMRMHVPSF
                     NLSREEMNLVQQTVWTSPLLYEKSETVPKKKSRFEDELLEYLNSYSSYTSLYGLIASL
                     KRYKWHVLDEQNCQFVYSTPYNGGLTQLKSCLRASGMKLHGDEEDDDLSFVNLFIQVS
                     SMGNPFRKKFDLLQDVMIPYLYTDWFEKDGYDKKLKSKEYTTPFLAHSTLVWPTKTEI
                     KECMTQGLSANWFFYKRSEQTERKVVPCLRKHVPLPTNATQSDKNRHMVPSHTKYYIQ
                     FTDENTLKRPDWILLTSHNLSQAAWGPSPLKKPTNYECGILYTTTMGRNKVRLTLASA
                     QQPPGRTIGSRVPEDITVLPTVKVVTPYPLKFQRYSATDEPYTSVVQ"
     gene            <887288..>889102
                     /locus_tag="KLLA0_F09647g"
                     /db_xref="GeneID:2894956"
     mRNA            <887288..>889102
                     /locus_tag="KLLA0_F09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455518.1"
                     /db_xref="GeneID:2894956"
     CDS             887288..889102
                     /locus_tag="KLLA0_F09647g"
                     /note="similar to uniprot|P53128 Saccharomyces cerevisiae
                     YGL125W MET13 Isozyme of methylenetetrahydrofolate
                     reductase catalyzes the reduction of 5
                     10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
                     in the methionine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455518.1"
                     /db_xref="GeneID:2894956"
                     /db_xref="GOA:Q6CKM1"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM1"
                     /translation="MRISQKLQRAHEEREDATFSFEFFVPKTSQGVQNLYERMDRMYQ
                     TQPEFIDITWNAGGRLSMLSTDLVATSQGVLGLETCMHLTCTNMPVSQIDDALKKAYD
                     AGCENILALRGDPPINSLGEEEEWKPCENGFRYAKDLVSYIREQYGDHFDIGVAAYPE
                     GHPECDCDDKLLLHLKEKVDCGADFMVTQMFYDVDKFLDWCARVREAGISIPIIPGIM
                     PITSYPSFIRRTQWCQINVPDNFLELLEPVKDDDQLVRDVGTELMVELCQKLLDSGYV
                     NHLHMYTMNLEKASLMILEKLDLLKRSNVGKDVIEPLEPLPWRKSLNPKRRNELVRPI
                     FWQKRPYSYVARTSLWNEDEFPNGRFGDSSSPAYGDLDLCGHSLIRQSVKKSIELWST
                     PQTLDDMSNLVTSYLEGKLKCLPWSDVPLNHEVDDILKHLIDLNKHHIFTINSQPKVN
                     GKPSTDPVVGWGPTKGYVYQKEYLEFLLPREKLPLFQEICQEHSDHLTYFAIDSQDNL
                     ATNHPEDSRANAVTWGVFPGSEILQPTIVEKASFLAWKEEFFTILKEWKLTFVEHKAT
                     ESVNLVNHIIDNYVLINVVDNDFISTNDTIYDLLQQLY"
     gene            <890193..>892073
                     /locus_tag="KLLA0_F09669g"
                     /db_xref="GeneID:2894957"
     mRNA            <890193..>892073
                     /locus_tag="KLLA0_F09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455519.1"
                     /db_xref="GeneID:2894957"
     CDS             890193..892073
                     /locus_tag="KLLA0_F09669g"
                     /note="similar to uniprot|P38321 Saccharomyces cerevisiae
                     YBR225W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455519.1"
                     /db_xref="GeneID:2894957"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CKM0"
                     /translation="MSGLPLSLQMEPVVHTSSTPVSVRERERGQPQTNVKNLPRKHKS
                     KSITALTSSSSPDIKQPSLKWNVLPKIGETLHQRKHSMNVTYTDSMHIAYDPRYNSRL
                     SKFDTFIQFNEQCELSDVITMAPTRLESFVKFLNYYYESKKFMTNTEERAFETSHYPG
                     TIDGINFLEVDYLIQLWYLQCLRFLHKTQSLSFSPNIVQSLLQRRQRAKHRSVSNGFV
                     DPDILVIRSNMSDSFWGWQVAYDEPSLNIVDYEFEVSIFSKASQDILALPMCATLSEL
                     TVKDVMGRSTDDLEDGISPIDSLEQQERSDSDVSSITADSAGKNSINSRNSSTTSNKL
                     MKAAHAGTSGLAHLFKKKSSTALSTASPTLDTITTTDTINPTTAISDSGTLTLKNKWL
                     ENYYSKKLSNYSSVHSPCCYETPTSTPLEEGFDEKKVLEYKLQYLKIKLPFQDNSIPS
                     MLCPNLWFHLRFDEWRSVLQEIYRCLVPGGSIQTENFDFKGSSIDTDDECSNATTSEF
                     RKFLDAAALEAMKVNIQIFPMRHLVHMLNEVGFVNVKCCILSLKRGDLVNNLGFMYEF
                     MAMCHYDSIVKKYLSDPSLYPEDTYPPTFPMRYFNEHINSVDNHVGALRMVCITAEKP
                     LR"
     gene            complement(<892208..>893725)
                     /locus_tag="KLLA0_F09691g"
                     /db_xref="GeneID:2894958"
     mRNA            complement(<892208..>893725)
                     /locus_tag="KLLA0_F09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455520.1"
                     /db_xref="GeneID:2894958"
     CDS             complement(892208..893725)
                     /locus_tag="KLLA0_F09691g"
                     /note="similar to uniprot|P38323 Saccharomyces cerevisiae
                     YBR227C MCX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455520.1"
                     /db_xref="GeneID:2894958"
                     /db_xref="GOA:Q6CKL9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL9"
                     /translation="MLSLGVRNFSHSRICFSASSKLIHGSKNKIPSPKELKNFLDEYI
                     VGQNDGKKVCSVAVYNHYLRVNDKQKKLEARLQRKLLEEQQKKLDSTSPIEFTSTEAE
                     QGMRNLQRQLSLELDNDDEDLELSKSNLMVVGPSGSGKTLLATTLARMLDVPIAITDC
                     TQLTQAGYIGEDVEVCIERLLINADYDVAKAEKGIIVLDEVDKLAKPAASIGTKDVSG
                     EGVQQSLLKILEGHGVELTLKRPVNKKKDDKNNQTAAKKEETFVVDTSNILFMLMGAF
                     VGLDKHIVKRIERIKNPDATANDKESDSKKLRFSNTIEHIDIGDGKTISALNFVTPSD
                     LVSYGIIPELIGRVPIVTALEPLKQTDLFHILKEPRNALLHQYEYIFKQFGVTLGVTE
                     KALKRVAQFALKEGTGARGLRGIMERLLLNVNYECPDSGISYVLVNEETVKALQHKEH
                     SLSTKVKAKYYSRGEQDQFVIDVYKEDEQLGKEFDKRFGRVGTLEKKGKSYKMEN"
     gene            <894192..>895058
                     /locus_tag="KLLA0_F09713g"
                     /db_xref="GeneID:2894959"
     mRNA            <894192..>895058
                     /locus_tag="KLLA0_F09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455521.1"
                     /db_xref="GeneID:2894959"
     CDS             894192..895058
                     /locus_tag="KLLA0_F09713g"
                     /note="similar to uniprot|P38324 Saccharomyces cerevisiae
                     YBR228W SLX1 Subunit of a complex with Slx4p that
                     hydrolyzes 5' branches from duplex DNA in response to
                     stalled or converging replication forks function overlaps
                     with that of Sgs1p-Top3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455521.1"
                     /db_xref="GeneID:2894959"
                     /db_xref="GOA:Q6CKL8"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /translation="MSNKQHRVPDFYCSYLLRSIPKPNSFYIGSSPDPVRRLRQHNGA
                     VRRGGAYRTKRNGTRPWKMVCFIYGFTSKIAALQFEHAWQHSYKTRFIENNERLVTKK
                     NTRNGIATKLGNARLLMKHPYFDKMNLHIRFFDRLAWESWELNKFKVDYGLSLCEVDE
                     AVLTDESQLDELDELNLERIKAFYEDQMAQESSLLQRYQDNLTYDQKSCMICDKKIDY
                     IHDEGTQMVGFCSDDECDFLSCLSCLYKEFTKNSKQIIPKSGHCPNCHKCLEWSQIVK
                     YSTVLREKLIKD"
     gene            complement(<895086..>897818)
                     /locus_tag="KLLA0_F09735g"
                     /db_xref="GeneID:2894960"
     mRNA            complement(<895086..>897818)
                     /locus_tag="KLLA0_F09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455522.1"
                     /db_xref="GeneID:2894960"
     CDS             complement(895086..897818)
                     /locus_tag="KLLA0_F09735g"
                     /note="similar to uniprot|P38138 Saccharomyces cerevisiae
                     YBR229C ROT2 Glucosidase II catalytic subunit required for
                     normal cell wall synthesis mutations in rot2 suppress tor2
                     mutations and are synthetically lethal with rot1
                     mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455522.1"
                     /db_xref="GeneID:2894960"
                     /db_xref="GOA:Q6CKL7"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL7"
                     /translation="MKLSLSTLLRWLLSFGIALAFQDDLLKKCSQSGFCHRNRQYAKN
                     IQESRNSHYSLDQGSLEFDTNNHTIQGFIIKSIKANQKDIKIPLPFTLDLFDGDKVRF
                     RLDEHRSIKLGKAGINLQRYNETEHWAFDPDYIPIRQEVIAKSPTFWNKKDFTFTADR
                     FTVTLSSQDFQINVKYDSADVLTVNSDNMLNFEHYRTLEENFENINEEEEPFNMFKDS
                     FADSKSDSIPLGPESVALDFKFHGISNLYGIAEHADSLRLRDTSNIDPYRLYNVDVFQ
                     YKLNSTLPMYGSIPFVVGIKESLSIGLFWMNPSDTWIDIQYGHSDSSTHWMSESGIID
                     FIVIVQETPKLVTESYVNITGKPMLPLLSSVGYHQCRWNYNDEKDVLTVDSLMDKWQI
                     PYDFLWLDLEYTDQKQYFTWKPDAFPNPTRMLSKLAFLGRNLVTLIDPHIKSNYHISE
                     AIIAAKVYVRNALNKPFFGQCWPGESIWIDTFNPLASKLWSKFVQTFISTPSNLYIWN
                     DMNEPSIFDGPETTAPKDLLHYNGFEERSVHNLYGLTVHQATYDSFVDMNPNKRPFVL
                     TRSFFSGSQRTAATWTGDNVANWEYLQLSIPMVLSHNIVGMPATGADIAGFFGNPDDE
                     LLIRWYQAGIWYPFFRAHAHIDTRRREPFLLNERTRSVVTEFIRLRYQLLPTLYTAFH
                     DSHSRGIPIMNPMIYEHPNVANFYDIDDQFYLGEQGILVKPVTSANTKSIPITFPSGV
                     FYDLQNLEIAHFGTLETKTVSAPLEKLPAYIAGGHIITRKDQYRRSSRLMQNDPYTLV
                     IAPTAYGTAKGRLYVDDGETFAYKQGKLLEVELEYNKNVIYGTVLHKDTSSFFNDISI
                     EKIVIAHHPDGKVAETCTLELDDIRTNIEVIHEDHSHVIKNPGIQIGQDWKIIL"
     gene            <898398..>899156
                     /locus_tag="KLLA0_F09757g"
                     /db_xref="GeneID:2894961"
     mRNA            <898398..>899156
                     /locus_tag="KLLA0_F09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455523.1"
                     /db_xref="GeneID:2894961"
     CDS             898398..899156
                     /locus_tag="KLLA0_F09757g"
                     /note="some similarities with uniprot|P40209 Saccharomyces
                     cerevisiae YMR136W GAT2 Protein containing GATA family
                     zinc finger motifs; similar to Gln3p and Dal80p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455523.1"
                     /db_xref="GeneID:2894961"
                     /db_xref="GOA:Q6CKL6"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL6"
                     /translation="MEVVATLAPISCDNAEQANLPPIKDVLGDIPIVSSQIDKLRKEL
                     TRNKTELQASIAKMKALIENFDYESIVAIQKECQVIREFTNKIRMRMIKHDCIDIQNN
                     SDIYINEIIPPTWFEFKREGPKYCVHCECVETIEWRNGPWGKATLCNACGLWYRKLKK
                     KFTAEQSAIIMEEKRLFSNKHDRKEFSKFDADDKRLKIIKDSLIDRINKFIKEVELCK
                     STAAKLKQIKAKEDMDQKVTPREINKYDSISRIC"
     gene            complement(<899099..>900685)
                     /locus_tag="KLLA0_F09768g"
                     /db_xref="GeneID:2894962"
     mRNA            complement(<899099..>900685)
                     /locus_tag="KLLA0_F09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455524.1"
                     /db_xref="GeneID:2894962"
     CDS             complement(899099..900685)
                     /locus_tag="KLLA0_F09768g"
                     /note="weakly similar to uniprot|P53129 Saccharomyces
                     cerevisiae YGL124C MON1 Protein required for fusion of
                     cvt-vesicles and autophagosomes with the vacuole
                     associates as a complex with Ccz1p with a perivacuolar
                     compartment potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455524.1"
                     /db_xref="GeneID:2894962"
                     /db_xref="GOA:Q6CKL5"
                     /db_xref="InterPro:IPR004353"
                     /translation="MRRSPSFQISTKNSAKPTTSIDLTNHLSARGGLFYQDIDTGTTA
                     SIKAKNDPNLLAATYDHSISADTDLNIDLQSLITSELNSLYPLTLNQETSNKSANTTK
                     FIDERGGKDKHFFVFTSAGKLVFSQWENENHAMGLTGIIHTVMNYFNINDNTAMRQFT
                     MYGKDGIMTRFVFLDKNHIKLMVQCNNNYESTAQLQQQLDLVYSYIISSVSQRNLNKL
                     MLKRSNFDLQHYLTDLDQQLLKSLCESLATQPKLTWFANSLECLPMSPKKRNAINSIL
                     STTYLDFNISNHNGQILYTLVTSLDMRLISILRPSNHTLHTMDLQILFEVVRAQLTDL
                     LLDKVLWFPICFQKFNDNGFLYALIKVLPNNTIMMVISSQKNAFDILNEFVRRIEDKM
                     IDDNTCNNLELQLLDWHKKFPYINHFIYKMKRTVQIYTPSQPTNEMLQFYYHLKNLCE
                     DDKGTNLNKSSVAMLKWKNDATPGLLSGVYWATEKFELYILLNDINLSNQSILKSAKL
                     LIQHIREIESYLFISRGVTF"
     gene            complement(<901211..>901738)
                     /locus_tag="KLLA0_F09790g"
                     /db_xref="GeneID:2894963"
     mRNA            complement(<901211..>901738)
                     /locus_tag="KLLA0_F09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455525.1"
                     /db_xref="GeneID:2894963"
     CDS             complement(901211..901738)
                     /locus_tag="KLLA0_F09790g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455525.1"
                     /db_xref="GeneID:2894963"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL4"
                     /translation="MSSEKHDAQHHNQQQEKRKAAKDVKEAKETAKNKASHAAHDAHD
                     AVDKAHDEVKKHLDEYEGILKPYWDKLVEIVNAVASKTVGVTQATVSTVAANTSKATT
                     IVLHELQNPVVAFNTLLGAASITTLLNGYANKRRFLKGKSDKDIALIVSGLSAFIAAD
                     AYVSYYNYKRFDKRH"
     gene            <903154..>903933
                     /locus_tag="KLLA0_F09812g"
                     /db_xref="GeneID:2894964"
     mRNA            <903154..>903933
                     /locus_tag="KLLA0_F09812g"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_455527.1"
                     /db_xref="GeneID:2894964"
     CDS             903154..903933
                     /locus_tag="KLLA0_F09812g"
                     /note="similar to uniprot|P25443 Saccharomyces cerevisiae
                     YGL123W RPS2"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_455527.1"
                     /db_xref="GeneID:2894964"
                     /db_xref="GOA:Q6CKL3"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL3"
                     /translation="MSAPQAQGQQAPRRGGFGGANRGGRGGRRGGRRDQEEKGWVPVT
                     KLGRLVKAGKISSIEEIFLHSLPVKEFQIIDQLLPNLKDEVMNIKPVQKQTRAGQRTR
                     FKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLA
                     TKTSGKCGSVSVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTSSTGSTRTLENTLKA
                     AFVAIGNTYGFLTPNLWEVQALTPSPMDVYADYATASKKKL"
     gene            complement(<904512..>906080)
                     /locus_tag="KLLA0_F09845g"
                     /db_xref="GeneID:2894966"
     mRNA            complement(<904512..>906080)
                     /locus_tag="KLLA0_F09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455528.1"
                     /db_xref="GeneID:2894966"
     CDS             complement(904512..906080)
                     /locus_tag="KLLA0_F09845g"
                     /note="similar to uniprot|Q75E99 Ashbya gossypii AAR178C
                     AAR178Cp and some similarites with YGL122C uniprot|P32505
                     Saccharomyces cerevisiae YGL122C NAB2 Nuclear
                     polyadenylated RNA-binding protein related to human hnRNPs
                     has a nuclear localization signal sequence that binds to
                     Kap104p required for both poly(A) tail length control and
                     nuclear export of mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455528.1"
                     /db_xref="GeneID:2894966"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL1"
                     /translation="MSTVPEYIASNLKTVISERLKVVPNFNEDVNQVAEYITLLMSNG
                     SSGPDIVQELTSLFDGISTQEFQSVVSIAFTSADLLKAGDDLNTVYAKLSGNSSQPSS
                     SAPSAPVSTGTETSVGVPVQSPPVSAPAPSAPVSAFSGVVDVSASKYNTANEGRSSQR
                     NKDSSAHNGTSRRGGFSSIRGGISKSAGVTNRRGVNSRYGANQLAMALGINESEGANE
                     TSGHVVIKREGRCPDFPHCSLGRKCPRGHPTVTCPSYPNCKNPPGTCTYLHPNEDGQL
                     IQELERVREERRIKREEMEKKQQQRISGIVVCKFGIICSNQKCPFGHPTPANEDAKVT
                     QFSWCENNLQCTDPTCNKAHSSLSKIKEIKPIIHKPAPKPVISKPSNPKFAPRSVVPL
                     EEKILEQCKFGPKCTNKNCPKRHARSSIMCREGAQCTRIDCLFGHPINEPCRYGAECR
                     TYGCLFQHPPERVLPEKPKKPDTENTNGIWFNPQLIGSGNSSSNERPFAVPESNVQSV
                     HAGQEVDGDAMMMS"
     gene            complement(<906641..>907750)
                     /locus_tag="KLLA0_F09867g"
                     /db_xref="GeneID:2894967"
     mRNA            complement(<906641..>907750)
                     /locus_tag="KLLA0_F09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455529.1"
                     /db_xref="GeneID:2894967"
     CDS             complement(906641..907750)
                     /locus_tag="KLLA0_F09867g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455529.1"
                     /db_xref="GeneID:2894967"
                     /db_xref="UniProtKB/TrEMBL:Q6CKL0"
                     /translation="MHYWRRVFFLLNFEKFRLKGEYITVNGFDSLHVTGDQFHTKMLP
                     MYFEPRMTIIEVNSGKCTFTFHYWVYINIKAYNHIGVVHWFICTKIMSGNNLSSANHL
                     DSEKLTELLRKKYPFLVMYDGKNDVIDLGKFYLGFAHFMSREITFAEQISSEFIFAFM
                     RIDSERRRLEHDDELFSKASDDLLATRRNINRWAKELEVQILPIVLSAYQILAGDLTE
                     GVEKIKEALRDETLDGLAIRLNILSAYAIDIINEVITIYPEMYNLSVSNKRSLGDYSL
                     HLTLASLLLQSLHLFADLCERHPNLYQRSLQPFTYEQFQIELQEKSEAVTKINEEYEE
                     LIKSITTITFNNVINYMKDKKTKLRDTSKEYLSKE"
     gene            <907978..>911079
                     /locus_tag="KLLA0_F09889g"
                     /db_xref="GeneID:2894946"
     mRNA            <907978..>911079
                     /locus_tag="KLLA0_F09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455530.1"
                     /db_xref="GeneID:2894946"
     CDS             907978..911079
                     /locus_tag="KLLA0_F09889g"
                     /note="uniprot|Q00976 Kluyveromyces lactis KLLA0F09889g
                     SPT16 FACT complex subunit SPT16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455530.1"
                     /db_xref="GeneID:2894946"
                     /db_xref="GOA:Q00976"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="InterPro:IPR029148"
                     /db_xref="InterPro:IPR029149"
                     /translation="MSDGGIEIDFQAFYDRFTKLGKAYSGFEGSPNSLLFVLGSTNEE
                     NPYQKTTILHNWLLGYEFPATLIAFFKDKGVIITSSAKAKHLLPAVTKFEGSDYKLEI
                     WQRNNKDANHNKKLFEDLIKLLSENGNTVGVPTKDSYQGKLILEWKPLWEEAKKTHSL
                     NVIDCSAGLSSTWKGKDDKEKAYLSVSSKGSDKFMDLMSNEIVNAVDEELKISNSKLS
                     DKIENKIDDSKFLKKLSSDLNPLCPTDEKFDVNFLDWAYSPIVQSGSKFDLKVSARSN
                     NDSLFGKGSILASCGIRYKNYCSNITRTFLIDPTDEMTDNYDFLLILQEKIIDDLLKV
                     EADPTSIYEKTLEFIKEKKPELLSHFTKNVGSLMGLEFRDSAGMINAKPTAHKISENC
                     CYNISLGFGNLKDSKTGQVYAVQLADTVQLSSDGKPSTLTKYTKARSQISFYFNNEEE
                     NKAATVKSEKSKPPALPKPDGTSKILRSKLRGESRADDEEKEQIRKENQRKLHERLQK
                     EGLLRYSDADAVDGDEKPKHFFKKYESYVRETQIPSNVRDLKIHVDWKSQTIILPIYG
                     RPVPFHINSYKNGSKNEEGEYTYLRLNFHSPGAGGVGKKTEELPYEENPENQFVRSLT
                     LRSKDGARMSDVFKQITDLKKESTKREQERKALADVVVQAKLVENKTGRTKRLDQIFV
                     RPSPDTKRVPGTVFIHENGIRYQSPLRTDSRIDILFSNIKNLFFQSSKGELIVIIHVH
                     LKNPILMGKKKIQDIQFYREASDMAVDETGNSRRNNMKFRRYGDEDELEQEQEERRKR
                     AALDKEFRYFAEAIAEASDGLLDVDSPFRDLGFQGVPSRSAVFCMPTRDCLIQLVEPP
                     FLVINLNEVEICILERVQFGLKNFDMVFVYKDLTKPVSHINTVPIEQLEFIKTWLTDV
                     DIPYTVSTINLNWSTIMKSLQDDPHQFFLDGGWSFLATGSDDERSDESEEEISEYEAS
                     DEDPSDEEVYSEEEEDYSDDEKFSDEGSDDFADGSEDDEGDDWDDLEKKAAKADRNSN
                     YKE"
     gene            complement(<911305..>916269)
                     /locus_tag="KLLA0_F09911g"
                     /db_xref="GeneID:2895010"
     mRNA            complement(<911305..>916269)
                     /locus_tag="KLLA0_F09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455531.1"
                     /db_xref="GeneID:2895010"
     CDS             complement(911305..916269)
                     /locus_tag="KLLA0_F09911g"
                     /note="highly similar to uniprot|P22137 Saccharomyces
                     cerevisiae YGL206C CHC1 vesicle coat protein presumed
                     vesicle coat protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455531.1"
                     /db_xref="GeneID:2895010"
                     /db_xref="GOA:Q6CKK8"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK8"
                     /translation="MSDLPIEFTELVDLTSLGISPQYLDFRSTTFESDHFVTVRESSN
                     GTNTVAIVDLTNGNEVTRKNMGGDSAIMHPSQKVISVRANGTIVQIFNLDTKSKLKSF
                     QLDEPVIFWKWLSEDVLGFITANSLYVSNVFDGNVSAKPAKITDRHVNLNNTQIINFV
                     ANEKMDWFAVVGIIQENGKIAGKIQLFSKTRGISQAIDGHVAIFSKILLDGNTEPVQV
                     FVTGNRNVNTGAGELRIIEIDPPQDQSVRYQKKIVDIFFPADAVNDFPISVQVSEKYG
                     IIYVLTKYGFIHLYELETGSNLFVNRITADSVFTATYYNHKNGIACINKKGNVLAVEI
                     DTTQIVPYVLNKLSNVSLALTMASRGGLPGADDLFEKQFDNLLSQGDYSNAAKVAASS
                     QQLRTQATINKLKNIQAPPGSISPILLYFSTLLDKGKLNQYESIELTRPLLQQNRNQL
                     YEKYLKEDKLQCSEELGDIVKPFDTTLALATYLKAEVHPKVIACLAELQQFDKILPYS
                     AKVGYNPNFVVLISNLLRTNPDKASEFAISLLSNPETASQLEVEKIADIFFSQNYIQQ
                     GTSFLLDALRSNTPDQGHLQTRVLEINLLNAPQVADAILGNDIFSYYDKPTIAGLAEK
                     AGLYQRALENYSDIKDIKRCIVHTSSIPADWLVDFFGKLNVEQSLACLKTLLDDNLEA
                     NLQIVIQVATKFSDLIGSQVLIKLFEDYRSNEGLYYYLASLVNLTTDKEVVFKYIQAA
                     VKAGHFQEVERIVRENNVYDPEKVKNFLKDAQLQDQMPLVVVCDRFNMVHDLVLYLYR
                     TKNFKFIEVYVQQVNPSKTAQVVAGLLDVDCDEKVITSLLDTVVGQVPIDELTAEVEK
                     RNRLKLLLPFLEKTLQSGTQNQSVYNTLAKIYIDSNNSPEKFLKENDQYDTLNVGRYC
                     EKRDPYLAYIAYEKGQNDDDLIRITNENSMYKYQARYLLARSNSDLWNIVLSPDNIHR
                     RQLVDAVISVGIPELTDPEPVSLTVQAFMSNGLKTELIELLEKIILEPSPFNDNPALQ
                     GLLLLSAIRYEPNKVSGLIEKLDHYDVDEIAPLCIENELNEEAFEIYDKHGKHDKALK
                     VIVEDLLMLDRAESYADKINTPELWSQLGTAELNALRIPEAIDSYIKAKDPSNFMNVI
                     KAAEDAGKFEELVPYLLMARESLKEPVIDGALILAYAELSKLNEIENLLSVSTVANLE
                     EVGDKLSQHNDYKAAKLCYSSISNYSKLASTLVYLGDYQNAVDTARKASNVKVWRQVN
                     DACISNKEFRLAQICGLNLVVHAEELDELVAVYEHNGYFEELISLFEAGLGLERAHMG
                     MFTELAILYTKYNPSKTYEHLKLFWSRINIPKVIRAVEDAHLWPELIFLYAHYDEWDN
                     AALTMIEKSAYNFDHSYFKEIIVKVSNLEIYYKAINFYVKEHPSLLVDLLTVLIPRLD
                     IPRTVRIFSKSDNLPLIKPFLINVLPKNNSVVNQAYHDLMIEEVDYKALQDAVSSYDK
                     FDQLELATRLENHEIIFFKIIAAELYRRNKKWAKSLAIFKGEQLWKHAIETAAISQSQ
                     QIAEDLLSFFIETDNKEGFIALLYSCYHLITYDTVLEQAWLNNLETFIKPYEISVKKE
                     QNDAIKQLSSEFASKAKVGSNSDDQPLLLTNGAIGSQATGFSNY"
     gene            <918014..>920224
                     /locus_tag="KLLA0_F09933g"
                     /db_xref="GeneID:2895011"
     mRNA            <918014..>920224
                     /locus_tag="KLLA0_F09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455532.1"
                     /db_xref="GeneID:2895011"
     CDS             918014..920224
                     /locus_tag="KLLA0_F09933g"
                     /note="similar to uniprot|P13711 Saccharomyces cerevisiae
                     YGL205W POX1 Fatty-acyl coenzyme A oxidase involved in the
                     fatty acid beta-oxidation pathway localized to the
                     peroxisomal matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455532.1"
                     /db_xref="GeneID:2895011"
                     /db_xref="GOA:Q6CKK7"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR012258"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR029320"
                     /translation="MTRQSTVDQNQSTYNAKNFITKERQESKLDIDQLNVFLENGEQE
                     AKLTHDLIEEIINDPILKTDTDHYDITKSQEREITARRIARLSLYMEHDVKTKQREFK
                     DDLVKNLERKDSKLLTNKDLSIFDRRLSLVANIDPGLSTRIGVHLGLFGNCIKGNGTD
                     EQIHYWLQEKGALLLKGIYGCFAMTELGHGSNVAQLQTTATYDPSSDTFKINTPDLLA
                     TKWWIGGAAHSATHTTAYARLIVNGKDYGVKTFVVPLRDEKTLNLLPGIMIGDIGAKM
                     GRDGIDNGWIQFKNVVIPRQFMLQRFTKVIPGSPPKVQTQPLLDQISGYSALLSGRVN
                     MVMDSFRFGSKFAIIATRYAVGRQQFGPEGNETQLIDYPLHQYRVLPQLALCYLVAPT
                     AHKLMGTYISTLMELHQAGADKAKLINVSNKLKDLFIDSASLKATNTWLVAKLIDDLR
                     QTCGGHGYSSYNGFGKGYNDWVVQCTWEGDNNILSLTSAKSIVKKFADISRGKNTTVT
                     TDSLKYLTPQFIGKSLSKDLTFKFDNKKDFTEIWAVMIIRLIHHVVELISKGTKIDSL
                     SKTLVQISKFHAIHSMLLTYQDKLNNESEASVKDAYTKGYLWKLYELFSLYFIDQHLG
                     EFLLLKVVTSDQMSQVLQPRLLQLLPEIRKECIALTDAFKLPDAMINAPIGYYDGDIY
                     HNYFNEVTNNNKLEPDGAGRPPYYPLLTSMLGRDDFQNRLGGSFESETLDSLLK"
     gene            <920896..>921720
                     /locus_tag="KLLA0_F09955g"
                     /db_xref="GeneID:2895012"
     mRNA            <920896..>921720
                     /locus_tag="KLLA0_F09955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455533.1"
                     /db_xref="GeneID:2895012"
     CDS             920896..921720
                     /locus_tag="KLLA0_F09955g"
                     /note="similar to uniprot|P08456 Saccharomyces cerevisiae
                     YER026C CHO1 phosphatidylserine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455533.1"
                     /db_xref="GeneID:2895012"
                     /db_xref="GOA:Q6CKK6"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004533"
                     /db_xref="InterPro:IPR016271"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK6"
                     /translation="MSSRVPDLRNSMSSSQSKNSSGSALVSDAEDDSFVSRRTPSRRP
                     SSIFSLDTTPLEPPNEIDIKKFTSDDFHFSMIRNLHLADFITMLNGFSGFYSIVSCLR
                     FTLTGKPHYVQRAHFFIVLGMFFDFFDGRVARLRNRSSLMGQELDSLADLISFGVAPA
                     SIAFAIGFQSTLDVLFLSFFVLCGLARLARFNVTVAQVPKDTSGKSKFFEGLPIPTTL
                     FLVAVMAFCVHKGYITENIPFGIYGASEWYEFHPAVLAFFIQGCGMISKSLKIPKP"
     gene            <922726..>923340
                     /locus_tag="KLLA0_F09977g"
                     /db_xref="GeneID:2895013"
     mRNA            <922726..>923340
                     /locus_tag="KLLA0_F09977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455534.1"
                     /db_xref="GeneID:2895013"
     CDS             922726..923340
                     /locus_tag="KLLA0_F09977g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455534.1"
                     /db_xref="GeneID:2895013"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK5"
                     /translation="MTSFEHSATYDENETRKLEQRLGHHSSKIPRVALDCNVNNNLLD
                     DDPFFFYINDADELNYLKMLGVNVSPEKIEEILIEFRAQVLALDTINTLERQQNYLSA
                     EESLSALLYKEAQRPPLKTNSYKHLFKKILIFWRKHQYAMNTDISLVDSSVTSCSSSI
                     FPQRVQTIQHEGSFFSLTNSLISPNKRKKTWFIQGHLKKLFKLQ"
     gene            complement(<923413..>925341)
                     /locus_tag="KLLA0_F09999g"
                     /db_xref="GeneID:2895014"
     mRNA            complement(<923413..>925341)
                     /locus_tag="KLLA0_F09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455535.1"
                     /db_xref="GeneID:2895014"
     CDS             complement(923413..925341)
                     /locus_tag="KLLA0_F09999g"
                     /note="similar to uniprot|P09620 Saccharomyces cerevisiae
                     YGL203C KEX1 Protease involved in the processing of killer
                     toxin and alpha factor precursor cleaves Lys and Arg
                     residues from the C-terminus of peptides and proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455535.1"
                     /db_xref="GeneID:2895014"
                     /db_xref="GOA:Q6CKK4"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSLWLFFVQTVLLIQCALGGLPNAKDYLVAPDLLPGLNDVKDKE
                     LIPEMHAGHIPLDDGDDDDDDDEKNYFFWKFHDLANQTSVVASKTLIIWLNGGPGCSS
                     LDGALMESGALRIDDDGEAYLNPGSWHTRGDIVFVDQPAGTGFSTVGDSKYDKDLNQV
                     SKHFMKFLKNYFKIFPDDLDKDLVLAGESYAGQYIPFFANEILKFNSKLDKDDNEEES
                     RSGKKYNLKSLLIGNGWIDPDQQSLSYIPFALENNLISTKADYFPDLLNMHSRCQNLV
                     NNNGGKKFSFDECEDILTKILYYTRRKTDENGNKVPSNQECTNIYDFRLFDSYPACGS
                     NWPDDLPSVSKFLGKPGVMDSLHLDVDKVPHWRECDSKVSSHLKNKNTQPSIHLLPNL
                     LKHMQIFLFNGDKDIICNSRGVQDLIKNMKWNNHTGFTNDAEYYDWQYYDQFTDDTIS
                     AGFVKHESNLTYVSVYNASHMVPYDNALISRGIMDIYLKDVELVVGKDNQDDVIISKD
                     FVVHSDHSTGEEELSADQKQDEDENSHKDRHRNSDKFEIAVILLVVFSITGTIAYYFL
                     RERFRKQIHAILIDPENRPPSSNKSVAWADDIENQGDDFKLSIDEAPSTADKPAKNKS
                     GYTKVPNTDDDSFELDNL"
     gene            <926569..>928062
                     /locus_tag="KLLA0_F10021g"
                     /db_xref="GeneID:2895015"
     mRNA            <926569..>928062
                     /locus_tag="KLLA0_F10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455536.1"
                     /db_xref="GeneID:2895015"
     CDS             926569..928062
                     /locus_tag="KLLA0_F10021g"
                     /note="similar to uniprot|P53090 Saccharomyces cerevisiae
                     YGL202W ARO8 Aromatic aminotransferase expression is
                     regulated by general control of amino acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455536.1"
                     /db_xref="GeneID:2895015"
                     /db_xref="GOA:Q6CKK3"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK3"
                     /translation="MTQGVAKDFSHLYSDETKSRMPSQLKSIIHYFNDPNLIFLGGGL
                     PMSDYFPWDNLTVESPLPPFSNGIGAKPSGDDADTCQIHITKNLEESQKGVDIPLSRS
                     LQYGYSQGQPEITKFFKEHHSLIHDMKYENWDVLATIGNTGAWESVLRIFCNRGDTIL
                     AEQFAFSSSISAAEAQGVNVFPIPLDEHGIIPSKLETILDNWTEGAAKPKLLYTVPTG
                     QNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKE
                     FIQNLEKSFVSIDTEGRVLRLDSLSKVLAPGTRFGWIVGAKDILARILSLQEMTIQAP
                     AGFTQSIIAGTMNRWGQEGYLDWLIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPI
                     AGMFFTVNIDASKHPEFATKYGSDPEKVEKAIFDRSIASGVLVVPGNWFKSQGQTTPP
                     QPEASFKSEKPNEIFFRGTYAAVPLDKMTVGLHRFGDGLYEEFQLTK"
     gene            complement(<928691..>930277)
                     /locus_tag="KLLA0_F10043g"
                     /db_xref="GeneID:2895016"
     mRNA            complement(<928691..>930277)
                     /locus_tag="KLLA0_F10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455537.1"
                     /db_xref="GeneID:2895016"
     CDS             complement(928691..930277)
                     /locus_tag="KLLA0_F10043g"
                     /note="uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g
                     jen2 Carboxylic acid permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455537.1"
                     /db_xref="GeneID:2895016"
                     /db_xref="GOA:F2Z688"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:F2Z688"
                     /translation="MAAESIVSRDESIASLEKAEGRITYLKPQSRITWSDAKKYLATR
                     IPTLFPTKASIREARKEYPINPFPALRSMNWLQTQYFIVGFLAWTWDALDFFAVSLNM
                     TNLAKDLDRPVKDISHAITLVLLLRVIGALIFGYLGDRYGRKYSFVLTMALIIVIQIG
                     TGFVNSFSAFLGCRAIFGIIMGSVFGVASATALENAPNKAKSILSGIFQEGYAFGYLL
                     GVVFQRAIVDNSPHGWRAIFWFSAGPPVLFIAWRLMLPESQHYVERVRLEKLENDGKS
                     QFWKNAKLACSQYWLSMIYLVLLMAGFNFSSHGSQDLFPTMLTSQYQFSADASTVTNS
                     VANLGAIAGGIIVAHASSFFGRRFSIIVCCIGGGAMLYPWGFVANKSGINASVFFLQF
                     FVQGAWGIVPIHLTELAPTEFRALITGVAYQLGNMISSASSTIEASIGERFPLEGRED
                     AYDYGKVMCIFMGCVFAYLLIVTVLGPENKGGELRLSTTGTEQDDEESQNNISFEEIV
                     AAGPVSDLNFKQEIQHKERV"
     gene            complement(<931989..>934694)
                     /locus_tag="KLLA0_F10065g"
                     /db_xref="GeneID:2895017"
     mRNA            complement(<931989..>934694)
                     /locus_tag="KLLA0_F10065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455538.1"
                     /db_xref="GeneID:2895017"
     CDS             complement(931989..934694)
                     /locus_tag="KLLA0_F10065g"
                     /note="highly similar to uniprot|P06738 Saccharomyces
                     cerevisiae YPR160W GPH1 Non-essential glycogen
                     phosphorylase required for the mobilization of glycogen
                     activity is regulated by cyclic AMP-mediated
                     phosphorylation expression is regulated by stress-response
                     elements and by the HOG MAP kinase pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455538.1"
                     /db_xref="GeneID:2895017"
                     /db_xref="GOA:Q6CKK1"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK1"
                     /translation="MGSGTARRPSLSTSTSNDMMVDEPHGVPRLSRRLTGFLPQEIKS
                     INTMIPLQSREIWKKHGVKKFETPDEFQSKFIQHVETTLARSLYNCDDLAAYQATSQS
                     VRDNLVIDWNKSQQRQTARGSKRVYYLSLEFLMGRALDNALINSQDGSEESGVEKREK
                     IKGAIDELGFKLEDLLEQEPDAALGNGGLGRLAACFIDSMATGDYPAWGYGLRYQYGI
                     FAQKIIDGYQVETPDYWLNFANPWEIERSEIQVPINFYGYVDRSDNNGDGSTLCASKW
                     IGGERVIAVPYDMPIPGFKTENVNNLRMWTARPTTEFDFAKFNSGDYKNSVEQQQRAE
                     SITAVLYPNDNFQEGKELRLKQQYFWCAASLHDIVRRFKKAKHSWEDFPNQVAIQLND
                     THPTLAIVELQRILVDLEHLDWHKAWDIVTKTFAYTNHTVMQEALEKWPIGLFGHLLP
                     RHLEIIYDINWFFLKHVESKFPRDVDLLSRVSIIEEASQERQIRMAFLAIVGSHKVNG
                     VAELHSELIKTTIFQDFVKIYGPGKFTNVTNGITPRRWLKQANPKLGELISKAIGDPQ
                     DDYLLNMSKLTELAKFAEDEDFQSQWNDVKQFNKQRLADLIEKLYDGEDVIQRDNIRN
                     TLFDIQVKRIHEYKRQQMNIFGCIYRYLSIKKLLSQGVPISEVEKKYPRKVSIFGGKS
                     APGYYMAKLIIKLINSVSDVVNHDKEINNIFKVVFIPDYNVSKAEIIIPASDLSEHIS
                     TAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLAENVEELRYQH
                     QYHGEPLPQELEEVFQVIEQGTFDGDFKPLVESIRHHGDYYLVSDDFKSYLQTQSLVD
                     EVYHKNKKEWLKKSILSVANVGFFSSDRCIQEYADEIWNVEPLTN"
     gene            complement(<935618..>938629)
                     /locus_tag="KLLA0_F10087g"
                     /db_xref="GeneID:2895018"
     mRNA            complement(<935618..>938629)
                     /locus_tag="KLLA0_F10087g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455539.1"
                     /db_xref="GeneID:2895018"
     CDS             complement(935618..938629)
                     /locus_tag="KLLA0_F10087g"
                     /note="similar to uniprot|P53091 Saccharomyces cerevisiae
                     YGL201C MCM6 Protein involved in DNA replication component
                     of the Mcm2-7 hexameric complex that binds chromatin as a
                     part of the pre-replicative complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455539.1"
                     /db_xref="GeneID:2895018"
                     /db_xref="GOA:Q6CKK0"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6CKK0"
                     /translation="MSAPSSPFQHGQQSSQPPSSVGAYDSSQFDDQSLGNRTPQFPSS
                     SRGVSDGNRHFGTDDTRQGINSESQIEAMENDSQEITPLAGIRQKNLNAIKKVDDKTG
                     ETVREAFEHFLSNFTALNDETGEMEKVYRVQIEYMRWYELNTIYVDYKHLAEVEDGAL
                     AVAILQQYYRFLPFLLSGLRNVVKKYAPGLLLTSDSVLPSQSQENSQDRSSQRIDSSL
                     PTSQAATAGGTAPSTIATNPDQVERVLQISFLNLPTVHRIRDIRANKIGSLMAISGTV
                     TRTSEIRPELYKASFTCELCRAVIDNVEQVFKYTEPTSCPNPTCENQSFWSLNVNRSK
                     FLDWQKVRIQENSNEIPSGSMPRTLDIILRGDCVERAKPGDRCKFIGTEIVVPDVSQL
                     GLPGVKASSTPDSRGISRTTEGLNSGISGLKSLGVRDLTYKISFLACHVENVGTSFNG
                     SRINEEDADKTSKFDYINLRNYQNYEMAAETDQEIFLTRLDSDEINELKEMVKDENIY
                     DKLVKSIAPAVFGHETIKKGILLQMLSGVHKTTVEGIKLRGDINICIVGDPSTSKSQF
                     LKYVCNFSPRAVYTSGKASSAAGLTAAVVKDEEGGDFTIEAGALMLADNGVCCIDEFD
                     KMDIADQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLTLRSNLN
                     MSAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDSAINPPFSAEQLSRYINYA
                     KTFKPVMTKEARDYLVKRYTELRKDDAQGYSKSSYRITVRQLESLIRLSEAIARANCV
                     DEIVPSFVAEAYDLLRQSIIRVDVDDVEIEDDDNSPEESTEGEGTIPATQHFGETLDT
                     QSQSPSQPLNADSETGGGPDVESHDNAHHTTHKVAISYDKYVEMMNLIVRKVVDREKN
                     EEPEMTKTEIVDWYLQQKENDINTEAEYWQERKLAFKVIKRLVKDRVLMQIHGQNDDL
                     SADVESSNAKTVYVIHPNCSVLDEITPNPPQ"
     gene            complement(<939195..>941066)
                     /locus_tag="KLLA0_F10109g"
                     /db_xref="GeneID:2895880"
     mRNA            complement(<939195..>941066)
                     /locus_tag="KLLA0_F10109g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455540.1"
                     /db_xref="GeneID:2895880"
     CDS             complement(939195..941066)
                     /locus_tag="KLLA0_F10109g"
                     /note="weakly similar to uniprot|Q00947 Saccharomyces
                     cerevisiae YDR463W STP1 Transcription factor activated by
                     proteolytic processing in response to signals from the SPS
                     sensor system for external amino acids activates
                     transcription of amino acid permease genes and may have a
                     role in tRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455540.1"
                     /db_xref="GeneID:2895880"
                     /db_xref="GOA:Q6CKJ9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ9"
                     /translation="MPSVQLLDTDKSILKRLSWRLTNWFNAIASHVVGVSLDCKTLQD
                     DSSMDVRNKGNKSDFETEDEDEGEDGKLNENGKNSQEDTDNRRISLFPSSHNVDRQLE
                     YNASVIPCSLNINGLQSPMSVARTPEGQMEWKMTIDTDPVTSKRAFAQNTSPKVNEDR
                     ETKTTQDITPKTDATPETGETSANDDSKTSLNDHVDVIKSEDSSVGSTPEVSSGIVPV
                     SSTDSESQVPTDKSDEKKETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWD
                     ASLPSEKRCHSTGGFSRRDSYKTHLRSRHFIYPDNVKNVDRVNSHGHCGRCKKHFDST
                     NEWIEHHIENRECEAILPTFKGNLKKSKKCGKLKMIMTSDGQSRFISNQATISEAKVP
                     ISNFMPENRKKLSSEYSKPASASPPIKQTISDLALDNTFALASIPLNYNGNINGNINE
                     HNDNQNYGHFENQVYGNGVPSLAPSNSVPFTGQPQLIPHSGSQNTATHLRKCTQPFDE
                     FSSLNKSPVEDAALDTVRSISSQSSHEHTVLHKEMNFISTDQKSQINPDWEVLPLDIE
                     QAGMSMEEEVKFTNNSNEPKINTTLQRQMNEYALGERHFRETQQFMNFFNYTYNYQE"
     gene            complement(<942082..>943392)
                     /locus_tag="KLLA0_F10131g"
                     /db_xref="GeneID:2895881"
     mRNA            complement(<942082..>943392)
                     /locus_tag="KLLA0_F10131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455541.1"
                     /db_xref="GeneID:2895881"
     CDS             complement(942082..943392)
                     /locus_tag="KLLA0_F10131g"
                     /note="similar to uniprot|Q03697 Saccharomyces cerevisiae
                     YML038C YMD8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455541.1"
                     /db_xref="GeneID:2895881"
                     /db_xref="GOA:Q6CKJ8"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ8"
                     /translation="MKMDRDTVRIFTLIMGMYIAAILLTMYNKWMFDPNRSLHIPYPL
                     LVTGLHQTQLWGMAYLYLRWKGQLTPENLNKGDWKYYAKYIIPTAIATAGDIGLGNIS
                     FKYVPFTVYTIVKSSTIAFVLFFGCLFKVEVPSWRLFIIVTLMFCGVVMMGLKPINSD
                     SSQTHGEIQETFGVILVVISCALGGFRWVYVQVILNHKKNTIVLSPNDGDELMAADKP
                     ATKKNPVITLYQLALPMTILLFSTSFIVERPIPDVLHSELMTWEGHSKLAALLRGLAL
                     LTLPSCLVFILTMCEFGILQLAPVLTLSVTGIIKELFTVFLGMLVFNERLGFYNWLGM
                     IVVLIDVCYYNYYRYMQRKRLQEVQQDYQLVETDEPPCTSTHDGDIWSNLQDNISGDS
                     ATVWELGSLNSRKSIESNLPELTSGTITEPTKNKSDDTVMGNSK"
     gene            <943788..>944348
                     /locus_tag="KLLA0_F10153g"
                     /db_xref="GeneID:2895882"
     mRNA            <943788..>944348
                     /locus_tag="KLLA0_F10153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455542.1"
                     /db_xref="GeneID:2895882"
     CDS             943788..944348
                     /locus_tag="KLLA0_F10153g"
                     /note="similar to uniprot|P25654 Saccharomyces cerevisiae
                     YCR090C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455542.1"
                     /db_xref="GeneID:2895882"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ7"
                     /translation="MLFLTSCATLSENIRRIFPKDTEQSPAEYTFKLVCTSCREEHDS
                     PIRINRFESHDMPGSKGNASFVMKCKFCGNECSINLTRTKEDLYNLDEESNFELIEQG
                     KKDRKKVGLRSVPVEKAVWLELDCRGCEVTKFEPADTIFVAELVSKKEMEFQFEDDEN
                     EWYDYDDDAGEEVSVVDMNFEIVKGK"
     gene            complement(<944501..>946231)
                     /locus_tag="KLLA0_F10175g"
                     /db_xref="GeneID:2895883"
     mRNA            complement(<944501..>946231)
                     /locus_tag="KLLA0_F10175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455543.1"
                     /db_xref="GeneID:2895883"
     CDS             complement(944501..946231)
                     /locus_tag="KLLA0_F10175g"
                     /note="similar to uniprot|P15891 Saccharomyces cerevisiae
                     YCR088W ABP1 Actin-binding protein of the cortical actin
                     cytoskeleton important for activation of the Arp2/3
                     complex that plays a key role actin in cytoskeleton
                     organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455543.1"
                     /db_xref="GeneID:2895883"
                     /db_xref="GOA:Q6CKJ6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ6"
                     /translation="MAFEPIDTTTHSRAIEAEYLKVVKGDPDTTWLIISPNSKKQYEP
                     ELVGTSFSEFLQSFDDTKVQYGLARVSPPGSDVQKLILIGWCPDSAPLKTRASFAQNF
                     GVISNQVFKTYHVQVTARDEDDLDESELLMKISNSAGARYSIQQQTPASKKPISSAAK
                     TAKKPVSVSSRQSEQKEPTPSFPSRRSVSPPKTEKSRGKKDDEWGEPELEERDFDKKP
                     LEPNSSSWKPIGKVDLQKVIAEENSKEDPRLVVSGPNYDKKIDPQSEIAKLKQESKLK
                     RDAEYNKVLGPKSSSSAQSSGNDSDDKVIKGFKNEKSPAQLWAEKKGQKKPSNLENKT
                     QREEFSDSNEEEEAEEEIEEVRSKFESIKTKEIPIIKPSDSSRSRPQASKINSSDSWT
                     KKQNKFGQPLPGLHDQKKEQNDDWSSDEEEQEEEEETPAPSLPVRRNVPPPPESDEEE
                     EEEQEEEEEEEEEEEEEAPSLPTRRNVPPPPESDEDEEDDDERAFSKSQNTPPSPAPR
                     ASKPGKKESGPSAIAEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGL
                     FPSNYVNLEE"
     gene            <946952..>947194
                     /locus_tag="KLLA0_F10198g"
                     /db_xref="GeneID:9487425"
     mRNA            <946952..>947194
                     /locus_tag="KLLA0_F10198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999383.1"
                     /db_xref="GeneID:9487425"
     CDS             946952..947194
                     /locus_tag="KLLA0_F10198g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999429.1"
                     /db_xref="GeneID:9487425"
                     /db_xref="UniProtKB/TrEMBL:B5FVA0"
                     /translation="MHVRKLCHRNSEKGTGRQAPKSIISIPAGLYSLTHYLKNRPSSR
                     LYKKLSNPRTRFRSSKYHIWSKYDLIQAFIDLWAYM"
     gene            <948000..>948467
                     /locus_tag="KLLA0_F10219g"
                     /db_xref="GeneID:2895885"
     mRNA            <948000..>948467
                     /locus_tag="KLLA0_F10219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455545.1"
                     /db_xref="GeneID:2895885"
     CDS             948000..948467
                     /locus_tag="KLLA0_F10219g"
                     /note="similar to uniprot|P37263 Saccharomyces cerevisiae
                     YCR087C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455545.1"
                     /db_xref="GeneID:2895885"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ4"
                     /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPQAYYTCIDCNQTFDDGIS
                     YKKHIQCITEDEKYQKGLYKGKKNGNQNDQNGKQPNAQVKKEVKVEKKEEKPVKKESK
                     PEKKDKKDKKDKKSSLIKGESLYKILKSINNKDDKKELLKRLIVTAENKIELQ"
     gene            complement(<948591..>949121)
                     /locus_tag="KLLA0_F10241g"
                     /db_xref="GeneID:2895886"
     mRNA            complement(<948591..>949121)
                     /locus_tag="KLLA0_F10241g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455546.1"
                     /db_xref="GeneID:2895886"
     CDS             complement(948591..949121)
                     /locus_tag="KLLA0_F10241g"
                     /note="similar to uniprot|P25651 Saccharomyces cerevisiae
                     YCR086W CSM1 Protein that forms a complex with Lrs4p
                     located in the nucleolus Lrs4p-Csm1p heterodimer binds to
                     Mam1p at kinetochores during meiosis I to mediate accurate
                     chromosome segregation may be involved in premeiotic DNA
                     replication"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455546.1"
                     /db_xref="GeneID:2895886"
                     /db_xref="InterPro:IPR020981"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ3"
                     /translation="MDPLAEYKESVQDRLEKADLAVQGVLNENVKLMRQLELKQQEIE
                     SLKEQLQSDKTKISQLEDSKADAEEQSEIMKDLFEQLCGVRIHKTYEDDLGLWFDTSQ
                     GNKNGIMDYKLGFVKGKDDETEIVYVPLLKQRSVQELKQLQDQLPEYMFETLSFPLKS
                     LNQFYNKLSKGLSKSV"
     gene            <949926..>951974
                     /locus_tag="KLLA0_F10263g"
                     /db_xref="GeneID:2895005"
     mRNA            <949926..>951974
                     /locus_tag="KLLA0_F10263g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455547.1"
                     /db_xref="GeneID:2895005"
     CDS             949926..951974
                     /locus_tag="KLLA0_F10263g"
                     /note="uniprot|P56094 Kluyveromyces lactis KLLA0F10263g
                     TUP1 Transcriptional repressor TUP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455547.1"
                     /db_xref="GeneID:2895005"
                     /db_xref="GOA:P56094"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MSSVAASQNKINDLLEAIRQEFANVSQEANSYRLQNQKDYDFKI
                     NQQLAEMQQVRNTVYELELTHRKMKDAYEEEISRLKLELEQKDRQLASIAHGSTVGNV
                     PGQVPQLSRNSGAQGNANIAPPNIPQPMVSQTVGTGMAPQMAPLNTQHPTQQTKSNAG
                     EQAAANLAPVIQQQQQPQQQLPPQQQQQQQQQQQSNIPVTTAAPVQPAGGNLDQTVPN
                     SISPQQQPTEQQQPASTATTAPATASTAPPTSAPSDQVGQDHYLVPADQRAVHAKPIP
                     PFLLDLDSQLVPSHLKKQNNDYYVLHNPALPTDLDVELHKSLEHSSVVCCVRFSSDGE
                     FLATGCNKTTQVYKVSTGELVARLSDDSASQPQPQPQNQTVTAETSTSNSNGSSAEDG
                     TGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQD
                     IYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAG
                     SLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLW
                     NLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLL
                     MLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKKNSQQNSTQIKEIKE
                     "
     gene            complement(<952632..>953825)
                     /locus_tag="KLLA0_F10285g"
                     /db_xref="GeneID:2895887"
     mRNA            complement(<952632..>953825)
                     /locus_tag="KLLA0_F10285g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455548.1"
                     /db_xref="GeneID:2895887"
     CDS             complement(952632..953825)
                     /locus_tag="KLLA0_F10285g"
                     /note="similar to uniprot|P32377 Saccharomyces cerevisiae
                     YNR043W MVD1 Mevalonate pyrophosphate decarboxylase
                     essential enzyme involved in the biosynthesis of
                     isoprenoids and sterols including ergosterol acts as a
                     homodimer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455548.1"
                     /db_xref="GeneID:2895887"
                     /db_xref="GOA:Q6CKJ1"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ1"
                     /translation="MSIYSASTTAPVNIATLKYWGKRDKVLNLPTNSSISVTLSQEDL
                     RTLTTATTSPDFAKDQLWLNGKEESLASERTQHCLQDLRQLRRELEEKDSSLPTFSQW
                     KLHIASENNFPTAAGLASSAAGFAALIKAIAKLYELPQSESELSKIARKGSGSACRSL
                     FGGYVAWEMGKLEDGSDSKAVEIGSLNHWPEMKAAILVVSADKKDTPSTSGMQLTVKT
                     SDLFQERINNVVPKRFEQMKKSILEKDFPTFAELTMKDSNSFHATCLDSYPPIFYLND
                     TSKKVIKLCHAINEFYNETVVAYTFDAGPNAVLYYLEQSEDKLFAFLYHLFQNVSGWE
                     SKFTKEQLSQFNAKFDEIKDDVSFYLDSELHQGVTRVILTRVGPGPQDTDLSLIDSAT
                     GLPSN"
     gene            <954558..>955673
                     /locus_tag="KLLA0_F10307g"
                     /db_xref="GeneID:2895888"
     mRNA            <954558..>955673
                     /locus_tag="KLLA0_F10307g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455549.1"
                     /db_xref="GeneID:2895888"
     CDS             954558..955673
                     /locus_tag="KLLA0_F10307g"
                     /note="similar to uniprot|P32378 Saccharomyces cerevisiae
                     YNR041C COQ2 Para hydroxybenzoate: polyprenyl transferase
                     catalyzes the second step in ubiquinone (coenzyme Q)
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455549.1"
                     /db_xref="GeneID:2895888"
                     /db_xref="GOA:Q6CKJ0"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="UniProtKB/TrEMBL:Q6CKJ0"
                     /translation="MLYLNGLVRNGINIGVKRGTAVALLAAKYRSPIFAATRYQSNKV
                     EDKLAGVFTEEQLKEARETRLKGLGPYVSKLPTKLIPYAELMRLEKPVGTWLLYIPCT
                     WAITMAAMETAAPLGSTLWMLALFGVGALIMRGAGCTINDLLDRNLDNKVIRSVERPI
                     ASGRVSPGKAVVFLGAQTAIGMGILAQLPADCWYLGLASLPIVFTYPLFKRFTYYPQA
                     ALSACFNWGSLLGFPAMGLMDWSTMIPLYVSTYIWCMIYDTIYAHQDKKFDIKAGIKS
                     TALAWGKNTKKICTALGTVQIGTLALAGLNSGLLLGPGFLCGLGIFTYRLFDMIRRVD
                     LNDPADCWKWFQSNINTGIIFSGALFFDYILKLLGWM"
     gene            complement(<955834..>956634)
                     /locus_tag="KLLA0_F10329g"
                     /db_xref="GeneID:2895889"
     mRNA            complement(<955834..>956634)
                     /locus_tag="KLLA0_F10329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455550.1"
                     /db_xref="GeneID:2895889"
     CDS             complement(955834..956634)
                     /locus_tag="KLLA0_F10329g"
                     /note="similar to uniprot|Q751D6 Ashbya gossypii AGL230C
                     AGL230Cp and weakly similar to YNR040W uniprot|P53736
                     Saccharomyces cerevisiae YNR040W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455550.1"
                     /db_xref="GeneID:2895889"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI9"
                     /translation="MSIPFSTKMAALLAKAAPEQIYSYKPGKLITFGAYSLSFTFILY
                     GASFADWSLTTSSGLYKEESEEPKKDLKWYENANVAFLGRSAGSVLLSVIPFTLAAVA
                     LYIPTRIVTKMHYIPDKIPKCKVTTRTLFNGEKSKTIPLRNLRRHEKSRVFTGIGEQG
                     VEDRGSFSFSLMDKGAPFFDKVYIVNRSGKFWGSDGRFMDALFGGESITQLELKDFKT
                     EKNEYTKNEQKLEKIIQQQIARPRLNTNADIKNIVLNSKSKHHQDGKK"
     gene            complement(<956981..>957400)
                     /locus_tag="KLLA0_F10351g"
                     /db_xref="GeneID:2895890"
     mRNA            complement(<956981..>957400)
                     /locus_tag="KLLA0_F10351g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455551.1"
                     /db_xref="GeneID:2895890"
     CDS             complement(956981..957400)
                     /locus_tag="KLLA0_F10351g"
                     /note="similar to uniprot|P25372 Saccharomyces cerevisiae
                     YCR083W TRX3 mitochondrial thioredoxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455551.1"
                     /db_xref="GeneID:2895890"
                     /db_xref="GOA:Q6CKI8"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI8"
                     /translation="MISRTALRTATASRATFVRPLAFSQVRFQSTAGGNTIKHLTNLH
                     EFEVAMKADNLSLVDFFATWCGPCKAVAPHVQKLSEKYNNVKFYKVDVDESPDIAGAL
                     GISSMPTFVLFKNGKGLGKVVGADPRGVEEAIKHFNK"
     gene            <957948..>958994
                     /locus_tag="KLLA0_F10373g"
                     /db_xref="GeneID:2895891"
     mRNA            <957948..>958994
                     /locus_tag="KLLA0_F10373g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455552.1"
                     /db_xref="GeneID:2895891"
     CDS             957948..958994
                     /locus_tag="KLLA0_F10373g"
                     /note="some similarities with uniprot|P38141 Saccharomyces
                     cerevisiae YBR240C THI2 Zinc finger protein of the
                     Zn(II)2Cys6 type probable transcriptional activator of
                     thiamine biosynthetic genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455552.1"
                     /db_xref="GeneID:2895891"
                     /db_xref="GOA:Q6CKI7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI7"
                     /translation="MSKDRNFTGCWACRFKKRKCDERKPICSLCLKHGVECCYDVRLS
                     WLPENMYVVKDNELGVISGNSNRRMSKEKFKELTNLKYDSPISESASFTISARRFKVY
                     DNSRKCVHEDNRGADVYDSKHVDEKLSIFLDGLEESEEFQSGPFTKFKIQQQVSVRKC
                     DPAQILKSLWHDHSYQLSNNWCLTEPEYLQNFQQDLQKVLLRCDFPINVINTNFDADH
                     WSRLVPKLPKRHQSVVMFFLYAQNVKGYQQILLNWVYIKTTISSLDFPLLVQLCQCQS
                     SNRSTLIYLRNLIAHYKPSSRNNENISKLIKMEIEQYITAIDLSTLPTPILDAFSNSI
                     EWDNNDNYMKLQVM"
     gene            complement(<959120..>960238)
                     /locus_tag="KLLA0_F10395g"
                     /db_xref="GeneID:2895892"
     mRNA            complement(<959120..>960238)
                     /locus_tag="KLLA0_F10395g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455553.1"
                     /db_xref="GeneID:2895892"
     CDS             complement(959120..960238)
                     /locus_tag="KLLA0_F10395g"
                     /note="similar to uniprot|P46672 Saccharomyces cerevisiae
                     YGL105W ARC1 Protein that binds tRNA and methionyl- and
                     glutamyl-tRNA synthetases (Mes1p and Gus1p) delivering
                     tRNA to them stimulating catalysis and ensuring their
                     localization to the cytoplasm also binds quadruplex
                     nucleic acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455553.1"
                     /db_xref="GeneID:2895892"
                     /db_xref="GOA:Q6CKI6"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI6"
                     /translation="MSCDLLNKFEALSISAPSLTQEQKALEAQWDSVAKSGNIQGSFE
                     ELNLHLRDHTFVLGTAQPTVSDVTLFEHVLPVAKELINSSKDVKGNYAKYRHILRWSQ
                     YLNDLLQLNDLTLNIDLDLPREVIEKKKKEDKKDEAEASKKGGEAAAKKDGKADKQPR
                     GKPDEETLKKLREEAKAKKAAKKAANAQQAQAPAQESAKPSPGVIDFRVGFIQKAIKH
                     PDADSLYVSTIDVGDEEGPRTVCSGLVKYFPLEAMQERYVVVVCNLKPVNMRGIKSTA
                     MVLCGSDENNVEFVEPPAGSKAGDKVFFEGFGDEEPIKQLNPKKKIWEQLQPHFSTNE
                     QLEVIFKDEDDKAQQIRKLTNKNGDAFKVASIANACVR"
     gene            <961004..>962527
                     /locus_tag="KLLA0_F10417g"
                     /db_xref="GeneID:2895893"
     mRNA            <961004..>962527
                     /locus_tag="KLLA0_F10417g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455554.1"
                     /db_xref="GeneID:2895893"
     CDS             961004..962527
                     /locus_tag="KLLA0_F10417g"
                     /note="similar to uniprot|P38140 Saccharomyces cerevisiae
                     YBR239C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455554.1"
                     /db_xref="GeneID:2895893"
                     /db_xref="GOA:Q6CKI5"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR013767"
                     /translation="MSVKRNKKVSVACVHCAKSHVTCDDNRPCTRCIRKGLEESCIDA
                     PRKKVKYLRDVPEDQLPSVLRSTKQVPPVNAVKLKMEPGILPNIPLDYDGGTIRQSAP
                     ANNGKNNPETQQTLSNGQITHRPKFLSSAADLEYSILSDIIHGDSLFNKIPVNFLYSN
                     PTEKTPSPINQGSLNGQQDLHFSLQLRSKPMNQIRGNTRAIYSNLLGPVSHEILQSEF
                     NLYTNHFPLQPQESLDGTLDFKRMTIGTLSPHLTKFDKTINQYYLNFANTFPEIYDSR
                     KIPNLSYALEVEPPEYREIPHDTEIPHTLRFTTPSEIYSLVQTAFPSTTGFHALLRYL
                     KRRFDKNQLVEMCRCLAELRPIFIASTIDLTDEDMIFMEKSHQRTLLEYEKFISQVGT
                     PTCVWRRNGQISYVNDEFSLLTGWNRLELLNKMTFIVELMDGDTVMEYFQTFTRVAYQ
                     GFRGAETMRICNLLTPIKGSVIKCCCLWTLKRDAFGLPMMIIGNFMPILTLPEDVGF"
     gene            complement(<962683..>963111)
                     /locus_tag="KLLA0_F10439g"
                     /db_xref="GeneID:2895722"
     mRNA            complement(<962683..>963111)
                     /locus_tag="KLLA0_F10439g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455555.1"
                     /db_xref="GeneID:2895722"
     CDS             complement(962683..963111)
                     /locus_tag="KLLA0_F10439g"
                     /note="highly similar to uniprot|P53141 Saccharomyces
                     cerevisiae YGL106W MLC1 Essential light chain for myosin
                     Myo2p may stabilize Myo2p by binding to the neck region
                     may interact with Myo1p Iqg1p and Myo2p to coordinate
                     formation and contraction of the actomyosin ring with
                     targeted membrane deposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455555.1"
                     /db_xref="GeneID:2895722"
                     /db_xref="GOA:Q6CKI4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI4"
                     /translation="MSRINKDIFTLFDKQAKGSISKAQVGDYLRAIGYNPTNALVEEV
                     VASSGDELTLGDLEKLVKDNEEKLEQTTQGKVEDFIKAFQVFDKDNTGKVSPGDIRYL
                     LTGLGERLTDEEVDELMKGIEIDSDGLIDYKKFVEDVLRQ"
     gene            <964030..>966024
                     /locus_tag="KLLA0_F10461g"
                     /db_xref="GeneID:2895723"
     mRNA            <964030..>966024
                     /locus_tag="KLLA0_F10461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455556.1"
                     /db_xref="GeneID:2895723"
     CDS             964030..966024
                     /locus_tag="KLLA0_F10461g"
                     /note="similar to uniprot|P38330 Saccharomyces cerevisiae
                     YBR238C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455556.1"
                     /db_xref="GeneID:2895723"
                     /db_xref="GOA:Q6CKI3"
                     /translation="MFRLVQQQTLKSRVPNQFVSASRNSLNSQFRFNSAVALERNPQQ
                     DPTTAAPAKSSSDKRNSKKKYENNEIIERNVKKVRNLRRNIKFDNFKNSPNSPAFSKL
                     NALDDCLARGLEASSSRAPDGKFLDQSSLFWDSVSSSMNIYRELVITGDLNNHRASRV
                     IQLMHVALKVNRTQLTSMNKKPDYDSQSFHKEMTNYLCESLREISGDILANRVSVSEH
                     GAAHLLSSFKELLLYEETLNIWKAAVNSENKDIVKSFMFPNVVGVVLPLLYENGTTFE
                     EIKKLYEKSASNTTRSHGSPSLVLGMIKTSLAANENEHALSLFQEMCTSEGFGVSPYA
                     VLTGTHLAFIGECKDLYVAKSFFERALSKDMPYKINLQVSSVKQLIQNIWDQTHDFNE
                     VVDVWTKATKYYGKDVSHGISSSLNSKFISIFFENYVTDKAAGLQHLQELVTAYDEMK
                     AIDEPFLNIILTKCTVWQDRNIIESIEKSYELYHIPKTIVTYRIILKAMGSISVPNDV
                     IREKWVQLIQKADQIGQTYIANADWAALRDATVTYTQEQFKNGGSYEMTTSDSYNPAL
                     EAANASGAFDDFNEPTSGTKHADHLNTQTNKEDNDRILLYYQLVKRYGVYCRDPKQYA
                     RITSGIALNFEVAQPYLGLVNTMDVSSIYVPPLRNFHLNH"
     gene            <966417..>966701
                     /locus_tag="KLLA0_F10483g"
                     /db_xref="GeneID:2895724"
     mRNA            <966417..>966701
                     /locus_tag="KLLA0_F10483g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455557.1"
                     /db_xref="GeneID:2895724"
     CDS             966417..966701
                     /locus_tag="KLLA0_F10483g"
                     /note="similar to uniprot|P53139 Saccharomyces cerevisiae
                     YGL108C Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455557.1"
                     /db_xref="GeneID:2895724"
                     /db_xref="UniProtKB/TrEMBL:Q6CKI2"
                     /translation="MGLCGSKPSKGVPLAADSSAPKSNNKTTSKKSTGRPIDVTQSHH
                     TLSPREAARVAAEQRNAKLEAANAKSELSQKLAHERAKSRKTHVMEIAQK"
     gene            complement(<966736..>969174)
                     /locus_tag="KLLA0_F10505g"
                     /db_xref="GeneID:2895725"
     mRNA            complement(<966736..>969174)
                     /locus_tag="KLLA0_F10505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455558.1"
                     /db_xref="GeneID:2895725"
     CDS             complement(966736..969174)
                     /locus_tag="KLLA0_F10505g"
                     /note="similar to uniprot|Q754U8 Ashbya gossypii AFL027C
                     PRP5 Pre-mRNA-processing ATP-dependent RNA helicase PRP5
                     and weakly similar to YBR237W uniprot|P21372 Saccharomyces
                     cerevisiae PRP5 RNA helicase in the DEAD-box family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455558.1"
                     /db_xref="GeneID:2895725"
                     /db_xref="GOA:Q6CKI1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MDQTEKLRIRQEKLAKWKKQKLNNDVTASVSVDAKEERLKKLEA
                     WKKKKKQQDELKQKDIKLTSIKSADRDRNKRRGQCSRKRPAFGGSDSESDDENSTSTL
                     FKPRRNDTNTHVLTKDNSKDDLDDGNDALDEYIHKLIDKDSNTNRVRLIDNISEDEDA
                     NDSSSEKTISQEEAPVDSEILFKKKGRKKIKAIDYSKVLNLITLNKCLYREPNDLGLM
                     SEKDVEELRLSLDNIKISGKDCPKPVTKWSQLGLSSEIMDLISNELQFVTLTPIQCQA
                     IPAIMSGRDVIGISKTGSGKTVAFLLPLVRQIKAQPPLAPDETGPIGLILTPTRELAV
                     QIQEEALKFCKGSGISSICCVGGSELKQQINELKRGVDIIVATPGRFIDLMTLNSGHL
                     LSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIRPDKQCVLFSATFPSKLKHFASRTL
                     KNPIQITINSKSLINENIQQRVQIFDEEHVKFEFLLKRLSDRLALHRGEDEKTIIFVG
                     SQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEVLSRGLNV
                     PEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFVMVDELASAYILVKCMKENEL
                     SSVPMVVYQKLKEMNDEFSSGLKTGKYRLIQGFGGKGLDHLDELNEAKQSQEYTDYGV
                     VENEEDVTEEESGATKMEYTRGKREEGHSTTYFAHININDLPQLARWEATKTETVSNI
                     KQETGCNFESKGSFYPEGKGPKNDTDDPKLYLIVEGAEESDVTMALELLNTKVKEGIR
                     KAAVKDIQSGKYRM"
     gene            <969804..>971084
                     /locus_tag="KLLA0_F10527g"
                     /db_xref="GeneID:2895726"
     mRNA            <969804..>971084
                     /locus_tag="KLLA0_F10527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455559.1"
                     /db_xref="GeneID:2895726"
     CDS             969804..971084
                     /locus_tag="KLLA0_F10527g"
                     /note="similar to uniprot|P32783 Saccharomyces cerevisiae
                     YBR236C ABD1 Methyltransferase catalyzes the transfer of a
                     methyl group from S-adenosylmethionine to the GpppN
                     terminus of capped mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455559.1"
                     /db_xref="GeneID:2895726"
                     /db_xref="GOA:Q6CKI0"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR016899"
                     /db_xref="InterPro:IPR029063"
                     /translation="MVLLPEKPVWMSQQQYEEQYGSLLKLKESEKCNHEDKQLALQPK
                     ESSIGYSTQERIAKLSVPEVQDDDKNSKVRNRKHQRFDLEEKKKKLRLQKTIEEQIKH
                     HDIEMTANRVVNVDHVVRQHYNERTFLSKKHNRNYSPIIKLRNFNNAIKYILIDKFTR
                     AGDVVLELACGKGGDLRKYGAAGISQFIGIDISNASITEALKRYHSMKNLEYQVILIT
                     GDCFGESLGVAVESFPECRFPCDIVSCQFALHYAFETEEKARRMLLNVVKSLKIGGYF
                     FGTIPDSEFIRYKMNKIPESVEKPSWGNSIYKVTFSNNEYQKNGNEFPSPFGQMYTFW
                     LEDAIDNVPEYVIPFESFRSLADEYGMELELQKGFNEFFVEEIPNWVNRFSPKMREGL
                     KRSDGRYGVEGVEKEPAAYFYTTFAFRKVRDYQE"
     gene            complement(<971178..>974453)
                     /locus_tag="KLLA0_F10549g"
                     /db_xref="GeneID:2895727"
     mRNA            complement(<971178..>974453)
                     /locus_tag="KLLA0_F10549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455560.1"
                     /db_xref="GeneID:2895727"
     CDS             complement(971178..974453)
                     /locus_tag="KLLA0_F10549g"
                     /note="similar to uniprot|P38329 Saccharomyces cerevisiae
                     YBR235W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455560.1"
                     /db_xref="GeneID:2895727"
                     /db_xref="GOA:Q6CKH9"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH9"
                     /translation="MSKFYELPGSHLPSQSERSPLLKRRSSLTYFKYQDTPLQQEQSS
                     KYDLENPHRNKLGTFDGVFIPTTLNVLSILMFLRFGFIIGQMGILGTFLLLILSFIID
                     VSTTLSISAISTNGTVRGGGAYYMISRCLGPEFGGSIGLIFFIGQILNSGMNIVGIVE
                     PLLYNFGISEGVLTQVLPEGHWYQFGYSTVLLLLCLAVAMIGSQTVSRAGNVLFWLLL
                     ASTISIPISVLFVKPFELNGIVYTGPSLQILKQNLYPKFTKGAAGSVLKGYETFNDLF
                     GIFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLLTFVCYSLVIISLGCSVPKKSL
                     HKDVQIIQTVSGFQSIILVGELSTSLFSVIVGMVGAAYVLEAISKDNILPGISIFGRN
                     PVLCLLFSWFLTQMCLFSDVNKIATFITMTFLMTFIIMNMACFLLEISSAPNFRPSFK
                     WFNRYTAFLGAMFCIIAMYVVDNVSASAVISSLCLLFVIIHYFCPPKPWGDVSQSLIY
                     HQVRKYLLRLRQDNVKYWRPQVLLMVDNPRTSWNLIKFCNHLKKGGLYILGHVTVASN
                     FQSEYQELNKQMRAWVNIRDMAGIKAFVQIGMGPTLPWGIRNVFMGSGLGGMKPNITV
                     LGFFDLNNYLQKKRPHGVGASSPLREDMNFRVTKYKDSISIEMPSHPEFESLPTDECK
                     NEEKVKLQQWVQVIEDLSLMRSNIAVAYGFKNLQLPQKNETRDTKGYIDLYPIQMSAT
                     IVNENSSGEVTTTNFDTYTLILQLGAILTTVPDWHRTHQLRVIVFVENERERYDEKKR
                     IDALLSVLRIEAEVLVLSLDQFRVYNTIVKADIIAKKCVDEALKNDDWWRELVDARTR
                     QHSNRKFTTTEPTSIKINGNHLKKKYDVSNLQRLGVSLTMASSMPATDMAGNESEYES
                     DYAVGAYESNSTLLSNGDQNQSIHPVRSMKALDNASIRSNRPVFSSKAMPKTKVIEEA
                     TGQQPTLVPVIDHTTDIKQNPVLHPISPCQSSADLTGSSDELTFNMLPSRVQHLILHD
                     MMTQVSSKSNLLLSTLPLPPLGTHKNELASLEYVQNIDIWLDGLPPTILINSQSMTVT
                     TAL"
     gene            <974719..>976602
                     /locus_tag="KLLA0_F10571g"
                     /db_xref="GeneID:2895728"
     mRNA            <974719..>976602
                     /locus_tag="KLLA0_F10571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455561.1"
                     /db_xref="GeneID:2895728"
     CDS             974719..976602
                     /locus_tag="KLLA0_F10571g"
                     /note="similar to uniprot|P53137 Saccharomyces cerevisiae
                     YGL110C CUE3 Protein of unknown function has a CUE domain
                     that binds ubiquitin which may facilitate intramolecular
                     monoubiquitination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455561.1"
                     /db_xref="GeneID:2895728"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH8"
                     /translation="MTTRYQRVLEINAKEKISLAIVKFPPFKLRAAMVEKDPVIWLHL
                     LEVYVQHMSYLLHGDNLDFLSDETIDHLCIFVKAYVHEMSEEEGKLLSLGINADVLKQ
                     LELLRAYVLQLIKSCGLLYLKLNTESLWDITRSYVEGNATTVRSLIEGSLRPTINTQK
                     AQLDRTYQIQQHIRYLIEANKFSRVDLKSLELLLAADDKAKSSFTDNFVSAKWVDTLE
                     SMYGKEPGSYLSDWGKKLGILSFLSCSVTHLADLLKQMSITNLRTLSMYPLLGSLLID
                     ARFQEKLPHIKTKIPFLDIQEEPKAAPHLSGLLMPSVNVEQIDTIKELFPDLTSNQIT
                     KLLQRYDNNTEVIINNLFENPSVISSLEDGPLQDDEIQNTTENLMEEHKPKENLLPAI
                     TPKDKIEKKNMLFPTNDVPDAVRNKTLSRALSLLYDATEDERDDTYDDAEVKQASADR
                     VSVDTSDTAKVSTITPGTSKYDKIEGYLWELLKRDKNLFSRQQRGSKQRKEMKKETNW
                     SDEQIEGWSRMIEKSPKRAQLLEEKYIFKGNVRQGKKTFTKAREDKEGFDHHVVDSTV
                     NSPNTNSNNDSGREKTPTTKEPLTKEQQKRKNARNEKLKSSRANHNRKAGHDKKLAKS
                     GVL"
     gene            complement(<976698..>978008)
                     /locus_tag="KLLA0_F10593g"
                     /db_xref="GeneID:2895729"
     mRNA            complement(<976698..>978008)
                     /locus_tag="KLLA0_F10593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455562.1"
                     /db_xref="GeneID:2895729"
     CDS             complement(976698..978008)
                     /locus_tag="KLLA0_F10593g"
                     /note="similar to uniprot|P53136 Saccharomyces cerevisiae
                     YGL111W NSA1 Constituent of 66S pre-ribosomal particles
                     involved in 60S ribosomal subunit biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455562.1"
                     /db_xref="GeneID:2895729"
                     /db_xref="GOA:Q6CKH7"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MRVLLASDDSGSLKEIIFNRGTNTSIKTALQPFHIDIHLNQGLS
                     NRIDKIYHVSDSLLLLARHSGSLELVSSKRVSKDVDETNEPKYDVTEFELQDLISGLF
                     DQSVLDTLSSKSKKKSKIEDQFVELYLIKKSAKNPIFLAATKSGNVTIIEVDLHSTKI
                     SKIASHKIKAPVEFVTLYDLDKSDKFVMAYGGEENLVRLIELSSDFKEISDIWAAKNV
                     PFDNIGLRVPAWDVALRFLESEKNGVYNFITITKYAQLRKYSTNAEDCRPVKSITLLP
                     KGEQLNSCKIIGDTSPLGNFQSSNFDELEFLAADSRKDVYQFNGKGRLLRKIAKGDIT
                     GFASCIAVTDKYLLQGGLDRYVRIFDLADYKLLAKIFTGGKVSDIILLEDNDLELPLT
                     EKQLKMKKKKEAKRSIVEADEDAENEDLWNKLESKKRKVSKNDI"
     gene            <978492..>979604
                     /locus_tag="KLLA0_F10615g"
                     /db_xref="GeneID:2895730"
     mRNA            <978492..>979604
                     /locus_tag="KLLA0_F10615g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455563.1"
                     /db_xref="GeneID:2895730"
     CDS             978492..979604
                     /locus_tag="KLLA0_F10615g"
                     /note="highly similar to uniprot|Q754U3 Ashbya gossypii
                     AFL022W AFL022Wp and similar to YBR234C uniprot|P38328
                     Saccharomyces cerevisiae YBR234C ARC40 Essential subunit
                     of the ARP2/3 complex which is required for the motility
                     and integrity of cortical actin patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455563.1"
                     /db_xref="GeneID:2895730"
                     /db_xref="GOA:Q6CKH6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017383"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH6"
                     /translation="MSDIAAQFKLVKGSIYSHCFNQDRSLLAITYDTDCYVYKVSAAK
                     QPQLVAVLPDHDKTVTAVDISVHGRIVTCSQDRNAIVWEPLSNGTYKPTLVLLRINRA
                     ATCVSWASSGYKFAVGSSARIIAVCYYEQENDWWVSKHIKKPIKSTINALSWHSNCVL
                     LACGGTDGYARVFSGFIKGLDTKEQVAGSPWGEKFPFGSLVREWYQGAWIHDIKWRSS
                     IDKVAFVTHDGSLNITDYTDDIKSVDNPEGLPFITLCWINDHEILAAGFSNHPVLYSE
                     GSRGWEVSKILDSPVKSAGKLVASTGDDEEEGAFGMSALRKFKELDLKGKVSQQEEKS
                     THVNSITELAAYKESNNNVTQVSSVGLDGKLVIYKL"
     gene            complement(<979795..>980052)
                     /locus_tag="KLLA0_F10637g"
                     /db_xref="GeneID:2895731"
     mRNA            complement(<979795..>980052)
                     /locus_tag="KLLA0_F10637g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455564.1"
                     /db_xref="GeneID:2895731"
     CDS             complement(979795..980052)
                     /locus_tag="KLLA0_F10637g"
                     /note="similar to uniprot|P69850 Saccharomyces cerevisiae
                     YBR233W-A DAD3 Essential protein component of the DASH
                     complex involved in spindle integrity and kinetochore
                     function interacts with Duo1p and Dam1p localizes to
                     intranuclear spindles and kinetochore"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455564.1"
                     /db_xref="GeneID:2895731"
                     /db_xref="GOA:Q6CKH5"
                     /db_xref="InterPro:IPR013965"
                     /translation="MSSELTPLQRSVLDKYRFLAESLRELSETLSDLNNTHEDSKPEA
                     ILQEMREIEVKISLVSTLLKGSVYSLVIQRRMDHQQKPSDL"
     gene            <980423..>981973
                     /locus_tag="KLLA0_F10659g"
                     /db_xref="GeneID:2895732"
     mRNA            <980423..>981973
                     /locus_tag="KLLA0_F10659g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455565.1"
                     /db_xref="GeneID:2895732"
     CDS             980423..981973
                     /locus_tag="KLLA0_F10659g"
                     /note="similar to uniprot|P53040 Saccharomyces cerevisiae
                     YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455565.1"
                     /db_xref="GeneID:2895732"
                     /db_xref="GOA:Q6CKH4"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH4"
                     /translation="MSQQSSQQQSYTIWSPHDTVKDVADSLGISNTNDDVLRSLAMDV
                     EYRILEIVEQAVKFKRHSKRSTLTTSDVAKALRVLNVEPLYGFEEGSAKNEPVKFNKL
                     EGANGQTLYYLDDEEIDFEKLINTPLPEVPRLPTFTAHWLAVEGIQPAIPQNPNINEL
                     RLSQVPLQRGAIVSPLNETSVQTSLQTNVNEERQATANGPISTQVKPGAASEAKPLVK
                     HVLSKELQIYFEKVASALTSKEEDINSQRMRAAALTSLKSDTGLHQLVPYFIQFIAEQ
                     ITHHLEDLELLTTMLEMIYSLLSNQSVFLDPYIHSLMPSILTLLLAKRLGGNGSKNSS
                     DDKIVDQQNKKEFLEKTNAVRDFASSLLDHVLKKFPKVHKSLKPRVTRTLLKTFLDIN
                     RSFGTYYGCVRGVSVLGNETIRFFLGNLQNWSKLVFEEYDRSQSEDSKSGKNLTDLEI
                     KLLSTVIVSTLENLKSDLPSSYNPSGDFSEEDKTRLRERCGITVGNVILERDDAKTLY
                     DAIFFGEL"
     gene            complement(<982014..>983909)
                     /locus_tag="KLLA0_F10681g"
                     /db_xref="GeneID:2895733"
     mRNA            complement(<982014..>983909)
                     /locus_tag="KLLA0_F10681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455566.1"
                     /db_xref="GeneID:2895733"
     CDS             complement(982014..983909)
                     /locus_tag="KLLA0_F10681g"
                     /note="weakly similar to uniprot|P53135 Saccharomyces
                     cerevisiae YGL113W SLD3 Protein that interacts with Cdc45p
                     in initiation of DNA replication gene exhibits synthetic
                     lethality with dpb11-1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455566.1"
                     /db_xref="GeneID:2895733"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH3"
                     /translation="MDTSARQWVLICSFLKLPAGFEIDETSVTLVDLKSSEFQQVQAN
                     IKATDVVLKHLLRNGDQFIILEHYFQDSWLRWGLVKVPNQESIGHDKPNYKEQVSTRY
                     DVKTLDEWCDLSIEDILPYWKEDRQKIPDGDMPEQLPLVMKPPGFSYGKEMVIDEHGS
                     GSFIHRQELDPSSYLQQKYYEMLYSLNDPLAHFVKSKLSRLKVLCKRHGKAYQTVLKS
                     SLVDQSTFEQRHHLEHCGLLKYESIPDECKDFRVRSIRDTLGVDIERMQNLNDVISDI
                     SNILKVRDIKLQIMILLELLTEGKLDSTIKQYETNHANKLNEGSFNMMTTMTRFSRRR
                     NKGKSSKSVKQLKVIDYCQNLDILLDKLGIAEALISTEISLHSEQPPINKLIHEYKQG
                     IVNKNKEISSKGFLSYVVVPYWYKKLPFVVTFITNKIKGPTMEKKPMTNAQQTNSNRS
                     RAGSISSVSDGKRSSPQMPPLLRTRTNSNLVEFLEEETTKKKPKMASRSSSDLKLNRL
                     QKRQMSVQDLSLDDIVKQRQQILEEFSTVRTVLVNGKAINISQSHNNSFQRVGKRKLA
                     SYISETGFDDKQQDIHVTATPIKPIEEKKDTPVLVASPSVVSETPVRASPVKVKTRHV
                     RRRLFAP"
     gene            complement(<984298..>985551)
                     /locus_tag="KLLA0_F10703g"
                     /db_xref="GeneID:2895734"
     mRNA            complement(<984298..>985551)
                     /locus_tag="KLLA0_F10703g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455567.1"
                     /db_xref="GeneID:2895734"
     CDS             complement(984298..985551)
                     /locus_tag="KLLA0_F10703g"
                     /note="similar to uniprot|P38151 Saccharomyces cerevisiae
                     YBR233W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455567.1"
                     /db_xref="GeneID:2895734"
                     /db_xref="GOA:Q6CKH2"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH2"
                     /translation="MADEEVLSLEPVSSPNSLKRKPDHETLEAGIKRVALEDNEAEPQ
                     NSELNGDGTHLTEKDSGQVPNYINLRMLCLMKQASKVVGGKGERVNRIKSETNTRINV
                     SDNINGVMERVIFVRGKCEEVARAFGKIVRAINNESDDDSNERSLPLVVNLLIPHHFM
                     GCIIGRQGSRLHEIEDLSAARLMASPQQLPMSNDRILSLTGVADAIHIATYYIGQTIL
                     ENESKLKNKKSVFYHPGPMHSVLVNNYQMYMIYSGGAPTNPQDITPMVAPHQEHHQYH
                     PMDKKTMNRRTKPPVSKYPIGPQQSLQPYTDMVDSCKHVKIISQLQQSPISPHLVLPQ
                     EVFIDNKFVGNVIGKGGKNIQQIKQSTGCMIKINDPVEGLDERKLVLIGTPLATQTAI
                     MMINNRIDMDKRKRQENITIGMNDE"
     gene            <985843..>986790
                     /locus_tag="KLLA0_F10725g"
                     /db_xref="GeneID:2895073"
     mRNA            <985843..>986790
                     /locus_tag="KLLA0_F10725g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455568.1"
                     /db_xref="GeneID:2895073"
     CDS             985843..986790
                     /locus_tag="KLLA0_F10725g"
                     /note="similar to uniprot|P38326 Saccharomyces cerevisiae
                     YBR231C SWC5 Protein of unknown function, component of the
                     Swr1p complex that incorporates Htz1p into chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455568.1"
                     /db_xref="GeneID:2895073"
                     /db_xref="GOA:Q6CKH1"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="InterPro:IPR027124"
                     /translation="MSDTKGSDLNEDSALEFDEESYHESEDEDFDPSKEQNKRKTTND
                     NKKTDVNANISDSDQDEDEDEEYDEEAQEEEKKYSSIVSESGGLIKTRRARLQEEHDA
                     LKNKYEQIDIAETSGKSNDLWRQLKERALSRSQFNGSVMDQDAGSITDSMQEQKILIE
                     RTYKFAGEVIKEKKWVLRHSAEGQEYLNSIKFKTGTLDKNTVPPDTVKNTQAQQTEGK
                     QNRVNEAGRLLKRHLKRPPILEQIIAGNLKPKLTTLEKSQLDWASYVDKEGIHEELNL
                     HNKDGFLAKQDFLNRVESSKDQKYRELRKLQLQTEQQKQ"
     gene            complement(<986879..>989077)
                     /locus_tag="KLLA0_F10747g"
                     /db_xref="GeneID:2895074"
     mRNA            complement(<986879..>989077)
                     /locus_tag="KLLA0_F10747g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455569.1"
                     /db_xref="GeneID:2895074"
     CDS             complement(986879..989077)
                     /locus_tag="KLLA0_F10747g"
                     /note="similar to uniprot|P53134 Saccharomyces cerevisiae
                     YGL114W Putative member of the oligopeptide transporter
                     (OPT) family of membrane transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455569.1"
                     /db_xref="GeneID:2895074"
                     /db_xref="GOA:Q6CKH0"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:Q6CKH0"
                     /translation="MESQTGGSRGGSITEWDRKPWLKQVTLRSTIIGLIIGSLVLVSN
                     FQFGLQTGWVSMMSLPSALLACAVFKQVWPLVFPNDSQFSDVENVYVQSIAVAVGTGP
                     LAYGFVGVVPAIEKFLTDEESGGTRHMGEAFSFNELLMWSAALAFFGIFFAVPIRKQV
                     IVREKLPFPSGSATATLISVLNGSEILQEVTTQELVEMKERRLREYGEVLCSDDETNC
                     EISPLLRNGNSNAPNSYTSADSNGSNETNVNHLVPSTSKGVPTYRENVSVLMKTFSAS
                     ALYTVTSYFVPAVKSIPMFGNYASDVYLWNIEPSPAYVGQGIIMGLPTVSYMLFGCIL
                     GWGILAPLARYNRWVDPEANVHDWENGVQGWIIWTSLSIMVVDSVVGFIVFTIRSIVK
                     FILLDDKMEMFNSVLDDSIQSMLLEEERVLNDSRGRHENTVKLVSTEIDHEVDSKHLV
                     AYTTVLSGLAISFILCVTVMIYLFGIDIIPLYSIVSALVIASFLSILAVRALGETDLN
                     PVSGIGKLSQLLFALIIPNSQNGSVLLNLVAGGVAEAGAQQAGDLMQDLKTGHLLGAS
                     PKAQFIAQSIGAAWSIVLSSIVYKLYNKIYDIPNQQFRIPTAVVWIDCARLVTGKSLP
                     DKALECSLVLGSIFAVLSLIKNCLRDRGYKWVLWIPSGVAVGVGIYNSPSFTIERFAG
                     GMLAHIWLRTNRGNPDAKTKMIVFSSGLVLGEGIFSIVNMFFTGIGVPHF"
     gene            complement(<989640..>990626)
                     /locus_tag="KLLA0_F10769g"
                     /db_xref="GeneID:2895004"
     mRNA            complement(<989640..>990626)
                     /locus_tag="KLLA0_F10769g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455570.1"
                     /db_xref="GeneID:2895004"
     CDS             complement(989640..990626)
                     /locus_tag="KLLA0_F10769g"
                     /note="uniprot|Q9P869 Kluyveromyces lactis Nuclear protein
                     SNF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455570.1"
                     /db_xref="GeneID:2895004"
                     /db_xref="GOA:Q9P869"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR013785"
                     /translation="MPASSDKLQPKDQQTIELEQKLAVQSIRVFLQSKTSYDVLPVSY
                     RLIVLDTSLLVKKSLNILLQNNVVSAPLWDAQTSKFAGLLTSSDFINVIQYYFHNPDK
                     FELVDKLQLNGLKDIERAIGIQPYDTRSIHPFRPLYEACVKMIESRSRRIPLIDQDEE
                     TQREIVVSVLTQYRILKFVALNCKEIRYLKRPLRELDIISTNNIMSCQMSTPVIDVIQ
                     LLTLAGGVSSVPIVDEQGKLVNVYEAVDVLGLIKGGIYNDLSLSVGEALMRRSDDFEG
                     VFTCTENDKLSSILDTVRKSRVHRFFVVDSNGFLTGVLTLSDILKYILFAES"
     gene            991014..991125
                     /gene="SNR20"
                     /locus_tag="KLLA0_F10776r"
                     /db_xref="GeneID:9487512"
     ncRNA           991014..991125
                     /ncRNA_class="snRNA"
                     /gene="SNR20"
                     /locus_tag="KLLA0_F10776r"
                     /product="U2 RNA"
                     /note="SNR20 (U2 RNA)"
                     /transcript_id="XR_002633608.1"
                     /db_xref="GeneID:9487512"
     gene            complement(<991642..>993279)
                     /locus_tag="KLLA0_F10791g"
                     /db_xref="GeneID:2895075"
     mRNA            complement(<991642..>993279)
                     /locus_tag="KLLA0_F10791g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455571.1"
                     /db_xref="GeneID:2895075"
     CDS             complement(991642..993279)
                     /locus_tag="KLLA0_F10791g"
                     /note="similar to uniprot|P26309 Saccharomyces cerevisiae
                     YGL116W CDC20 Cell-cycle regulated activator of
                     anaphase-promoting complex/cyclosome (APC/C) which is
                     required for metaphase/anaphase transition directs
                     ubiquitination of mitotic cyclins Pds1p and other anaphase
                     inhibitors potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455571.1"
                     /db_xref="GeneID:2895075"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG8"
                     /translation="MDKNSQLSAKQSMLSLTSPTKLHVIPNENKITKRKGKSTLGNVT
                     NTINRPKLIAKNGIPPLLRRSSSFFREESPVHEPLSGTGYNSIDQETNPDRFIPQVHH
                     SQNTKCIDLEEDPEEIKPPPNASPFKHLSAQTKKMFKQKVANACGLDMNQRILQYMPL
                     PPQPSLDRPIFSIGSRQTYKFDSKTNALAKLRKINTNPERILDAPGFQDDFYLNLLSW
                     SKKNVLAIALDNSIYLWDGESGDVNLLVELKATCTSLTWSDDSCHISIGKNDGNVEIW
                     DAETMTHVRTMRSGLGVRIGSQSWLDTLCVTGSKSGEIQINDVRIKNHVVQTWERHQG
                     EVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTKRNHKAAVKAISWHPEITNLL
                     ATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVATGGTP
                     NNCITIYNYETKFKVAEIQQAHDSRIVSSQLSPDGTTIASVGGDENLKFYRVFEERRK
                     RKYLDDRTHRYTDKLDTKSHENDEPQRSPSKGTYIIR"
     gene            complement(<993942..>995270)
                     /locus_tag="KLLA0_F10813g"
                     /db_xref="GeneID:2895076"
     mRNA            complement(<993942..>995270)
                     /locus_tag="KLLA0_F10813g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455572.1"
                     /db_xref="GeneID:2895076"
     CDS             complement(993942..995270)
                     /locus_tag="KLLA0_F10813g"
                     /note="similar to uniprot|P53095 Saccharomyces cerevisiae
                     YGL196W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455572.1"
                     /db_xref="GeneID:2895076"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR026956"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG7"
                     /translation="MATQLSPSERYPLDPAGVQESIRNAYKGRHYKELPTPALIMKEP
                     VIDSNISTLLQSIDSINSLLERPVKYRAHIKTHKTIEGTLKQLGHNLPEYDGPKYGSI
                     VVSTLREAYLVLDYHEKKKTKIVTDMAYGLPACVPDIIPQLYEISKKVDHFRIFVDNI
                     QHIDFLEKFAKELGDPDFKWSVFVKIDCGTHRAGVFLEEDLIALLERLLKATDSIELF
                     GFYAHAGHSYSKSSAEANESVLREEIDHVNNACNTLLAIDEEYPVSKLILSVGASPTA
                     RSFQYATNTSELSQYINNLHGTLELHAGNLMISDLQQVSTGAITEHNISSFVLGTVIS
                     QYPKRGNSIGEMLTNTGVLSMTKEVSHKFPGYGLLPEHPEYGQWFLQRLSQEHGILQP
                     LDDDCKMIPHGTKVEILMQHVCITMACFGHYFVVNDEGIITDVWIPCRGW"
     gene            <997512..>999782
                     /locus_tag="KLLA0_F10835g"
                     /db_xref="GeneID:2895077"
     mRNA            <997512..>999782
                     /locus_tag="KLLA0_F10835g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455573.1"
                     /db_xref="GeneID:2895077"
     CDS             997512..999782
                     /locus_tag="KLLA0_F10835g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455573.1"
                     /db_xref="GeneID:2895077"
                     /db_xref="GOA:Q6CKG6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG6"
                     /translation="MEESIFDVSNSGKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKC
                     VKRNISCTYQLSLVFQDVSQSKLKSMPVIHSIMDSNDGMIKEIPSQPIGSQPRKKSST
                     SSTSSSQSLTHTLQIQPHPQPHPQVRPQVHQQVHQQAHQQAHQQAHQQAHSQAHPLAQ
                     PQGQPQGQPQIPTQLPLLLPQLSQQQQPQHQQQQQQQQQQQQQQPPQRQQEHLQLLSN
                     IPQQQQQQQQLSTQQADSLHWNVKPDFAQLLDLNDFNLQNLICVSPSDAKLLSLPNLN
                     AKPNTSATELKNWVPLLKPYDINWRNFVWIDMLQLLEKEDPFQTAYKSVNPIAISEIR
                     IDDPNLTNFIWRFACTTLIAGNFLLFPHDRFDTFMRCLWSLNEKHTIVQDAIRYDISV
                     FMQDVYENAKLHHFSQIWDRYVRALSFKQVLGTINERIQNSQDFVEYVCLTFTVFLMF
                     FANSALRSNLWRTHLRGCQQLLIRASILMPKGQLTDLEQNAADIYSVLRDWFCHAETA
                     ASIASNFGISLIDITEFTKTAFLTESSPLSLTGNSFNLLKGMSNNLNSVYFHLLLRMF
                     EFKDKGVDISGLNIFLFKVNGTTKSVLPQLSMFGRELLDELQRSAVLDSNLELNLIDV
                     TDLRLKFSMLASHSMFYFLMEVYLKVYFLDVDPKSPEIKSILYTMVKTSYSNPYYSSC
                     GVCCHPSLFVGALTCIIAEDDVLYVHFIDLLSKITDSGMAVAKNSVDKLNAIKANVAI
                     GAYQNIINPDHDFIPI"
     gene            <1000899..>1001525
                     /locus_tag="KLLA0_F10857g"
                     /db_xref="GeneID:2895078"
     mRNA            <1000899..>1001525
                     /locus_tag="KLLA0_F10857g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455574.1"
                     /db_xref="GeneID:2895078"
     CDS             1000899..1001525
                     /locus_tag="KLLA0_F10857g"
                     /note="weakly similar to uniprot|P40449 Saccharomyces
                     cerevisiae YIL161W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455574.1"
                     /db_xref="GeneID:2895078"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG5"
                     /translation="MSAKAAGKVENGVIKHTKESEADKRKNAGHSYRRKRGRRSKAEK
                     SVPAEKATSLEITAKSSHNENAEKKFKLRNALKLQRKAEIDQLCHLAGSDIVMLRKGQ
                     YVTTYSLTFITTDQDQNQKKVKCVFNIPVDYPQSAIKLSKPKDCSSDDPLSRIVNNFN
                     YKSKALLKDKQPLVIQLNYLVTNWNSLQSPEYINRDTVQKNLMSKLSD"
     gene            complement(<1001626..>1002840)
                     /locus_tag="KLLA0_F10879g"
                     /db_xref="GeneID:2895079"
     mRNA            complement(<1001626..>1002840)
                     /locus_tag="KLLA0_F10879g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455575.1"
                     /db_xref="GeneID:2895079"
     CDS             complement(1001626..1002840)
                     /locus_tag="KLLA0_F10879g"
                     /note="similar to uniprot|P27796 Saccharomyces cerevisiae
                     YIL160C POT1 3-ketoacyl-CoA thiolase with broad chain
                     length specificity cleaves 3-ketoacyl-CoA into acyl-CoA
                     and acetyl-CoA during beta-oxidation of fatty acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455575.1"
                     /db_xref="GeneID:2895079"
                     /db_xref="GOA:Q6CKG4"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG4"
                     /translation="MASRLQQLEKHLTGRSSEKDIKSKNPDDVVVVAAYRSAIGKGFK
                     GGFKDVNTDYLLTQFLKEFFEKVDIDKSVIEEIACGNVLNPGAGATEHRAAMLAAGLP
                     YQTPLVAINRQCSSGLTAVNDVANKIISGQINVGLAIGVESMSKNYGPKALGSISNEL
                     KSNTAAAKCMIPMGFTNENVAKKFQISREDQDKFALESFYKAERAVSQGLFKDEIIPI
                     ELPDGSIIAQDEGPRKGVTFESLQKIKPAFVKETGVTTAGNASQISDGVAGVLLMRRS
                     MAMKLGLEIVGKYVAFQAVGVPPEIMGVGPAYAIPRVLKDCGLNVNDVDVYEINEAFA
                     GQAIFCVNHLKIDKKKLNPRGGAIALGHPLGCTGARQVATILRELDAGQIGVVSMCIG
                     TGMGAAAVFVKE"
     gene            <1003827..>1007678
                     /locus_tag="KLLA0_F10912g"
                     /db_xref="GeneID:2895115"
     mRNA            <1003827..>1007678
                     /locus_tag="KLLA0_F10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455577.1"
                     /db_xref="GeneID:2895115"
     CDS             1003827..1007678
                     /locus_tag="KLLA0_F10912g"
                     /note="some similarities with uniprot|P40450 Saccharomyces
                     cerevisiae YIL159W BNR1 Formin nucleates the formation of
                     linear actin filaments involved in cell processes such as
                     budding and mitotic spindle orientation which require the
                     formation of polarized actin cables functionally redundant
                     with BNI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455577.1"
                     /db_xref="GeneID:2895115"
                     /db_xref="GOA:Q6CKG2"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG2"
                     /translation="MTVDKNEKSISILFPLRSGSINAPTANAKTRFSSNDSNDDLVIQ
                     GLNLVGTGLKPRSQTLRYMKSHNFSTPNVDSTRHVSKTDKMCLADTQLPSEQEIDAKF
                     EELLNGHAFLGTAKQNLKSLSYTRKWELIQKEKKLHGDITMQDDSKLNTLHMILSNLN
                     KRFSVTQTLYQLERLLRHADFISLFVNANGVSILNGFIDLLDKKSQYVYLCCYKALLN
                     DTSARSVIFQNNDWITYVFCLLGTLTTDLRVRLLSTQIVILLTYSTEWSDSLLESLDL
                     CYESWIQAVEMTLRNPEDYAFNNSLILPKPKELLVDYSISTLLLVQSIQQLLPSNDLK
                     LACFKRWKRAGIHRVFRLMKDLDSSALNQDIDLYIELELKVQDKQFKNEFLSEISYGP
                     QIKSLIEYTKDTPLETPICNIIETILELVNERTTEGSIKLFYVFNSILTYLCEHTLDG
                     SFDETNTEQVFMTSLDHIMDNLQSHQIAKRAMMELDEKKKEFDGIQLQLDTLLQDKQV
                     SKGDLLQKLENKEELLKSREIRIEELQDRLEVVENQLKKEKKQLDLTIAHRDVAEYTP
                     KRSVSLFETLKEHKPLIGTQRSTSLSKSKRIASLSTVANEKPQSKYPHSTPYNILNNN
                     SDDDLPVTPIYPRKNDIFHQVSALPKLSSSNDVVSATTTEVPSAQTAFVIPASIAAPA
                     APPPPPPPLPPQLKSIEAFTSPMTNGPALVTSSASCASSNVAPPPPPPPPPPPLPSTL
                     SSLNKESTVEDTSLSVAFPNETLPGKPTDGIPPPPPPPPPPPPLPLANNVTFVSKPKP
                     EVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVRMKKKS
                     NVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLEFF
                     NKDDFETIPQSIIRSFEPYASDWKTGKAPKEDVSKLERADRIYLEMFYNMRYYWKIRS
                     SSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNNKKTQGI
                     KLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKINIESIE
                     SEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQCKL
                     TMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQQ
                     LLQKASTETQVEKSADDEAADTIDILIKKLRSVDPQQTIPGSSVPGTSSHPEKRSTPR
                     TNRDQNLLSRAMTLKSGIQNL"
     gene            <1008727..>1009773
                     /locus_tag="KLLA0_F10934g"
                     /db_xref="GeneID:2895116"
     mRNA            <1008727..>1009773
                     /locus_tag="KLLA0_F10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455578.1"
                     /db_xref="GeneID:2895116"
     CDS             1008727..1009773
                     /locus_tag="KLLA0_F10934g"
                     /note="weakly similar to uniprot|P36169 Saccharomyces
                     cerevisiae YKR100C SKG1 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and bud"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455578.1"
                     /db_xref="GeneID:2895116"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG1"
                     /translation="MSDNTVGVAVGCAVGIPIGVGIIVAFGFWYRMQRRFKEEELEHD
                     GHSNFDEEMSFNDMGVMKMQQAGEHVQENEHEVHGNHVSSDETASSSEEKREREVDHT
                     STQLKNNSSTGSISRGKSGKRNIYTPAYRKRLQETVSSIQKPMDFDSSNNTKSTSTSI
                     TSADTPKRQSSQINMFDKMIPMLPDAAVGGNGSGSIFDEGSVPRRNSSNETLLKTIGT
                     LDLGAYPRRGSSVQISGMNNNNAINNHNINNADNSIISSRHSLTSLHTHMSSPSTNSK
                     PIIENVFDTPKGSKVLTLPAENDSSEQYRLQNNYDIRDDHHIAEEDQYENEFTNYSEN
                     KREFIDSLRPKRQT"
     gene            complement(<1010089..>1010631)
                     /locus_tag="KLLA0_F10956g"
                     /db_xref="GeneID:2895117"
     mRNA            complement(<1010089..>1010631)
                     /locus_tag="KLLA0_F10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455579.1"
                     /db_xref="GeneID:2895117"
     CDS             complement(1010089..1010631)
                     /locus_tag="KLLA0_F10956g"
                     /note="similar to uniprot|P40452 Saccharomyces cerevisiae
                     YIL157C FMP35 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455579.1"
                     /db_xref="GeneID:2895117"
                     /db_xref="InterPro:IPR014807"
                     /db_xref="UniProtKB/TrEMBL:Q6CKG0"
                     /translation="MFRRILAPRSGISVSRILTRRFLASQEPEIILKDKFRPMRIDRE
                     LPDPTKDVNKRRLQFVGFIVLMTSALAMIFNYEKTQSPVISNTLYHMRRSPKIREVLG
                     DQIDFDGLVPWVSGELNQVAGNVNIKFYLKGSKGKVGEVRLVADRENQHQEFFIHEWS
                     VKVDDKKYDLLEESGGAKTL"
     gene            <1010911..>1011286
                     /locus_tag="KLLA0_F10967g"
                     /db_xref="GeneID:9487483"
     mRNA            join(<1010911..1010919,1011074..>1011286)
                     /locus_tag="KLLA0_F10967g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999384.1"
                     /db_xref="GeneID:9487483"
     CDS             join(1010911..1010919,1011074..1011286)
                     /locus_tag="KLLA0_F10967g"
                     /note="highly similar to uniprot|Q2V2P4 Saccharomyces
                     cerevisiae YIL156W-B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999430.1"
                     /db_xref="GeneID:9487483"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:B5FVA1"
                     /translation="MTFIGKTVHLAIDAVLISTCLAGIKRNTGLTPKIDHISDITVRE
                     YSTKYLNLGESVYDYTVATLGSSSYFQRK"
     gene            complement(<1011479..>1013788)
                     /locus_tag="KLLA0_F10978g"
                     /db_xref="GeneID:2895118"
     mRNA            complement(<1011479..>1013788)
                     /locus_tag="KLLA0_F10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455580.1"
                     /db_xref="GeneID:2895118"
     CDS             complement(1011479..1013788)
                     /locus_tag="KLLA0_F10978g"
                     /note="similar to uniprot|P22035 Saccharomyces cerevisiae
                     YKR099W BAS1 Myb-related transcription factor involved in
                     regulating basal and induced expression of genes of the
                     purine and histidine biosynthesis pathways"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455580.1"
                     /db_xref="GeneID:2895118"
                     /db_xref="GOA:Q6CKF9"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF9"
                     /translation="MNESSSEKGTVASSVSDDSGDMSEEHMSNLRKRVKKEPVNALEV
                     SESLGYQTFRRKMRKIWTKEEDDLLRKLVNESLVNLGYPDGIKSIKTIQQSSNVVKKI
                     PWDQLAKQFELDNKKATDVKKRWTSSLDPVLKKGKWTPEEDELLLKSYEHHGPQWFKI
                     SYVLENRTEDQCAKRYIEVLDPSTKDRLRPWDETEDLLLIAKVKKYGTKWRQISTEMD
                     ARPSLTCRNRWRKIITMVVRGVASETIKSAVQAGNMDAGNEMTRLGEENEKENKTDDD
                     EDVSRPMSTSNTPQPSMKSPSGTVKREESTPMIFDMTNRTNSSAALLDVLKTGKINAN
                     DGQQPHQSNERSTATPDPAVLNSIISPSPHYNSPHPSIFVGSINKKESALPSPSTFLP
                     IPNVETRKQQPETTVDWKFSLKESSGHTLSNGVISNADLVKQLINHAKANDLKISIHQ
                     HIHNHYLAPRQISPPPLMLPQQQQNKHIGNTTSNSQDLPKIRSPSFSDFETDFLSKTP
                     NFNNWGLDDETQSPSALNDKLQRFYHHHHHHHHDSLDEAQEQNIKQQHLMNGANYAQN
                     GLSQLPPNPTSSTASYPSPTAPEIREIGPSRHSHFNYLPPTVKPQLGSSENAKTVELS
                     RLLNPSPNGLHGHKRKQTKRRGKNESRNSSAAGSTGNTPAEDFDRNGPKNKVTPSTVS
                     SISIMEEDGNDFWENLRSLGGNIGSDGKSSERKSPSISHINDLFQNTENAADTPTGYD
                     AIFKFCEQKQMDDKQSTEEVVAEFAINPS"
     gene            <1014492..>1016159
                     /locus_tag="KLLA0_F11000g"
                     /db_xref="GeneID:2895119"
     mRNA            <1014492..>1016159
                     /locus_tag="KLLA0_F11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455581.1"
                     /db_xref="GeneID:2895119"
     CDS             1014492..1016159
                     /locus_tag="KLLA0_F11000g"
                     /note="similar to uniprot|Q02724 Saccharomyces cerevisiae
                     YPL020C ULP1 Ubl (ubiquitin-like protein)-specific
                     protease that cleaves Smt3p protein conjugates
                     specifically required for cell cycle progression
                     associates with nucleoporins and may interact with septin
                     rings during telophase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455581.1"
                     /db_xref="GeneID:2895119"
                     /db_xref="GOA:Q6CKF8"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF8"
                     /translation="MTVSYHRKGFDDISDYSRSTVITADVSSKPYYFDRKGIKDSLNS
                     GNEARDRGSESRWKSLGYNTVLSTLFDSAKTWFSWIDPLEQENGKDRTISNTTGANYD
                     SLKRGVDEESTPRKKIHLDSLLQEKEHLREQLQHSITPTKEVLKLPKDPFHWDNTNEE
                     NYTESSPTRVQYGTRLYRKLKHKNQQQQSTALIAKPSDEVSYLKNLFNGEYHVPIEMQ
                     KERENQLKLLSRDNSHSSNASTNSSNNNIVRLTERIKALILENRKSIGPSTERGSTTD
                     DIVIIREHKLDPLEEKRKQIYNQTLKFDRSLLTFEEEFKSYSQLIEERRKLVEQVRKT
                     AKPQKLIPDLSTEDLSEVKATFNRSDNAVLSSKYMLEVTVRDFKTLAPRRWLNDTIIE
                     FFMKYIEQNTAKTVAFNSFFYSTLADRGYQGVRRWMKRKKVDILDLNKIFVPINLNDS
                     HWTLGIIEMKQHKIYYLDSLSSGMNSVSFLIMKNLQSYVMEESKQKLGEDFELCHIAC
                     PQQPNGFDCGIYVCLNTLYMSKDYTLSFDSKDAANMRNYIGHLILSK"
     gene            complement(<1016214..>1018880)
                     /locus_tag="KLLA0_F11022g"
                     /db_xref="GeneID:2895120"
     mRNA            complement(<1016214..>1018880)
                     /locus_tag="KLLA0_F11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455582.1"
                     /db_xref="GeneID:2895120"
     CDS             complement(1016214..1018880)
                     /locus_tag="KLLA0_F11022g"
                     /note="similar to uniprot|P40965 Saccharomyces cerevisiae
                     YFL003C MSH4 Protein involved in meiotic recombination
                     required for normal levels of crossing over colocalizes
                     with Zip2p to discrete foci on meiotic chromosomes has
                     homology to bacterial MutS protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455582.1"
                     /db_xref="GeneID:2895120"
                     /db_xref="GOA:Q6CKF7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF7"
                     /translation="MNNTATTSGNVTSFAKWAFESSSVEGTSSVGTTTSDNQSQNNSR
                     VSRHSTSKKRKVDRQPTIFELSNHQQERDCSLPIRKSMQTRQSKSESRYTSRNKKITT
                     TTSGLVVGPDRTIFSIFESGKNADTRVGICVVNYSTAEMHVSEFIDTQVFIKTLNKIY
                     VCQPTEILIPSHSLSGKVSKLSTIVKCNISDNVKICEAATKVYNPQEGLEVLEKFALL
                     GTNKSPVPFAEQLIGKEFCLMAVSAASNYMTQIAEADLALKFSNFRVRIDNGDNTMLI
                     DMKTVQSLELIENTLESNGMTLLKVIDKTVTKMGHRALRNDILQPLTDINSLKLRVSA
                     VQELQNNPDFLNSFRMELKVLHDLDALFSKLLSFNHTVILPDQKLNYVILLKESIESA
                     TTLKRLFEESKFESKLLSEIMAIFSSDDISSIFDLINRYLNEDTRWASTPIDLQNQKA
                     YAIKRGSNGLLDVLRQLYKSLTDDIMREVDSLRDKFGLNFSHGHDVNRQFYLKLKKKD
                     INQLSDLDSCFINRVTKKTAYEFTTLNLMKMNTRLSELTCEMIALSEQTVSELLSNIS
                     SHIATLFMISEAISVLDLLCSLATTGLENNWILASFGNHLSLSGARHPILENTLTNFV
                     ANDVEAIPNLSSFQIVTGCNMSGKSIYLKQVAMLTILAQIGCPVPCTSASFPLYQKLH
                     ARVCNDDIEAYSSTFSAEMKDMAYFIDDITDKTLMILDELGRGSSIADGFSIALAISE
                     YLLSKNATVFLSTHFRDIPKILAPKPRVLHLEMKTEIDQESHLKMKYKASTESEEIEG
                     YGMMICKRIFSERIMLEAYKISELLRASKRKGLKIIAKEDSCDNACQTTQIKQVYYLV
                     QKLKAFCNHEKTIDIEELRSLQDDFISTFEIV"
     gene            complement(<1018877..>1019887)
                     /locus_tag="KLLA0_F11033g"
                     /db_xref="GeneID:2895121"
     mRNA            complement(<1018877..>1019887)
                     /locus_tag="KLLA0_F11033g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455583.1"
                     /db_xref="GeneID:2895121"
     CDS             complement(1018877..1019887)
                     /locus_tag="KLLA0_F11033g"
                     /note="similar to uniprot|P53686 Saccharomyces cerevisiae
                     YPL015C HST2 Cytoplasmic member of the silencing
                     information regulator 2 (Sir2) family of NAD()-dependent
                     protein deacetylases modulates nucleolar (rDNA) and
                     telomeric silencing possesses NAD()-dependent histone
                     deacetylase activity in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455583.1"
                     /db_xref="GeneID:2895121"
                     /db_xref="GOA:Q6CKF6"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF6"
                     /translation="MSAEIPKAIKKLAKYLQDNPDVKVIFMVGAGISTSSGIPDFRSP
                     ETGLYHNLSKLNLPYAEAVFDIEYFEQNPKPFYTLAKELYPGNFKPSPFHYLMKLFES
                     KNRLKRIYTQNIDTLEREANISDEFIIEAHGSFASNHCIDCGKEFPKEAFQNKLLLNE
                     QETDEDGGNYATCDGCGGLIKPKIVFFGEGLPTEFFDTWDLDSSTKEKTVCIVCGTSL
                     TVYPFASLPMEAPNSWLRVLLNREIVGDFKTSRQDTDLIFKGSADYAAFLLAQELCWL
                     EDLENLSGKQFKPESKTKTKVHINKPEPEQQEKINTKEEEVLKEVTEEIALELNNLTI
                     KE"
     gene            complement(1020157..1020230)
                     /locus_tag="KLLA0_F11055r"
                     /db_xref="GeneID:2895122"
     tRNA            complement(1020157..1020230)
                     /locus_tag="KLLA0_F11055r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2895122"
     gene            <1021058..>1022797
                     /locus_tag="KLLA0_F11077g"
                     /db_xref="GeneID:2895123"
     mRNA            <1021058..>1022797
                     /locus_tag="KLLA0_F11077g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455584.1"
                     /db_xref="GeneID:2895123"
     CDS             1021058..1022797
                     /locus_tag="KLLA0_F11077g"
                     /note="weakly similar to uniprot|P53918 Saccharomyces
                     cerevisiae YNL125C ESBP6 Protein with similarity to
                     monocarboxylate permeases appears not to be involved in
                     transport of monocarboxylates such as lactate pyruvate or
                     acetate across the plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455584.1"
                     /db_xref="GeneID:2895123"
                     /db_xref="GOA:Q6CKF5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF5"
                     /translation="MSFSTGSSSKSTSSVVVVDVPKPFIQEDDHTNSENVVPFDQSVI
                     ECRDANNEEQEAGGFISRVSTKLENYHKESVLLNQENIELPVYDNDLFDPLSRAATQD
                     VVSRRNTCRKDSVEGSIPEIEDDGLYNADDIIDPPPDGGYGWICCACVVVMNFCTWGP
                     NTCYGVFLSYYLSSNYFPNATPTDFAVIGGLMLGLTLFLLPLSAMCMNKFGYRPVMLV
                     GVLLQFTSFISSSFVTTIGELYFTYGILLGFANGFIFGCNSVVIPGWFLKKRAFANGL
                     THIGVGLGGLVLTFAVHAIMEKTGSHKWPMRFLGIMVLVFNTIAALIVKIRVPRNPPP
                     QKSSLQLLKDVYDFNVYKLTPLQYCTLWSTMTNIGYVILLFSLSNYALSIGLNSQQAT
                     VTLALFNGAQIIGRPAMGYFSEKIGRVNCTSICMFYTILLLGPYWFNVDSYSAILGFT
                     FLLGLAAGVSSVNVIPLIADVTGMAHFPAGLGYNNIWNGSTAVVAEIFALKLRDYSLP
                     QPYLHCQIFVLVMYFVGLLALIPYREWKVRRMLNARISGKNVDDKIRLKWHRVLEPGV
                     LNYFKRAFYLVRC"
     gene            complement(<1022939..>1024666)
                     /locus_tag="KLLA0_F11099g"
                     /db_xref="GeneID:2895124"
     mRNA            complement(<1022939..>1024666)
                     /locus_tag="KLLA0_F11099g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455585.1"
                     /db_xref="GeneID:2895124"
     CDS             complement(1022939..1024666)
                     /locus_tag="KLLA0_F11099g"
                     /note="weakly similar to uniprot|P40960 Saccharomyces
                     cerevisiae YDR488C PAC11 Dynein intermediate chain acts in
                     the cytoplasmic dynein pathway forms cortical cytoplasmic
                     microtubule capture site with Num1p null mutant is
                     defective in nuclear migration essential in the absence of
                     CIN8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455585.1"
                     /db_xref="GeneID:2895124"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF4"
                     /translation="MDKNERLQLMKQKIEALQLQRKKIDSKHEEIADCTLPFISHITN
                     SINNNESEVKKEVKTVEISVQTDDVNEFELSAVKEAVITYDIGIQTDEYDGKHEIMED
                     GHLPSQDLIEQQASTSDITETKEDKEVVEKDVFDFGNVVSAEDYATLKKETFSLQETI
                     EAAALKSSSHQIAGDGKISMYLSISPKVAIDSTSEARVISSDVLDNLLVTVIHLVTKY
                     VKSSLVQITHVSSGEVLDTVLFQGQNVVRSKFIDNPNSKITSVVLSCYTGKLILYELR
                     TVKINNSFQVERNIVSTNYHHYPVLSIIIPKFNDHSILAASTNGQLKLISTLDLSLKE
                     DDDVKIIPIPRTDLSYSTEQTKKDNKYYQHLLIMSLYDELSIISMLLLPSDPSSIYLG
                     CEDGFIYKVCQLPLKGDNKGCYKISEGNNGFIPNFTSNVDDASLFHEGPITGMVACAG
                     IDDLFFSYSIDGDCIFWDAVSNSRVSVIECDDAIIKAQWINENGSFYVALLTSFTFQI
                     KSLRFSRDTQNNWQLNEDETSKDIVILPSDTPLKEFSSFEVICNEDACILVLCGTAST
                     IYCYVINNL"
     gene            <1024978..>1025856
                     /locus_tag="KLLA0_F11121g"
                     /db_xref="GeneID:2895125"
     mRNA            <1024978..>1025856
                     /locus_tag="KLLA0_F11121g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455586.1"
                     /db_xref="GeneID:2895125"
     CDS             1024978..1025856
                     /locus_tag="KLLA0_F11121g"
                     /note="similar to uniprot|Q6Q558 Saccharomyces cerevisiae
                     YDR489W SLD5 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455586.1"
                     /db_xref="GeneID:2895125"
                     /db_xref="GOA:Q6CKF3"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="InterPro:IPR021151"
                     /translation="MSIDIDDILAELDRDTTAVEQNASSYPDQSDRTQGNDVSQIRPA
                     DKAVDPVAPTQFNKIDDYQKLITHWKNERMSPELLPYPHHLMTRTLIRIQERIELIET
                     LSMGYLEDNQELTVDSKLPLLCMEAELERLKFLVRSFIRCRLSKIDKYSIYLRQQSEL
                     PNNAGLSRLDLLMSKEEVKYHMKHSDILLKLFNNAVLKHLPEELQAVNDTEGSISMID
                     EPDWNKTVFILVCGGVVDESGIDSKLTTDDDGKHCYSVIIEDLNEEIYLLIGAVYVIR
                     YSVIRDLMTEGRVVLI"
     gene            complement(<1026129..>1028570)
                     /locus_tag="KLLA0_F11143g"
                     /db_xref="GeneID:2895126"
     mRNA            complement(<1026129..>1028570)
                     /locus_tag="KLLA0_F11143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455587.1"
                     /db_xref="GeneID:2895126"
     CDS             complement(1026129..1028570)
                     /locus_tag="KLLA0_F11143g"
                     /note="similar to uniprot|P22216 Saccharomyces cerevisiae
                     YPL153C RAD53 Protein kinase required for cell-cycle
                     arrest in response to DNA damage activated by trans
                     autophosphorylation when interacting with
                     hyperphosphorylated Rad9p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455587.1"
                     /db_xref="GeneID:2895126"
                     /db_xref="GOA:Q6CKF2"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016256"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF2"
                     /translation="MDDITQPTQQATQATQKYLIDKFSQEKIDDDVVCRVICTTGQIS
                     LRDLKVQPESIFKKESSIKKTWTFGRNQGCDYYLGDISRLSNRHFMLMLGEEGTLMLK
                     DTSTNGTWLNGARIQKDTNHILTQGDEISVGVGVPSDVVSLVIFINDSFKNRLKELNM
                     MKDVTSPASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTF
                     AVKIIHKRKVMDKFDGVKRELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLM
                     DFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDF
                     GLAKVQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVIL
                     TGHLPFSGQSQNELFKQIKRGSYHEGPLKDYRISEEARNFIDCLLNVDPKERMNAGKA
                     LQHPWMKMAYVDSMQSQISISQSLSQQQFVDSMNEAEYESYIAKKRLEIIKKEITAPA
                     AETNKEPVFKKPQIAPSKIAQSQNLQFNFSNPNTGKAINVNYKSGEEGLSNNKNKKIN
                     RPLTKVNGEGLFLTLHSLPGSSISGKVQVKQGINPFFIGRSDECNCKIDDNRLSRIHC
                     FILKKRHAVGDSIYESPAQGLDDVWYCQSGTNSSYVNGKKITPGTKILLHDGDEIQII
                     WDKINDVTVSFQLEFNDTTGLFHEGKLDTNEKTNKTLLHKQTQEELALVPKFMEFMKS
                     RSSQHAKSNINQSSSSNIDANSQNIEELDSVVEMNSTTGLKRIHSVSLSQSQPQTTKR
                     AKLAQAQKPDIEGFL"
     gene            <1030159..>1031397
                     /locus_tag="KLLA0_F11165g"
                     /db_xref="GeneID:2895127"
     mRNA            <1030159..>1031397
                     /locus_tag="KLLA0_F11165g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455588.1"
                     /db_xref="GeneID:2895127"
     CDS             1030159..1031397
                     /locus_tag="KLLA0_F11165g"
                     /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
                     YOR245C DGA1 Diacylglycerol acyltransferase catalyzes the
                     terminal step of triacylglycerol (TAG) formation acylates
                     diacylglycerol using acyl-CoA as an acyl donor localized
                     to lipid particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455588.1"
                     /db_xref="GeneID:2895127"
                     /db_xref="GOA:Q6CKF1"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:Q6CKF1"
                     /translation="MGKEQIRKRQTKKVRKGSQPVANGKSSVVGVSKDGKPEFCAIDT
                     PIERRLQTLSVAWYVECIPLMIIIMLFVWVNPLMWSFVIPYTIYYFIDRTASNGNAVK
                     RHSKWFRSLKVWFYFRDYFPISMHKSTELEPTFTSIDSTELENDASEPGYLDSSQPVL
                     PDKWWNPFREKDETVRPTGPRYIFGYHPHGIAAFGAFGAFATEACNWSKVFPGIPVCL
                     LTLVNQFQIPVYRDYLLALGITSVARKNAMKVLEKNYSIAIVIGGASESLLTNLGSSD
                     IILSKRKGFVKLALQTGNVSLVPVYGFGETDTYKILKLKNDSIIGRIQIWLKENYSFT
                     VPLFFARGVFNYDFGLLPFRHPVNVVVGNPIHIKEKIDHPTIEEIDHYHSLYIEELKR
                     LYDDNKAKFNYSEKTLNIVE"
     gene            <1031839..>1032921
                     /locus_tag="KLLA0_F11187g"
                     /db_xref="GeneID:2895128"
     mRNA            <1031839..>1032921
                     /locus_tag="KLLA0_F11187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455589.1"
                     /db_xref="GeneID:2895128"
     CDS             1031839..1032921
                     /locus_tag="KLLA0_F11187g"
                     /note="similar to uniprot|Q12461 Saccharomyces cerevisiae
                     YPL152W RRD2 Resistant to Rapamycin Deletion 2; similar to
                     hosphotyrosyl phosphatase activator (PTPA) from several
                     organisms"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455589.1"
                     /db_xref="GeneID:2895128"
                     /db_xref="GOA:Q6CKF0"
                     /db_xref="InterPro:IPR004327"
                     /translation="MAIKRLINEHDMELWNNSKTFEDVIGFINTLALSVRGRENNDYT
                     QPISDNVQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKI
                     FEGIEKPDTGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDS
                     SNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKP
                     KSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDISGVKRWSKVAEGMV
                     KMYKAEVLQKLPIMQHFYFGYFLKCPEGVSEPSARAQDHHEDDSCCTDGSHGHSTWAD
                     CCGIAVPSAIAASQMANKDVRLFPFD"
     gene            complement(<1033024..>1034343)
                     /locus_tag="KLLA0_F11209g"
                     /db_xref="GeneID:2895129"
     mRNA            complement(<1033024..>1034343)
                     /locus_tag="KLLA0_F11209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455590.1"
                     /db_xref="GeneID:2895129"
     CDS             complement(1033024..1034343)
                     /locus_tag="KLLA0_F11209g"
                     /note="highly similar to uniprot|Q08649 Saccharomyces
                     cerevisiae YOR244W ESA1 Histone acetyltransferase
                     catalytic subunit of the native multisubunit complex
                     (NuA4) that acetylates four conserved internal lysines of
                     histone H4 N-terminal tail required for cell cycle
                     progression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455590.1"
                     /db_xref="GeneID:2895129"
                     /db_xref="GOA:Q6CKE9"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /translation="MSHGEEKEPGIPQKVDSIDEIFVGCKSWVLKDGQDRLAEILSIN
                     SRRDPPKFYVHYEDFNKRLDEWITADRLQIDKEVIFPRPKELEEKKDSKKKKQQQNKS
                     ATPQAASATPDGGDVMDLDNLNVQGIPNEDISREDEIKKLRTSGSMTQNQNEVARVRN
                     LNKVIMGKYEIEPWYFSPYPIELTDEDVVYIDDFSLQYFGSKKQYERYRKKCTLRHPP
                     GNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDEL
                     GHHIVGYFSKEKESADAYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKVGSPEKP
                     LSDLGLLSYRAYWADTLIKLLVEHGQEITIDEVSSISSMTTTDILHTAKALEILRFYR
                     GQHVLYLNSDVMKRYKKLKNNKRRSIDPQKLIWTPPVFTASQLRFAW"
     gene            complement(<1034708..>1036012)
                     /locus_tag="KLLA0_F11231g"
                     /db_xref="GeneID:2895081"
     mRNA            complement(<1034708..>1036012)
                     /locus_tag="KLLA0_F11231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455591.1"
                     /db_xref="GeneID:2895081"
     CDS             complement(1034708..1036012)
                     /locus_tag="KLLA0_F11231g"
                     /note="similar to uniprot|Q12417 Saccharomyces cerevisiae
                     YPL151C PRP46 Splicing factor that is found in the Cef1p
                     subcomplex of the spliceosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455591.1"
                     /db_xref="GeneID:2895081"
                     /db_xref="GOA:Q6CKE8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MNTSSRSSEPSKVADDVYVQTRWNNEFKHADYLPESLQKCLDQE
                     KTVLERYSELVEVSKTVANESSQALVKHTTKPGDQLVRRVFQQPHQQISLMERYEKTR
                     SYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKIT
                     LIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPS
                     LDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLW
                     DIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTNDVRSWKLPEGQLLTNFQSQNTG
                     ILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSLESERSILCSTFDV
                     TGTRLITGEGDKSIKIWKQVPDATEDTFPGLPWNPTLISQRF"
     gene            <1036274..>1038304
                     /locus_tag="KLLA0_F11253g"
                     /db_xref="GeneID:2895082"
     mRNA            <1036274..>1038304
                     /locus_tag="KLLA0_F11253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455592.1"
                     /db_xref="GeneID:2895082"
     CDS             1036274..1038304
                     /locus_tag="KLLA0_F11253g"
                     /note="similar to uniprot|Q08647 Saccharomyces cerevisiae
                     YOR243C PUS7 pseudouridylates U2 snRNA at position 35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455592.1"
                     /db_xref="GeneID:2895082"
                     /db_xref="GOA:Q6CKE7"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE7"
                     /translation="MSDQSLKRESEAAAQQEDIKRTKVGEGINEGINNNNITEKDVGI
                     THYLSMDNVGFNGQIKQRYTDFLVNEITKQGEVVHLTDKGFNMPKKPKPTREQIEQSQ
                     KEELEKRQGFKVDEGIRNELVELLGEEDVQKIEAVYRSNKKIETSKAFDDKLERTKIH
                     QLLRRAFDNKLESVTTDSNHFIVGMASRQTRVSKEELIEQTKDANGVENWGYGPSKSF
                     IHFTVYKENKDTMDVANTLSKFMRIPTRLIRFSGTKDRRAVTCQRMSLSKIGLDRLNG
                     LNKGLKGVVLGGYKFEDEPLNLGDLQGNEFTIAIRDVSLKNEGDDLDDILANGMKSLE
                     QNGFINYFGMQRFGTFSVSTHQIGQVLLSGNWKQAVDLIMAEQENVLPISKEARRIWA
                     QTRNPIYAAKAMPHQCLAENAILNALCHEEKCETSNDYPISSYHNAILKIPRNLRTMY
                     VHAYQSYVWNMVASERIKLFGLNVIEGDLVVDETSAAESDDQAKQDEDDFDEDLRETK
                     FIRARPVTAEEVAAQTFTVNDVVLPTPGFDIVYPSNENLRQLYVDVMAKDNMDPFDMK
                     RKVRDFSLAGSYRNVINKPTDIEYQVVSYENPTDQLINTDLEILNANRGKDNGQKYIK
                     SKLERYMKVKDGNKKAVIIKFKLGVSAYATMVLRELMKVETSRRGDMCNVSV"
     gene            <1038770..>1039927
                     /locus_tag="KLLA0_F11275g"
                     /db_xref="GeneID:2895083"
     mRNA            <1038770..>1039927
                     /locus_tag="KLLA0_F11275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455593.1"
                     /db_xref="GeneID:2895083"
     CDS             1038770..1039927
                     /locus_tag="KLLA0_F11275g"
                     /note="weakly similar to uniprot|Q96US5 Saccharomyces
                     cerevisiae YOR242C SSP2 Sporulation SPecific involved in
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455593.1"
                     /db_xref="GeneID:2895083"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE6"
                     /translation="MISEGSFLDPQIEATLYGQKKASNLGTFQTNSTASKTSSLNREL
                     FGFRRKARQYFETTTQRFREHGNDKELMRAGVNYKPRSEDEEMEELNKSKLMMDMLFE
                     KANHGSKQDFDKLGGTGKYGVHISSTPKSVPELLCEAVYQDVHGEISLASPESESIDI
                     SNSAGRRVVIFQDLLKNIGVGTLLAQVSGGPLEKVLYAYDNKTGSRDVVYVELHFLFP
                     DDAAQFMKYARFHLFKVNGVHLVPHWGVIDSLDSSEKSLLDIQQYVHPDFCKDIQNFD
                     STGARRCLIMKKYSRKHKSISTELNSKSHIYDLDIQQIIDDFNQFGQVLEVSPLISRK
                     ICLQISFHDIRSAIEAMRSYETSNSYINGKYFKDWSIWYGKDIVDKPCIEV"
     gene            complement(<1040048..>1041529)
                     /locus_tag="KLLA0_F11297g"
                     /db_xref="GeneID:2895084"
     mRNA            complement(<1040048..>1041529)
                     /locus_tag="KLLA0_F11297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455594.1"
                     /db_xref="GeneID:2895084"
     CDS             complement(1040048..1041529)
                     /locus_tag="KLLA0_F11297g"
                     /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
                     YOR241W MET7 Folylpolyglutamate synthetase catalyzes
                     extension of the glutamate chains of the folate coenzymes
                     required for methionine synthesis and for maintenance of
                     mitochondrial DNA present in both the cytoplasm and
                     mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455594.1"
                     /db_xref="GeneID:2895084"
                     /db_xref="GOA:Q6CKE5"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE5"
                     /translation="MRLPLSLKMANRNYQDAVQALNSLQSNYANIMAIRASGDRKNMM
                     NIWEMQEWSRRIGYSVSDFNKLNVIHITGTKGKGSTAAFTQGILNQYKDTLSKVGLYT
                     SPHLRSVRERIRINGEPITEELFSKYFFEVWDRLDETSSNEDKFPHMTEGQKPGYFKY
                     LTLLSFHVFMQEGCGTCIYEVGVGGEFDSTNIIEKPTVCGVSALGIDHTFMLGNTIEE
                     IAWNKGGIFKEGAPAFTVKSQPKTGSQVLQERAAERHTTLSEVPIFEHLKTIKLGIAG
                     DFQIKNASLATALAHQHLVSLDILKEPLELASSAKIPDLFRKGLEQTVWEGRCQIIRS
                     NNITWYIDGAHTKESIEAASGWFRDVTATFNRKKVLLFNQQSRDAKALLGYLYETISP
                     AVEFDAAIFTTNVTWKTGNYSADLVSLNTSKEQVDKLEVQQNLQKEWILLNETEHRNV
                     EVTSSIEAALDLIKNMGEPVDVFVTGSLHLVGGFLVVLDGKPT"
     gene            <1042436..>1044967
                     /locus_tag="KLLA0_F11319g"
                     /db_xref="GeneID:2895085"
     mRNA            <1042436..>1044967
                     /locus_tag="KLLA0_F11319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455595.1"
                     /db_xref="GeneID:2895085"
     CDS             1042436..1044967
                     /locus_tag="KLLA0_F11319g"
                     /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
                     YPL150W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455595.1"
                     /db_xref="GeneID:2895085"
                     /db_xref="GOA:Q6CKE4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE4"
                     /translation="MFTTRAEQNNIKATIAASYDKLYSQFSSDELSEIGNYKISKFIG
                     EGSFGKVYLATHRLTHQKVVLKTGNKRDPNVVREVFYHRQFDFPYITKLYEVIVTESR
                     VWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVL
                     LDGNGHAKLTDFGFTREMATRSQLETICGTTVYMAPELIERKCYDGFKVDIWSLGIIL
                     YTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRKNPNERISLAQ
                     VLSHPFLQPWGVVAKEKTDKVLLKQRGGHVHFHSKHEKRLLKRLKQCGFDTGSIKNSV
                     NKRKCDSLSGLWFLLLERYELSDAKVPKRSKSVMSVRKVFESSVNMVMDDILVTSPEC
                     VKINSLKKILSRKSVDQDVELPQTIEDVKVRTQPKDRKAAEPESIHPADTTNKKKGFL
                     QRVSSLFKPKKHNNHVDDNQSIKFSSQGIHPLLGKKRHKNGSNDSEAPSISQSTKPPP
                     EQEDLNVQFEDITNKANHSFKKLKSHSSSEISKNINEPQLNHLHIDGGTEDSLKISNN
                     RGIRRSSIASQHSAISNDTFNSDYSTDAQSGFRSNNTQSSSRINANSETSAATRKNVR
                     RTLSVLSSASSNSEMSSRTDSFYDITTASSPMNMDIRSNYNIRSDSQFPKINGNSPWL
                     IKRGKSPIGRRSRISNRSLNRKFRQPTPNRADSVIQEESSFDENERASNLPEVSEYDS
                     GEIAIHSDSETPSKGNTPLYAIGINHPESRPVLFNVGRSVSDGSSWSHPQSDFHEPLS
                     APVIRKSSRRHVEDDDYESNIAADDEDNSLEDEEQEHVRSIAESV"
     gene            complement(<1045057..>1046616)
                     /locus_tag="KLLA0_F11341g"
                     /db_xref="GeneID:2895086"
     mRNA            complement(<1045057..>1046616)
                     /locus_tag="KLLA0_F11341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455596.1"
                     /db_xref="GeneID:2895086"
     CDS             complement(1045057..1046616)
                     /locus_tag="KLLA0_F11341g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455596.1"
                     /db_xref="GeneID:2895086"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE3"
                     /translation="MLVTKTQPYVNDNFLWQQETTELNDDIFNQEHETTMMFGIFYLD
                     ELIKDQDQIILKSQLSELSSMLEPWNEAFPWNGYNGVSLEIRESLSGEYYIFGSLQVG
                     DNARDEECLVLSILLNFSRHAGPCTFIKVCDTDGEFILMEANEIIPAELEFPVSNNRI
                     WITMGKISYIPITFYYDRGLSKYEALSFLKKDSSKVSYLPDLESNIRKNFLKVFPYST
                     LNKLKCCKTIITDSKVAEILKYNPKLVSLALTHFMTSSFETIPTEKHTEDGHMIDVIA
                     PQSHLALVKKFVDLTSTDQELNNKLDFYSDTLGSVLVDSIHHMIDNDILTLNSNNRLK
                     PKALLSCLQEHKIITEDFQIANVKWDILNPDDDVELNATSLDTLKTNLLSFLNDESDL
                     KGIINDNSDERNVNGDAHVDNEQESFLEKDSDISIDEDDFFEFFLKNGLNLADDYIAN
                     LRGSYMDSDADKDQIADSELDTLSELHQSLQDVSAECSPIADLVKSLTVDGAPSGPLQ
                     TILQNLKKQEP"
     gene            <1046847..>1047662
                     /locus_tag="KLLA0_F11363g"
                     /db_xref="GeneID:2895087"
     mRNA            <1046847..>1047662
                     /locus_tag="KLLA0_F11363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455597.1"
                     /db_xref="GeneID:2895087"
     CDS             1046847..1047662
                     /locus_tag="KLLA0_F11363g"
                     /note="similar to uniprot|Q12380 Saccharomyces cerevisiae
                     YPL149W ATG5 Conserved autophagy-related protein that
                     undergoes conjugation with Atg12p and then associates with
                     Atg16p to form a cytosolic complex essential for
                     autophagosome formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455597.1"
                     /db_xref="GeneID:2895087"
                     /db_xref="GOA:Q6CKE2"
                     /db_xref="InterPro:IPR007239"
                     /translation="MEELRERVWHGSLNVEIMLSDSIVVPNTPLSEKCYHIVVLRESF
                     LALYLPAIVRKLGNNVIVTYENPYKQWWFEYDGVPVPWEYPCGVLFDFLCNSSTTSTG
                     KEDDQRLQMWKLKLCHGNKYPPGILPLVDGLRQVKDHWKHQWKQACFILNGSAKRIMS
                     LSIPDFEAFWQSLISRHQPDYIKVREKLLTPNKTKHIPIRVWTADASFLQPSIPANSD
                     TMTLFDVMTSMDIKLQENNRAIIQGIVICSDEDIINLYDLFASIDGFLYVVIK"
     gene            complement(<1047731..>1048795)
                     /locus_tag="KLLA0_F11385g"
                     /db_xref="GeneID:2895088"
     mRNA            complement(<1047731..>1048795)
                     /locus_tag="KLLA0_F11385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455598.1"
                     /db_xref="GeneID:2895088"
     CDS             complement(1047731..1048795)
                     /locus_tag="KLLA0_F11385g"
                     /note="similar to uniprot|Q08641 Saccharomyces cerevisiae
                     YOR239W/YOR240W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455598.1"
                     /db_xref="GeneID:2895088"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE1"
                     /translation="MQQTVNQQLLLPKKIRLGKTNLSEEPENDLESTFTNDESLSSSL
                     ELVEIKDTRIGRDEPFDFGKRTLKADDEVWNHNAWDNVEWGEEQVLAAEEKIQKQYKD
                     PVPEFDKNLYNSNPARYWDIFYKNNRENFFKDRKWLQIEFPSLYEATKPDAGPVTVFE
                     IGCGAGNTFFPILTENQNEQLRIVAADFAPRAVELVKTSDQFNPKYGHATVWDLANIE
                     GELPDGIEPNSVDIAVMIFVFSALSPEQWSKAMDNLHKILKPGGKILFRDYGRYDLAQ
                     VRFKKNRLLDDNFYVRGDGTRVYFFTEQELRDIFTEKYFVEKQIGTDRRLLVNRKRQL
                     KMYRVWLQAVFEVPNDVSTE"
     gene            complement(<1048734..>1049333)
                     /locus_tag="KLLA0_F11396g"
                     /db_xref="GeneID:2895089"
     mRNA            complement(<1048734..>1049333)
                     /locus_tag="KLLA0_F11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455599.1"
                     /db_xref="GeneID:2895089"
     CDS             complement(1048734..1049333)
                     /locus_tag="KLLA0_F11396g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455599.1"
                     /db_xref="GeneID:2895089"
                     /db_xref="UniProtKB/TrEMBL:Q6CKE0"
                     /translation="MGVADLIKKFESIAKDPVEDKGDSNHSAVETSPVNGQQVSSEGS
                     AEEEDKPAQEEEPAQEEEPAQEEEPAQEEEPAQEEEPAQETEPVVKEVIEESVKEEIE
                     ESEPVIEENSEDVAENEPTKAEEAEETPEASAEASAEAKDEAKDKDEAEHEGDTQDVN
                     EPASKSSNKNKNKKKKKKKNAANSESAAPAAEENSLRQD"
     gene            complement(<1049704..>1050210)
                     /locus_tag="KLLA0_F11418g"
                     /db_xref="GeneID:2895090"
     mRNA            complement(<1049704..>1050210)
                     /locus_tag="KLLA0_F11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455600.1"
                     /db_xref="GeneID:2895090"
     CDS             complement(1049704..1050210)
                     /locus_tag="KLLA0_F11418g"
                     /note="weakly similar to uniprot|Q12036 Saccharomyces
                     cerevisiae YPL148C PPT2 Phosphopantetheine:protein
                     transferase (PPTase) activates mitochondrial acyl carrier
                     protein (Acp1p) by phosphopantetheinylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455600.1"
                     /db_xref="GeneID:2895090"
                     /db_xref="GOA:Q6CKD9"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR016614"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD9"
                     /translation="MILPHIFLKNTNVISAATDIVFLPRVEKLLQRNSSSRLHRILKK
                     FMHPYEIKQFETLVNSGSSLKHKSIYIAGVWASKESLFKTLPHSSDRPSAIDIYTKLA
                     FKSNDPDGKPNLNLDQKRFSTGEHNITYWNEYLHSTRYEISISHDQDYLICILLHLRD
                     ANLNKWSV"
     gene            complement(<1050417..>1051088)
                     /locus_tag="KLLA0_F11440g"
                     /db_xref="GeneID:2895091"
     mRNA            complement(<1050417..>1051088)
                     /locus_tag="KLLA0_F11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455601.1"
                     /db_xref="GeneID:2895091"
     CDS             complement(1050417..1051088)
                     /locus_tag="KLLA0_F11440g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455601.1"
                     /db_xref="GeneID:2895091"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD8"
                     /translation="MSTFNLRNGSIFTKPTVDSIEPLQFHLKGSDQQVTAFPIFSADE
                     IPGTLVEFLYKLFNEEVESGTSYPHFGEHTKEEFTDYWFHSFAVVVLNTTEKTIDPKW
                     NNWDELVLGTFYVKPNYIGRCSHNCNAGFLVNPTFRGKKIGYRLGQVYLKWAPLLGYN
                     YSVFNLVFVTNPASWKIWDKLKFTRIGLVPKVAILNGIDEPVDAIIFGKDLTNVEPEL
                     FEDLK"
     gene            complement(<1051409..>1052272)
                     /locus_tag="KLLA0_F11462g"
                     /db_xref="GeneID:2895092"
     mRNA            complement(<1051409..>1052272)
                     /locus_tag="KLLA0_F11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455602.1"
                     /db_xref="GeneID:2895092"
     CDS             complement(1051409..1052272)
                     /locus_tag="KLLA0_F11462g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455602.1"
                     /db_xref="GeneID:2895092"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD7"
                     /translation="MSSTKVPGTLHLFKEKRVAFEFDPIGKSKALIFVGGLTDGLLTV
                     PYLQGLAKALDPLGYSLVQIQITSSYIGFGTGSLKRDDEEIDSLVDYLKKDGREMVLL
                     MGHSTGSQNTIHYLLHHPGKISGGILQAAVSDREFGSTVIPQPLLSKLNAEAKALVDA
                     GKPEELLSSKHAECMLDTPITAYRWCSLLLPDGDDDFFSSDLSDEKLEITFGYIKDPF
                     LIALSEKDECYPNNGKPLELLQRWQCFVDKKLWSKNSGLIKGATHAVPEEDSQKELFK
                     MVTGFIKENGF"
     gene            <1052991..>1055528
                     /locus_tag="KLLA0_F11484g"
                     /db_xref="GeneID:2895946"
     mRNA            <1052991..>1055528
                     /locus_tag="KLLA0_F11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455603.1"
                     /db_xref="GeneID:2895946"
     CDS             1052991..1055528
                     /locus_tag="KLLA0_F11484g"
                     /note="similar to uniprot|P41909 Saccharomyces cerevisiae
                     YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
                     peroxisomal ATP-binding cassette transporter necessary for
                     transport of long-chain fatty acids into peroxisomes ABC
                     family long-chain fatty acid transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455603.1"
                     /db_xref="GeneID:2895946"
                     /db_xref="GOA:Q6CKD6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD6"
                     /translation="MPDISVKVKLTKLLVQLHYHILRLDLRNVKPKGYLSTLLRHCLT
                     LVRSSSEIGQGLGSRNDKFRRHAKLILWVFATIGISSSVGTVFWVNRVIAYWRNKKNA
                     RVTSHSVAKNQLLQNGTRELYISDGSKDKKIVVTPTEKDQYEHDKYLFKNLERDVKSQ
                     LFNSKFLQQLNVLSTILIPKFLHKNSLMLSAQIFFLILRTWLSLMVARLDGQIVRDII
                     SGQPRKFVIDMACWFFIAFPASYTNSAIKYIQRKLSLNFRSRLTRYIHDMYLDKRLVF
                     YKTAFDNEATSSIIANIDNSITNDVQKFCDAITNVFANVAKPVIDLVFFSIYLRDSLG
                     SFGVIGIFLNYFLTGYVLRKYSPPLGKLVSLRSSSEGDYYNYHLNMINNSEEIAFYQG
                     TSVERSKVNTLYDKLMDQMLLVDRSKVEYNIIEDYILKYTWSAWGYVFASIPIVLRTW
                     ASEETSESANMKDFIMNKRLMLSLADAGTRLMHSIKDISQLTGYTNRVFVLLKVLHRV
                     HDSNFDYGMVSSFDEAELNATSTTVVSNGKTAIRGTVQHDFNGIRFENIDVVIPSARG
                     INGTTLVKGLTFQIPAVINPEPSSSKQVSLANVRDPLDQSRFMINHGMGSSLLILGPN
                     SCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFCVPQRPYFIQGGTFRDQIIYPMTYE
                     QFHERGHKDTYLVQILREVRLDYLLKRDRGLNYFDAIADWKDVLSGGEKQRMNFTRIM
                     FHRPRFVVLDEATNAISVDMEDHLFTMLKRYRFNFISISQRPSLIKYHDYLLELTNGT
                     DWSLQALGSDEAILSIENEIETLNQKLTKVKEWERQRDELQAKLTLV"
     gene            complement(<1055769..>1057103)
                     /locus_tag="KLLA0_F11506g"
                     /db_xref="GeneID:2895947"
     mRNA            complement(<1055769..>1057103)
                     /locus_tag="KLLA0_F11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455604.1"
                     /db_xref="GeneID:2895947"
     CDS             complement(1055769..1057103)
                     /locus_tag="KLLA0_F11506g"
                     /note="similar to uniprot|Q75BZ3 Ashbya gossypii ACR126W
                     ACR126Wp and some similarites with YPL146C uniprot|Q12080
                     Saccharomyces cerevisiae YPL146C NOP53 Nucleolar protein
                     involved in biogenesis of the 60S subunit of the ribosome
                     interacts with rRNA processing factors Cbf5p and Nop2p
                     null mutant is viable but growth is severely impaired"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455604.1"
                     /db_xref="GeneID:2895947"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD5"
                     /translation="MAGSKDRPAQYKQSSRKGKKAWRKNIDISDVERKLEEKQILETT
                     HGKQNLTELSDDALFAVDTEGDQVLKQKLVKRKAIKKTLKSTEILESIKSKSKVPALT
                     NPKTANKKHDKIQGVSKKELDRLLALAGKKIGESKLKARVAKEGLVKSGSLDLWGEDA
                     GKEVKVPSGLKLKIAPEEVEKLPNGFLKQSTTSWSVATVKPDSIARVPEIVKERDVIP
                     HAGKSYNPSKEEWEALISTEYEGELINEQRRIALEQYKQRIQHLMDTIEDKEEEDSDS
                     EEENESELDDKDLSEEGEETKLSLNPATKNKKKTKYQRNKQRRHEEKVKLQQELKKLK
                     EKVLKLEKLEEIQQEVESTVPNPVSTAGKVKKNKKHKLGTKHSVMEDNLEVKFSDELS
                     DSLRKLRPEGNLLYDTVRALQSSGRVESRIPIRKGRRYKPRVTEKWTYKDFK"
     gene            complement(<1057527..>1059788)
                     /locus_tag="KLLA0_F11528g"
                     /db_xref="GeneID:2895948"
     mRNA            complement(<1057527..>1059788)
                     /locus_tag="KLLA0_F11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455605.1"
                     /db_xref="GeneID:2895948"
     CDS             complement(1057527..1059788)
                     /locus_tag="KLLA0_F11528g"
                     /note="weakly similar to uniprot|P17629 Saccharomyces
                     cerevisiae YDR138W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455605.1"
                     /db_xref="GeneID:2895948"
                     /db_xref="InterPro:IPR021861"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD4"
                     /translation="MEDLESSLAEIVDQLQIKLYEDPERPIPENVLSEPLKRENISEG
                     VLSSSFSLDTELSLGKRELLLKGLLNELVTNAGDTDMRKLSVLLDFCYHLKYVGEEDE
                     SKVWAALFFDLTATCILTLTFPHELGQFYTYLRSRLSWYLEGLSKEPVSNGGTNLKMG
                     IRPPAAKLFFSIDTFFKNIDSHSLFITPNHFELVHKLLWWISQLIPINDHCNINRRAK
                     ITDEYPETFWAPHLPALPSSPTILSDWTKICDDFFLHPLHWLFSHPRDKLTLEPVVHR
                     FVDEIFVYETELYNLIKGKNEKHAKQEAAVNGKDFYPLNFIDNVYDEPDDSRNSIFPS
                     KVEFWKEFNLESTKSENIIQLLPLELDLFDLRSFQDRIEAYEYDYFRKLVISQVYLTF
                     YLLKEIISNDTLVHYYGKIFNQSSLSHSSKWRVEYGDNVLNKNDSAINFLTKKLNRIS
                     SFYEIRDRQFYELLNHLAQNELDALNQKVGDFSNLKDIHWSSDLITVPTANNAFKKFG
                     WIKLGNKKLDGLWKVQSGLDLARKYSENNRQDPSELYDTIISEYKDKTEKTDGDETTT
                     DNVIVKQWQNLRSLRPKYLFEFNKVSEKTTLAGFANEELIRNDIESKKRRLAERIESK
                     KKKHSEQVAEAEQFFKDKEQERKDLLQAKIKSQRETLENGKNDKTTSPDDQDNDSLKR
                     RHDSPEADGNEEEQAVSKKQKLEEEVEEPDADAEAQKEKALESEPTELKTIESTETEV
                     EVPKEHEGSSHTE"
     gene            <1060194..>1061885
                     /locus_tag="KLLA0_F11550g"
                     /db_xref="GeneID:2895949"
     mRNA            <1060194..>1061885
                     /locus_tag="KLLA0_F11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455606.1"
                     /db_xref="GeneID:2895949"
     CDS             1060194..1061885
                     /locus_tag="KLLA0_F11550g"
                     /note="some similarites with uniprot|Q12500 Saccharomyces
                     cerevisiae YLR114C AVL9 PHO85 Requiring"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455606.1"
                     /db_xref="GeneID:2895949"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="UniProtKB/TrEMBL:Q6CKD3"
                     /translation="MNNNVVFGCGLVDFHHTRGPEIEYWYDGGTTALNVNNLWEYLPF
                     QALPDGAHSYEQSFTYFTLLYDEVNKKCCSSVGDSLKDGDQSGRYSTFFAISCSKQIQ
                     SDTLIKKPKDVIRSTVQKSLVVVCRKPILGQIKDKLAIITNALFMQRDFTDKTIIDTL
                     YSNLNSIEYDDHDESHLYVGLNLRKTVYDLRKEVLVILKAILLEKKVLFYGNDVEQLC
                     NIQFAFISLIPCLLSNIQDCGSPMLDTYSKNMTMVNSFKSSDRGSVLRFLGFPLQIFT
                     KGGFFSPYVPLQQMNDLTASVTKWFVAGTSNTLLLEQSKTLCDLLVNIDDSTVQIMNK
                     KDKDLHQALQLSQSDKKWMDVVIQSVLKSWNQDDYSTLRNSQFEGSEDYIRWQFEDYL
                     SGLVLTVKLLEFTKKYKNNAALLKTVDDLATTEQTINQYNSTWVRDWQHTNNYRIFKQ
                     YTDDRLFDVFDSRHPYRGSDAMAVVQQRFNKIFSRKEKGEDKSRERHPEGEIVNKGGM
                     KDHNRGNWFKKKEKKGYQNDGPESIATTDPLILSKDDTQPTVADIPGEITENPWR"
     gene            complement(<1061995..>1063788)
                     /locus_tag="KLLA0_F11572g"
                     /db_xref="GeneID:2895950"
     mRNA            complement(<1061995..>1063788)
                     /locus_tag="KLLA0_F11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_455607.1"
                     /db_xref="GeneID:2895950"
     CDS             complement(1061995..1063788)
                     /locus_tag="KLLA0_F11572g"
                     /note="weakly similar to uniprot|P16664 Saccharomyces
                     cerevisiae YDR137W RGP1 Subunit of a Golgi membrane
                     exchange factor (Ric1p-Rgp1p) that catalyzes nucleotide
                     exchange on Ypt6p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_455607.1"
                     /db_xref="GeneID:2895950"
                     /db_xref="InterPro:IPR014848"