GenomeNet

Database: RefSeq
Entry: NC_006043
LinkDB: NC_006043
Original site: NC_006043 
LOCUS       NC_006043            1249940 bp    DNA     linear   CON 20-APR-2018
DEFINITION  Debaryomyces hansenii CBS767 chromosome A complete sequence.
ACCESSION   NC_006043
VERSION     NC_006043.2
DBLINK      BioProject: PRJNA12410
            BioSample: SAMEA3138183
            Assembly: GCF_000006445.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Debaryomyces hansenii CBS767
  ORGANISM  Debaryomyces hansenii CBS767
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Debaryomyces.
REFERENCE   1  (bases 1 to 1249940)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1249940)
  AUTHORS   Casaregola,S., Val,M.E., Neuveglise,C., Talla,E., Martin,T.,
            Durrens,P., Barbe,V., Bleykasten,C., Bon,E., Despons,L.,
            Fritsch,E., Groppi,A., Iragne,F., Jauniaux,N., Leh,V., de
            Montigny,J., Pottier,S., Straub,M.L., Wirth,B., Wincker,P.,
            Sherman,D.J., Gaillardin,C. and Souciet,J.L.
  TITLE     The second release of the complete genome of Debaryomyces hansenii
            type strain CBS767
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1249940)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1249940)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382133.
            On Apr 13, 2010 this sequence version replaced NC_006043.1.
            This is an updated version of the complete genome sequence. The
            Debaryomyces hansenii sequence is made of 7 chromosomes (A to G).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1249940
                     /organism="Debaryomyces hansenii CBS767"
                     /mol_type="genomic DNA"
                     /strain="CBS767"
                     /type_material="culture from type material of Debaryomyces
                     hansenii"
                     /db_xref="taxon:284592"
                     /chromosome="A"
     gene            complement(<2023..>6370)
                     /locus_tag="DEHA2A00110g"
                     /db_xref="GeneID:8998143"
     mRNA            complement(join(<2023..6069,6191..>6370))
                     /locus_tag="DEHA2A00110g"
                     /product="DEHA2A00110p"
                     /transcript_id="XM_002769902.1"
                     /db_xref="GeneID:8998143"
     CDS             complement(join(2023..6069,6191..6370))
                     /locus_tag="DEHA2A00110g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00110p"
                     /protein_id="XP_002769948.1"
                     /db_xref="GeneID:8998143"
                     /db_xref="UniProtKB/TrEMBL:B5RSN5"
                     /translation="MRRAASYRFGCELFFFMVVNGYHHKSSQRSSQRSSRSGFWTSTT
                     APSQPFNPALPVLLKPFFERYGDDGVQEPRDEHYMSHEEYEETYAAQFSYEFGSTKDT
                     KLRDVSETPINYDVSDYYFDPQLGLGIHKEIGLVVVFHRDPRKNYIIRSLLFERYAQA
                     IMCKMTSFRGALQLSRAKDELSSKLVLSCEMGEPGLEHARGKLSPQCMPLQAVPIHFG
                     FGCGCGIIRRRYGELSRHSCIQRDSIRPMAFQKFPQRYGLRPANFEVYCPTDDGYVEA
                     RARDGPASSSSSSSSSSSSSSLSGTATTVQNHSRTTTVPDSQHHPLVKKILQEVDREI
                     VDIQVKGMKEANFVPKIAQLLVGAMTLFSANINHVNLAGLEVVRLFKGAANNTGRASN
                     NFNRRPSTYFRAVQTYSTCVQYSKYMAELVYMVLMYGPKPAASLALTEMLDKYRDDEV
                     VLEVNSRDYHNLTGYSQFITAEERTRILDQTFTESSLRDIDQLVHWIMDHCIRKEFDE
                     NLSVAGDEQQQQPDIDIESDAIAAGILDEDGDDNNETPEVYLEAMNTTMSSSQQQTAA
                     ESLASLYYPVYGVNNNAEEEEEQNTSNENAFVVYLGYLGAKYPTKQYCRSLSGICYVA
                     KTCVLLDIIKRARTRRVSLRDAEDPSVVDTGSYRILAQVRTHYTYLGLSLARSEGNLF
                     RLNFSTGDIFNSDNVVVGHTNMISKIFGRLYDLAQETIQDLSNGEELDYSVDNARLSD
                     GMVSFTECVRVPSYSRYKHRLLSIHNNNIDSFRKAHTNLSLILITLLHISCLPARSTE
                     IDRLSVEGTSKEYRGVYFLGPTFGFCYNYNKSANSKDPIIREIGPELSSLFLWYVLVF
                     RRMYVESSRVESSEKLYQFDAMSPDKIRRGVSYWFTYGMNNQREYKFCEVRQILKRCI
                     EFHYTKSVTADLDMYRSVYETIARTSGHSVATSTEHYGTIANYPPSVNAADVLRSRHL
                     GQVWHRSGLRRKFIGFEGEVVEPEGEPGDVDDVASDVSIDPASPVNEEVEEVEPLRDD
                     IGGNPVYADDEVDSISDMLMEIPRIDYNRAVGSDPTPVPPLEPSAVPPSEPPAPSRSV
                     PVSAPDAPPVSVSWNDSSLSPNHASSPYVHQLPGYRPPFSPPYHHAPVSSGFALPPQD
                     AYLGAPLYDAHVSREVLSGARKRHSREKKERKERKMERKRKEKERISKREEDIRKREE
                     KIRKREEKEKIRKREKREKRERKRAEEKREKESAALASPVTPVRTLKVKDVHLYSSAT
                     SGRLFRRESPSGPSGPSSPRAMPSGPPTPNSSARRVHPLIYQSSTQSSAVPGSSHPTR
                     VQKQPKQPPSARSLGSPPSFPETPRRSLLSPQHLRQRITESLQASPLGRFFAPSDSPK
                     SVARKGPKIPKNDPVVDDSDYSESDYSDED"
     gene            complement(<6587..>7810)
                     /locus_tag="DEHA2A00132g"
                     /db_xref="GeneID:2899348"
     mRNA            complement(<6587..>7810)
                     /locus_tag="DEHA2A00132g"
                     /product="DEHA2A00132p"
                     /transcript_id="XM_456331.1"
                     /db_xref="GeneID:2899348"
     CDS             complement(6587..7810)
                     /locus_tag="DEHA2A00132g"
                     /note="similar to uniprot|Q03558 Saccharomyces cerevisiae
                     YHR179W NADPH dehydrogenase 2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00132p"
                     /protein_id="XP_456331.1"
                     /db_xref="GeneID:2899348"
                     /db_xref="GOA:Q6BZN8"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BZN8"
                     /translation="MTKSFNYQLSTEFKPKSLADTSLFKPIKVGNMNLQHRAVLAPLT
                     RFRNHINSIPNPEAMGMYYGQRSSRPGTLVITEATIVSAAAGGYDTAPGIYNQEQIDA
                     WSKIFKRVHDNNSYVYLQLWSLGRQSDPANLKKIGKPFVSASDVYSDDRGITSEGVIA
                     EDGAIAVNNELRPMTIPEIKQYVNDYAQAARNSLAAGADGVEVHCGNSYMLNQFLDIS
                     SNLRTDEYGSQTLENRARFALECIDAVVEAVGADKVGVRFAPYGRFGGMSGSDDLTAI
                     ALYAYIFAELEKRAQQGKRVSYIHLVQARMTDFNINENDESAKFDTEFVYKIWKGVVM
                     KAGAYATDPAAVRREVEVGQTLIAYGRYFISNPDLPDRLALGKPLTKYVRDSFYLPDP
                     IAGYVDYPTYKQQDL"
     gene            <8314..>9354
                     /locus_tag="DEHA2A00154g"
                     /db_xref="GeneID:2899349"
     mRNA            <8314..>9354
                     /locus_tag="DEHA2A00154g"
                     /product="DEHA2A00154p"
                     /transcript_id="XM_456332.1"
                     /db_xref="GeneID:2899349"
     CDS             8314..9354
                     /locus_tag="DEHA2A00154g"
                     /note="weakly similar to uniprot|P00330 Saccharomyces
                     cerevisiae YOL086C ADH1 Alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00154p"
                     /protein_id="XP_456332.2"
                     /db_xref="GeneID:2899349"
                     /db_xref="GOA:Q6BZN7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BZN7"
                     /translation="MSTQTVFRINKGTSYEDISVNKEEIPVPAANEVLIKVKAVSLNY
                     RDIAISTGAYPFPVKRDVVPCSDASGEVVSFGHNVRGFEVGDKVVSNFDITNLYGPQQ
                     DWEGGLGGPIDGVLREYVTLPYESVVKAPSSSKLSFESLASLVCTGTTAWNALYGNNQ
                     LKPGQIVLLQGTGGVSMTGLLLAKAAGAITILTSSSDEKLERIKAKYGVDYTVNYKKF
                     PKWGEAVNQMIGKNRVDYIFENGGSGNIEQSIECIAYGGQIGIIGFLNVAKQSEMPDA
                     VALALSKGCVMRGIAVGSKQLLEELMRFVNSKGLSIPVDKSFKFSKPEVIEAYKHLQS
                     GSQVGKVCVTLD"
     gene            complement(<9632..>9844)
                     /locus_tag="DEHA2A00176g"
                     /db_xref="GeneID:2899340"
     mRNA            complement(<9632..>9844)
                     /locus_tag="DEHA2A00176g"
                     /product="DEHA2A00176p"
                     /transcript_id="XM_456333.1"
                     /db_xref="GeneID:2899340"
     CDS             complement(9632..9844)
                     /locus_tag="DEHA2A00176g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00176p"
                     /protein_id="XP_456333.1"
                     /db_xref="GeneID:2899340"
                     /db_xref="UniProtKB/TrEMBL:Q6BZN6"
                     /translation="MVAKIDHLLALRTLKDIELRIFSTLVLGYATSLKGDPSPICETI
                     SPFSQLWSFLNFKCSFIQGGIRFCHL"
     gene            <13806..>14132
                     /locus_tag="DEHA2A00198g"
                     /db_xref="GeneID:2899634"
     mRNA            <13806..>14132
                     /locus_tag="DEHA2A00198g"
                     /product="DEHA2A00198p"
                     /transcript_id="XM_456338.1"
                     /db_xref="GeneID:2899634"
     CDS             13806..14132
                     /locus_tag="DEHA2A00198g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00198p"
                     /protein_id="XP_456338.2"
                     /db_xref="GeneID:2899634"
                     /db_xref="UniProtKB/TrEMBL:Q6BZN1"
                     /translation="MLSIFKMPVSTLNQFVPLNLAMEQQNYFSSLPDEFHDNMPGFRL
                     LFNSDKMEFKIDGSVGVFKGVNCETDLPVNVSEAKNFISSSHSDHNYYLTTGLSEFVM
                     CSFCCS"
     gene            complement(<14558..>16519)
                     /locus_tag="DEHA2A00220g"
                     /db_xref="GeneID:2899347"
     mRNA            complement(<14558..>16519)
                     /locus_tag="DEHA2A00220g"
                     /product="DEHA2A00220p"
                     /transcript_id="XM_456339.1"
                     /db_xref="GeneID:2899347"
     CDS             complement(14558..16519)
                     /locus_tag="DEHA2A00220g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00220p"
                     /protein_id="XP_456339.1"
                     /db_xref="GeneID:2899347"
                     /db_xref="GOA:Q6BZN0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BZN0"
                     /translation="MNNSTFPNSIRRYILEGGGEDKDMDIDVDADIDLFEITKFNYRT
                     LFDKGANQNITHTEMVYKFFGTNKKSEMDMVTLKHKLYFDDHPDEWKELFIFFCVMPF
                     TEYEFQGVDGKLLNPDSLHAIGSSHGTDNVLIETFSELEFESFNKIIPEGRLAFNLEN
                     ILKTDIFSSNFNKDETKRILTKLLGVGFKEDYMLVTDISSTDEDTYRLNFMNYLFNPI
                     CEYVATLLKFEINIRTKNTAGRTGVNTKVPHQSNDIFHSHPDVVAYDKWKHRRSLAIV
                     EVKKLPILKGEKVVDFTESRMVSFIIQVVAEMFSDHTNKGMLTDSYTTILIEIDIERS
                     MDIVNQKLTGPENCKFIALNYRLLDCQSSGLTLRGGLISFIYEAFSANEYQLNDVKRG
                     LDAIYDYVRKSDEEYLTYLDGLGEKADKIFKNNYNSFMRKLHVIEPKIALGEFKRIDV
                     QSGVTFNSQLFKVNSKDVKMYLKEDIDETVELVVKVFDPAKAKRDHNKYVIKKHDMFD
                     NCRRAYLCEKRAYERLLPNFKFNSVYIAQEPVYGRFFIGNHYHALGPFIVLKYLAKET
                     LPRDEETYEKAKEQLNIIHLYNIIHGDISPRNILYSQGKVYFIDFGYSEYTEDKLGSN
                     PVSANPERIKSEHQQLCGIFGQPNPKEYE"
     gene            <17520..>19442
                     /locus_tag="DEHA2A00242g"
                     /db_xref="GeneID:2899322"
     mRNA            <17520..>19442
                     /locus_tag="DEHA2A00242g"
                     /product="DEHA2A00242p"
                     /transcript_id="XM_456341.1"
                     /db_xref="GeneID:2899322"
     CDS             17520..19442
                     /locus_tag="DEHA2A00242g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00242p"
                     /protein_id="XP_456341.2"
                     /db_xref="GeneID:2899322"
                     /db_xref="GOA:Q6BZM8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022167"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM8"
                     /translation="MYFSGVDSDIIAYNDPENRCIRVNLDLFIKVLNNNEQNTRVFLD
                     THLLKIRGNEDGQDRRAEKLVSKGNASVGLGNMPSIPIVVYSSRALITAEFREMSSDD
                     FKETYLAPLDKALEESNISIPLLAPAYPYPSGDAMHVEQAIQEYFNEIAIPIKGLYRD
                     VGDTNNYFGSPSIIRPTLDQRRIVQPDIIHMLTKSDLNTQYPEIVFGIGDYKTGVYKM
                     MQGFEEFKTAISNRRRLRSHSLGNFFPDREWSPRVLFALVLSKYIYQAFLCGTDRILI
                     SDHQTFSGFFRYEIVDGEMIIDYYVINNPETVENGITLRSAIAGFFYKNVADTADTKA
                     RLMKSFDIANNTGIKKLEESDPFFNVRPRDPSGSSGKLARRGFSGNLDSVKENDASDN
                     FDAIDGNTYCRVIYDSAEFYPDLKLPSPVFVKLYYYSSRLWEENSLMCLEIPEKEGYY
                     GMFFNELLINERIAKSEFASNFPKLLVSGYWNGLSDHPMHIFEYLGKEVPEEKWNNKE
                     VYKVIKSRLEELHSIGISHNDIRLANIHVSVSGKISLIDFGLSDYTNNEEHKKNDFET
                     LEYILRANGSNESFKHANRVNAKSEAIPADRADKNDKYGNDSNSSSEEVFDEGSSGTF
                     GTQITIEDIASKPSRR"
     gene            complement(<22619..>23977)
                     /locus_tag="DEHA2A00264g"
                     /db_xref="GeneID:2899331"
     mRNA            complement(<22619..>23977)
                     /locus_tag="DEHA2A00264g"
                     /product="DEHA2A00264p"
                     /transcript_id="XM_456344.1"
                     /db_xref="GeneID:2899331"
     CDS             complement(22619..23977)
                     /locus_tag="DEHA2A00264g"
                     /note="similar to uniprot|O94091 Candida albicans LIP1
                     Lipase 1 precursor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00264p"
                     /protein_id="XP_456344.2"
                     /db_xref="GeneID:2899331"
                     /db_xref="GOA:Q6BZM5"
                     /db_xref="InterPro:IPR005152"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM5"
                     /translation="MRLIIIVLSAIFCNIVCGAPAIPLKPRGLPTKPSEDPFYIAPEG
                     FESKSPGDVLKHREMNNSFGIVVIPEKIKSVHQFLVRSEDSFGEPIAAVTTIFEPYNA
                     DPTKLLSYQAAEDAANIDCSPSYAMQLGADADTILTAQIEQLLAQAGLNEGWYVVIPD
                     HQGPKSTFVVGESAGHIVLDSIRATLRSGNITGIHEDAKVTLWGYSGGSFASGWAAQM
                     HPTYASELKIVGAAYGGIVANISQVAEKNFGGPFTGFVMAAINGLANEYPKLDNLINE
                     IGYKDKLDKFRKATQMCLIEELPYYAFDQVSEYVDGDKQYLLSLPIVKNITEKNTMIG
                     SKYLPTIPLYFYQGKGDEIIPASGTDELHNDFCERGVDIDYHEDLLSEHIIQAVTGAG
                     GAFNWMRDRLNGKPHTQGCNKEITASNAITPEGLSGLGDIFSGAILTLFQKPIGPYED
                     VL"
     gene            <24949..>25434
                     /locus_tag="DEHA2A00286g"
                     /db_xref="GeneID:2899312"
     mRNA            <24949..>25434
                     /locus_tag="DEHA2A00286g"
                     /product="DEHA2A00286p"
                     /transcript_id="XM_456345.1"
                     /db_xref="GeneID:2899312"
     CDS             24949..25434
                     /locus_tag="DEHA2A00286g"
                     /note="some similarities with uniprot|Q9P559 Neurospora
                     crassa Hypothetical 35.0 kDa protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00286p"
                     /protein_id="XP_456345.2"
                     /db_xref="GeneID:2899312"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM4"
                     /translation="MVSTMTNTDNDKCMKYRVVRGTDSGYTSKLVASCSFKKGEVLEI
                     ITGATLGMKRYTTVQISEKEHIELNSDIVYLNHSCDPTCIMDVKNMLVRLIKDVPVGG
                     ELTFFYPSTEWDMDQPFRCWCKSSSCIETVNGARYLSKELLNNYFINEHILALHDKNS
                     G"
     gene            complement(<26440..>26640)
                     /locus_tag="DEHA2A00308g"
                     /db_xref="GeneID:2899328"
     mRNA            complement(<26440..>26640)
                     /locus_tag="DEHA2A00308g"
                     /product="DEHA2A00308p"
                     /transcript_id="XM_456347.1"
                     /db_xref="GeneID:2899328"
     CDS             complement(26440..26640)
                     /locus_tag="DEHA2A00308g"
                     /note="some similarities with uniprot|Q9HFS1 Candida
                     albicans Glycosyl-phosphatidylinositol protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00308p"
                     /protein_id="XP_456347.1"
                     /db_xref="GeneID:2899328"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM2"
                     /translation="MLSLDLLATTVITFYISSAQAETTNQCVTFPSVAKAASINGFAY
                     NIYNNLPECARPCVEEDTGCML"
     gene            complement(<26756..>26962)
                     /locus_tag="DEHA2A00330g"
                     /db_xref="GeneID:2899973"
     mRNA            complement(<26756..>26962)
                     /locus_tag="DEHA2A00330g"
                     /product="DEHA2A00330p"
                     /transcript_id="XM_456348.1"
                     /db_xref="GeneID:2899973"
     CDS             complement(26756..26962)
                     /locus_tag="DEHA2A00330g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00330p"
                     /protein_id="XP_456348.2"
                     /db_xref="GeneID:2899973"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM1"
                     /translation="MGDTSWPADIDEDKNNSNISDDNFFFNRKIKCGFFVIYGSSIVR
                     LSELYKGCSRILNTFNPDRISNCS"
     gene            complement(<27281..>27835)
                     /locus_tag="DEHA2A00352g"
                     /db_xref="GeneID:2899361"
     mRNA            complement(<27281..>27835)
                     /locus_tag="DEHA2A00352g"
                     /product="DEHA2A00352p"
                     /transcript_id="XM_456349.1"
                     /db_xref="GeneID:2899361"
     CDS             complement(27281..27835)
                     /locus_tag="DEHA2A00352g"
                     /note="similar to uniprot|Q9HFZ1 Candida albicans
                     Repressed by TUP1 protein 5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00352p"
                     /protein_id="XP_456349.2"
                     /db_xref="GeneID:2899361"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="UniProtKB/TrEMBL:Q6BZM0"
                     /translation="MKCLSLVTVYSSFIALARANNWATYPSVAKSASINGFADPIYTK
                     LPECGQECVDIPTDNTPCPYWDTGCFCVMPQWAGLIGECFASKCSGDDVASATSLALS
                     LCSSVGANMFLVPASITAVLNEAAAGKAQQEATTTDSSASSTSISESSIQSGSESTTE
                     NLAMMSANYDILSVIVVLLATLFL"
     gene            complement(<30389..>31498)
                     /locus_tag="DEHA2A00374g"
                     /db_xref="GeneID:2899291"
     mRNA            complement(<30389..>31498)
                     /locus_tag="DEHA2A00374g"
                     /product="DEHA2A00374p"
                     /transcript_id="XM_456350.1"
                     /db_xref="GeneID:2899291"
     CDS             complement(30389..31498)
                     /locus_tag="DEHA2A00374g"
                     /note="weakly similar to uniprot|P36081 Saccharomyces
                     cerevisiae YKL077w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00374p"
                     /protein_id="XP_456350.2"
                     /db_xref="GeneID:2899291"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL9"
                     /translation="MKLSNLFLVFWIETVLSLLLPLHKEDLVKYLEKRASKTTTLEKE
                     VWTTITGTKHTTITPFAFDGATVSASPIGDETTPWVSLDSSGVPYKVTPTVKDGKTTS
                     PSPTPTNTNFPTPLAAPPVLRCMGDRVADGNPFCIGEGAEFVVDETYWITWDPLYFNP
                     DNDSEGISKVKIKVRPFPNNESTSPIETSDWLENKDGFYAWTIESSDIDSDMDGYAQI
                     YLSPFRTSDTDSEEEDTAIGPVVRLISSKGDAYTKISRVPSDNNDENDSSDKKDDGGS
                     SNKAKIIVPAVVVPVFSIFLIAGAVFYYLLKKRKNAINKSSNSIKLGIFGKNKGYVGS
                     RSQRMGESELTETKSQDSSYSNKADGKSDQNTFKG"
     gene            <32152..>32877
                     /locus_tag="DEHA2A00396g"
                     /db_xref="GeneID:2899327"
     mRNA            <32152..>32877
                     /locus_tag="DEHA2A00396g"
                     /product="DEHA2A00396p"
                     /transcript_id="XM_456351.1"
                     /db_xref="GeneID:2899327"
     CDS             32152..32877
                     /locus_tag="DEHA2A00396g"
                     /note="weakly similar to uniprot|P28319 Saccharomyces
                     cerevisiae YKL096w CWP1 cell wall mannoprotein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00396p"
                     /protein_id="XP_456351.2"
                     /db_xref="GeneID:2899327"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL8"
                     /translation="MVRIIPLIIGLISSAICVSSSSFEFVLSSLNLDSEIQFDTYSLL
                     KYNGEGIVGLYADCDTCYNFTGLITDEGYFEITESSEGVFANSRYLNIDQTTGLFTVN
                     ETADTNVYVISTHLLYTNSSVDYTILEVEENKTYHLYFSDIKFDVADLGNSFSSILNT
                     IYPNGSTYISYSPTDASETASISSIDNVSPSTKTASASSASSYTTDQSSSSTAGVSYQ
                     YKKDIGVSGLVTLAFGYVLIYGF"
     gene            <33674..>34576
                     /locus_tag="DEHA2A00418g"
                     /db_xref="GeneID:2899321"
     mRNA            <33674..>34576
                     /locus_tag="DEHA2A00418g"
                     /product="DEHA2A00418p"
                     /transcript_id="XM_456352.1"
                     /db_xref="GeneID:2899321"
     CDS             33674..34576
                     /locus_tag="DEHA2A00418g"
                     /note="weakly similar to uniprot|P22134 Saccharomyces
                     cerevisiae YER142c MAG1 3-methyladenine DNA glycosylase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00418p"
                     /protein_id="XP_456352.2"
                     /db_xref="GeneID:2899321"
                     /db_xref="GOA:Q6BZL7"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL7"
                     /translation="MPNKETRNVRSLRKRVKKEYTEDDDEYYEETPKEKKAKLVKTSS
                     KKGAPSSYSGDSKEVLGNNSFEKAIALFEKTDPALSDFIKSCDDPNTLMDVKMNAYQT
                     LVKIIISQQLSTSAARSIMTKFIKLFLKEGESTEPDHQFKAHPHFPTPEIVKETSPER
                     LRSAGISFRKAGYLLIISEKFSDKNYLLNDDKKLNDMSNEDIARLLIDLKGIGPWAVD
                     IFLLLYMKRSDIFPISDAGIRKGLSMLIQNTSGKKGKKLNYLSIEEMEKYSENWKPYR
                     SVASWYLMKVSSPERVKGYLKIRE"
     gene            complement(<35065..>36033)
                     /locus_tag="DEHA2A00440g"
                     /db_xref="GeneID:2899629"
     mRNA            complement(<35065..>36033)
                     /locus_tag="DEHA2A00440g"
                     /product="DEHA2A00440p"
                     /transcript_id="XM_456353.1"
                     /db_xref="GeneID:2899629"
     CDS             complement(35065..36033)
                     /locus_tag="DEHA2A00440g"
                     /note="weakly similar to uniprot|P41903 Saccharomyces
                     cerevisiae YJR019C TES1 Thioesterase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00440p"
                     /protein_id="XP_456353.1"
                     /db_xref="GeneID:2899629"
                     /db_xref="GOA:Q6BZL6"
                     /db_xref="InterPro:IPR003703"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL6"
                     /translation="MKPGTRIENRFELIEKSDTVYEGARPLEKFLEQNRSVYGGEFIS
                     QAMYAAWKTIPGEEFTPNSLHAYFLKVGNNGSVIRYEVKKTNDGKNFCNRTVECYQTE
                     TNALCVVYMMSFSKKNDRNKLRSDHKSLEEGKFSLDFQKKPNFYFDKYVKTIDNINYI
                     EHTHEFFHHALPPEFFDTRLPPNYKNVSLSDREFGMFFRVNDDLTVAKDVIKSKFLLL
                     SYISDSFYLPSIYRALGHPIGPGMMKDVNISLDHCVNFHDVNFDPTQWMFMSWSYDRM
                     VNNRVLVNCFIYTLDGTMVASIRQEGLSFISKETLLGSDAPGIPKL"
     gene            <36268..>37098
                     /locus_tag="DEHA2A00462g"
                     /db_xref="GeneID:2899967"
     mRNA            <36268..>37098
                     /locus_tag="DEHA2A00462g"
                     /product="DEHA2A00462p"
                     /transcript_id="XM_456354.2"
                     /db_xref="GeneID:2899967"
     CDS             36268..37098
                     /locus_tag="DEHA2A00462g"
                     /note="similar to uniprot|Q05871 Saccharomyces cerevisiae
                     YLR284c ECI delta3-cis-delta2-trans-enoyl-CoA isomerase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00462p"
                     /protein_id="XP_456354.2"
                     /db_xref="GeneID:2899967"
                     /db_xref="GOA:Q6BZL5"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL5"
                     /translation="MSEGKDILYEVREKVTIITLNNPKKLNSLDKPQYILLAKLMEKA
                     DKEEGTVLTILQSTGRYFSAGAQLGGKDMLNLDPSVLLSHEYWLNEFVSKNVFLTDVF
                     HNHTKVLAAAVNGPIIGVSAAMVALCDLVYVMDETKMHIITPFTALGLVAEGASSSTF
                     FLRLGWSKAAEAIILAKPIPGTELNKLGFINKSYHETNFDSVEQFNQKVHDDLVSQFS
                     GLYEPSILANKQLLKANRDQLINSASSREVIKTFNNFVQGIPQSRFMEKMQQARENKM
                     "
     gene            complement(<38481..>39377)
                     /locus_tag="DEHA2A00484g"
                     /db_xref="GeneID:2899620"
     mRNA            complement(<38481..>39377)
                     /locus_tag="DEHA2A00484g"
                     /product="DEHA2A00484p"
                     /transcript_id="XM_456355.1"
                     /db_xref="GeneID:2899620"
     CDS             complement(38481..39377)
                     /locus_tag="DEHA2A00484g"
                     /note="weakly similar to uniprot|Q0CUF0 Aspergillus
                     terreus Predicted protein ATEG_02684"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00484p"
                     /protein_id="XP_456355.1"
                     /db_xref="GeneID:2899620"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL4"
                     /translation="MKFDTVILISLAALATSQNANTITESQAEIVVKKQLDSRSFGLK
                     DFLSDHMPWSGKKNWKDHEGKQHWNDNDGKEHWKDHDGNDCWNDKDGKKHWKDHEGKE
                     HWNDNDGKEHWKDRDGNDCWNDKDGKKHWKDHEGKKHWKDHEGKEHWKDHDGKEHWKD
                     HDGNDCWNDKDGKKHWKDHEGKEHWNDKDGKEHWKDHEGNDCWNDKDGKKHWKDHEGK
                     EHWKDHEGKKHWKDHEGKEHWNDKDGKEHWKDHDGNDCWNDKDGKKHWKDHEGKEHWK
                     DQDGKEHFYKPPIAMKRSNFQI"
     gene            complement(<41695..>43455)
                     /locus_tag="DEHA2A00506g"
                     /db_xref="GeneID:2899965"
     mRNA            complement(<41695..>43455)
                     /locus_tag="DEHA2A00506g"
                     /product="DEHA2A00506p"
                     /transcript_id="XM_456358.1"
                     /db_xref="GeneID:2899965"
     CDS             complement(41695..43455)
                     /locus_tag="DEHA2A00506g"
                     /note="weakly similar to uniprot|P53283 Saccharomyces
                     cerevisiae YGR138C TPO2 Polyamine transport protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00506p"
                     /protein_id="XP_456358.1"
                     /db_xref="GeneID:2899965"
                     /db_xref="GOA:Q6BZL1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL1"
                     /translation="MSMQSSKLRDDSQTFIDDTSINSEKVHAFEGHNADVQPVIRQRS
                     NSKIEDRESLSKLISNNKGVERIVSELEEGAGKLGGLEEPLDLKRIETHPDPNSSFNE
                     KDPWKYPIDQETGLRLVEFVPGDKKNPLNISKARKWFYTFLLGIICFVVALGSAIVTG
                     DISGPKEYFGVTEEIIILASVTMFVLGFGFGPCLFAPLSEEIGRQPVYVGTLFLGVIF
                     IIPCALAQNIETLIICRLIDGLAFSAPMCLIGGSLADIWEASERGAAMAVFSAAPFLG
                     PVVGPIFGGLLGDNAPTWRWIYWCFLIIAGFFYVIFALAVPETHHNTILKRRAKKLRK
                     NTGDDRYRAIVELKIKNFKQVCNESLLRPFILLSELIIFLITLYMSVIYGLLYMFFFA
                     YPMVYGEGKGWSDSMVGVMFIPIGVGVVISSLIAPFVNRDYNKRAQVYRDKGELPPAE
                     LRLIPMMYSCWFVPAGLFSFAWSSYPSVSWAGPCFSGLAVGFGFTCLYNPANNYIVDS
                     YQHFAASGLAAKTFVRSMWGACVPLFTIQMYHRLGYEWASSLMAFISLACCAIPFGFY
                     YYGARIRTYSKYAYSPDSIN"
     gene            <44416..>44841
                     /locus_tag="DEHA2A00528g"
                     /db_xref="GeneID:2899964"
     mRNA            <44416..>44841
                     /locus_tag="DEHA2A00528g"
                     /product="DEHA2A00528p"
                     /transcript_id="XM_456359.1"
                     /db_xref="GeneID:2899964"
     CDS             44416..44841
                     /locus_tag="DEHA2A00528g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00528p"
                     /protein_id="XP_456359.1"
                     /db_xref="GeneID:2899964"
                     /db_xref="UniProtKB/TrEMBL:Q6BZL0"
                     /translation="MKYATTTVTIGGTTSDGAYSNSFPIQTLTAIVPQSADLVVEPYG
                     IFIAASQIDDLVPKWSVEKWYSQTATIWPSGKTSNTEGITYVENVPLGVNEYLDENGI
                     YLDATKFKGKDTSGGNQRLDKSMLFISLVIVLLLVTLTV"
     gene            complement(<45263..>46792)
                     /locus_tag="DEHA2A00550g"
                     /db_xref="GeneID:2899356"
     mRNA            complement(<45263..>46792)
                     /locus_tag="DEHA2A00550g"
                     /product="DEHA2A00550p"
                     /transcript_id="XM_456360.1"
                     /db_xref="GeneID:2899356"
     CDS             complement(45263..46792)
                     /locus_tag="DEHA2A00550g"
                     /note="similar to CA2211|IPF13921 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00550p"
                     /protein_id="XP_456360.2"
                     /db_xref="GeneID:2899356"
                     /db_xref="InterPro:IPR010640"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK9"
                     /translation="MNKKAFSDSNDRVITHTNDDVASAPHYQSQSTSSEAAMNEDEQQ
                     LTDSEGEDEFIRRHGHIDFQYIKKPKDAVWFIRPHALNYFKDGVLYRTKGERTSAKTE
                     LFLDLMYVGIISNLAGHATENASGGALLMYVLLFVPAWVVWADIKDFTNYYYTEDLSQ
                     KVYIIWILILLTLFVNSSSDVLNGIKGAAFTIVPYILCRVSLAISLLIYSLYIPEHRT
                     QMRIYSVCIFITSCIWIPVIFISTRAKIGVAIAVLFLEQLSFTVVYHPQTKRLLKLTT
                     STALNIEHEIERFATFVTIAIGEFLYKVVATNPLGTGFSSKFARGTFLLLIAYILFWI
                     YNNGSNSKKATHALRNNGWTAITWIYCHLPLVASLVLGADAGGDLTSLDITSLSKHQE
                     ESVLERSSEEEPNMYALSFFFTGSICVSLLCMCIIGLADKNEDPPNLHIVSRFWRVIW
                     RAPIGIIIVLLSFAELDSTLLMGIVTILLAVLLVYESIVSTPQDCINYPLARKRSLTL
                     E"
     gene            complement(<47242..>48924)
                     /locus_tag="DEHA2A00572g"
                     /db_xref="GeneID:2899358"
     mRNA            complement(<47242..>48924)
                     /locus_tag="DEHA2A00572g"
                     /product="DEHA2A00572p"
                     /transcript_id="XM_456361.1"
                     /db_xref="GeneID:2899358"
     CDS             complement(47242..48924)
                     /locus_tag="DEHA2A00572g"
                     /note="similar to uniprot|P53389 Saccharomyces cerevisiae
                     YNR055C HOL1 Putative ion transporter similar to the major
                     facilitator superfamily of transporters"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00572p"
                     /protein_id="XP_456361.2"
                     /db_xref="GeneID:2899358"
                     /db_xref="GOA:Q6BZK8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK8"
                     /translation="MSFLKLLFKNNDLGEEIPGTIHLIDVDQVPGISKVDSAKGNQNI
                     MLHPRPSSNPNDPLRWSHRKKKSQLFLLTFWAFIQNISSVWTGPVYDTWVDEFNCTYN
                     QLNIASGLVFVAIAVGCTTLQPIALKYGKRIVYIGCTILQIIGNIVYSQAHNVETTYI
                     ASALVGFAAAPIYSLVEISSTDIFFQHERAENISWLVLALQSGCALGPLAAGFITESL
                     NWRWCCYIMVIIFSVLLIIQIFTMEDSTFQREESPEELEENIVMQIRSHETFANSMQR
                     QPSSQNKKRDNHTVHIEPDIQYVDPSIPKRTYLQRLRLIENEFNDPTSIIVIFLKPFY
                     LVSFPIVVWCGILQGIQQMWLTLMTCTQSEFYSSAPYNFSSSMVGLSNLGQLVGIVAG
                     MAYGGKFVDWLTIQLAKRNNGIMEPEFRLYSMAFPTLINATGILTYCLGPAYKAHWFL
                     SVGVGQCCLGFAMASVTSICYTYCSDSYPKLASEGIVFISFLNNALATVFTFTIQSWI
                     DKDGLKLMAWLMFMLSLVLNGSFIVWVFYGKRVRRWTKNKYYQFCDDAGNHP"
     gene            complement(<49426..>51093)
                     /locus_tag="DEHA2A00594g"
                     /db_xref="GeneID:2899359"
     mRNA            complement(<49426..>51093)
                     /locus_tag="DEHA2A00594g"
                     /product="DEHA2A00594p"
                     /transcript_id="XM_456362.1"
                     /db_xref="GeneID:2899359"
     CDS             complement(49426..51093)
                     /locus_tag="DEHA2A00594g"
                     /note="similar to uniprot|P05066 Saccharomyces cerevisiae
                     YOR386W PHR1 DNA photolyase involved in photoreactivation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00594p"
                     /protein_id="XP_456362.2"
                     /db_xref="GeneID:2899359"
                     /db_xref="GOA:Q6BZK7"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018394"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK7"
                     /translation="MEPASKKTKLEELSKFGSKYYPYDIDNKTIISKYIKREDLKPIN
                     VLEAKLNDTRANRNNIDVGDSIAHLFLRDFRTIDNKGLSIASELATTTKTPLITFHIF
                     CLEEFDAHSVSPFKLEYMLGSLDVLKKDLREMNIPLVSLQVEKRKDVPTKIAEFLEQN
                     NTSHVFCNMEYEVDELRLLSKLVCFLLDKHISFNPVHDSCIVKPGELKTKSKGTQYAV
                     FTPWYKAWCNYLKIEDAPFMEYPRPHANESFSDPNKLFDSEIPQVPESKRLTHDQQKE
                     FDTCWKCGEHEAWSALSVFLESDKFKKYDESRNEISEESVSRMSCPISSGIISTRSII
                     RYILENKFVKKIDSGEQGTGWIRQIAWRDFYRHILCNWPYVCMFKPFLLEYDDLNWEY
                     NSDHFYKWCQGKTGFPIVDAAMRQLNQTGYLHNRCRMIVASFLSKHLLIDWKYGEYYF
                     MEHLIDGDFASNNGGWGFSSSTGVDPQPYFRIFNPWLQSERFDKKGTYIRTWVPELKD
                     IQDEKGIHNPYEKGYGHIAEKNGYPKPIVDHKYCRERALNRFKDAKY"
     gene            complement(<51402..>52457)
                     /locus_tag="DEHA2A00616g"
                     /db_xref="GeneID:2899355"
     mRNA            complement(<51402..>52457)
                     /locus_tag="DEHA2A00616g"
                     /product="DEHA2A00616p"
                     /transcript_id="XM_456363.1"
                     /db_xref="GeneID:2899355"
     CDS             complement(51402..52457)
                     /locus_tag="DEHA2A00616g"
                     /note="similar to uniprot|Q12525 Saccharomyces cerevisiae
                     YLL062C MHT1 S-methylmethionine-homocysteine
                     methyltransferase or uniprot|Q08985 Saccharomyces
                     cerevisiae YPL273W SAM4 S-adenosylmethionine-homocysteine
                     methyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00616p"
                     /protein_id="XP_456363.1"
                     /db_xref="GeneID:2899355"
                     /db_xref="GOA:Q6BZK6"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK6"
                     /translation="MINDINTLINTKPLVIDGALGTQLETKFSKLLQQDNINIQTHPL
                     WSALVLLKNPELIQEVHYDYMCSGANIITTSTYQASKRGLLEYAPGIENDDEVNAVYD
                     KAIELAVDARSQYLENMGKGMNTLTNKEIFICGSIGPFGAYLANGAEYTGKYGSHITE
                     PQELKKFHYDITSQFISNPKCDIIGFETIPNYSEFQQIVHLMEELLQKTNKPFYISLN
                     FKDPKTICDGTPITQVVDYLNERLSNNEKLRSAFIGLGCNCVPLEIATNILLNMSDLN
                     NVHRFPLIAYPNAGLNYDLSKGEYSIKSSEKQVWEDSCREWLEKLNVRLVGACCGSGP
                     DEILTIREVTDKFAGQR"
     gene            <52704..>54347
                     /locus_tag="DEHA2A00638g"
                     /db_xref="GeneID:2899357"
     mRNA            <52704..>54347
                     /locus_tag="DEHA2A00638g"
                     /product="DEHA2A00638p"
                     /transcript_id="XM_456364.1"
                     /db_xref="GeneID:2899357"
     CDS             52704..54347
                     /locus_tag="DEHA2A00638g"
                     /note="similar to uniprot|P32487 Saccharomyces cerevisiae
                     YNL268W LYP1 Lysine permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00638p"
                     /protein_id="XP_456364.2"
                     /db_xref="GeneID:2899357"
                     /db_xref="GOA:Q6BZK5"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK5"
                     /translation="MSEVVTNSLEKKLSEVLNHELSLNENDQEEERGKTNVERSLKSR
                     HLSMIALGGTIGTGLFISTSVPLNEAGPVNCLIAYIFIASVVYSVAQSLGEMATYIPV
                     AGSFTVFASRFVSPSIGAASGWLYWFCWAIGFAIELSVIGQIIEYWTSAVPNAAWIAI
                     FFVLLTVANLFPVRFYGEIEFWISSIKVITIMGWILYALIMVCGGGKYGAFGFRYWRN
                     PGPWGDGILVDNKNTGRFLGWFSSLINAIFSYQGTELVGVSAGECENPRKTVPSAIKK
                     VFYRIAIFFILSLFFMGLLVPYNDPKLNSETTYIASSPFVIAIQNSGTPVLPDIMNAV
                     ILTTIISAGNSDIYIASRTLYALANDKLAPRIFTLTINGIPYYSVLFSSLLGLLGFLS
                     LSAKGLVAFNWLVNISATSGLFAWVFISFSHIRFIKGLKLKGIVRSEELPFVAKGMPI
                     YAWYSVSVITFLIFFQGYEVFVGKFSVAEFFAAYISNIFFVILFVFFQFVWFRNTKFL
                     VPLEEMDIDTGKMPFFDYEMKNETSSGKQKREKLWNIIA"
     gene            <54756..>55436
                     /locus_tag="DEHA2A00660g"
                     /db_xref="GeneID:2899360"
     mRNA            <54756..>55436
                     /locus_tag="DEHA2A00660g"
                     /product="DEHA2A00660p"
                     /transcript_id="XM_456365.1"
                     /db_xref="GeneID:2899360"
     CDS             54756..55436
                     /locus_tag="DEHA2A00660g"
                     /note="weakly similar to uniprot|Q9R6H5 Agrobacterium
                     tumefaciens TIORF84 protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00660p"
                     /protein_id="XP_456365.1"
                     /db_xref="GeneID:2899360"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK4"
                     /translation="MGIKLYELRGKDPKYLWSSNPWKARMCLKLKGIEFESVPLTYPE
                     IHAILPGILHKENGCTVPVLVDGENVIQDSFKIAQYLEEKYTGASIFQGNLALHEFIY
                     NWIAEIKEPLFKLVILDIANKLDYESKEYYIKKNTALYGDLSTAALKDREVNVKRIQK
                     NLNLLLDNLKQNTFLSGETIGWTDISLASFLYMIKLANESVLNEVIASTDQDLFNGWW
                     NNMSKLMV"
     gene            <55808..>56890
                     /locus_tag="DEHA2A00682g"
                     /db_xref="GeneID:2899354"
     mRNA            <55808..>56890
                     /locus_tag="DEHA2A00682g"
                     /product="DEHA2A00682p"
                     /transcript_id="XM_456366.1"
                     /db_xref="GeneID:2899354"
     CDS             55808..56890
                     /locus_tag="DEHA2A00682g"
                     /note="similar to uniprot|P54007 Saccharomyces cerevisiae
                     YLR460C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00682p"
                     /protein_id="XP_456366.2"
                     /db_xref="GeneID:2899354"
                     /db_xref="GOA:Q6BZK3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK3"
                     /translation="MTTTIAAVLQKSTSQLQVKEVPVAPINSDEILIESKAASINGTD
                     YYHIDYDWAPDGAIMGLTVSGIVLKVGKDVKRFGPGDFIASFIHGGDYSNPDKGAYSK
                     FAIVQEVYSIKLNELSSSNLQILQSGNIDTFEGACSIPDAIITLGCSLYFTLGGSFSQ
                     LQNKSLLIYGGSTATGLVASQIAKQFGWTVISVASKKHATLIKGFGADYLIDYHDSNV
                     MQQIKNIDPNITMALHTIGGIATLQLTHDSVSDVMPTKIDSLVASNFEAIKNPKSNVE
                     FTMTRAFTANGNEARYNNGSVFPAIPGIKEAMLEFIPTIQKSINNNEIKHIPIKIQPN
                     GLNGINDGLKLIREGEISGEKLVIQF"
     gene            complement(<57034..>58488)
                     /locus_tag="DEHA2A00704g"
                     /db_xref="GeneID:2899352"
     mRNA            complement(<57034..>58488)
                     /locus_tag="DEHA2A00704g"
                     /product="DEHA2A00704p"
                     /transcript_id="XM_456367.1"
                     /db_xref="GeneID:2899352"
     CDS             complement(57034..58488)
                     /locus_tag="DEHA2A00704g"
                     /note="similar to CA1079|CaLIP1 Candida albicans CaLIP1
                     Secretory lipase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00704p"
                     /protein_id="XP_456367.2"
                     /db_xref="GeneID:2899352"
                     /db_xref="GOA:Q6BZK2"
                     /db_xref="InterPro:IPR005152"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK2"
                     /translation="MYFRTIICISLSAMLMSVHAIPLTVLVPTQDSFYIPPEGFERYS
                     NGHILKLRKTPHPLRRAKQQINIKNSWQAMVRSSDSYGAATTIVTTIMEPYNADPEKV
                     VSYQIFENSACIDCPPSYGLQLGANETTLTESNEMYFIEIALNKGWFVITPDYEGPKA
                     AFSASIQEGQATLDSIRAVLKSSNTTGISNHAKVAMWGYSGGTIPTTWAAALQPTYAS
                     ELKANLVGAAFGGLVSNISSTAELLDGGIHVGLTVAAVAGLANEYPDFKEVIMNDIFH
                     NKTDQFNEIYKLCMTPEGPYYSEQKMFSGPERYFKSGWDILKDPVVSKVLNKNILGLD
                     KDHGIPDIPLFLYHGEKDQMASIEQAQRVYDNWCDWGIGSFEFAADASVGHHLAALTG
                     LGAAMEWLNKRLEGEIPLQGCSKIVRKSNAFYPGIEKSVFDFITSTAKSWFGIRIGPS
                     GLSPALGDTGRTASVVTNNGSVVVDQAYIDKINW"
     gene            complement(<59288..>61213)
                     /locus_tag="DEHA2A00726g"
                     /db_xref="GeneID:2899353"
     mRNA            complement(<59288..>61213)
                     /locus_tag="DEHA2A00726g"
                     /product="DEHA2A00726p"
                     /transcript_id="XM_456368.1"
                     /db_xref="GeneID:2899353"
     CDS             complement(59288..61213)
                     /locus_tag="DEHA2A00726g"
                     /note="similar to wi|NCU09649.1 Neurospora crassa"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00726p"
                     /protein_id="XP_456368.2"
                     /db_xref="GeneID:2899353"
                     /db_xref="GOA:Q6BZK1"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR008963"
                     /db_xref="InterPro:IPR015914"
                     /db_xref="InterPro:IPR025733"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6BZK1"
                     /translation="MQFKALYKIFIAISYLKTSFAILQVRDLPENKVAPVQHRLAYAG
                     DTGMVVSWNTYQQLEAPWVQYGLSPDSLDQTAESSESITYPTSITWNNHVVIKDLQPD
                     TTYYYKVANSENNSDIYKFVTAKSPGSPDEFSFSVVVDMGTMGELGLSEEVGKGAEGA
                     LEPGEQNTMQSLRNGMNEFEFLWHPGDIAYADYWLKEEIQHYLPNTTIADGYKVYEQI
                     LNAFYEELQPISAFKPYMVGPGNHEADCDNGGTSDKDNDIKYTNSICVPGQTNFTGYR
                     NHFRMPGAESGGTGNFWYSFDYGQVHFVQFNTETDFGNGLAGPEDAAPNGPQGSYPNE
                     QIDWLENDLASVNRTKTPWVIAAGHRPWYVVGEGCTDCKTAFESILNKHNVDLVVSGH
                     VHNYERQKPISNGIIDPNGLNDPSAPWYIVNGLGGHYDGLDPLEYPLPNYTEVAQDSA
                     YGWSKFTVHNCTHLTHEFVASANNSVLDRATLFKNRTCIVSSTNTTDTTNPEQSSLTN
                     SSIHSTHMYTNVSTVIDSIDPKVLDTKTKSNVKVITITSCSNNICSEASVSATPVLTT
                     TTIQGVENILTSYCPISNTGDNKTADTIISAPYSNSSISNASSISPLMVSSVGENSAA
                     KIAAGGVIGFIILALAF"
     gene            complement(<63079..>64797)
                     /locus_tag="DEHA2A00748g"
                     /db_xref="GeneID:8998083"
     mRNA            complement(<63079..>64797)
                     /locus_tag="DEHA2A00748g"
                     /product="DEHA2A00748p"
                     /transcript_id="XM_002769903.1"
                     /db_xref="GeneID:8998083"
     CDS             complement(63079..64797)
                     /locus_tag="DEHA2A00748g"
                     /note="similar to uniprot|P48813 Saccharomyces cerevisiae
                     YDR508C GNP1 High-affinity glutamine permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00748p"
                     /protein_id="XP_002769949.1"
                     /db_xref="GeneID:8998083"
                     /db_xref="GOA:B5RSN6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B5RSN6"
                     /translation="MVLGSEKKLKPVISETRRGSSASGSECDNIPSVGVTKWDRFVDS
                     FRRQHVQHGDEGKSLQKGISSRHLILMALVTGMGTGLFVGTGNILSTAGPLFLIVGYI
                     IVGSFLYPTLQAAGELAVNYSELSGGYNNYPSKFIDESVAFAVTWIYCIEWLSTFALE
                     LVTASITIRYWDGDQKINPDVWVTIIFVIVVSLHFVGSKAYGEGEFVIGCLKVLMVTG
                     FLIMSIVVNVGGGPEGKFIGGQYWHDPGYYTNFKGLCTVFVTGAFAFSQSEFVALSAA
                     EQPNPRRAIPTACKLVFWRILILFLGSLIMVGLLVPMNSPELMGASGGGSNASPFVLA
                     ATLHGVTVVPHIINAVILLSVCSVASSSLYASSRTLQSLADQGYAPKYFNYIDRSGRP
                     LRSLIACSIVGLFSYIAAYEKQETVFNWLLSISGLAQLFTWDVICISHIRFRQALKYN
                     GISTDSLGYTSSTGIWGSVYAIVIHWLILIASFYTALFPVGSSTPDAQSFFQNYLGAI
                     VLVFFYVCHKLWSRNWKFYVNICDIDINTDRTIFDEEILNLEKQEFQEKYNNDPWYKK
                     LTTILL"
     gene            complement(<66014..>66961)
                     /locus_tag="DEHA2A00770g"
                     /db_xref="GeneID:2899346"
     mRNA            complement(<66014..>66961)
                     /locus_tag="DEHA2A00770g"
                     /product="DEHA2A00770p"
                     /transcript_id="XM_456371.1"
                     /db_xref="GeneID:2899346"
     CDS             complement(66014..66961)
                     /locus_tag="DEHA2A00770g"
                     /note="similar to CA4338|IPF3616 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00770p"
                     /protein_id="XP_456371.1"
                     /db_xref="GeneID:2899346"
                     /db_xref="GOA:Q6BZJ8"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ8"
                     /translation="MMQGQYKIQLRNGVRIFSTFSNYDNHDVFCSGGERKWTRVIFLL
                     HGFPDNNSSYNSVWTVILDSVPEDEKVLLLAPSMRGYEPSSQGEQCDYKMSDLAGDVS
                     SWIKNISPDGIPVHLVGHDWGAIVAFKTASMYPEMITSMACLAIPYITNIRLWEFAWY
                     FPDQIYHSSYMFTMQFGWLYKKRLSDTSSNSYLDGLWRCWSPTWNYTVDEIDSVKRTL
                     QEPGVIDASTAYYRCIANPLNISNRRWNVDFKKVPTLLLGGERDGCMNEKLYRLEASK
                     LANNPYVKVKTISNVGHFLHREDPTKVGELITDWFSEYP"
     gene            <67584..>69506
                     /locus_tag="DEHA2A00792g"
                     /db_xref="GeneID:2899310"
     mRNA            <67584..>69506
                     /locus_tag="DEHA2A00792g"
                     /product="DEHA2A00792p"
                     /transcript_id="XM_456372.1"
                     /db_xref="GeneID:2899310"
     CDS             67584..69506
                     /locus_tag="DEHA2A00792g"
                     /note="similar to CA0276|IPF15015 Candida albicans
                     IPF15015"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00792p"
                     /protein_id="XP_456372.2"
                     /db_xref="GeneID:2899310"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ7"
                     /translation="MKFGPKTTRKILLVLVLLFTLTGLLWTSKKATVKYPSLDKGKYP
                     TLDKIKGFYNDKISAFQKKPNDHLVVYPRSFSSESKEKLEDHFNTYLGGITGNLKVLS
                     YNGPKSPLTNKIREDKYHKHEISLYDSVRDIGGDVDKCQPDINKKIKLDVTNSNTFGF
                     SFEKIVRKLVQQLKDDPAISELKGFFNEDLEKHLEEGKTGDHWFKFAGTSVWLEQYGV
                     HFMISRMMYSPPGPKKRSVLSLLYGQVYDEDWNEIENIDLIMPSSDSLTNDKSFRSIN
                     FPSFLPIPFYHDANYLSKRFYGPEDARMLLVKNDNGIEEPLIVFNAYHRKGSDEIKID
                     EASSSIKFEYYRSMFVGWPFQFQLGKQNVDGSSNPKHANNEYTKITELRNIASPRLKV
                     QKNWTPFVSNKARQVDGYDKNIYFVYRWQSLEIMKCQLTSITDVSQCTFEYKRVDDLP
                     IDASVGDLRGGTELISINNIFPSLDSHFKSDTEVWVGFSRAHIKSCGCGSSMYRPNLA
                     ILYKDGNKFKISQLSEFFSLDVKVTGWSDPEKVCQSREPDALIPNGISSWDVNSHMSG
                     LEQVHEDYITLILSAGDAVDHKIHIKNLLKAIIGQTSLLSSKEENGYNDDLVLCSLRY
                     SKDFCAAYGKEQLKEN"
     gene            complement(<69716..>70840)
                     /locus_tag="DEHA2A00814g"
                     /db_xref="GeneID:2899296"
     mRNA            complement(<69716..>70840)
                     /locus_tag="DEHA2A00814g"
                     /product="DEHA2A00814p"
                     /transcript_id="XM_456373.1"
                     /db_xref="GeneID:2899296"
     CDS             complement(69716..70840)
                     /locus_tag="DEHA2A00814g"
                     /note="similar to uniprot|P38716 Saccharomyces cerevisiae
                     YHR112c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00814p"
                     /protein_id="XP_456373.1"
                     /db_xref="GeneID:2899296"
                     /db_xref="GOA:Q6BZJ6"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ6"
                     /translation="MTGISTNAIHASDEVNPVRDVIPPINVSTTYKYADNPDDLVKWS
                     DMPEESSIIGNIFYSRITHPNSERVEKALESIVGGPSVAYSSGLGAFFAALTYFNPSI
                     VCIGKGYHGCHSIIDIFTRLKGLKVIGLDDDLDQLNAGDLICLETPVNPDGTVFDIEY
                     FAQKAHKKGAFLLIDSTFAPPPLQDPFKWGADMVLHSATKYLGGHSDLLAGVLVTNDD
                     KVKNQLVTDRLALGTNIANLESYLLLRSLRTFELRITRQAENTEKLVKHLVKNRDSYP
                     KLKKIYHSSLQTEAFVKKQLPNGYSPVFCIELDNESSAKEFPSKLRYFHHATSLGGVE
                     SLIEWRVLSDSTVSPTLLRVSVGAENADDLIADFDEALRS"
     gene            <71210..>72382
                     /locus_tag="DEHA2A00836g"
                     /db_xref="GeneID:2899337"
     mRNA            <71210..>72382
                     /locus_tag="DEHA2A00836g"
                     /product="DEHA2A00836p"
                     /transcript_id="XM_456374.1"
                     /db_xref="GeneID:2899337"
     CDS             71210..72382
                     /locus_tag="DEHA2A00836g"
                     /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
                     YOR390w or uniprot|Q08991 Saccharomyces cerevisiae
                     YPL279c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00836p"
                     /protein_id="XP_456374.2"
                     /db_xref="GeneID:2899337"
                     /db_xref="GOA:Q6BZJ5"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ5"
                     /translation="MSEETSVGPLEFRDGSFQEERRNVHRELESLEAESLSESLPEGF
                     NVEKNYTTKRHLRDVYTKTSGIMPVFLSIVSGSIWGVLGRKGLMVLTTYNGSFLSGVI
                     WANFAACVVMGMAVDSVNLWRELVDSRVYVNKGLIGVYVGVTTGFCGTLSSFSSVILE
                     AFNKSADTLPGDEYYYPNSAYGIMEFLAVIIAHMCLSLTGFQIGKHLIDLIDPILPIL
                     SKRVYRTLEIVWISLGLAAFIIIVVLIGVKSDGSWRSWTFSCFFAPFGALSRFFLSKY
                     LNPKVKNFPFGTFTANLWGSLLLAVFTLLGRGKLPGNTQSQIVTNVLNCHVLTGLDDG
                     FCGALTTVSTFVVELFGLNTSHSYRYGFYSIASSYAVTILVLGTYNWAVGLTNPVC"
     gene            <73069..>75036
                     /locus_tag="DEHA2A00858g"
                     /db_xref="GeneID:2899335"
     mRNA            <73069..>75036
                     /locus_tag="DEHA2A00858g"
                     /product="DEHA2A00858p"
                     /transcript_id="XM_456375.1"
                     /db_xref="GeneID:2899335"
     CDS             73069..75036
                     /locus_tag="DEHA2A00858g"
                     /note="similar to KLLA0D07414g Kluyveromyces lactis IPF
                     4910.1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00858p"
                     /protein_id="XP_456375.2"
                     /db_xref="GeneID:2899335"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ4"
                     /translation="MATAATIDMADEVNPPLTYEPVDSDIPASKIYGTLKPNHNGLEN
                     KNLYELASKWIDAFNAIVKEIQNDPSEKNLDKLNSVIASHASWKDHLALSWDYRQFHD
                     LDNIKDVAKNSFPSFKLKNFEIDTTADHRFDKAVGLQTIDKADETNSIPIQWVQIIVK
                     FENEFGYGNGLIRLISVDEKDAPGGLKAFTIYTALENIKGNEETLGRSRPQGVNHGQN
                     QGRISWLEKREKDFEWGSEKTPTVLIVGGGQGGLNVAARLKTMGIDCLIIEKNSKIGD
                     NWRNRYKFLVLHDPVWYDHLAYIKFPDVWPVFTPKDKLGDWFEAYSKSMELSYWVNKT
                     VSGADFDPVTGVWSVNIIDNDTGKLTNIKTKHIVMATGHSGEPNIPTFKDQDKFKGTI
                     VHSSQHSTGKSFQGENAVVVGCCNSGHDIAQDFYEQGAKPILVQRSTTCVINSEIGLK
                     VTTKGLYEEGGPKTETADLILQSMPVKLLNLVMQQQYRQTMILEKDLHESLKKSGFKT
                     DSGYGGTGLFGKYYRRGGGYYIDVGCSKLIADDKIKVQQGKNIERFTENGLVFSDGTK
                     IDNLAIVVLATGYSNMRDTARRIFGDKVADKLNPVWGLDDEGEINTMWRDSGHPKFWY
                     MGGNLAVSRYFSKRLALKIIAQERGFDKSNS"
     gene            complement(<75344..>77266)
                     /locus_tag="DEHA2A00880g"
                     /db_xref="GeneID:2899324"
     mRNA            complement(<75344..>77266)
                     /locus_tag="DEHA2A00880g"
                     /product="DEHA2A00880p"
                     /transcript_id="XM_456376.2"
                     /db_xref="GeneID:2899324"
     CDS             complement(75344..77266)
                     /locus_tag="DEHA2A00880g"
                     /note="similar to uniprot|P47083 Saccharomyces cerevisiae
                     YJR002w MPP10 component of the U3 small nucleolar
                     ribonucleoprotein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00880p"
                     /protein_id="XP_456376.2"
                     /db_xref="GeneID:2899324"
                     /db_xref="GOA:Q6BZJ3"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="InterPro:IPR012173"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ3"
                     /translation="MIIPKVYYLQIKMPQDILSVLKDNPQNVFGLFKAESQENSGYFN
                     ELIKTFLDPITKEYSVLDKIYVDGLDSTQVYGQTKIVLEGACEALLFDKIPKLKLEHS
                     LNHDSEEEASESDEENMQQQNESDDQEEENENDSDSFDDVEGQNEDDIETLNEDDEES
                     ESLNGNDASEAETQVPSEDEDVRPPKKDSFGLNDEFFDIDDFNKQILALENTNNAGDE
                     EEIDFFGDLDEEDDDEEQMEYFDDFYDKPGKVKTSNSLGGRQGENEDEENGDEENEDE
                     GNIEEDEELNENEYDNAVGSAMLDLFADEKQKSKDTENLSSYQKQQQQIQAEIAALES
                     ELVADKKWTMKGEIASKDRPQDSLLDDPESASLDFDRTSKPVPVITQEVTESIEDLIK
                     RRIKEGEFDDLPKRIITDISKFHNRQKFELSEQKSSKSLAEIYEDQYNNVDENKEVSE
                     ELQKQHDEISELFTKVTHKLDSLCSAHFIPKPHQMKTIDIKVSDAASISMEDAQPLHV
                     SNETTLAPQEIYKIGDDKPAANGSKGRSEVLLKSGLSYSKDELSREDKQRLRRANKRK
                     KSKHFNERKEYQEQKQKQDTTPSNSNKRQKVSDVVNTLSNAKNVTIIDKKGELRDAKG
                     NIRKSQKPKGSSGFKL"
     gene            <77390..>78148
                     /locus_tag="DEHA2A00902g"
                     /db_xref="GeneID:2899299"
     mRNA            <77390..>78148
                     /locus_tag="DEHA2A00902g"
                     /product="DEHA2A00902p"
                     /transcript_id="XM_456377.1"
                     /db_xref="GeneID:2899299"
     CDS             77390..78148
                     /locus_tag="DEHA2A00902g"
                     /note="similar to uniprot|P53123 Saccharomyces cerevisiae
                     YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00902p"
                     /protein_id="XP_456377.2"
                     /db_xref="GeneID:2899299"
                     /db_xref="GOA:Q6BZJ2"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ2"
                     /translation="MIRGIVPTTLGNASFIRKLGSRWKSKSVSSSRWLNRQKKDSHTK
                     ESKLQNFRSRAAFKLIEIDDKYRLFNRKSKNIVDLGFAPGAWTQVAIERTKSLNINAN
                     IIGVDLINCSPPEGASFIQGNILSKQTHNNIKEFFNNNKNHSECEEKPVDLIISDMMA
                     NTSGIKDNDHYASMELCDGALILASALLNKNGSMVMKFYTGKEDSLLKEKLQKMFHKV
                     FKMKPSACRDESREMYYIGVRKKNNTIDTSDLFS"
     gene            complement(78176..78272)
                     /locus_tag="DEHA2A00924r"
                     /db_xref="GeneID:8998108"
     tRNA            complement(join(78176..78212,78235..78272))
                     /locus_tag="DEHA2A00924r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (ACG) cove"
                     /db_xref="GeneID:8998108"
     gene            <79896..>81491
                     /locus_tag="DEHA2A00946g"
                     /db_xref="GeneID:2899334"
     mRNA            <79896..>81491
                     /locus_tag="DEHA2A00946g"
                     /product="DEHA2A00946p"
                     /transcript_id="XM_456379.1"
                     /db_xref="GeneID:2899334"
     CDS             79896..81491
                     /locus_tag="DEHA2A00946g"
                     /note="some similarities with uniprot|Q03180 Saccharomyces
                     cerevisiae YKL163W PIR3 Protein containing tandem internal
                     repeats"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00946p"
                     /protein_id="XP_456379.1"
                     /db_xref="GeneID:2899334"
                     /db_xref="GOA:Q6BZJ0"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6BZJ0"
                     /translation="MQLTFSLSVLTTLAVLTHAAYVPSQPWSTLTPSGTIDSASASSN
                     YDGSFALSIKTLGKGSTGTSAAPAAPTGGSADETEASAVAGAVASDAAVSVPTAPADI
                     GASAAPVESGATASVPTPASDVGASAPTGEAAALRKRSDIVNQLGDGQIQQGGGSGSD
                     SGSGSDSGSGSGSSGDSGSGSGSGSGSSSEGSGTPGGASGSGSTPGSGSEGSGAPGGA
                     SGSGSGSEDSGAPGGASGSDSTPGSGSGSGAPGGASGSGSGSEGSGAPGGASGSGSGS
                     EDSGAPGGASGSDSTPGSGSGSASEGSGSPGGASDSGSTPGSGSSSEGSGAPGGAGGN
                     DSPSKTADVMNQIGDGQVQQQQQTGSPNGQAAAQSQEAGVTAVADKTAANVASQVNDG
                     QVQQTGAADSKAVGTENGETCLKSDSLSVTLKDGVLRDSKDRIGAIVAGHQFQFDGPP
                     PQAGTIYAAGWSVVPSDYSGSSSESSDSSNSKRSDSPGKLALGSQTTFYKCNSGDFYN
                     LYDQSIGSQCEEVEVTILKAVEC"
     gene            complement(<81772..>82110)
                     /locus_tag="DEHA2A00968g"
                     /db_xref="GeneID:2899293"
     mRNA            complement(<81772..>82110)
                     /locus_tag="DEHA2A00968g"
                     /product="DEHA2A00968p"
                     /transcript_id="XM_456380.1"
                     /db_xref="GeneID:2899293"
     CDS             complement(81772..82110)
                     /locus_tag="DEHA2A00968g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A00968p"
                     /protein_id="XP_456380.1"
                     /db_xref="GeneID:2899293"
                     /db_xref="GOA:Q6BZI9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI9"
                     /translation="MDVPHKRGYMKFRLDRYYLTKGYFNLSHYIETIPLDNKDIELYR
                     KAKGQLEVIHRHGIIHGDIKTENILCARDGKVYIIDFAFSVTKNEWNTQKSMESDISD
                     LKYVFGLDEV"
     gene            83619..83690
                     /locus_tag="DEHA2A00990r"
                     /db_xref="GeneID:8998112"
     tRNA            83619..83690
                     /locus_tag="DEHA2A00990r"
                     /product="tRNA-Val"
                     /note="tRNA Val (CAC) cove score=64.96"
                     /db_xref="GeneID:8998112"
     gene            <84276..>84728
                     /locus_tag="DEHA2A01012g"
                     /db_xref="GeneID:2899298"
     mRNA            <84276..>84728
                     /locus_tag="DEHA2A01012g"
                     /product="DEHA2A01012p"
                     /transcript_id="XM_456383.1"
                     /db_xref="GeneID:2899298"
     CDS             84276..84728
                     /locus_tag="DEHA2A01012g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01012p"
                     /protein_id="XP_456383.1"
                     /db_xref="GeneID:2899298"
                     /db_xref="GOA:Q6BZI6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI6"
                     /translation="MANTIHYGYVSSPKEVLEQCLNAYNSERLFCQILANNPEFNSCY
                     VQHRRGYIKVTVANHYLAKGNFNLFKFIKTVTMPRDTETYVKAKKQLEIIHRNGIIHG
                     DIWKANILYTKEGKVFIIDFASSIPENQSTDEINKESDKAALEIIFED"
     gene            complement(<85189..>87235)
                     /locus_tag="DEHA2A01034g"
                     /db_xref="GeneID:2899302"
     mRNA            complement(join(<85189..86973,87047..>87235))
                     /locus_tag="DEHA2A01034g"
                     /product="DEHA2A01034p"
                     /transcript_id="XM_456384.1"
                     /db_xref="GeneID:2899302"
     CDS             complement(join(85189..86973,87047..87235))
                     /locus_tag="DEHA2A01034g"
                     /note="similar to uniprot|P36070 Saccharomyces cerevisiae
                     YKL125w RRN3 RNA polymerase I specific transcription
                     factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01034p"
                     /protein_id="XP_456384.2"
                     /db_xref="GeneID:2899302"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI5"
                     /translation="MIMSVHDPLSRKRSLSNPNGQEGSVSKKSKNEDDATMDRNNNTV
                     FSEKMYHTYVKSALESLDKNDSLPVDNLTSKISLPISHNQAISVSNFNTVLKILISNV
                     SRLDNSSCNNLISAILEYNWLGVKPASDSDGAYFTFIDLYSHFLSVLVSSLPKYLHEV
                     TTKLVSEFISININENPSANHHVILNKIIKFIPTSVNSFPATLQKNFPHHLSSSTEEL
                     TNFVGNLIKILTYCSELQYDIWQLIIECCIKLDVELQNELDDLDDDEIEELINGEEDD
                     EESDSDDEDANDDGASDINSDDEDEVVEGEFEYMIDPVTSTVNTRKLSRKLDSIIHLL
                     LTNTSNSFTVDELNNGNGVYLFNTITSLFKTHILPTHFTKSIQFTLFHISQYQPELAD
                     SFLVLLIDVAFNTTEILEKRLKAMQYLSSYIARAKNLSRHQIVFVVSYLIGWLNKYVI
                     ERECEITDYDNDNKGRSTNNKQGGGMERFKLFYAAFQALLYIFCFRYKVLYKTQGSTE
                     SSSDSEWECDLDKFFQRVIIAKFNPLKFCDETVVYIFAKIATKLNVCYCYSIIEHNKR
                     ERMLQTNGTKNLPSAVGNFKQKQEFLDLEAYFPFDPLVLPTCKVLIGENYIEWSDVNP
                     SNEDEDDDEDSGSHPEEGLSDSDNDNMSSDEDD"
     gene            <87482..>88384
                     /locus_tag="DEHA2A01056g"
                     /db_xref="GeneID:2899319"
     mRNA            <87482..>88384
                     /locus_tag="DEHA2A01056g"
                     /product="DEHA2A01056p"
                     /transcript_id="XM_456385.1"
                     /db_xref="GeneID:2899319"
     CDS             87482..88384
                     /locus_tag="DEHA2A01056g"
                     /note="weakly similar to CA3181|IPF12241 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01056p"
                     /protein_id="XP_456385.1"
                     /db_xref="GeneID:2899319"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI4"
                     /translation="MSDIHTVQLHSIALFNLSDHITRREKSKFGVLLGTTDKATITVT
                     TSFELLFDNDLDINTEFLKKRLDQFKAVLPQYSMVGFYQLINDRVPNSATMSVLNQLQ
                     VFQRLISTHEMPIVFTLINMGSFHNAEDYEPFKSFLSENEPIPLRTSILANETENIAT
                     STIVNHPNYFSSEISRDVNDINNDFKLDKYNEELSVSVTQLHAKVESIIEYLQHRPSG
                     SDLKNLEQEIKLHNLITYLSSKIVTFQRNHISADHNEQLQTTQLSLLTAQLLALDNLK
                     SQIAKNIIRFSIHTNSQSIGPIRH"
     gene            complement(88446..88527)
                     /locus_tag="DEHA2A01078r"
                     /db_xref="GeneID:8998119"
     tRNA            complement(88446..88527)
                     /locus_tag="DEHA2A01078r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (CAA) cove score=68.15"
                     /db_xref="GeneID:8998119"
     gene            <89320..>92145
                     /locus_tag="DEHA2A01100g"
                     /db_xref="GeneID:2899320"
     mRNA            <89320..>92145
                     /locus_tag="DEHA2A01100g"
                     /product="DEHA2A01100p"
                     /transcript_id="XM_456386.1"
                     /db_xref="GeneID:2899320"
     CDS             89320..92145
                     /locus_tag="DEHA2A01100g"
                     /note="weakly similar to uniprot|Q00816 Saccharomyces
                     cerevisiae YDR028C REG1 Regulatory subunit of type 1
                     protein phosphatase Glc7p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01100p"
                     /protein_id="XP_456386.2"
                     /db_xref="GeneID:2899320"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI3"
                     /translation="MSSTNNLGDVFTGGATTSQHVEAEDDDHFENTTFKLKRTRSLGL
                     LDEFIQPSDAEKAKLGELDSKGESEMSSANNASPSDGRSDNKGELDGDDDAVIDDDEA
                     DRESHKLQSPVVLKSPEMLPHDDTDIQYQPSRHVDYLSHQWDVSDISKSWRYVIQKRK
                     DVANSARLENASWRTWAQRRSNLKTISPEVVNWSKDSDVTWLYGPIMKDEENGEADEE
                     DNHKRITTATSAVAGDISIPNKQKKGPKPILKRRTVQDMMISHSNLLKLQLATNRMHD
                     KQRQQHESQVRNENQSHNENEPPEFDDYDAISAKLNSQYKNIDSQNNSIVNLQKLNDD
                     KKSESANSNSHQAPKNETNQPEHTSSDNATNIPPNNADVSAGANSTTNTSSPVPKEER
                     RIHFNDEVQQCIAVEEYSDEDDDDYYDDDEDDYYYDDDEEDYMYETPHEDQDDENEDD
                     EDDEDDDDDEGGFFLKVKSPSSPNAPVPGLSLSASKESTKNISNNDNTEDTDSISTTN
                     SKVHRSIHLLPSTTLNYGSSDEESDDDNPYTSSLSHNANNRGYDYYYDYNTVYTCDPD
                     HAIYGLNNKNDSKAPDVVDVPENITLGSNFDYEDIENEDFNNEKMPIIDPSIINNNNL
                     NYPTSNNDDNSSSKANDFASNSNSNGEKTNDNSKGFEKSNSPEPSDKKASPFNFSDSD
                     SENDSDDSENGLSISTRNSSQSLAQSVFTHNMTRSSNNDDEHQYPTYESQPVTGPVSS
                     INPRHSSTSISKQSTSSNSLSQSFFGGGLTKQDENDSKALASSFFDTNDDQDEELQDQ
                     GEAISSSDMPQLQKTLSNTQRKASPLPPHTTSANAFSGNTTPPLEKQPKNTFSFDSES
                     DSEEESSNDIIIPHVDNTTPSYASLSQVADKNGIRSPSPDVNSINSPQSNSSNSNSTT
                     LGNQNKNIVGQAKGLATHLLGNWKNNE"
     gene            complement(<93012..>93647)
                     /locus_tag="DEHA2A01122g"
                     /db_xref="GeneID:2899311"
     mRNA            complement(<93012..>93647)
                     /locus_tag="DEHA2A01122g"
                     /product="DEHA2A01122p"
                     /transcript_id="XM_456387.1"
                     /db_xref="GeneID:2899311"
     CDS             complement(93012..93647)
                     /locus_tag="DEHA2A01122g"
                     /note="similar to uniprot|P36087 Saccharomyces cerevisiae
                     YKL070W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01122p"
                     /protein_id="XP_456387.2"
                     /db_xref="GeneID:2899311"
                     /db_xref="GOA:Q6BZI2"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI2"
                     /translation="MYIPKYYAQENEESQESLIRANPLGTVISTGESGIIANHIPFYL
                     HVDKDTNKKYLQGHLAKVNHQVPLFKEKGEVLVIFQSPSSYISPTYYPTKNETHKVVP
                     TWDFASIHCYGVPRLIDDSDWVRSQLDNITAQHETKKPVPWKVSDAPENYVKLMQKAI
                     IGVEIEITRIECKFKFEQKMKRHDIDGVIDGLVKDEKPEIASYVTKANEIP"
     gene            complement(<94094..>95221)
                     /locus_tag="DEHA2A01144g"
                     /db_xref="GeneID:2899341"
     mRNA            complement(<94094..>95221)
                     /locus_tag="DEHA2A01144g"
                     /product="DEHA2A01144p"
                     /transcript_id="XM_456388.1"
                     /db_xref="GeneID:2899341"
     CDS             complement(94094..95221)
                     /locus_tag="DEHA2A01144g"
                     /note="similar to uniprot|P38716 Saccharomyces cerevisiae
                     YHR112c similarity to cystathionine gamma-synthases"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01144p"
                     /protein_id="XP_456388.1"
                     /db_xref="GeneID:2899341"
                     /db_xref="GOA:Q6BZI1"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI1"
                     /translation="MPGISTNSIHAADEVHKVADVMTPIHVTTTYKFDDDPEKLIKDE
                     DLPENSIIGNVVYARETNPNSERVEKLLDSILDGHTVAYTSGLAAFFAALTYFNPKVA
                     SIGKGYHGCHGILNIFSRLKGLKQISLEDDLNQLNAGDLICLETPVNPDGTVFDIQYY
                     ADKAHERGAFLLVDSTFAPPPLQDPFKWGADMVFHSATKYFGGHSDLLAGVLATKDIN
                     VKNQLVKDRVDLGSNISNLESFLLIRSLRTYELRILKQAENAEKLIKFLVDNREKYPK
                     LKKISHSSLQTEPFVKKQLSNGYSPVFCIELESEADAKQFPSKLRYFHHATSLGGVES
                     LIEWRVLSDSTVSPTLLRLSVGVENIDDLIADVDQGLKSIA"
     gene            complement(<95915..>96034)
                     /locus_tag="DEHA2A01166g"
                     /db_xref="GeneID:2899285"
     mRNA            complement(<95915..>96034)
                     /locus_tag="DEHA2A01166g"
                     /product="DEHA2A01166p"
                     /transcript_id="XM_456389.1"
                     /db_xref="GeneID:2899285"
     CDS             complement(95915..96034)
                     /locus_tag="DEHA2A01166g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01166p"
                     /protein_id="XP_456389.1"
                     /db_xref="GeneID:2899285"
                     /db_xref="UniProtKB/TrEMBL:Q6BZI0"
                     /translation="MELIKVLHEEAWNREKREFLMRAEIKPYCGSRNPAQLNI"
     gene            <97126..>97263
                     /locus_tag="DEHA2A01188g"
                     /db_xref="GeneID:8998123"
     mRNA            <97126..>97263
                     /locus_tag="DEHA2A01188g"
                     /product="DEHA2A01188p"
                     /transcript_id="XM_002769904.1"
                     /db_xref="GeneID:8998123"
     CDS             97126..97263
                     /locus_tag="DEHA2A01188g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01188p"
                     /protein_id="XP_002769950.1"
                     /db_xref="GeneID:8998123"
                     /db_xref="UniProtKB/TrEMBL:B5RSN7"
                     /translation="MLFSDEPTTGLDIKALQVLRKFISTIWNHDYLIYSSISTGNHCI
                     I"
     gene            <97913..>98869
                     /locus_tag="DEHA2A01210g"
                     /db_xref="GeneID:2899318"
     mRNA            <97913..>98869
                     /locus_tag="DEHA2A01210g"
                     /product="DEHA2A01210p"
                     /transcript_id="XM_456391.1"
                     /db_xref="GeneID:2899318"
     CDS             97913..98869
                     /locus_tag="DEHA2A01210g"
                     /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
                     YPL162c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01210p"
                     /protein_id="XP_456391.2"
                     /db_xref="GeneID:2899318"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH8"
                     /translation="MKSIPSILLTTFVAISLQTTGNRPKHPDDGDDDGKCELIGTFSL
                     ITQAFLGVLCLSSLIVKRFYEYPLRRTWPVWFFDVMKQLIGAFGVHVFNVFLSILKSK
                     KDPGVKCARNKDEDDTGDIDPCDWYFLNIVFDCTIGVLVLYFVFNAINRFCRNWLKIT
                     QIESGQYGPNSEKPSVRAFLKQLAVYFGSLMITKIFLYGIVECFETELLWITSHILLV
                     WLDEYPDEFEIFVVMFVVPVVMNCLQLVLVDNIIQNRIIGKVNGRMHHEYAGQSEADE
                     GHIRDEIEEFTRHGDHRHKRSRRHHSLPNNEGIKTYGTFNDV"
     gene            complement(<99035..>99217)
                     /locus_tag="DEHA2A01232g"
                     /db_xref="GeneID:2899289"
     mRNA            complement(<99035..>99217)
                     /locus_tag="DEHA2A01232g"
                     /product="DEHA2A01232p"
                     /transcript_id="XM_456392.1"
                     /db_xref="GeneID:2899289"
     CDS             complement(99035..99217)
                     /locus_tag="DEHA2A01232g"
                     /note="similar to uniprot|Q12287 Saccharomyces cerevisiae
                     YLL009C COX17 Copper metallochaperone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01232p"
                     /protein_id="XP_456392.1"
                     /db_xref="GeneID:2899289"
                     /db_xref="GOA:Q6BZH7"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH7"
                     /translation="MSAGGDNKKEETKPKPCCVCLDEKKKRDECLLFNGQESGKCDDL
                     ISKYKACMKGYGFETR"
     gene            <99436..>102765
                     /locus_tag="DEHA2A01254g"
                     /db_xref="GeneID:2899306"
     mRNA            <99436..>102765
                     /locus_tag="DEHA2A01254g"
                     /product="DEHA2A01254p"
                     /transcript_id="XM_456393.1"
                     /db_xref="GeneID:2899306"
     CDS             99436..102765
                     /locus_tag="DEHA2A01254g"
                     /note="weakly similar to uniprot|Q12071 Saccharomyces
                     cerevisiae YDR027c LUV1 interacts with the beta-tubulin
                     binding protein RBL2P"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01254p"
                     /protein_id="XP_456393.2"
                     /db_xref="GeneID:2899306"
                     /db_xref="GOA:Q6BZH6"
                     /db_xref="InterPro:IPR012501"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH6"
                     /translation="MSAESSGSNSEQKLSSQSPIRLSTDGSANLNDDLANGSEYSSSS
                     FVSLPNHNLHRRSGSAVSFKNSIDADSSFSSSAYFQILNNHNSQEDGKSNDIFSPLGP
                     NSIYELTIASDSSRAKRNRAPKNTVIINGGMTTVNNLRNPTLKDIPQIQLSKLKSKVE
                     NKELEASLIHGTEEDYKNFDSSYRLLTEDTLQKFIESDNSRHGNLSASSSLSNFPTKN
                     NYLQYNGDDISSIPKVFLDPDFRLDDPRIFKQVIGDCNLFSDNETPDENVKSTLAKNN
                     DLQEELSRYLDIVEVNLIKEISKSSDSFFNTIGDIKEIQSQSENCAVKFHDILDKLKL
                     LEEKECQRGLDILNKVNERKNVEHLESSLLQLKYLISIIDLARKSYENGNHAKSLNEI
                     VVAEHLINGIELEDPDEEKQALYPDLPYPAVDFSRVPAISDLNTEIQDLKQECSKGYI
                     SAFIDLLLEDLRQHYNNVSYQDTLNRMSTSINKTKKYDAKSVNNSYQSISEDKREKLK
                     EYIRNLAKSGHLSQSYANYQDRIITEIKDIIKVNLPSSTRSGVSSADMSNAPSRSSSA
                     PPESNNNLLQPGGGTSGNSLSSNIRCMTPKEFEIMLTKIYTCLSECLRRLTVQQKVLL
                     DFALTAIPPNSESNLDVMSLDITFAINKSIELTQIRLTKIINVRSEQTAEISLDHYLR
                     LYALSSAYLQECELINPGYVASGAGNSLNDWVKNHIGYFIHKFHSNSLAILANNCDKE
                     VWREITSDDALQEHQVLIDEICGYSEYIETDGKSGFSGDSWMEMLNLHETTKEDKRSK
                     SNKQLNGRLIIHDESFMIPNLTLKSLVSVREYLIISKIFSSKGSVVENNLLNYFKLMN
                     SKASQAVLNAGATRTAGLKHITTKHIALCIQLVEFNIALLSSLQGISKQSRNASPPPN
                     SHEEISFARILSNYKDHENELFSKLVSIMYDRTVNHCATIVTINLSEPLKHPQQCHSY
                     METLVKETTTVTKVLTKYLPEIKCSLILSQIFDNYKKLLVDCFCTQLSQFKDFNEKHS
                     LLKDIDYFRVKLSEIPGYGNSGQVIWENVNSLPTIEDTKMEEVMRNNIEGERQQTIDS
                     SHASQRNSSEVNNEENTATDQ"
     gene            complement(<102881..>104101)
                     /locus_tag="DEHA2A01276g"
                     /db_xref="GeneID:2899313"
     mRNA            complement(<102881..>104101)
                     /locus_tag="DEHA2A01276g"
                     /product="DEHA2A01276p"
                     /transcript_id="XM_456394.1"
                     /db_xref="GeneID:2899313"
     CDS             complement(102881..104101)
                     /locus_tag="DEHA2A01276g"
                     /note="similar to uniprot|Q06489 Saccharomyces cerevisiae
                     YPR118W Methylthioribose-1-phosphate isomerase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01276p"
                     /protein_id="XP_456394.2"
                     /db_xref="GeneID:2899313"
                     /db_xref="GOA:Q6BZH5"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR005251"
                     /db_xref="InterPro:IPR011559"
                     /db_xref="InterPro:IPR027363"
                     /translation="MSSEAKTLQAIKFDRETKTLDILDQLLIPYATEYISIKSIEDAY
                     QAIKLMQVRGAPAIAIVGAFSIVVDVYNNLKETKEKSRTIGDLVESIHYLITARPTAV
                     NLSNACLDIEKLILTEFKKDELVNQHTFDIVYQYSVALYDDDLDNNFKIGDNGLHYIV
                     ETLKSQSFTGPFSIITICNTGSLATSGHGTALGIIRTVFKKLSKDAGEKFWLEHVYPC
                     ETRPYNQGARLTTYELNYEGIPSTLVCDSMASSLIATLSKQRKVKSSTAPVKFIIAGA
                     DRIVENGDTANKIGTFQLSTIADYFNSRAEKENTIKFIIAAPRTTIDFKTKTGDGIII
                     EERPSQELTTLNGPVLTNNGVLEKQTVGIATPGIDVWNPAFDVTPHELIDCIVTEDTN
                     AFVKNSEGDFNLKV"
     gene            complement(<104219..>105571)
                     /locus_tag="DEHA2A01298g"
                     /db_xref="GeneID:2899292"
     mRNA            complement(<104219..>105571)
                     /locus_tag="DEHA2A01298g"
                     /product="DEHA2A01298p"
                     /transcript_id="XM_456395.1"
                     /db_xref="GeneID:2899292"
     CDS             complement(104219..105571)
                     /locus_tag="DEHA2A01298g"
                     /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
                     YMR026c PEX12 required for biogenesis of peroxisomes -
                     peroxin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01298p"
                     /protein_id="XP_456395.2"
                     /db_xref="GeneID:2899292"
                     /db_xref="GOA:Q6BZH4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH4"
                     /translation="MEYYSSLDASQLDSEIPTLFELISASQLESLLSPSLRYILVHYA
                     SKYPYLLLKVANNFEELNLFFRTFIEWYFMSYWQGSFTENFYGLKRVSQTPLSDSKYK
                     SSKLTQLVPSMIEDRRSLSGLQRFASIFEITGVSYLSEKFNYWYEIWYPKYVTNQLVP
                     NDPTNRADIYRTEFKRRFVKLYPILQSIFRTGNFITTLLYLSGSSKSPTLLTILFKIN
                     YSRLNQYDYSKHEPKVASKKDTPNKIAPPTLAASIFRILNKNITKPSWRLINFILGTF
                     FPVAIFMLKFLEWYSNSNFASKIAKTQGNMLDSLLPPPSSLSRKRRLEDKPKKVYNSG
                     KTCPLCKDEISNPAIIETGYVFCYSCIYNYLAQSHKIISEKARLRREEMDSDTEESDN
                     EKEDQNEKVDANATQEEKITIDVNKGGRCPITGKKLLGCKWNGLKEEWEIEGIRRLIF
                     "
     gene            <105758..>106381
                     /locus_tag="DEHA2A01320g"
                     /db_xref="GeneID:2899336"
     mRNA            <105758..>106381
                     /locus_tag="DEHA2A01320g"
                     /product="DEHA2A01320p"
                     /transcript_id="XM_456396.1"
                     /db_xref="GeneID:2899336"
     CDS             105758..106381
                     /locus_tag="DEHA2A01320g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01320p"
                     /protein_id="XP_456396.2"
                     /db_xref="GeneID:2899336"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH3"
                     /translation="MEEFEGIGSIVTEFNIKGSTLNLFNIKWKTPSSDKELKRFVQIP
                     YGPHNKAFPSLPLVVNSSGKLLRYMAQDEMMDKSILEYDESKFDSDFELNESSVSTNL
                     TQFMNEYNINEESRQGVGYNESQVFLADNHKEQILSDIILESNCEESEFVETNSILTS
                     DFTQLSSNRWENASKKAKLSSEKEDLVSLKSEPFADLELDDFSALHN"
     gene            complement(<106497..>108681)
                     /locus_tag="DEHA2A01342g"
                     /db_xref="GeneID:2899281"
     mRNA            complement(join(<106497..108537,108659..>108681))
                     /locus_tag="DEHA2A01342g"
                     /product="DEHA2A01342p"
                     /transcript_id="XM_456397.2"
                     /db_xref="GeneID:2899281"
     CDS             complement(join(106497..108537,108659..108681))
                     /locus_tag="DEHA2A01342g"
                     /note="similar to uniprot|P06102 Saccharomyces cerevisiae
                     YIL038C NOT3 Subunit of the CCR4-NOT complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01342p"
                     /protein_id="XP_456397.2"
                     /db_xref="GeneID:2899281"
                     /db_xref="GOA:Q6BZH2"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH2"
                     /translation="MSHRKLQKEVDAVFKKINEGIDLFNYYYSRHQSSNSDSQREKLE
                     GDLKKEIKKLQKFRDQIKTWQSNDSIEAAIAPSKLQEHRKLVEEAMECYKDVEKSSKM
                     KSYSNQSIMLAALESEDIDLSPEAEEAVKFLESSIEELEDQCEKLEGEYEKISQKKIR
                     KNNLTMIEERKQELEGFSNRNKFHIEKMEMVIDFLKKDKISPDAVFAIQEDITFYLES
                     NQEPDFIDDDTLYDELTKEASRASTNNNIDEENSQNGDISFQDQSFSNKEDVEEVSVS
                     TPIKKSSDQFPTPSSHPRPDNLSQIHADATMTPQRAPLPVPSTPELSSPAIIKSLKPA
                     TTPSKPVGNLKWAVAAAGSAPSTSSGIGKNGDMDIKPMKEEPLFIQSQNSNVPSNKSP
                     FESQSQLQAPSELQYPEPSLESQFSVEKKSNDPNYRFVEVLQNSSVSNTELELFSDLN
                     LIRLPPGIQDLAISFTATRKVSTNDSKILINTNAYNPYITPIQKPFLPSAIQATFNHH
                     LPNNTQEQRIKAPLHLLKFQSYWNRIRAENQFDQFVKEIQLLSAQNNADNVPVINELT
                     MVLFYGYYYGFTPIENLIAESCLFKLNWKPYGSRSEIQNNLRATNHIQDKSPFDKVLF
                     ESKHYYYWFKCVRNSPTPQVYANEYVEHGDYQVFDLITWETYIKYDYRLELKLCQLEP
                     SKTLF"
     gene            complement(<108940..>110991)
                     /locus_tag="DEHA2A01364g"
                     /db_xref="GeneID:2899287"
     mRNA            complement(<108940..>110991)
                     /locus_tag="DEHA2A01364g"
                     /product="DEHA2A01364p"
                     /transcript_id="XM_456398.1"
                     /db_xref="GeneID:2899287"
     CDS             complement(108940..110991)
                     /locus_tag="DEHA2A01364g"
                     /note="highly similar to uniprot|P16474 Saccharomyces
                     cerevisiae YJL034w KAR2 nuclear fusion protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01364p"
                     /protein_id="XP_456398.1"
                     /db_xref="GeneID:2899287"
                     /db_xref="GOA:Q6BZH1"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MLKVNSRFWISGFTLAYVLLAVILPLLTPNQGQALAAEGETDND
                     TESYGTVIGIDLGTTYSCVGVMKNGKVEILANDQGNRITPSYVAFTPEERLIGDAAKN
                     QASSNVENTVFDIKRLIGLKYNDKMVQKEIKHLPYKIDKKDGKPVVKVEFNDETKTFS
                     PEEISGMILTKMKSIAEEYMGKKITHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIV
                     NEPTAAAIAYGLDKTEGEKQIIVYDLGGGTFDVSLLSIEGGVFEVLATAGDTHLGGED
                     FDFKVVRYLSSVFKKKHNIDISGNSKAISKLKRETEKAKRTLSSQMSTRIEIDSFVDG
                     IDFSETLSRAKFEELNIESFKKTLKPVQQVLKDAGFKKSDVDDIVLVGGSTRIPKVQE
                     LLEKFFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVHDIVLLDVNPLTLGIETTGG
                     VMTTLINRNTAIPTKKSQIFSTAADNQPTVLIQVFEGERALAKDNNKLGKFELTSIPP
                     APRGVPQIEVTFSLDANGILKVEAMDKGTGKSESITITNDKGRLSKEDIDRMVEEAEK
                     YAEQDSELKAKIESRNSLENYAHMLKGQVKDESENGLGSKLNDDDKETLDDAIKETLE
                     FIEDNYDSATSEEFEEQKQKLIDVASPITSKLYGGGAGGADEAQFGDDDSDDEFVHDE
                     L"
     gene            <111175..>111366
                     /locus_tag="DEHA2A01386g"
                     /db_xref="GeneID:2899316"
     mRNA            <111175..>111366
                     /locus_tag="DEHA2A01386g"
                     /product="DEHA2A01386p"
                     /transcript_id="XM_456399.1"
                     /db_xref="GeneID:2899316"
     CDS             111175..111366
                     /locus_tag="DEHA2A01386g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01386p"
                     /protein_id="XP_456399.2"
                     /db_xref="GeneID:2899316"
                     /db_xref="UniProtKB/TrEMBL:Q6BZH0"
                     /translation="MMGSDVRGVEVLSRQPPGPIATGHLVYRCWCKEFDNGMTSAGSV
                     ASSKSVSYNIIMKIYKISI"
     gene            <111817..>112947
                     /locus_tag="DEHA2A01408g"
                     /db_xref="GeneID:2899329"
     mRNA            <111817..>112947
                     /locus_tag="DEHA2A01408g"
                     /product="DEHA2A01408p"
                     /transcript_id="XM_456400.1"
                     /db_xref="GeneID:2899329"
     CDS             111817..112947
                     /locus_tag="DEHA2A01408g"
                     /note="highly similar to uniprot|Q08911 Saccharomyces
                     cerevisiae YOR388c FDH1 NAD(+)-dependent formate
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01408p"
                     /protein_id="XP_456400.1"
                     /db_xref="GeneID:2899329"
                     /db_xref="GOA:Q6BZG9"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG9"
                     /translation="MSKGKVLLVLYKGNEHAQQEQKLLGCLENELGIREFIESQGYEL
                     VCTDDKDPEPSSTVDKELQDAEIVITTPFFPAYITRERINKAPKLKMCITAGVGSDHV
                     DLDAANERKIAVTEVTGSNVVSVAEHVLMTMLVLVRNFVPAHEQVIKGEWDIAGAAKD
                     EYDLEDKVIATVGAGRIGYRVLERLIAFNPKKLLYYDYQDLPKEAIDKLNQASKLFNG
                     KDNIVERVENLEDMVGQADLVTINCPLHEKSKGLFNKDLISKMKDGAWLVNTARGAIC
                     VAEDVAAAVKSGKLRGYGGDVWYPQPAPKDHPWRQMQNKYGAGNAMTPHVSGTSLDAQ
                     ARYADGVKSILNSYFSGKHDYLPKDVIVIDGDYATKSYGQRK"
     gene            complement(<113216..>113812)
                     /locus_tag="DEHA2A01430g"
                     /db_xref="GeneID:2899288"
     mRNA            complement(<113216..>113812)
                     /locus_tag="DEHA2A01430g"
                     /product="DEHA2A01430p"
                     /transcript_id="XM_456401.1"
                     /db_xref="GeneID:2899288"
     CDS             complement(113216..113812)
                     /locus_tag="DEHA2A01430g"
                     /note="weakly similar to CA3446|IPF7324 Candida albicans
                     IPF7324"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01430p"
                     /protein_id="XP_456401.2"
                     /db_xref="GeneID:2899288"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG8"
                     /translation="MNRIFNNKAVHQFSQGLSKRTYSTSRSASTKSGAGIYLGGAAAL
                     VSAIAWTSIDTIDNEVDKKKIQEGKNIAENTGSNQKEDEAKKEAVGRGNVKTKIPAES
                     STPTTQSEAAANDEAEQTKESLSGSKDEKSQKGSDESEIKWGNKFLKPISSGACGGEF
                     KDAFSVLFSSSDLKSSDTFKKLDALRRCLKEHPEISND"
     gene            complement(<117638..>119542)
                     /locus_tag="DEHA2A01452g"
                     /db_xref="GeneID:8998096"
     mRNA            complement(<117638..>119542)
                     /locus_tag="DEHA2A01452g"
                     /product="DEHA2A01452p"
                     /transcript_id="XM_002769905.1"
                     /db_xref="GeneID:8998096"
     CDS             complement(117638..119542)
                     /locus_tag="DEHA2A01452g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01452p"
                     /protein_id="XP_002769951.1"
                     /db_xref="GeneID:8998096"
                     /db_xref="UniProtKB/TrEMBL:B5RSN8"
                     /translation="MKFENVAILFSIAAAVVANEEGAKHRRSLGDKGNSNSLTSIYRR
                     DVEGHKLGWRGIGWSKLSSRAVTDDGTVGVESTDGSDGSDGSDGSTAGVENTEGNVDG
                     VVQSTEESDQDAEGSDDGKGVESTEESDENAEGSGTTAVESTGVESTGIESTRVESTG
                     IESTGVESTQGSDDGTASAGRVGNGGEDDTPDDKGCNRYGRGSDGKKCDYHGPKPKPG
                     DPDDEEDDKQCNRHGKNRHGDKCDYHPPGGDDDDDNDDDDNDDDDNDDDDDAPDDKGC
                     NRYGRGHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNRHGDKCDYHPPGGDDNDDD
                     DDAPDDKGCNRYGRGHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNRHGDKCDYHP
                     PGGDDNDDDDDAPDDKGCNRYGRGHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNR
                     HGDKCDYHGKDKHPRPPSKTVTQYTTLTDYITYCPEPTTITLTTCKDKKCEPKTVTIT
                     EPTTLTITGECVVPVPVPTETGDSNDWNGNNWGYWGYCDPVTVTEYATKYIKQSPKTK
                     TKTETTTITAIGYDNMPTVIPTPMPTPMPTPIPTPTDDMTSSAEPTESDTLTATYTPP
                     IVIKRALFGL"
     gene            <121932..>123290
                     /locus_tag="DEHA2A01474g"
                     /db_xref="GeneID:2899621"
     mRNA            <121932..>123290
                     /locus_tag="DEHA2A01474g"
                     /product="DEHA2A01474p"
                     /transcript_id="XM_456402.1"
                     /db_xref="GeneID:2899621"
     CDS             121932..123290
                     /locus_tag="DEHA2A01474g"
                     /note="similar to uniprot|P07278 Saccharomyces cerevisiae
                     YIL033C BCY1 Regulatory subunit of the cyclic
                     AMP-dependent protein kinase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01474p"
                     /protein_id="XP_456402.2"
                     /db_xref="GeneID:2899621"
                     /db_xref="GOA:Q6BZG7"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /translation="MTDNQYATEELNQLQKELVAKNPIDVLQFCANYFNSKLELQRSQ
                     LWQQQNKAKAAGINLFPSIDNVFNSDGGAIMTTNKRQPSFKSPFGDNDPTSIDHHHDD
                     DPKEAPGASKQQNKAELFKGGFGVGKSTPSKPLQELDPNDPSHSASQDTDAAPPVPKS
                     KIPVAFNANRRTSVSAEAMNPNKFKSDSWKPPINDLTAAQKVELSKTLGSNFLFRQLD
                     VSSKKTVIEALGKKEFKNGDEIIKQGDEGDYFYIIEKGTVDFYVNGNQVNSSGEGSSF
                     GELALMYNSPRAATAVAASDTGVTCWALDRQTFRRILLERTFNRRLMYEDFLKDVKVL
                     SSLSSQERSKLADALSTEIYHKGDKIVKEGEQGENFYFIESGSCQVSKDGKGVLTKLS
                     KGDYFGEVALLNDLPRQATVEALDTVIVATLGKSGFSRLLGPAVDILKSQDPTANQGS
                     SN"
     gene            <123448..>123942
                     /locus_tag="DEHA2A01496g"
                     /db_xref="GeneID:2899971"
     mRNA            <123448..>123942
                     /locus_tag="DEHA2A01496g"
                     /product="DEHA2A01496p"
                     /transcript_id="XM_456403.2"
                     /db_xref="GeneID:2899971"
     CDS             123448..123942
                     /locus_tag="DEHA2A01496g"
                     /note="similar to uniprot|P40030 Saccharomyces cerevisiae
                     YER044C ERG28 Endoplasmic reticulum membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01496p"
                     /protein_id="XP_456403.2"
                     /db_xref="GeneID:2899971"
                     /db_xref="GOA:Q6BZG6"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG6"
                     /translation="MKISSMKTTNVYGEPPLNIKMIPYFQSFLPTTTSQGGYLPHWLL
                     FISVVSIFNSLQTYQSPDLTLTRRVYESAPTNEVTKLSARTFGTWTFITSIVRFYGAY
                     YLVGNKQIYELCMWSFAVAGGHFISEWLYFGNCKLGKGLAGPLIVSSTSLLWMYLQKD
                     FYLN"
     gene            <124793..>125977
                     /locus_tag="DEHA2A01518g"
                     /db_xref="GeneID:2899323"
     mRNA            <124793..>125977
                     /locus_tag="DEHA2A01518g"
                     /product="DEHA2A01518p"
                     /transcript_id="XM_456404.1"
                     /db_xref="GeneID:2899323"
     CDS             124793..125977
                     /locus_tag="DEHA2A01518g"
                     /note="similar to uniprot|O74885 Schizosaccharomyces pombe
                     SPCC576 Putative dioxygenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01518p"
                     /protein_id="XP_456404.2"
                     /db_xref="GeneID:2899323"
                     /db_xref="GOA:Q6BZG5"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG5"
                     /translation="MTQASILEVTPLADQPFGCMVSLPDYCDNDPSKLNEDDFKKLFT
                     AVHTHLVVVVKDQAKLSPKSQYELTKRFDPTIPEPKQEGFAGYGHGKEFRHEQSVLRK
                     DGTTVKSQPQVQILGQGTFEANEPGNENGEAISLTHPSHTTFHHTPLTQDDIKNQHKT
                     RFYRWHIDSALYDLLPPVVTTLLGIKVPPASEMQTISYEDSDEELKLASGATCFFSGQ
                     QAYDRLSDEEKQFAVNTTVEYPPHPYIFISPAGATSDGLTMVSEGKELAFDKMPEWEP
                     EKIKRLPMVWTNPVTNKHHLQVHGCCLYKLHTKSPDGTTKTLELEDARKKVHSMMRPA
                     ISPSKVLAHAWNEGDLVLFYNRGVLHSVTGELKGVKNGKDERRLMHQCNIASGIEPVL
                     VQ"
     gene            <126129..>128279
                     /locus_tag="DEHA2A01540g"
                     /db_xref="GeneID:2899637"
     mRNA            <126129..>128279
                     /locus_tag="DEHA2A01540g"
                     /product="DEHA2A01540p"
                     /transcript_id="XM_456405.1"
                     /db_xref="GeneID:2899637"
     CDS             126129..128279
                     /locus_tag="DEHA2A01540g"
                     /note="highly similar to uniprot|P38795 Saccharomyces
                     cerevisiae YHR074W QNS1 Glutamine-dependent NAD(+)
                     synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01540p"
                     /protein_id="XP_456405.2"
                     /db_xref="GeneID:2899637"
                     /db_xref="GOA:Q6BZG4"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG4"
                     /translation="MGHYITLATCNLNQWALDFEGNRDRIITSIIEAKKLGATLRVGP
                     ELEICGYGCLDHFLENDLYDHSWEMYGHILTNPNTQDILLDVGMPIIHKSIKYNCRLL
                     SYNGKILLIRPKLYLANDGNYREMRYFTPWNRPKYYESFQLPKNISSVTGQSNVTFGD
                     CVIQTLETTLGAETCEELFTPQSPHISMALDGVEIFTNSSGSHHELRKLDTRLQLITG
                     ATKKCGGVYLYANQKGCDGDRLYYDGCACIIVNGKVVAQASQFSLRDVEVVSATIDLD
                     DVRSYRNQKSSAFQSVSQSDSTVYHHIPTDIELSPNSNVFNPNVKPSPYRDIRYHLPE
                     EEIALGPACWLWDYLRRSKCAGYFLPLSGGIDSCATAVIVHSMCRLVVKSCEEGDKQV
                     ISDIQSLTHDPEFVPKTPQEVAGRLFYTSFMGTENSSKETRSRAKELSEKVGSHHIDM
                     NMDSLVSAVVSVFEVATGKKPIFKIFGGSQTENLALQNIQARLRMVLSYLFAQLLPWT
                     RNISGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIDWADKNFELP
                     ILHDFLTATPTAELEPITQNYVQSDEVDMGMTYDELSRFGRLRKVDKCGPMAMFIKLY
                     HEWSQPPLNLTAEQVAEKVKRFWFFYAINRHKMTTMTPSYHAEQYSPDDNRFDLRPFL
                     INPRFPWASKKIDEAVDIINQRTEEIKRANLSVD"
     gene            complement(<128661..>129833)
                     /locus_tag="DEHA2A01562g"
                     /db_xref="GeneID:2899326"
     mRNA            complement(<128661..>129833)
                     /locus_tag="DEHA2A01562g"
                     /product="DEHA2A01562p"
                     /transcript_id="XM_456406.1"
                     /db_xref="GeneID:2899326"
     CDS             complement(128661..129833)
                     /locus_tag="DEHA2A01562g"
                     /note="weakly similar to uniprot|P38796 Saccharomyces
                     cerevisiae YHR075C PPE1 Protein with carboxyl methyl
                     esterase activity that may have a role in demethylation of
                     the phosphoprotein phosphatase catalytic subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01562p"
                     /protein_id="XP_456406.2"
                     /db_xref="GeneID:2899326"
                     /db_xref="GOA:Q6BZG3"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSGLHKQFLKKIKEQERAFGLSSLSEDPDESESNSNYFSPTPQP
                     PNELRTDINEERHGHIRETYNDTKRDVFPIADIYTDPRSGVRFQTYFKPPSSSNAPIF
                     ICHHGAGSSSMTFCKLAQSLDNEYGKNNEYPGLFTYDMRGHGDSSTTIPPDYSLATIT
                     NDCEFIIDEFHAKHALRSSIYLLGHSLGGSVLTSYLVANPDNAYKFKGLIVLDIVEET
                     AIKALSAMPQFVRKRPTTFGDYQEAIDWHIKESHLLHSEESALVSVPDLLRECPNGLI
                     WKTNLQETEPFWETWFTGLSENFINCGKTQHIAKLLVLSGHETLDTNLIIGQMQGKYQ
                     LIVFNNTQNTGHFIQEDIPTQISISLVDFVRRNDSPNEYMKKEFGFVPKWGGKIHD"
     gene            <129949..>130914
                     /locus_tag="DEHA2A01584g"
                     /db_xref="GeneID:2899633"
     mRNA            <129949..>130914
                     /locus_tag="DEHA2A01584g"
                     /product="DEHA2A01584p"
                     /transcript_id="XM_456407.2"
                     /db_xref="GeneID:2899633"
     CDS             129949..130914
                     /locus_tag="DEHA2A01584g"
                     /note="similar to uniprot|P47058 Saccharomyces cerevisiae
                     YJL035c TAD2 tRNA-specific adenosine deaminase 2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01584p"
                     /protein_id="XP_456407.2"
                     /db_xref="GeneID:2899633"
                     /db_xref="GOA:Q6BZG2"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG2"
                     /translation="MSDMIPTFRNMAIALFIGYRAMINNETPVACILVSRSTNQILSI
                     GYNDTNRSLNGTRHAEFIAIDKVMSQIPVHDRSDIAKIQGFFGDVILYVTVEPCIMCA
                     SALKQIGIGYVVYGCGNDRFGGNGTILSIHQDKINKAYQSYGGVLRTEAVQLLRNFYI
                     QENDSAPNPKIKKNKELENKEYPPNLDFKEYLSPEEFTEFFGDERFAASYDNRGRELT
                     PVLNHGYTLRDILHIEDLLAVSELKEMYQEKDFEDKLENDLQNFYGLFYDIDEEGKVD
                     FNKIITKIDQIAQINPADPADPVNQVIQVDGFTTDLDCKKRKLNK"
     gene            <131290..>132834
                     /locus_tag="DEHA2A01606g"
                     /db_xref="GeneID:2899300"
     mRNA            <131290..>132834
                     /locus_tag="DEHA2A01606g"
                     /product="DEHA2A01606p"
                     /transcript_id="XM_456408.1"
                     /db_xref="GeneID:2899300"
     CDS             131290..132834
                     /locus_tag="DEHA2A01606g"
                     /note="similar to uniprot|Q04673 Saccharomyces cerevisiae
                     YLR005W SSL1 Component of RNA polymerase transcription
                     factor TFIIH"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01606p"
                     /protein_id="XP_456408.2"
                     /db_xref="GeneID:2899300"
                     /db_xref="GOA:Q6BZG1"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="UniProtKB/TrEMBL:Q6BZG1"
                     /translation="MDESDEEYIAPQHTAADTPSGVPSNEASQKESSVPADGVSKRTR
                     SSGMTHQPRSGAVGDLKSSNGGYAWEDEYQRPWDIVKDDEDGRSLETIIQTMIENRKK
                     KIMRNPTTPFQRGIIRTLVVIIDGSSVMSEKDLRPTRFSMMLSLLQEFVVEYFDQNPI
                     SQLGIIMMRNGVSNLISEVNGSPQYHLDKIRQLKSRQHNKYEPKGDPSLQNALEMARS
                     LLMYNFGTNLNDTKNSKEILIIFGALFTSDPGDIHKTINSLVKDEIKVKVIGLSAQVA
                     ICQELVNKTNNPGKSNTFWSAGGNNYGVIMNEIHFRELLMDCVIPLPVTTNAVIDENN
                     SKEVPIIKMGFPSKIQPVITSSTSNLSVDFPQLCACHPTQDSLESKNNDPTATLGTRS
                     VIGYECPQCNNKVCHLPTICPICGLMLILSTHLARSYHHLVPLGDYKEVPVSESYSST
                     YCYGCLLKFPSGIKNTDVNEDGKTKMDSLTSSRYRCGKCQNDFCIDCDVFVHESLHNC
                     PGCENK"
     gene            complement(<132972..>135875)
                     /locus_tag="DEHA2A01628g"
                     /db_xref="GeneID:2899625"
     mRNA            complement(<132972..>135875)
                     /locus_tag="DEHA2A01628g"
                     /product="DEHA2A01628p"
                     /transcript_id="XM_456409.1"
                     /db_xref="GeneID:2899625"
     CDS             complement(132972..135875)
                     /locus_tag="DEHA2A01628g"
                     /note="similar to uniprot|P27692 Saccharomyces cerevisiae
                     YML010w SPT5 transcription elongation protein singleton"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01628p"
                     /protein_id="XP_456409.2"
                     /db_xref="GeneID:2899625"
                     /db_xref="GOA:Q6BZG0"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /translation="MSEEENRITTSSDDVIKHEHPDNSTAGGAYEVQDRDQNDIDEEE
                     EEKEENKRSAEEEYSIGSKRSLEDSEEGESKVPTENDQALINNSGEGAEQQDNGDEAN
                     DDENDDENDEDEDEDEDEEEVSSNKRKRRRGANQFIDIEAEVDDEEEDEMDEDDEEAE
                     LLREQFIADDSRVETMDGKDSAGEHQDDRLHRQFDRRRQEAEDQDAEVLAETLKQRYR
                     KTHTVYRGDTTASGTVSQKLLMPSINDPAIYAIRCTPGREKDLVRKLYEKKRTLARSN
                     PLEILTVFQRDSFKGYIYIEAKKPEAIERALTGMVNIYAKQRLLVPVREYPDLLKQVK
                     SSDVEIVPGIYVRITRGKYKNDLAIVDNLSENGLDVRCKLVPRLDYGKNDDFDKDGKR
                     IRSKTKPIPRLFSEQEARMYDGEYLQSGRGPRAFIYRGEEYNEGFLFKDFKLQFIQTK
                     DVHPKLEELDRFQTGDPEEDGLDLAAIAASLKNKNNSEGAGRSSAFQPGDKVEIRRGE
                     QAKTIGKVLSTSLNEITILVTDSGDPKFVNQRLTVPANDLRKLFSAGDHVRVIEGKHS
                     DETGLVIKIDNDSVILLSDQTKQDVRVFANYLIKATDASSNTDVTGGKYDLNDLVQLN
                     VSTVGVIVKAEKSSFEVLTSEGRLMSVNPAGIASKLELSRREQIATDRNGSTVKIGDT
                     VKEVLGDKKREGAILHIYKNSLFIKSNEILENLGVFVTNCMNVSTITTKDSIVSKSLG
                     PDLNRMNPNLKLPNPIANAGLKTRVGGRDKLIYKDVLVNSGNYKGLMGKVTEADEVYA
                     RIELHTKSKKIKVTKNSLSVLVRGEAIPYLRFIGASSGPGNSNPSGNFGGASFNQPAK
                     TPAFSSGGKSSWGSGGATPSVGGGATAWGSGGAQSSWGGGKTPAYNSGNASTWGGNAG
                     GASAWGNNNGNASTWGSNSKNGGSSTWGGNSTWGNSNKGGKSSWGNGSAWGGK"
     gene            <136911..>137471
                     /locus_tag="DEHA2A01650g"
                     /db_xref="GeneID:2899963"
     mRNA            <136911..>137471
                     /locus_tag="DEHA2A01650g"
                     /product="DEHA2A01650p"
                     /transcript_id="XM_456410.1"
                     /db_xref="GeneID:2899963"
     CDS             136911..137471
                     /locus_tag="DEHA2A01650g"
                     /note="highly similar to uniprot|P49435 Saccharomyces
                     cerevisiae YML022w APT1 adenine phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01650p"
                     /protein_id="XP_456410.1"
                     /db_xref="GeneID:2899963"
                     /db_xref="GOA:Q6BZF9"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /translation="MSQVEISELAKEIRASLKQFPNFPSEGILFEDFLPVFTKPDLFQ
                     KLVRAFQLHVGEQKVDYVVGLESRGFLFGPTLALALGAGFVPVRKAGKLPGPVFTAEF
                     QKEYGSDKFQIQKDVIEEGAKVLIVDDILATGGSASSAGELVKQTGGDIVEYLFVMEL
                     DFLNGRDKLDKPAFTLLSGQAEKLQN"
     gene            complement(<137654..>137978)
                     /locus_tag="DEHA2A01672g"
                     /db_xref="GeneID:2899968"
     mRNA            complement(join(<137654..137907,137957..>137978))
                     /locus_tag="DEHA2A01672g"
                     /product="DEHA2A01672p"
                     /transcript_id="XM_456411.1"
                     /db_xref="GeneID:2899968"
     CDS             complement(join(137654..137907,137957..137978))
                     /locus_tag="DEHA2A01672g"
                     /note="similar to uniprot|Q02647 Saccharomyces cerevisiae
                     YDR424c DYN2 dynein light chain 1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01672p"
                     /protein_id="XP_456411.1"
                     /db_xref="GeneID:2899968"
                     /db_xref="GOA:Q6BZF8"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /translation="MSEKEQEPILKASDLPEEMQTRIFELSNEAVSNYKIEKDIATYL
                     KKELDQLYGATWHVIVGKSFGSYVTHEQGFFTYFYIGQLAFLIFKSG"
     gene            <138549..>139235
                     /locus_tag="DEHA2A01694g"
                     /db_xref="GeneID:2899617"
     mRNA            <138549..>139235
                     /locus_tag="DEHA2A01694g"
                     /product="DEHA2A01694p"
                     /transcript_id="XM_456412.1"
                     /db_xref="GeneID:2899617"
     CDS             138549..139235
                     /locus_tag="DEHA2A01694g"
                     /note="similar to uniprot|P43543 Saccharomyces cerevisiae
                     YNL335W DDI3 and similar to uniprot|P43543 Saccharomyces
                     cerevisiae YFL061W DDI2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01694p"
                     /protein_id="XP_456412.2"
                     /db_xref="GeneID:2899617"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR017771"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF7"
                     /translation="MSKYGFVKIARDIKTAVGKINEPTAQSVVELPDSPLGKFMLDYA
                     TKELPEKVLFHSLRVYQYSIAIINDHFDKWALDSEVLFVTCLLHDIGTTEKNMKATKM
                     SFEFYGGMITRDLILEHTNGNQDYAEAVSEAVIRHQDLGDTGFITTLGLILQISTILD
                     NVGLNTDLIHPDTLAAVNKEYPRHGWLNCFADHIDNENTKKPWGHTSSLGVPDFRNNV
                     LANKVKYEKL"
     gene            <139401..>144725
                     /locus_tag="DEHA2A01716g"
                     /db_xref="GeneID:2899630"
     mRNA            <139401..>144725
                     /locus_tag="DEHA2A01716g"
                     /product="DEHA2A01716p"
                     /transcript_id="XM_456413.1"
                     /db_xref="GeneID:2899630"
     CDS             139401..144725
                     /locus_tag="DEHA2A01716g"
                     /note="similar to CA4547|CaSRB9 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01716p"
                     /protein_id="XP_456413.2"
                     /db_xref="GeneID:2899630"
                     /db_xref="GOA:Q6BZF6"
                     /db_xref="InterPro:IPR009401"
                     /translation="MPEAIDASSIATNYYKLAHLCSVTYLIYTTNGATNDSTLLELEL
                     LIRHSHPKCLVTYYNKYLYYFQFNHVDEHVDLTKEYPQLQLKYSNQVSADLLANPPKV
                     ASDKDNHSTGNEYLAYACLSFLKAVKKLVLFNLSRNEAVQLFGNYAVVKEQGLSNFIL
                     HIDPILLPNGDLLISISEKCHLQLFDSSIVDISEIEAVDLNFVLYIIPSGIRCHLYDN
                     VNVASNFTTDPPKNSEVLMQLIKYSTGFDLNQLNSLVWVKLVPNLQHLNNQTSKISKF
                     IHPVDNKKFILWPWRLCLLQFGLSEKDTATSPHVLTCDPISLISDFIDFNISHHQQAN
                     ITGQLNPNHQHNQSFNYSIPSALSTGMSSTGANENKGDLNMVGDIPGSVSDIFGIQSS
                     DTNDFFNGPNFQPAQNPSDVKLDSQEPVKKNSDDEDVEMDDLFGDASEDEKAKTEVST
                     NELNEEKNFEDLFNDGLNQENQVDESDKVAKSIDEEVLKEESVKSEDLKEDKDLKMQP
                     SSGTIPNTFIDIPKDQMTIPSLKNLKQTPQIYNDPGAPMPVIPTPIFPQFGINSTLPG
                     SAQSVNPPTSAAATDNEANEGARSIFSPILFNPIIKSNIDTKYGKGGKFYVDKEVSAG
                     PDIDSKRKTLRATSVSGFELPSRREDSIGIESITDDNDRRQVFEFPEEQGNERMKDEG
                     HENHAAENDNIIKKMEELEEEDDNDDDDDDDDDDDENEDEDEESDEDDDLNLENNDMN
                     MKRSPPLKLNTLNDPYVAQSNQAVVNFNDSNYNAKQILPNSYNASSMNTGGFSSPASL
                     GFSSSRTNVPPKNDSPFGLNNLAREDRNGTTSPTGDNSDQPTKRQEQSDSPMVVDMEV
                     EKKSTSKEAENTPSGMTTPNSRGSISESSNCLPLILRGVNVASIPTSFILNNVIVSNK
                     ISTISTNFDMDVDDETEWSDYELCKNNEMTVKLNNLDEFLKCLGPNLIFDMGLNKLQN
                     SLEMKLSNNERDDEEYDNIEGKAPSRQFENKLCDIFPFCYKVNLNEFTTEAYVNELKG
                     ETTTIQDELDNQLSFLDDITNEDILNPKTQLKKLNSIEWDAIYSDSSSNEDNSKKYQG
                     MVHNVGQSSLVNTLEDGTIFPLANDKARVLKHNDTIINLNSIGIKFWKYLNFSPLNGP
                     KNFQLLLISEHDHNMLHHNYNIEFLNSLVYNYKECCFGNISKINLQSSDSRPDMEGID
                     NGLLMVHKKDEDQVYGNMYKQVNRKLNALVEMIKSDLINKTNKFEFDRPLLLLFINFD
                     KSVNSLLQISKLIRNFKLFLSHHQLPLVEVFAHIIPWSLIIKQSGSQRRLKYLSNFRL
                     SKLSMNLYNQCPNERTIGKPVKDPTKHLFTQLVKEPPSNLNFKFMNNGSNGNGKTTFN
                     DDIFLHLAYERSIDKNWFSAAWSDPLGVVVSTKSWNCSPNLQKTNNKNVHSLESISDE
                     IWTISTALFKKLNDEIIKRTSGLGGKKFLVLTRINSIIPDDELIHWKRLSMKHKDVSL
                     IVLSVNKSPKLLFSGPIGPSQQEDKSNYDPNTNRTSTNMDNSSSTNAANPTCGVGATS
                     NAPDFFKTFGSNNPSPNNNAGSMSISPSNNVGINFHSPQQFLNAPGNFLLPQDFVSST
                     GGSTNINANPHSNASQYNPDEIIHDPTEELTAVIPKAPLPSFNSPTRLGMKIGYLIKE
                     TGVSTHEDTKQYLVYEINLLSCSNYWNLNAIMKILLNQYKKLITLNDILCVGEIDGSI
                     TDDRAEKDSNIIPEMTPPLNYTASGLIPWHIAAVTKSLDYLIHIDVEE"
     gene            <144875..>146635
                     /locus_tag="DEHA2A01738g"
                     /db_xref="GeneID:2899362"
     mRNA            <144875..>146635
                     /locus_tag="DEHA2A01738g"
                     /product="DEHA2A01738p"
                     /transcript_id="XM_456414.1"
                     /db_xref="GeneID:2899362"
     CDS             144875..146635
                     /locus_tag="DEHA2A01738g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01738p"
                     /protein_id="XP_456414.2"
                     /db_xref="GeneID:2899362"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF5"
                     /translation="MEGIELDSTHELLNRYKVKEGRNEDITIYSDEDSIFNSPSIELG
                     RSAVKNTKNSSPFKKFGTGRSSSLSPSKKVRNDYQDHLHRMRGNSNTGSPLKRNNYDL
                     SEYNDFDDIKGMPGLNIDSLSGSDNTMDKEIQRILDMSSLKLPELQDDQGKDKTELLI
                     KETHKLINTVPASITSSMEGEAYQKMLTTSINKLIKQVESMKRDLENRDNEAKSHRIQ
                     LSNLEMKMGLYQRENNDLKKELNQVKKRSVIPQNESRENDLLRTKLIKYRNLYTEADR
                     ENQELKSKHNGEPVKESASQQMPVREQPRPTGQADAAEMPSGINPIDRKSLSQDVYKQ
                     RLVELQNQLSDIIDDVKDEPPQPEIRPVSQPKSQPHETSKSNEMADAHSQPSLRMLAI
                     FEDLVRAMKNESDESKHVEKPIETQTTPNETSPNESVEQESMENLRNPIDPVLEKILA
                     SLDKNNQMYNRLLDVLNPDANGQPIRISEASTAPMLDEAHYPDPKEREKDIVFQCYVC
                     CPQNHKLHAKRPCKRCSAASSEASGSAGNSVTHSAGNSASDSTSDTHVRDSGPNRMVD
                     FSDPKDNKTINLMGEYKWTI"
     gene            <147554..>149080
                     /locus_tag="DEHA2A01760g"
                     /db_xref="GeneID:2899975"
     mRNA            <147554..>149080
                     /locus_tag="DEHA2A01760g"
                     /product="DEHA2A01760p"
                     /transcript_id="XM_456415.1"
                     /db_xref="GeneID:2899975"
     CDS             147554..149080
                     /locus_tag="DEHA2A01760g"
                     /note="weakly similar to uniprot|P24869 Saccharomyces
                     cerevisiae YPR119W CLB2 Involved in mitotic induction"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01760p"
                     /protein_id="XP_456415.1"
                     /db_xref="GeneID:2899975"
                     /db_xref="GOA:Q6BZF4"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF4"
                     /translation="MPQTVNNENEYRLTRSKAMQNQSLRGNEGGPKTHAQTQMEAQSQ
                     KGGRGEAVMGDGNGDTKDGLYNLSQHSSEEVLAGTRSYLGDVSNQYGSSGVKPNMGSK
                     RRPLGGDNAPLQQHQRIMLKPNNSSTNTNHLLASQPKDTVTTTTATINDNTNGNITTN
                     NHTSASSSNSSTQNLAVPARMPQKRQATESSTNLVEKLHISGPHSNHVSYKKSRIIDY
                     EWQDLDEEDIDDPLMVSEYVNDIFPYLSELEHKTLPDSQYLFKQKHLKPKMRSILVDW
                     LVEMHTRFRLLPETLFLAINIMDRFMSLEIVQIDKLQLLATGSLFIAAKYEEVFSPSV
                     KNYAYFTDGSYTEDEILQAEKYILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGK
                     YLLEITIIDYKFIGMLPSLCSASAMYIARLILGKTPVWNGNLIHYSGGYRVSDMKDCI
                     ELLVQYLIAPVEHDEFFKKYATRKFMKASILCRSWAKKIVSENKDIFANDLFINKAEN
                     "
     gene            <149414..>152071
                     /locus_tag="DEHA2A01782g"
                     /db_xref="GeneID:2899976"
     mRNA            <149414..>152071
                     /locus_tag="DEHA2A01782g"
                     /product="DEHA2A01782p"
                     /transcript_id="XM_456416.1"
                     /db_xref="GeneID:2899976"
     CDS             149414..152071
                     /locus_tag="DEHA2A01782g"
                     /note="weakly similar to uniprot|P38850 Saccharomyces
                     cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01782p"
                     /protein_id="XP_456416.2"
                     /db_xref="GeneID:2899976"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF3"
                     /translation="MFQGSAFLVVVSDAFTDEEVNDVESMLKQNNAKVFVKEEHDNEV
                     NYLGTEAVSNTHIDHIICKSVEFIEYNLAQTSMVPITTPEWVFDSVSRAKISNPKVYS
                     PDPKLFLKDTFVCVADNLPVGDKEAIYGGVRAFGGQYLDDLTRYTTHLIAMDMNNDKS
                     VIATSAINTTQENGDKIDIKIVLPHWIDDCLKMGKKLHEEPYMLPSPSILKTTSEGID
                     SPVITEDDVLPIDSSKSSFLDNKLFYISPDYKISHRLTSAIGALIKKHGGKVTTQFDS
                     KMVDIYIGQYRAGDAYITSCKSNRIIVGNLQWLYSIIVSNKWKLPINSNLLHYPIPLT
                     SLPDFQNLKISVTNYSGDARFYLSKLITILGGTFTKTLTRDNDFLVAAKPEGKKYEAA
                     KVKWRSEDNNNIKIVNHLWLEECFANWKLMEYDRPQYQFLGNNANGVEKLLCKTKLKQ
                     NVLESWYNQENIASEKENVADSMSEDESTQPKSRLKSNTKTNNTKKSPSTNGSVTDEN
                     IEQEEEIQDEQKDDDEQEKIKAKEDETRLSTKEKTKKSSLPSEMCKEDDEAVLPATPI
                     TGRSGRSAKQKAVNKLHSDMNDLNDYQQMSKSSRKMKSYMEELEKSSSAKRKAEIENK
                     DTNTIETPVKAKKRKTESPRPDTDTKIVAVITGCENEITLTRQDTQNLNHIGVKVLSD
                     YSTKQGINTLIAPRILRTAKFLRSLSQVDKIIHPNYLIDVLKKLNSSQDADGDQVSKE
                     FSINDYSLDKVIPIKAINQELGVTNAKENGLANLLNTTNRGLIFQDLKINLSSNLVGG
                     VQVISEILESHGLAEAKSIKSVTAANTKSLLTNDDGKTIMIAHKSKDAKLITSFKKNV
                     QNGVIVEWDWCVKSIFKMKLEEFDSYQLL"
     gene            complement(<152242..>153759)
                     /locus_tag="DEHA2A01804g"
                     /db_xref="GeneID:2899616"
     mRNA            complement(<152242..>153759)
                     /locus_tag="DEHA2A01804g"
                     /product="DEHA2A01804p"
                     /transcript_id="XM_456417.1"
                     /db_xref="GeneID:2899616"
     CDS             complement(152242..153759)
                     /locus_tag="DEHA2A01804g"
                     /note="similar to uniprot|Q05785 Saccharomyces cerevisiae
                     YLR206w ENT2 clathrin binding protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01804p"
                     /protein_id="XP_456417.2"
                     /db_xref="GeneID:2899616"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF2"
                     /translation="MSKSFVRSIKNVTNGYSSGQVLVRNATSNDPSGPTTFDMEEIAS
                     RTYQSQTDFLEIMDMLDRRLNDKGKNWRHVAKSLTVLDYLVRYGSEKCVLWSKDNLYI
                     IKTLREFIHFDEADNDQGAVIRVKAKELVSLLRDDERLQHERELAARAQNGPGHRPGR
                     ERRNRRGSRRNTVNSNSSRPVTGDDDDEMQKALEMSRITAEEEARRKNQIPDDDDLQA
                     ALKLSMEEEEMRKLKNQQNDNLLDLDEQQAQPQYYLATGYQQPQYYMMPQQTQTQQQY
                     DMFGNPIQNAMNTGLYQQQHYQQQEPMQQQPSFTGFNGPQQQQQQPQELQPLKTGSNN
                     PFALQSESAQQQPASQSLNDIASQQQQQQQDLYQQQQQQQQQQPQFFTQPTSQLKPQT
                     TSSSKFDDSTHADLNNLLAQGTGIDTFGNTGATRIPHQHTKTQQFINSSGTGYKQNYD
                     EAKLSSNATGNPFLNTGIGYQQQSQINPAYTGYGFGNANTQQQQRRNDGPSLIDI"
     gene            complement(<153981..>154127)
                     /locus_tag="DEHA2A01826g"
                     /db_xref="GeneID:8998118"
     mRNA            complement(<153981..>154127)
                     /locus_tag="DEHA2A01826g"
                     /product="DEHA2A01826p"
                     /transcript_id="XM_002769906.1"
                     /db_xref="GeneID:8998118"
     CDS             complement(153981..154127)
                     /locus_tag="DEHA2A01826g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01826p"
                     /protein_id="XP_002769952.1"
                     /db_xref="GeneID:8998118"
                     /db_xref="UniProtKB/TrEMBL:B5RSN9"
                     /translation="MTVAQVGPGRGSGGMGVSLPSDSPAGTGGYERGGMGPILVWPGS
                     LASV"
     gene            <154694..>156421
                     /locus_tag="DEHA2A01848g"
                     /db_xref="GeneID:2899623"
     mRNA            <154694..>156421
                     /locus_tag="DEHA2A01848g"
                     /product="DEHA2A01848p"
                     /transcript_id="XM_456418.1"
                     /db_xref="GeneID:2899623"
     CDS             154694..156421
                     /locus_tag="DEHA2A01848g"
                     /note="similar to CA0284|IPF14657 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01848p"
                     /protein_id="XP_456418.2"
                     /db_xref="GeneID:2899623"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF1"
                     /translation="MSEVRRCRRCKRKRLDDEPPEVRQYKTCAKCRIIERQKKKSRKP
                     LAEETMIYGMKQFQQQNQNANFIHDDIFMDDDVFSGGVRNSARRYEGDGVVNPSQQQQ
                     QQQQQFYQFQPQQASHVAMPTASLAPVAPLHQVQHQVQQQQVQQQQHVQQQQAHRAHQ
                     QHMRNMPVQVSMPETVSQQPINCEICSTKLDRNDELNMNYRLCLECYSNPFRQDNVYG
                     NYNEFLMAITTHKYKDIRNYIYIKETDKTFSDHLVYQNRPISSERSYREFILENIQII
                     YLDPIIASLGCKFNRVSSNVSETNSLPPVFNPVINQYQYKNTKPIRSYHKYYKESACD
                     ANIYMTFDFSTNILTVKLNQKVFNNSSNYPSKFIDLVHSILKSLATQDSKANVGYNYH
                     TALIIFDELIKNKYSYPPDIQQFLSTCNSSDFARDFINFEETTEVDATGKKDSLPAQK
                     DDADEPVPDQVHGDARQATHAGVDDEEEDEEEEEDEEEEEDDDDEDEEGEEDEDDDDD
                     DDDREPQQGPNASQGVQSRDVTDTPSETPIPTSEPQTQINPTINLDSTQNGLYPKPTG
                     ENLDPAFVQ"
     gene            <156585..>157931
                     /locus_tag="DEHA2A01870g"
                     /db_xref="GeneID:2899638"
     mRNA            <156585..>157931
                     /locus_tag="DEHA2A01870g"
                     /product="DEHA2A01870p"
                     /transcript_id="XM_456419.1"
                     /db_xref="GeneID:2899638"
     CDS             156585..157931
                     /locus_tag="DEHA2A01870g"
                     /note="similar to uniprot|P36091 Saccharomyces cerevisiae
                     YKL046C DCW1 Mannosidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01870p"
                     /protein_id="XP_456419.1"
                     /db_xref="GeneID:2899638"
                     /db_xref="GOA:Q6BZF0"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:Q6BZF0"
                     /translation="MKLTIVLSAVIGLVSTVQGIWLDTNNVTNLKEVSAIFAEGLLDY
                     YDGNEYGGTIGMFTWPYYWWEAGGAWGSLIDYTYYMENDTFVPLIKQALEYQTGDDLN
                     YIPLNQSTTEGNDDQGFWGLAVMAATEKNFSNPDNKDKHWLALTQAVFNTMTARWDHK
                     ECHGGLRWQIFQWNSGYDYKNSVSNGCLFNIGARLARYTSNDTYMEWAEKVWDWMYGI
                     GLLTEGEHWYVYDGVTVGGNCTDITKLQWSYNQALMLSGCAFLYNYTEDEMWYNRTMR
                     LLSGAQVFFKDDIMYEAACQGSNNCNQDQRSFKAYFSRLLGLTSVMVLDTEPVITEWL
                     VASANAAAKNSCTGGSDWHTCGLNWQNGTWDGYYGLGEQMCALEVVTNLRVHDLPPPY
                     TANNGGSSKGNPAGGYAVTNTNSSPLNLDKGDTAGASIITVIIAASLVGSGVWLIL"
     gene            <158128..>159876
                     /locus_tag="DEHA2A01892g"
                     /db_xref="GeneID:2899618"
     mRNA            <158128..>159876
                     /locus_tag="DEHA2A01892g"
                     /product="DEHA2A01892p"
                     /transcript_id="XM_456420.1"
                     /db_xref="GeneID:2899618"
     CDS             158128..159876
                     /locus_tag="DEHA2A01892g"
                     /note="weakly similar to uniprot|P47057 Saccharomyces
                     cerevisiae YJL036W SNX4 Sorting NeXin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01892p"
                     /protein_id="XP_456420.2"
                     /db_xref="GeneID:2899618"
                     /db_xref="GOA:Q6BZE9"
                     /db_xref="InterPro:IPR001683"
                     /translation="MSSDDQFTSIQWDRDELGPNKETKVNKQETITEDDEHHNNDNED
                     KDNDTTKSNEPENIQEDDETKDDNEPTDSLILSKTGDENISNIESQNEGDHIVGEPDV
                     NQEPSSDSQTEAYEINVVVTSPLRDLDSSSKPYISYLLTTATNHPSVMKLSTVKKEQG
                     KEVVEITARRRYGDFRFLFDCLSNDHPEVMMPPLPSKSNFKYLTGDTFSTEFVHKRLH
                     SLDRFVRFITCHKVLSQSSIFHLFVSDSADWSTFQKNLKISKVGVQESDADKGNSSMT
                     SNVVNKVVNEDLLTETIMNFLTPSKHKRETNKEILEISDKLKKLYENLIKLDKIFTKL
                     NKKNHDLSVDYEQFSQQIMKLSVIQNSSDETNEPTTPEINEQKQFATNFKVFASSLSY
                     FSDNWSNLHKYIDESFLVSLKDCAKYIISLTNLIELQHNKKIDLQVLQDYLNKAKSEL
                     QGLGGSHNAPPNPIITHNNGGIVNNTTQLIRDTLSTSATPNIGSSVTESKVTKLQNRI
                     TELENEISVQSQLVLDLTNKIINEEYPNWDKFNKIELKESLLGLCNEEISFYKGLVDN
                     WSDIELKLLKRLDELK"
     gene            <160242..>161975
                     /locus_tag="DEHA2A01914g"
                     /db_xref="GeneID:2899639"
     mRNA            <160242..>161975
                     /locus_tag="DEHA2A01914g"
                     /product="DEHA2A01914p"
                     /transcript_id="XM_456421.1"
                     /db_xref="GeneID:2899639"
     CDS             160242..161975
                     /locus_tag="DEHA2A01914g"
                     /note="similar to uniprot|P32857 Saccharomyces cerevisiae
                     YKL039W PTM1 Putative membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01914p"
                     /protein_id="XP_456421.2"
                     /db_xref="GeneID:2899639"
                     /db_xref="GOA:Q6BZE8"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:Q6BZE8"
                     /translation="MQLIYHKKLSVITGLFILSLINLVSGYVTKFNELNSQVCSGIYS
                     KHDWGGSFKPSIEIKLLSYGKDKYDSKSKDQKEKEDISVSYVIFEYKDLGNIGYDLGD
                     GKYRYICDDYAINDLGICEKKQKGKFIIQSTSPNSTIMTSSFNHLGEANIHYNVSRSG
                     YYCISTVSMNDKSYSGTMNFQNAFGHLSASEIPKLPAYGILTIFYAIALALYGFQFYK
                     KRNQNQILPLQRYLLAMLGFLTFDTIVVWSYYDLVNRTRNPSAGFVTFYMFFLSFMNA
                     MKISFSFFLLLCISLGYGVVVLKLKKSVMLKCKILAGCHFVATMVYLVSNYYNGSAYT
                     TSSGSSRSMNNSGAGDFLGLLPLIPVTITLTAYYLAVLISIKKTTANLHKQRQIIKLQ
                     LYQNLFRIIFSSVILTFGGLILSSFIYLSMSTTEMIEEHWKGAFFIFDFWPSVVFYGV
                     FMGVAWLWRPTETSYMLAISQQLSTEETADNEDGEADIGQGYHRGHEFELDDLSLISH
                     SDNENQPPADHDSFELSRDENPPPQYSETDDDNKKSKKKEEPSETGNTLFELGEESDD
                     ENKDDDRLNSK"
     gene            complement(<162046..>163263)
                     /locus_tag="DEHA2A01936g"
                     /db_xref="GeneID:2899631"
     mRNA            complement(<162046..>163263)
                     /locus_tag="DEHA2A01936g"
                     /product="DEHA2A01936p"
                     /transcript_id="XM_456422.1"
                     /db_xref="GeneID:2899631"
     CDS             complement(162046..163263)
                     /locus_tag="DEHA2A01936g"
                     /note="similar to uniprot|Q04062 Saccharomyces cerevisiae
                     YDR427W RPN9 Non-ATPase regulatory subunit of the 26S
                     proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01936p"
                     /protein_id="XP_456422.2"
                     /db_xref="GeneID:2899631"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:Q6BZE7"
                     /translation="MSAMDVDRDVYTVLSTLRSETESNELINIFYQLEDYFERKLYHQ
                     LTLTLNEFYENPESKNNRLRIKIYDLFISQFSQKLNSIQVVDFLLASFEDDKEECLNK
                     LLQLKETFVKQLRNNYTNKSEIEETINNDESIIYIDLQIARYYLILNNLEKSETILEH
                     LNPKFESTFENEFSSKINSAFYLTKCQLYKINENYNLFYLNGLLYLSSIKNKSLSIEE
                     QQMLCYDLCIAALLGDKIYNFGELLLHDILNCFKDSQYDWLYNLIHNLNSGNLKNFNK
                     WLAIGFQKSPFLKTFEVFLKQKVIIMSLLELISMKSTTNKQLNFKEISEFTGTPVNDV
                     EHLIIKCFSLNLIKGYINQIDEVLVVTWLQPRILNLDQVNVLYNHLCKWNGQVEGLAK
                     EVHKNGGSIWAGL"
     gene            <164313..>165410
                     /locus_tag="DEHA2A01958g"
                     /db_xref="GeneID:8998127"
     mRNA            <164313..>165410
                     /locus_tag="DEHA2A01958g"
                     /product="DEHA2A01958p"
                     /transcript_id="XM_002769907.1"
                     /db_xref="GeneID:8998127"
     CDS             164313..165410
                     /locus_tag="DEHA2A01958g"
                     /note="similar to uniprot|Q9C454 Emericella nidulans
                     Transmembrane protein UsgS"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01958p"
                     /protein_id="XP_002769953.1"
                     /db_xref="GeneID:8998127"
                     /db_xref="UniProtKB/TrEMBL:B5RSP0"
                     /translation="MASPILISNPSSSVSVLAIVRGVQLALLGGYRSLQNRQLYEIDV
                     CCLALRLIQMSIIIQIILWTPAYFCRFATYILSYLFNRNLAIDFDGDYLLSILNMNYM
                     MISSIRFFEPRLDGIFLMTLSFMDSKSDQQYYANLMRLSFEHNEDLESHISILTSIKR
                     KYNNSIQFRKFVKTNTKTILSTLSIYLMCNKSSKLESILIVVLTFQNFDDKIGTVSSL
                     ILSVILSIIPKHHSLQFITTFGGSCSLMQDLLNPYFTRISLNKLEKNQWVRSREGLLL
                     GFSICYFLIIRKLPWLGLLIYGIAEASTAYLVTKISNPPPEQPKQLINWCSTQLIWSV
                     EEQRRILDGNFIFDKNFKPFPGSFFFYPPPN"
     gene            complement(<165403..>167667)
                     /locus_tag="DEHA2A01980g"
                     /db_xref="GeneID:8998131"
     mRNA            complement(<165403..>167667)
                     /locus_tag="DEHA2A01980g"
                     /product="DEHA2A01980p"
                     /transcript_id="XM_002769908.1"
                     /db_xref="GeneID:8998131"
     CDS             complement(165403..167667)
                     /locus_tag="DEHA2A01980g"
                     /note="weakly similar to CA3944|IPF4750 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A01980p"
                     /protein_id="XP_002769954.1"
                     /db_xref="GeneID:8998131"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024761"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:B5RSP1"
                     /translation="MIKNIPIGRANVAAGITDPLQWSENSQLAVNNGSQLTILDPKLP
                     LIHQSITSSTYGDGSSSFTMLDPKKLFDISSILDSESIDGLNLRNLDNIIIESANEKF
                     SFGRITEPLITSHYWSPLNPTSKDCYLGVLFNTSELLIFQRSNFRPSNYAVKINVFHE
                     LLSKLHLTDESFSNGEISMNYEQYLSLKVQCFRFNQITGNNETRLFLSLGLANNNISI
                     CELCDGLPVFLNIDTGETIFKHSWSPWLIKAGKYHSYLVVTTSMNSVILYELTFDPNS
                     NSINSSEHVCLQKSSRFLISQCAFHPIGNAMLLMITNTKKLKVFTIDTLNKVHEANHD
                     LSTSSLVTGTFNVSENEAVLDINIAFETGQFELVSFDLKTRSIQAKTPHNSLTKFVSK
                     NLHKYQLYNSKQHDVEESENNATTPFLNNVVEGNFINYCTRLNSNGLVSVIYRIYPKN
                     VLNYTILSKFEFNIGFIPIREVYTQMEGTRLSCTSLSYLNQLWFNKYNEIPKFPKLIS
                     DNKQDEINSFIESIQSFRKNNFIDISGAAIDINNIADLRKYLIVNFVENDTIKNLQYL
                     FNFNTIVSKSLSILTSKFPDTNNISEVERQIDREQKQIERIIIKHLCKLIISFVNQYN
                     PEITSNLDQFIVINYYLLMSETDTTFESKFPIETEIKLTTRFFEESFRVSVNDIIDDN
                     TTDMTTSTTNHKWSRCKLTFLPILELKNKVDELKMFNYIIYEHMPKESWIINTLMETL
                     DFCIYSGNKKYEIS"
     gene            complement(167761..167844)
                     /locus_tag="DEHA2A02002r"
                     /db_xref="GeneID:8998133"
     tRNA            complement(167761..167844)
                     /locus_tag="DEHA2A02002r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (TAA) cove score=67.29"
                     /db_xref="GeneID:8998133"
     gene            complement(<167989..>169953)
                     /locus_tag="DEHA2A02024g"
                     /db_xref="GeneID:2899636"
     mRNA            complement(<167989..>169953)
                     /locus_tag="DEHA2A02024g"
                     /product="DEHA2A02024p"
                     /transcript_id="XM_456427.1"
                     /db_xref="GeneID:2899636"
     CDS             complement(167989..169953)
                     /locus_tag="DEHA2A02024g"
                     /note="weakly similar to uniprot|P38069 Saccharomyces
                     cerevisiae YBR015C MNN2 Alpha-1 2-mannosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02024p"
                     /protein_id="XP_456427.2"
                     /db_xref="GeneID:2899636"
                     /db_xref="GOA:Q6BZE2"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6BZE2"
                     /translation="MVALNNMFGMSKLYVKHSKRILLVCLILVSIHVFYLVHRNKWAS
                     NSVSIKNEGYRLIKYFENSESGLMVVEKSYKVSRSEAGRAENEDEGINNNRFNIETIE
                     GYKYDKQQAIDQQQKILQENASVEEKMEFETRFVERLVSFFSDLFVLIEACGPDIDKV
                     NNDEHYQASKEANKFPNRDGRMPTYGGHLRENYLEEPIRTKELLESYLQLSKEEIFAL
                     TKSQSKFMESMPNEYPSEMVELSKYNQFLKGDGIVYLGGGKYNQLVMLSLKLLRSHGS
                     QLPVEVIIPKRSDFDIDFCNRVLPNMNAKCKVMSDYLPEKIMKTIGGFQFKTVALLIS
                     SFENVLYLDADNLPIKNIDLLFTNKPYVDKHLVMWPDLWRRSTSPIFYDIAQIATDDK
                     KRLRNSYFLGDTRGTSDKISYHDSEGTIPEASSETGQILINKKVHFKTLVLSMYYNFY
                     GPDFYYPLLSQGAAGEGDKETFIAAAHKLDLPYYQVQEFNREFGPINHDTLKHEYFGM
                     GQYDPIIDYIQSSQQEKYFNSVNPTYGKSNTDVENSNYDYHLYHSSSLLFLHANWPKY
                     YVRDLLLGNANGRGPKDKDGNRRRLYDKNLIQELNGYDFELHIMEELKWCFCNLININ
                     LADVPNPKDPVRGDICKEIHGQIEFLQQNK"
     gene            <171295..>173172
                     /locus_tag="DEHA2A02046g"
                     /db_xref="GeneID:2899969"
     mRNA            <171295..>173172
                     /locus_tag="DEHA2A02046g"
                     /product="DEHA2A02046p"
                     /transcript_id="XM_456428.1"
                     /db_xref="GeneID:2899969"
     CDS             171295..173172
                     /locus_tag="DEHA2A02046g"
                     /note="weakly similar to uniprot|Q04053 Saccharomyces
                     cerevisiae YDR425w SNX41"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02046p"
                     /protein_id="XP_456428.2"
                     /db_xref="GeneID:2899969"
                     /db_xref="GOA:Q6BZE1"
                     /db_xref="InterPro:IPR001683"
                     /translation="MNPNDNNLFGDIEQDNNPSFYGNQSFLRDPYGKSKQTCPPSVTS
                     NGDPSITNDDNNSAHNNDLVSNSIVLSKKIEQMVNDPNLQINVISSERMINSSVVAYS
                     IELSSFDDNRMIVKRRYSEFKSLRDNLQILFPTLVIPPIPEKHTLFTYLINSIDNSKE
                     LNIIETRKRCFANFLKDIIFDSNVALKSCVLVHKFLDPNYELCWNNAVNEPPVSLIPN
                     NLLLANPVNPTDQNGLYSLLPIVNGFELNSNIDNISSLHKLNEDLHKLNEQVHVFELR
                     KEQNERRHPSEPTTSLFTEIPISLIDFEKNFHQNIKVLTELNKLNSRSVKNFKSIINT
                     LIELGGNLNNFSLQIHELNTDSNALSSLIEKFGSTIDSNFLGYEAFLMNDIIPEWQEP
                     ISQLVQYYLTSLQLIKFYKFKIIQYKLVYKLKFNKYQELANISTNFESQSKLKDLRNL
                     DIDSPSINEAIKKIELNQKRLKNRKISSKKSWYGLFGGNSKPTFNLREDLPASTIPSE
                     GTGIRRERTPLVSDENMSYPVNPSANLENTNIDINSHYKHKINQIEKELTKLDQLIDL
                     TNTDISTLTQELNLNFNDFLVRVEKKWLVIMLEFIKNGKQLFKDNLQNWNECKVFIND
                     L"
     gene            complement(<173853..>174068)
                     /locus_tag="DEHA2A02068g"
                     /db_xref="GeneID:8998121"
     mRNA            complement(<173853..>174068)
                     /locus_tag="DEHA2A02068g"
                     /product="DEHA2A02068p"
                     /transcript_id="XM_002769909.1"
                     /db_xref="GeneID:8998121"
     CDS             complement(173853..174068)
                     /locus_tag="DEHA2A02068g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02068p"
                     /protein_id="XP_002769955.1"
                     /db_xref="GeneID:8998121"
                     /db_xref="UniProtKB/TrEMBL:B5RSP2"
                     /translation="MTDSQITRCSILPVKDINTSLHPYISGTANGCETYSDRGYIESV
                     ISIGSIATGQMFQSEEIKFVTQAYSSR"
     gene            <174270..>175322
                     /locus_tag="DEHA2A02090g"
                     /db_xref="GeneID:2899970"
     mRNA            <174270..>175322
                     /locus_tag="DEHA2A02090g"
                     /product="DEHA2A02090p"
                     /transcript_id="XM_456429.1"
                     /db_xref="GeneID:2899970"
     CDS             174270..175322
                     /locus_tag="DEHA2A02090g"
                     /note="similar to uniprot|P25379 Saccharomyces cerevisiae
                     YCL064c CHA1 L-serine/L-threonine deaminase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02090p"
                     /protein_id="XP_456429.2"
                     /db_xref="GeneID:2899970"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q6BZE0"
                     /translation="MSLPVETLRDSQPFIKTSLVEVTKDLPNKPPCRVFLKNEYEQPC
                     GSFKLRGISNLIYRSIQKAKKEKIDKTLYVFASSGGNAGLAAAYSARYFRIGCTVVLP
                     TTSKPEIIEKLQSYGAKTIMHGKNINEADGYLKNMMRNIDLNIYPIYCHPFDNPLIWE
                     GHSSLVDEVYQEQLSYNDSQKVKGIVCSVGGGGLYNGIMKGLEQNKTNKDTSLMLVET
                     NQAPTLLETIKAGEVFTLDSVNSLATSLACSYLSEQSLDNYYNSKFKTYVDSIDDLDA
                     IQGLIDFYSNSGVVVEPACGTALSLVYNRMDILTKHYTNLSPDDIIIVVACGGSCTNL
                     EGVENFKKMLNTTCKL"
     gene            <175605..>178067
                     /locus_tag="DEHA2A02112g"
                     /db_xref="GeneID:2899632"
     mRNA            <175605..>178067
                     /locus_tag="DEHA2A02112g"
                     /product="DEHA2A02112p"
                     /transcript_id="XM_456430.1"
                     /db_xref="GeneID:2899632"
     CDS             175605..178067
                     /locus_tag="DEHA2A02112g"
                     /note="similar to uniprot|P22516 Saccharomyces cerevisiae
                     YPL008w CHL1 Conserved nuclear protein required to
                     establish sister-chromatid pairing during S-phase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02112p"
                     /protein_id="XP_456430.2"
                     /db_xref="GeneID:2899632"
                     /db_xref="GOA:Q6BZD9"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGNLEANDVGNNSRKYNHPFEPYDIQIQLMDAIYDAIDNYKIGL
                     FESPTGTGKTLSLICSSMTWLREYKKNSTFRETEDSESEDEPEWVKQAYQKTIANRTK
                     VRAQEYERLLDDLSENYDVSKVSVLPEKKVKRQKPEQEQDENFIPADYYSDSELDSKY
                     ENDKLTSEINELLSRVDGPKETVEPVNDCPVKIFFSSRTHSQLSQFSHQLNMTEFESS
                     LDNIPERIKFSPLASRKQLCIHPKISKLSNVSSINDACIDLQQSSKNSCEYIPKLHNT
                     QSEEIVKKFSDLSFTKIHDIEDLGKLGNKLKICPYYSVRKGIDVTEIIALPYQMLLQD
                     STRSALNLNIDDSIIIIDEAHNLLDVISSIYSVSITSNELSDITKSLKFYLNKFIKRL
                     NSGNRINIMKLIKLCQVLEKFISSNSKDGKIKHGDEIITSDIFEGTTGDLVNIHKIEQ
                     FLNKSKIAYKIESYMQKLNDSESIKNRSNPLLFKITKFLKCLTNPSKEGKFFWDKTND
                     SVSINYMLLDPSEIFRDIVKRARCVLLCGGTMEPMNDYTNYLFPYIPPEQIKKFSCGH
                     IIPQENLEVFPIGNYNDISFEFSFDKRNNSKMIIELGHAILNIIESTPDGIVIFFPSY
                     KYLNVVMNVWRQNKIIESLTKVKAIFQEPEDSSKVEKVLNDYSSTNKSEKHSALLLSV
                     VGGKMSEGINFSDELARGVIMIGLPFPNIFSAELIAKRKFIEESTIAKGGTKSQAMVN
                     AKNFYENICMRAVNQSIGRSIRHKNDYSIIYLFDQRYGSDKIQDKLSGWVKQKLFTRG
                     RCTDFNQVIKETQDFFRQKLLG"
     gene            complement(<178085..>178846)
                     /locus_tag="DEHA2A02134g"
                     /db_xref="GeneID:2899635"
     mRNA            complement(<178085..>178846)
                     /locus_tag="DEHA2A02134g"
                     /product="DEHA2A02134p"
                     /transcript_id="XM_456431.1"
                     /db_xref="GeneID:2899635"
     CDS             complement(178085..178846)
                     /locus_tag="DEHA2A02134g"
                     /note="similar to CA3941|IPF4754 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02134p"
                     /protein_id="XP_456431.2"
                     /db_xref="GeneID:2899635"
                     /db_xref="GOA:Q6BZD8"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD8"
                     /translation="MPPKKSKNDSKVLKTDSKLLKKFKFPDNFNNLSINYSKQFFKPQ
                     PETLISDQIIIVEKFFSNELCNELIKSFESSPDLKMETTPLIKSKDYAARFNDRGFSV
                     DFDASRNLWSYLQKILLRDVEYEDDDDNDVKSIFNDAIALNSQLRIYRYRKGHHFGQH
                     YDESVICPLTEDKNNQKGITKWTLLIYLTGDDEFKGGGTIFYPDYSSAKHLNVHPSKG
                     MALLHKHGDDCLRHEAELVEDGVKWVLRSDVVYPS"
     gene            complement(<178960..>181830)
                     /locus_tag="DEHA2A02156g"
                     /db_xref="GeneID:2899966"
     mRNA            complement(<178960..>181830)
                     /locus_tag="DEHA2A02156g"
                     /product="DEHA2A02156p"
                     /transcript_id="XM_456432.1"
                     /db_xref="GeneID:2899966"
     CDS             complement(178960..181830)
                     /locus_tag="DEHA2A02156g"
                     /note="similar to uniprot|P34077 Saccharomyces cerevisiae
                     YFR002w NIC96 nuclear pore protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02156p"
                     /protein_id="XP_456432.2"
                     /db_xref="GeneID:2899966"
                     /db_xref="GOA:Q6BZD7"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD7"
                     /translation="MSFFGQCNGLSGSSGSSGTGGTNLATGGVNESLQMGNRSDAGAI
                     PSSGNVSGTIPSSNAHTSSRLLQDLLESANNLPKPNNSDLGSIHLTLNGLKKKSNQLR
                     KRNDNEGQNFTKAHYLLASSGVSAEEIENELNSIEVPVKPLESQTVSNAVNNNIDSYL
                     NDKKDENILAAIEQSLVSASKDFNQFINENVSIDWKVRRDELRKSFGIGSPQKNTSHK
                     VSKPTKSVTWNKSIPGNYNVLTPLSTNKSTSFLKNLTREKFENNAQIVYQLNEARLNN
                     SFFPIALSFEELNKSYSDLKSRQISEAWKILIELTNEKTNKINQEQKFFETYQTADHT
                     NSMKFRKQVIQRSKNYLEQQFYNYMDEIYTKDDKKKQFSTSINIDKVSYFIDRIIMKN
                     NTGFVDQTLNVNGVPIWALIFYLLRSGLYNDALELASQNKDLFNKFDKNFPVYIKKFV
                     ENDCINLPMELNERLNAEFNQQFAFINDDLKGNFDPFKYSVYKLIGKCDLSKKKLPDE
                     INLSIEDWLWFHLSIINEFSFDLNSSSLIFENYSLENLQKKVIQLGPKKFNSSSNNPL
                     YLKTLIMVGLYELAVEYAFDSINECDAVHLAIGLCYYGLLKVSSFNNKDELIFINSSN
                     EYEINFSRLLGSYTRFFKISDPMVACQYLILIAMSKGGDSKEEISKCHEALRELILIS
                     REFNMLLGELNQNNGNKIPGILEKQRSLINLSNLEQFQKQIIETSAIRCEEEGRIFDA
                     LLLYQLCQDFDTVVSLINKLLGETLSTTELDKPLINYGNYENINGEIQSENTIDNNII
                     LLSQHIMKLFYNNSFILDRISPSKKETCDLLLPIIHIRDLFMNKNWNDVIIEINKLGL
                     LPVNKSNGLIEIRKMAEFVHNTLDDTLIKVIPSLLIMVMTSVSQLNYSILTKRYQTSS
                     NEREELSNLKTIAKNCMIYAGMVQYKMPRETYSLLISLESSL"
     gene            <182788..>183429
                     /locus_tag="DEHA2A02178g"
                     /db_xref="GeneID:2899307"
     mRNA            <182788..>183429
                     /locus_tag="DEHA2A02178g"
                     /product="DEHA2A02178p"
                     /transcript_id="XM_456433.1"
                     /db_xref="GeneID:2899307"
     CDS             182788..183429
                     /locus_tag="DEHA2A02178g"
                     /note="similar to uniprot|P36018 Saccharomyces cerevisiae
                     YKR014c YPT52 GTP-binding protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02178p"
                     /protein_id="XP_456433.2"
                     /db_xref="GeneID:2899307"
                     /db_xref="GOA:Q6BZD6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD6"
                     /translation="MATSKSPPYKIVILGDSSVGKTSLVHRFTTNKFDEHTANTIGAA
                     FITKEHHSNNNPEKKVKFEIWDTAGQERYRSLTPMYYRNAKTALVCFDLSNMEETFDK
                     AKYWIEQLQINANDQDIKIKLIGNKNDIDSSSDPSDYISSLASTMKFYKTSAKTGEGI
                     DELFDEVVDDIDEEFFTEYYKNQDNEANNSQRPGMINVFNSRFGDTTNNNKCC"
     gene            complement(<183487..>185289)
                     /locus_tag="DEHA2A02200g"
                     /db_xref="GeneID:2899308"
     mRNA            complement(<183487..>185289)
                     /locus_tag="DEHA2A02200g"
                     /product="DEHA2A02200p"
                     /transcript_id="XM_456434.1"
                     /db_xref="GeneID:2899308"
     CDS             complement(183487..185289)
                     /locus_tag="DEHA2A02200g"
                     /note="similar to uniprot|P53632 Saccharomyces cerevisiae
                     YOL115W TRF4 DNA polymerase sigma"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02200p"
                     /protein_id="XP_456434.2"
                     /db_xref="GeneID:2899308"
                     /db_xref="GOA:Q6BZD5"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD5"
                     /translation="MMVSKRKRESPPVKLKSKKQRKKTSKSGGIIPIENKYEALPSSD
                     NESDSSLKFDFKSNSREPEMVFVESDDEEEGVVIVSDDDKPEDSEEPASKKQKFVNNE
                     LAKNQDFIEFGFSSSEEDAPERNDYDDYSDDGVLSDDESGTIHTQTTTKSLYPWIKDH
                     DHSKQKEIADWFTMEIKDFVNYISPSEAEIMTRNRVVNQLKQQIGQFWPATELHVFGS
                     CATDLYLPGSDIDMVVVSETGDYEHRSRLYQLSSFLRNKKLAKNIEVIAKAKVPIIKF
                     VDPTSNIHIDISFERTNGIDAAKKIRRWLSSTPGLRELVLIVKQFLRSRKLNNVHVGG
                     LGGYSTIILCYHFLKLHPRLSTKNMAVLDNLGSLLIEFFELYGRNFSYDNLIIAIDTE
                     TDLPKYLLKRKHPVLNTSRNPFSIIIQDPSDPANNITRSSYNLRDLKKAFGGAFQLLV
                     DKCYELNGASYKSRIGQSILGDIIKYRGKERDFNDDRHKVTNDALINHENEEGNDDDE
                     SDGANGNNKYYFSDMTVESEEDTTFAQEIKPEDPNKKKVADFMSINVPSEDEEDDPKE
                     KKEEDTETQDSDKQKNNLDKDIKRDYWRQKGLGL"
     gene            complement(<185407..>187611)
                     /locus_tag="DEHA2A02222g"
                     /db_xref="GeneID:2899640"
     mRNA            complement(<185407..>187611)
                     /locus_tag="DEHA2A02222g"
                     /product="DEHA2A02222p"
                     /transcript_id="XM_456435.1"
                     /db_xref="GeneID:2899640"
     CDS             complement(185407..187611)
                     /locus_tag="DEHA2A02222g"
                     /note="weakly similar to uniprot|P47042 Saccharomyces
                     cerevisiae YJL057c IKS1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02222p"
                     /protein_id="XP_456435.2"
                     /db_xref="GeneID:2899640"
                     /db_xref="GOA:Q6BZD4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD4"
                     /translation="MSIVPYNSSNEIVYHDPNHGILVLHDNQDNTLQLVSTANEGQNN
                     KIDLVRSEDRSSGTRYGNNNPHSHIKCPSCGFAWSEHSNIGETSKRSKSDASNELMDS
                     LKSGPDSRKAMMKNFPEGFMHHDYFKLLGKLPYNQKPRVRSASTLPENIFNQGYFKRF
                     FKKVPPFMLGSGAHSQVYKVVHVLNDIKLGTYAVKRISIGDKIELLEQVLNEVLILYE
                     LSIQGANENNLIRYNHVWLELGDIQDSKTYFLPDKQKNSEFDNSIPYVFILQQYCDGG
                     HLEDLIEKVFLRELHLSAKEQLDLERQRRRSVRKNSNQKLEDMDPESKENKKFWLGCI
                     EIWKFFRDVAKGVHYLHLHGILHRDLKPSNCLLDNKYDNNPIDNRIYGCENELNGELS
                     KLPKVLVSDFGEGQFINKHNIPADDVSIKDVNKDEDERRGNTGTLEFTAPELWLFSNF
                     DPSLGSERQYFINEFTYESDIYSLGLILCWLCAGILPFSHMIKGELDPQLIRDKILEW
                     YFDLNATKFHEWFVSSVQIKPGTNEFDESCVSDFEKLIYLMIKGDDSKEPENSPPNRL
                     LSGDVIKFLEAMKWKRFIAENEIIQDNPEEETNKFGLIPAINPSQPEEAIDPDFIYQS
                     DDITSEDDDVHDIASSEYDDDYSVQVPTRDAFISSAVTKSNIFNFCMILGYMLNILLF
                     DIIEYNIFYTYKLMVKILVLVLFSTDLLLLESKFARVSCLILAFSLSMALAI"
     gene            complement(<187836..>192938)
                     /locus_tag="DEHA2A02244g"
                     /db_xref="GeneID:8998076"
     mRNA            complement(<187836..>192938)
                     /locus_tag="DEHA2A02244g"
                     /product="DEHA2A02244p"
                     /transcript_id="XM_002769910.1"
                     /db_xref="GeneID:8998076"
     CDS             complement(187836..192938)
                     /locus_tag="DEHA2A02244g"
                     /note="some similarities with uniprot|P29539 Saccharomyces
                     cerevisiae YBR275C RIF1 Protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02244p"
                     /protein_id="XP_002769956.1"
                     /db_xref="GeneID:8998076"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:B5RSP3"
                     /translation="MWVDSDTQINGSSSSGSPIIVEKPHNHLGIVDSTSESSFAKSGT
                     HPIDTSHGIQKRDSFTPRTRSTHTNSEVARGLNENDKDNETTSEMTSDSSIIDMNISE
                     DKLESGDLDVSDGNLAKIPKGELSTREEKNYINIPPLADEFMNDQAYMDMELNSSPIK
                     PTSKKVRYREELSSSPIKKKKSVAFSDDLVSELPSSPAAVHCGSRLPVLEHTPKKSIL
                     KINSLNQTSSPCNPNDTSLWVKSSNNINIKNSPSNPEFWLSGTIIQLAPNSPDLPQLI
                     DGCINVLRDKKFSKKFEVYATLNHICRCNTSDSLLKLLTIPSKSNSPQKINSKSSMKT
                     NSTSFMDNTYIHTLSAFIQRDVKQIELKLFCENEEKENNYSPSKNDPFSIRIISQALK
                     VINFIMLDQELNNFVSIEDAKWFYVHCCKTIVKPTISKTLIIPYLSILKDCKFNNKKK
                     KLIFNNQNENANISELILQSLLNMRKFVSSSLVVEEFVTLKNLVSNFPVMMANNFKHW
                     FEFFLMNLCDLSSPLYSKVIGMGISVLLEVARNYLDNKNVLFSVRRLLASPLPSTVKS
                     ITSDSTISVSPEAPTTKSDENLVIHFIISTLETLIGNGQYKSAMDIWVGVTLLSSDSG
                     SGYENWPFLSDWLRVHKSCFNVNNNSAKMIALNSWKAVIFNVCHNDLDSIRCLIDSSP
                     NSKSSKSKPQAINNILKPKIKLLIHPLLNISAVENQKEIIDSSHNLFLSIIYTLLNPS
                     VLNSSRYVHVYWDKIIQSVFINFYFKKELSNTYMNELGLKILTRLIKPSVSTNEKPFN
                     EMRCLSNESISLNDISPVSPKWIFSKFDRILQNINIVFKLEGLTIDSKLEFFNNFLNS
                     LKSITKKEIKPSDATQDIIDNLPNVLSVLFKHNKLSYSSIQKLMLNLNDTFDASNLIE
                     KNGTRSNATNIYILIINNCLSDMEELQAFDFLESIHLAIRDSKNLIFLLELVKLQEYN
                     THAGLKNFIVSALNSRKINAASNLELELAGNLFQIISKDYESIAKKLIQSIVLLSATE
                     FERVSGILDIQLWTIPIFKYFVELVHNAPHPHLKQIPLNLIISRFENDEEFFEILKFL
                     IDKRFDLELYNLRKNIMKKFKALEGFRQFEFRSVWNSYLSNIVESGNFKLLDDFLVSS
                     YEVGLDVRSHIQNKWDRLPLLKKAWLTDNSKLYFDSELLNQTGPASPGDSKNSEVSGK
                     EDNTQIIAAPDCSKDLQMDDMETIESIENIAIPKSFSNSNKDSKTNRYEKRNMSSGSD
                     ISQLEIDNSTKSKANRKRSKSVAKPKPKKKTNIKVKKENTPAPEVNPNFDIHSFTAML
                     NAKLSPATPIKKARRNAKSNLNKSSPDNGSNSESCISPSGNEETIDLDHIKSEVQIPS
                     SFNDDDISQLEASSMSQNSINEFDLVEDEPSSPPETLDRTRKSISPSSNDYSKVIQNG
                     FSSRESSDSSDDIENTDDQESTNYKRKTCYDEDEISGRKKQKQNEFPSDEKNDNGTSA
                     PESGISMTDESTGNSNLDNHIVHVSSSDQFRKDVNDSIENDEIQCSATSDQTAPPTFD
                     TQDFRATSTALAEPSNTETSSSIQLSDSYNSMIPNSPPVHVGDRSEDFTPESDSKSNN
                     FLSTIGEDDEIDSQNLKEKEDSDNGPQDEGSTTNENSELQPCEAANNLTSYIENMSDV
                     EISRIPQSEKYQLETKLMTFILRMRNIDSVES"
     gene            complement(<193093..>195342)
                     /locus_tag="DEHA2A02266g"
                     /db_xref="GeneID:2899627"
     mRNA            complement(<193093..>195342)
                     /locus_tag="DEHA2A02266g"
                     /product="DEHA2A02266p"
                     /transcript_id="XM_456437.1"
                     /db_xref="GeneID:2899627"
     CDS             complement(193093..195342)
                     /locus_tag="DEHA2A02266g"
                     /note="similar to CA4051|IPF10231.exon1 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02266p"
                     /protein_id="XP_456437.2"
                     /db_xref="GeneID:2899627"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD2"
                     /translation="MATEDNRLAQPIELCSNALIDLINQFVPDDDSNYLLKTFEFEKF
                     TGKHQIFEDIIKEYDFDYKIDVPMTEVDDTDDEVANNLKNEIGNFNVGLDEKTRDFIL
                     TMSFQKAAQEFLTKQLEELKNTANEDEVKADKVIETGKFNISRDELRSYNRLSVLVDF
                     QMHLVIETYPSIKSSFYSLLSQISQTLFNMSTNAISTFWYYLETRKKLIQDKIFDKQV
                     TSDRISFLEICNTLTDRFFEKNIQGKRDLCKKDTFNDTFQYRVRMFIANIFNFEDNTG
                     LNKYFSTSNRIVKDFSTNSRSRDDSFIKDVIQINKLFRDPYYFLKPANHKQLTRISDT
                     LKKVYEYLMEEENSWSSVAPKIDQFAVPTPKSETEERHLKEKYANKLYFPEHYSLAQF
                     DEKKRGDSFDQLKKQDYSFMSKQFDDSKVRQTCLIQIYFICHLYYELNAANKKVFLKS
                     LNGPANIKHFTDDSPPDSLVSLFFKIKREIPKRYRSIDSQFSFLLQHMAIDETFWWGW
                     LIYGKDPNTGKSLFVDKVLTASELAVAQEKTETIIPFKEKRYFNNYATPQLSRKMKVE
                     RGISILAKDSETSDNDRFQEGIDLLTEKISDAKDKQELDQLVDERNVLTWKHLKKQRN
                     SNWLKFGNLLNKQMLSAELNMPEVSEKAAESTEQPETKEKTEDAGDNNNGNIVEKIAE
                     ESQSNIEEIEKEGMVRDSEILHDESNTESNPQSNELDSNDESSGIKRSRDADDTITEE
                     EPATKKTKN"
     gene            complement(<195593..>196300)
                     /locus_tag="DEHA2A02288g"
                     /db_xref="GeneID:2899696"
     mRNA            complement(<195593..>196300)
                     /locus_tag="DEHA2A02288g"
                     /product="DEHA2A02288p"
                     /transcript_id="XM_456438.1"
                     /db_xref="GeneID:2899696"
     CDS             complement(195593..196300)
                     /locus_tag="DEHA2A02288g"
                     /note="weakly similar to uniprot|Q12322 Saccharomyces
                     cerevisiae YOL114C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02288p"
                     /protein_id="XP_456438.1"
                     /db_xref="GeneID:2899696"
                     /db_xref="GOA:Q6BZD1"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD1"
                     /translation="MVCIIAIFLGHKSNKWVLVPSNRLYNIIMYRMKLLQLPVKGIRF
                     YPISLNCIRNVNPVTPGIVRAFSTAPDSEFSTEEISKAKEWMENFSSTQVPDNIFEIS
                     YSRSSGPGGQKVNKTSSKATIALGPDQWLNPQFCFWIPKPIRSQINENKIRYETKSGG
                     ILVQSDSTRNRDTNTDECFRKLIQEIKDNTFFAGETSEEDKKRWQEIKDDRKEKRLFN
                     KKRQSDKKKHRSKNFDV"
     gene            complement(<196452..>197009)
                     /locus_tag="DEHA2A02310g"
                     /db_xref="GeneID:2899697"
     mRNA            complement(<196452..>197009)
                     /locus_tag="DEHA2A02310g"
                     /product="DEHA2A02310p"
                     /transcript_id="XM_456439.1"
                     /db_xref="GeneID:2899697"
     CDS             complement(196452..197009)
                     /locus_tag="DEHA2A02310g"
                     /note="weakly similar to uniprot|P38013 Saccharomyces
                     cerevisiae YLR109W AHP1 Thiol-specific peroxiredoxin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02310p"
                     /protein_id="XP_456439.2"
                     /db_xref="GeneID:2899697"
                     /db_xref="GOA:Q6BZD0"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:Q6BZD0"
                     /translation="MLSQLTRNIARPQFVRTFRTSMPSFVAVGDKIPSTTLFESSPGN
                     NVNLAEETSNGKSVIIGVPGAFSPACSSSHVPGFLSKLRDFNNKGYQKFFIVSVNDAF
                     VMKAWGSSLLGNIDGDQISFLADPQAEFVSALDLKFDATKAFGNERSKRYALLVEDGK
                     VTETFVEPDNISVDVSDAEKVLSQI"
     gene            <197214..>197795
                     /locus_tag="DEHA2A02332g"
                     /db_xref="GeneID:2899698"
     mRNA            <197214..>197795
                     /locus_tag="DEHA2A02332g"
                     /product="DEHA2A02332p"
                     /transcript_id="XM_456440.1"
                     /db_xref="GeneID:2899698"
     CDS             197214..197795
                     /locus_tag="DEHA2A02332g"
                     /note="similar to uniprot|Q12517 Saccharomyces cerevisiae
                     YOL149w DCP1 Decapping enzyme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02332p"
                     /protein_id="XP_456440.1"
                     /db_xref="GeneID:2899698"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC9"
                     /translation="MSGKVSSQRSSQRQTPEGDQEEITAQKALELYRNALNFNVISRY
                     DEFIKQLLYHTSHCVIYKFNDETQEWVKTDYQGTLALYLRDFKVPQNQGFPPTYQDLQ
                     NLFCYGLLLLNRNNPECFSLGLLPNKIIKHFFPQGLNNMNILEMDVELNDNLIIVKDL
                     VGDIYGLWVFNEDDRMKLYKLLEFCLTNDSSML"
     gene            <198425..>200905
                     /locus_tag="DEHA2A02354g"
                     /db_xref="GeneID:8998056"
     mRNA            <198425..>200905
                     /locus_tag="DEHA2A02354g"
                     /product="DEHA2A02354p"
                     /transcript_id="XM_002769911.1"
                     /db_xref="GeneID:8998056"
     CDS             198425..200905
                     /locus_tag="DEHA2A02354g"
                     /note="weakly similar to uniprot|P50875 Saccharomyces
                     cerevisiae YOL148C SPT20 Subunit of the SAGA
                     transcriptional regulatory complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02354p"
                     /protein_id="XP_002769957.1"
                     /db_xref="GeneID:8998056"
                     /db_xref="GOA:B5RSP4"
                     /db_xref="InterPro:IPR021950"
                     /db_xref="UniProtKB/TrEMBL:B5RSP4"
                     /translation="MINTGANNVSSAPHNRTNPSVQAQTQAHLQHSKLSVQQQQLLRQ
                     RQQQQLQQQQQQQQVTQQRQPRPNLQNYHFASTSPEVLKKYAKYPPSLSFHIYESHYR
                     LSNSQDSNIIPKSSPMIKSFLQHVMREEIPFEMSELIKDFAIRSYDGCLILQVYDHRN
                     MIPAGAPNSSNASSTSASTANNTDSSNPSGSTSANINTVANTTTDTSGPASKSSSPSQ
                     NGTNNMVSSTTTTTIESTKVISKPKAYRTLLRPTQLSLYYDLLYHTDSALTKFTDPLS
                     LQMESEILTLTNRKVDLSVPLNPYLCEDYLKPEIEYPRKEWDEKNQDWKLIHSHRDEV
                     QNPPRKLHQDELIMHKSSDYEEIMFLLSNKYKRSDDTSDKKLVVVGSSSLVSTGTTNK
                     NGKEDSVDPEDKGKNSETKNGSTTVVNSNTTSNSTTGQFMRLRYIEEIRKRREAQKAQ
                     QEAVAAQATNNGANLLAQSNNAAAINASKETVPDNKGSFAPQDTNILRPGSQPPAAPA
                     NSQLQRQQQMMAEKAQTLRARQFQAQQQAQQQARQQLQQQQLQQQTNKRQKTDHVQQQ
                     PPQPPQSQQQQQQPQQPYNSISSTPQMGMSQPASSMGTPVMNGNMPTPQQRFQQAQQQ
                     ALSQQPSQSGPSQPQSQGQLNASPAGQTPGTAQNQPNQTQIQQQQIFQNTLNPQEQQT
                     FRQLQSRMNAFAMMGNSGIAPNRAQLTQQQQQQAIQQAKLIQQQLLQKFPVYFQRLRQ
                     FQLLQQQRRQQQQQQPQPPSQSPQPMGNIPSSLPQNSQFNQHQNVGGKTVPGAMSPQQ
                     QQMINQQMLQQMANNMNQQGKKKMYKKK"
     gene            complement(<201195..>202655)
                     /locus_tag="DEHA2A02376g"
                     /db_xref="GeneID:2899719"
     mRNA            complement(<201195..>202655)
                     /locus_tag="DEHA2A02376g"
                     /product="DEHA2A02376p"
                     /transcript_id="XM_456442.1"
                     /db_xref="GeneID:2899719"
     CDS             complement(201195..202655)
                     /locus_tag="DEHA2A02376g"
                     /note="weakly similar to CA2124|IPF10490 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02376p"
                     /protein_id="XP_456442.2"
                     /db_xref="GeneID:2899719"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC7"
                     /translation="MSTYNTQGITPPDDEVKNEVSSLDERLIDYDVNKLIYVRRGSQR
                     DSRRVIGRDNLNFDNSHLSKEHACFQYRNGALYVKDCGSTFGTTVNDKFIVANRWHVL
                     ESCDTIGLIVSKPSTWIAKIVEKFPDHDDIPLEEFSNPPIGLKLRFDYLDDKLKFCVV
                     KDDRDHESVSEVVPNDVSMNETYDTDAYYFDNCLEVGEKHPHECACAERSCTEGNDDE
                     VEPESKLNNNPKDTDKSNDFITHEEVSHLDCKDIECSADLDVHEPHLEISITQEVVDA
                     KSENSDDDESCSFGHFTSELISDSDIGSDSDSLSGFSSSDSDSSSISSSSSSSNSSSS
                     ISDESEPELDTSIIIANINSDDDCADHDCTDHDGWSCQNFSSFTNSNSEESTIYGLPH
                     AIVPVLDRTGDYLDPCITSESSNAEGRKKRSFDEYQDDIQSSDEEHESKKVKLPSTED
                     KFAFKSIAKEVVKGALYALATITALGVYGSTIDNQE"
     gene            complement(<203073..>203993)
                     /locus_tag="DEHA2A02398g"
                     /db_xref="GeneID:2899720"
     mRNA            complement(<203073..>203993)
                     /locus_tag="DEHA2A02398g"
                     /product="DEHA2A02398p"
                     /transcript_id="XM_456443.1"
                     /db_xref="GeneID:2899720"
     CDS             complement(203073..203993)
                     /locus_tag="DEHA2A02398g"
                     /note="similar to uniprot|Q8NIR4 Neurospora crassa G15D1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02398p"
                     /protein_id="XP_456443.1"
                     /db_xref="GeneID:2899720"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC6"
                     /translation="MAIEGLTPEQLETFQREGVLCIPNFLNSEQIQQLADRSHALLNN
                     FDLKDHPKTQFKTNDNDHIGDQYFFDSANKISFFFDVDAFDKESGELRFPKDKAINKV
                     GHGLHMKDELFHKITFDSKVKAIARSLNYTDPRVLQSMCIFKQPQMGGHDARDNSVPS
                     HTDGTFLYTEPQSAVGFWFALEDCTEENGCLSYNPGSHKRFPITKRFAKVNGGKNGCN
                     FISVEYDTSKKIPDDSPNDYKLVECPVGSLVLIHNSVLHKSEKNTSTKSRYAYTFHVI
                     DGTAKYDKLNWLQVPPSEEGGTEFSKLYEE"
     gene            <204881..>205900
                     /locus_tag="DEHA2A02420g"
                     /db_xref="GeneID:2899721"
     mRNA            <204881..>205900
                     /locus_tag="DEHA2A02420g"
                     /product="DEHA2A02420p"
                     /transcript_id="XM_456444.1"
                     /db_xref="GeneID:2899721"
     CDS             204881..205900
                     /locus_tag="DEHA2A02420g"
                     /note="highly similar to uniprot|Q07748 Saccharomyces
                     cerevisiae YDL244w THI13"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02420p"
                     /protein_id="XP_456444.1"
                     /db_xref="GeneID:2899721"
                     /db_xref="GOA:Q6BZC5"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR027939"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC5"
                     /translation="MSTEKISFLLNWQPTPYHIPIYIAQTKGFYKEEGVDISILEPSN
                     PSDVTELIGSGKIDMGLKAMVHTLAAKARGFPVTSVGSLLDEPFTGVLYLEGSGITSD
                     FTSLKGKKIGYVGEFGKIQIDELTKHYGMTPDDYTPVRCGMNVAKYIIEGKIDAGIGI
                     ECIQQVELEDYLRKQGRPISDAKMLRIDKLAELGCCCFCTILYICNDEFLKANPEKVK
                     KFLKATKRATDYILAHPKQAWEEYSDFKPQMTSELNSKMFERCFAYFSDSLYNVHRDW
                     KKVTAYGKRLEILPPDYESNYSNEYLSWPEPKEVEDPTGAQNLMLKHQEECKSCGGYR
                     RLAVN"
     gene            complement(<205983..>206909)
                     /locus_tag="DEHA2A02442g"
                     /db_xref="GeneID:8998095"
     mRNA            complement(<205983..>206909)
                     /locus_tag="DEHA2A02442g"
                     /product="DEHA2A02442p"
                     /transcript_id="XM_002769912.1"
                     /db_xref="GeneID:8998095"
     CDS             complement(205983..206909)
                     /locus_tag="DEHA2A02442g"
                     /note="similar to uniprot|P23833 Saccharomyces cerevisiae
                     YBR037C SCO1 Copper-binding protein of the mitochondrial
                     inner membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02442p"
                     /protein_id="XP_002769958.1"
                     /db_xref="GeneID:8998095"
                     /db_xref="GOA:B5RSP5"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:B5RSP5"
                     /translation="MLSRILLRPRLLTVHSLRTNSLCYSRRLLSNSVYRLNENKPTSS
                     EASEDAATPRKRPLSRVAIGGVQEPDKKFAGGNSVEFAAWKAIVLLLVLGGGVTYWFS
                     TEKERLRIQKETEAKRGYGKPLIGGNFNLIDTEENAFTQENLKNDQKKFSIIYFGFTH
                     CPDVCPDELDKLGVMLDELKEKDNIELQPIFITCDPARDSPEIIKEYLSDFHPSIIGL
                     TGPYENVKNACKKYRVYFSTPPDVKPGQDYLVDHSIFFYLMDSEGNFVDVIGREAEAE
                     EGAEKIRTHIDAFVPAAEREARKESWLSFLYK"
     gene            <207077..>208918
                     /locus_tag="DEHA2A02464g"
                     /db_xref="GeneID:2899787"
     mRNA            <207077..>208918
                     /locus_tag="DEHA2A02464g"
                     /product="DEHA2A02464p"
                     /transcript_id="XM_456446.1"
                     /db_xref="GeneID:2899787"
     CDS             207077..208918
                     /locus_tag="DEHA2A02464g"
                     /note="weakly similar to uniprot|P38732 Saccharomyces
                     cerevisiae YHL039W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02464p"
                     /protein_id="XP_456446.2"
                     /db_xref="GeneID:2899787"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR017119"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC3"
                     /translation="MTVSDLLKWAQEKGTFISSDVEFKELSQGNIGAIYTGNSNGESK
                     SSDDFDLQLPIDLAITLNRAIESFNESGHGDFRDIAKKTSNVNSLLKMFLARERASTR
                     LNSSYFKPYLSLLPNLSDINSPYCWTPQEKALIKGTNLGNSLKDNVGQLVEEWWQVIN
                     LLPQELPKPEEHFINMKFYYENKFYNDDDMYNYFIVDEPKNRDNWTSFPCYLWASLIL
                     KSRSFPAHLLRGHVKNSEIKEDEAMLLPIIDLLNHNMNAKVDWSVSSSNSCTYFNFRS
                     NSAVPGEQLYNNYGMKGNEELLLAYGFCLEDNSADSAALKIKVPLEMLPELESQGVKL
                     PTASDYTTSVIRNTEEAKPDTNTDYSQYENGLLFFITKDHLPDNLIKLFQFLVKNKWE
                     DKLTLRTQLAGLNQLRQAIETKSDILKTLSIPDKNDTNLNNIRIYILSQKKIFAATIK
                     KIKHLEKDLLAEFKLHLITLKNVYKKDLKFQQSLLISLGISSYDAIIESQFQDQCWLL
                     YLMRCYNRDEYIKTDKDEEDNYLPEWIHHSFIKLAKETEVTAAEIVSYKEIYQSLIPR
                     LAEIVPEIYGRGKWGVDEMIISAKLLDLIGFVRGKDQECILVEPFDK"
     gene            complement(<209099..>209677)
                     /locus_tag="DEHA2A02486g"
                     /db_xref="GeneID:2899788"
     mRNA            complement(<209099..>209677)
                     /locus_tag="DEHA2A02486g"
                     /product="DEHA2A02486p"
                     /transcript_id="XM_456447.1"
                     /db_xref="GeneID:2899788"
     CDS             complement(209099..209677)
                     /locus_tag="DEHA2A02486g"
                     /note="similar to uniprot|P38264 Saccharomyces cerevisiae
                     YBR106W PHO88 Probable membrane protein involved in
                     phosphate transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02486p"
                     /protein_id="XP_456447.1"
                     /db_xref="GeneID:2899788"
                     /db_xref="InterPro:IPR012098"
                     /db_xref="InterPro:IPR019263"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC2"
                     /translation="MNPAITNLGVMLVMMQVSRRLDLEDPDILFYVRAAYLSCQAIAL
                     AIYAITRAKICAKNDLTTLKYVEPANAMSGETEPKAVVTTVREYDLKQVNTQIRSIFT
                     SLAMMGFMHIYMKYTNPLVMQSISSVKSALEANIVKIHLFGTPATGDLKRPFKAAPGL
                     MQALSGASTDVKTDKHSIENAEISGAGGIKED"
     gene            complement(<209895..>212624)
                     /locus_tag="DEHA2A02508g"
                     /db_xref="GeneID:2899789"
     mRNA            complement(<209895..>212624)
                     /locus_tag="DEHA2A02508g"
                     /product="DEHA2A02508p"
                     /transcript_id="XM_456448.1"
                     /db_xref="GeneID:2899789"
     CDS             complement(209895..212624)
                     /locus_tag="DEHA2A02508g"
                     /note="similar to uniprot|Q7SE42 Neurospora crassa
                     NCU02134"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02508p"
                     /protein_id="XP_456448.2"
                     /db_xref="GeneID:2899789"
                     /db_xref="GOA:Q6BZC1"
                     /db_xref="InterPro:IPR002999"
                     /db_xref="InterPro:IPR016071"
                     /db_xref="InterPro:IPR016685"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC1"
                     /translation="MTQVFIAKVKNVLSGDTVILVPSKTSQFPVPERMLTLSYVRSGD
                     SYQSKEYLRQLLIGKDIKFRVLFKTPNVGKEFGDIQAPIFKSLVEHLLEKGHVKLKDN
                     IQDDSEYVDDLRNLESKAKQSQVGLWSVTSASEDKIETIDLNEGIIGKSQNTPITTIV
                     EKVISGDRVMARIIVNKNQHITTPLLLAGIKCPRTDDATESASVTKVAQEAKAFVEEK
                     LLTTKAVIKVSVIGESQAGVPIALIHHPSGNNVHAKLLENGFGEVVDWQSSLVGSSTM
                     GELRKAEQTAKALGKGLYSNTKVSRSSAPVTQSSKGLKPGSTITNASIAKVIGADTLI
                     VRLPSSDEELTVQLASIRGPKPSDSTVTSNHQQQLALVNTAREFVRQHVIGKTGTVYI
                     DGYKDANKELGFDARFLISFKINGTNDLSEMIVNSGMGTVIKHNKATAHERSLNWDKL
                     VELEEEQKKLAKKGVFFNGDINKVLTVGTRIVDASENYTKAKTFFNGFKQKGRIANGY
                     YVEFIPSVNRVKLYNPKEGLKLTLILGGLSNNKNEALGDDGLKYMNKKFLQRSIEFDI
                     YDMDKIGGFIGNLYLNASSLQPIQVSLLEQGLVSVHDLAVNSNPFSNELINAEESAKS
                     SKKGLWANYDASKVQEELDSQNAKLSELKLDSAKPKFFDVEVTDIDSTGTISYHQLDQ
                     STVNTFATFKKQFADFHSQTPSASNTSIDLPHNLSKPPKKGDLVSAKFSENGKYYRGK
                     VLNYDKTTRNFEVKHLDFGNVDKVPLSSLRVLPAKFSLTQLPKFAHTCVLQNLRLPPT
                     RPTDYLTDALYALEDLTFDKKLVISALPSSVPNVDYSVVLYDSEESLKDPTYTINKQL
                     ISEGWAVVEATGVSPNLKEYLESVQKVQQQARSAHLGCWEFGDVSFDDEDTLI"
     gene            <212830..>213333
                     /locus_tag="DEHA2A02530g"
                     /db_xref="GeneID:2899790"
     mRNA            <212830..>213333
                     /locus_tag="DEHA2A02530g"
                     /product="DEHA2A02530p"
                     /transcript_id="XM_456449.1"
                     /db_xref="GeneID:2899790"
     CDS             212830..213333
                     /locus_tag="DEHA2A02530g"
                     /note="highly similar to uniprot|Q02159 Saccharomyces
                     cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02530p"
                     /protein_id="XP_456449.1"
                     /db_xref="GeneID:2899790"
                     /db_xref="GOA:Q6BZC0"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6BZC0"
                     /translation="MAPRSTAQKRLLKEYQQLARDPPPGIVAGPISEDDLFKWECLLA
                     GPPDTPYENGVFPASLTFPKDYPLSPPTLTFDPPLLHPNIYADGTVCISILHAPGEDP
                     NQYERPEERWSPVQSIEKILLSVMSMLAEPNPESGANIDACKLWRDNRVEYDRQIRDH
                     VRKTLGL"
     gene            <213612..>215081
                     /locus_tag="DEHA2A02552g"
                     /db_xref="GeneID:2899791"
     mRNA            <213612..>215081
                     /locus_tag="DEHA2A02552g"
                     /product="DEHA2A02552p"
                     /transcript_id="XM_456450.1"
                     /db_xref="GeneID:2899791"
     CDS             213612..215081
                     /locus_tag="DEHA2A02552g"
                     /note="similar to uniprot|P50264 Saccharomyces cerevisiae
                     YMR020W FMS1 Polyamine oxidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02552p"
                     /protein_id="XP_456450.2"
                     /db_xref="GeneID:2899791"
                     /db_xref="GOA:Q6BZB9"
                     /db_xref="InterPro:IPR001613"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB9"
                     /translation="MTQSIEVEVCIIGGGVSGLKAAHTLLNHSGSKYSSKDLILLEAQ
                     DRLGGRIFTDRKSSKLGISYDLGASWFHDSLNNVVLEESIKDGTFNVMEDGYYDDKDI
                     RVFASDEDGPLDVNNMKLHRVAEDLEKFIELYYFDDLNKADMSLNEIVELFMEKHSSR
                     LTTEQKRYCSTILRYLELWYGITWDKISAKYSIMDHQGRNLFNKKGYDFLINKLASGI
                     PEDRILHSHPVTNIIRNNKKGNERVAVESSNGPTVYCNYLVVTVPQSILSLSPSHTHG
                     ITWIPPLPSNITDALENIHFGALGKVIFEFESCWWDINEDRFEILADSTDDSSLSSPI
                     SSSPESFKFPVFAVNCAAVYKESVRGASLCILTQSPLTDYLESHPQQAWSYFKPMLSK
                     LKLNDLQVSDPINTITSNWTNNPYIRGSYSAVETGDDPLDIITQLSGEHDCGLIDKNI
                     RFAGEHTTSDGSGCVHGAYMSGQREAMWILNDCGAFSTQ"
     gene            <215234..>215668
                     /locus_tag="DEHA2A02574g"
                     /db_xref="GeneID:2899792"
     mRNA            <215234..>215668
                     /locus_tag="DEHA2A02574g"
                     /product="DEHA2A02574p"
                     /transcript_id="XM_456451.1"
                     /db_xref="GeneID:2899792"
     CDS             215234..215668
                     /locus_tag="DEHA2A02574g"
                     /note="similar to uniprot|Q08971 Saccharomyces cerevisiae
                     YPL225w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02574p"
                     /protein_id="XP_456451.1"
                     /db_xref="GeneID:2899792"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB8"
                     /translation="MGKFKAEEAENLEDIEKQFAVKAVMQAETYWGLLEKIPGSKLKL
                     TKYDDRIYDQLLEDFPEFKDPSAAAVIEEAYMKSPSGKAKWRAFCDKFKDIEDYNFGT
                     LLRSKATDEYSQEGTIFAVRIQFYAVEIARNRYGLNDWIANK"
     gene            <216014..>218206
                     /locus_tag="DEHA2A02596g"
                     /db_xref="GeneID:2899793"
     mRNA            <216014..>218206
                     /locus_tag="DEHA2A02596g"
                     /product="DEHA2A02596p"
                     /transcript_id="XM_456452.1"
                     /db_xref="GeneID:2899793"
     CDS             216014..218206
                     /locus_tag="DEHA2A02596g"
                     /note="some similarities with uniprot|Q05040 Saccharomyces
                     cerevisiae YMR029C FAR8 Protein involved in G1 cell cycle
                     arrest in response to pheromone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02596p"
                     /protein_id="XP_456452.2"
                     /db_xref="GeneID:2899793"
                     /db_xref="InterPro:IPR013258"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB7"
                     /translation="MNNPKMQSNNTNSNSNNVNMNNNGSSKLPQWQQQQQQPLANYTL
                     PGVINYLTSEFTDLERFKIMTNLEKSEMKYKIVQLQGELNTLRYITEKQKSRIDVLEK
                     ENQKLHRQLKHEGRDSQSGSETKKEGTIKEDDIEIPEIDLLEIQKSRTQLTKSMRQVL
                     HLLKTPHANNMNPLNLNNPADESNEYDDLIKNDKSDAFCFSEKGDTRIPDYSGRSRKY
                     NKESIFSQYLNDIPFDSENQGSTEKIQDDSCQNNLTGIGDINATSIQYLAQPSEEKEV
                     FPSSNYKAEESDAETVIMDDSDGEELELTKTKSNLAKKPVTNSSSANYSPVKSEFPSE
                     SNNVTEDTYSVKPNALITTNDPKYGSCRMFTSCLNNTIVYLNYDHDSDENLVLLNVWS
                     TSLNKLVVSKEFTDTIVERPTNIIDIYCVSHDESNSTIYLLIIYKSGTVDHIKLNENS
                     QISKSCILNLAPTTLNSSKLIEFRHKSSPESRNFGLVVTGLQNPASIPFIKVYNLMVD
                     AMNSIIETEIGSYVKSFFKLQNLQESDMFEVVHWFKNDDTTSITDTSSQKPNKGKSHK
                     RTVSCTDVSLSPYEIILKLGYQLIRFNFVSKKYYTLIDEQHGDTTKDVCFNDHLAIFV
                     EVKEDIYKLRVYDLVKKTTISQTNFNGSLAQNSSLILVSDQKKYAIARLDRTHIQFYD
                     LNFSLLHHINISPLPNTLLYANGEIVLATVSNNSVENLAIYDLNTFTA"
     gene            <218483..>218794
                     /locus_tag="DEHA2A02618g"
                     /db_xref="GeneID:2899794"
     mRNA            <218483..>218794
                     /locus_tag="DEHA2A02618g"
                     /product="DEHA2A02618p"
                     /transcript_id="XM_456453.1"
                     /db_xref="GeneID:2899794"
     CDS             218483..218794
                     /locus_tag="DEHA2A02618g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02618p"
                     /protein_id="XP_456453.2"
                     /db_xref="GeneID:2899794"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB6"
                     /translation="MSSSNIDTIGQSNEGSTALSNTLSPSKPEVDDDNYDDDPQAFSL
                     IRFFGVCYVFRSKSRCNGKVNVGSVAATLGTSLCIRFCLWPYYLGTMSSCCDVRPIWG
                     C"
     gene            <219192..>219725
                     /locus_tag="DEHA2A02640g"
                     /db_xref="GeneID:2899795"
     mRNA            <219192..>219725
                     /locus_tag="DEHA2A02640g"
                     /product="DEHA2A02640p"
                     /transcript_id="XM_456454.1"
                     /db_xref="GeneID:2899795"
     CDS             219192..219725
                     /locus_tag="DEHA2A02640g"
                     /note="some similarities with uniprot|Q07824 Saccharomyces
                     cerevisiae YLL028w TPO1 Proton-motive-force-dependent
                     multidrug transporter of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02640p"
                     /protein_id="XP_456454.1"
                     /db_xref="GeneID:2899795"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB5"
                     /translation="MGEYGFTRGVAELPYLSMLVDIFIGSFVCTLFEKRFNKAMAKNN
                     GKPIPEERLSPMIFGSIFFAIGLFLLAWSGSYPEHVHWIVPTIGSSFIGFGLITIFLP
                     CMNYIIDCYLMFAASAMAANTFLRSMFGGAFPLFARQMFVNMKIQWVGILLGCVSVVL
                     LPVPFLFYSYGRKIREK"
     gene            complement(<220031..>221584)
                     /locus_tag="DEHA2A02662g"
                     /db_xref="GeneID:2899712"
     mRNA            complement(<220031..>221584)
                     /locus_tag="DEHA2A02662g"
                     /product="DEHA2A02662p"
                     /transcript_id="XM_456455.1"
                     /db_xref="GeneID:2899712"
     CDS             complement(220031..221584)
                     /locus_tag="DEHA2A02662g"
                     /note="weakly similar to uniprot|P15365 Saccharomyces
                     cerevisiae YJR152W DAL5 Allantoin permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02662p"
                     /protein_id="XP_456455.2"
                     /db_xref="GeneID:2899712"
                     /db_xref="GOA:Q6BZB4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB4"
                     /translation="MKDKGSSIVEEVSLDKQEVSENHENEHKDFDKLIDKAGIFLAER
                     EGIYGEIQEGEEKRIVRKLDWRLLPMLFFTATLGAVDKQCISTAAIYGFTEDNNLSGS
                     EYSWLGSIIFIGSLVGMWPMTFILQKFRLGMVLVVASLLWSALTLLFCAGHNFAGFAA
                     LRFLLGFIECAIVPGCTLMVTRFYIKKEQAPRLAYVFAFASSVINGFLSWLVGNFNDN
                     IPKWKYLYLMVGSISFTWSCFIFFYLPDTPMNTKFLTDREKYFLIKKVVKNQTGIESN
                     DWKWEQMVEALLEPKSYIIMLFNIGINITNGGLSAFSSIIINNLGFSAMESSLMSMPT
                     GVIATLATIGFTYATTKFPNKRCLICVISLFIPLIGAILLYTIDQSKIGPQLFGLYLA
                     YFYFAPYVIMMSLAQANTAGNTKKSVVYSMNYLGYAAGALIGPQTFRAEEAPKYTGGF
                     TGMMVSFCVCILLSILYWFICVLNNRNKKAMVECDQNIEIQIAVASEETDLMYDLTDK
                     QQATFLYTT"
     gene            <222644..>224326
                     /locus_tag="DEHA2A02684g"
                     /db_xref="GeneID:2899713"
     mRNA            <222644..>224326
                     /locus_tag="DEHA2A02684g"
                     /product="DEHA2A02684p"
                     /transcript_id="XM_456456.1"
                     /db_xref="GeneID:2899713"
     CDS             222644..224326
                     /locus_tag="DEHA2A02684g"
                     /note="weakly similar to uniprot|P26370 Saccharomyces
                     cerevisiae YDL170W UGA3 Transcriptional activator
                     necessary for gamma-aminobutyrate (GABA)-dependent
                     induction of GABA genes (such as UGA1 UGA2 UGA4)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02684p"
                     /protein_id="XP_456456.2"
                     /db_xref="GeneID:2899713"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB3"
                     /translation="MLAKGLIFGRSERNRKKLKARKDSTENNRDDVNIDKSLDVQSIQ
                     KAPLKGKSLFLNTTINDLKSIYEVPDEQLATNSDPTSIYHSFETYTFDNQYDKKSFKV
                     MDTDIQLISKPDNIWGAYNDFNFEDYLNPFCDDTSYFPLVNDLSFFPFNYDTMDYNLF
                     EYFVKKICPVCICYSERGIPSEADTPINSQSDKINPYLKYIVPLGMKSELLFKTIVAI
                     AANELNIVQYRSFYEDIARNSMSYVLEELPKLIHKGKVTNSNNWDEILPTILMLCFAD
                     ISTECGRIWILHLNGAKEFIRYLIDSQVEGELSKFVVRYFISHEIMGQTAWSDQPNNL
                     LWDPFFEDLKYDYDTNIDLVLGCSPYLISLINSITMLGDYTETLDFGLKHTRDSIQPD
                     ILKQRDRLELELVNLEQKLTVEEINESAVYVRQIARVKKIAAILYLFIRVDQELYFTL
                     GKSFYRQCHLRLKNMRPWVLEAIDIMNNMNTSSMSLLWPLFIVGVVSYDDEDHRHFVL
                     HRLQEMEMSRKLASVRMAKHTIETLWKEKDLGCSLLNWKDMMRGRADTISLA"
     gene            <224694..>228644
                     /locus_tag="DEHA2A02706g"
                     /db_xref="GeneID:2899714"
     mRNA            <224694..>228644
                     /locus_tag="DEHA2A02706g"
                     /product="DEHA2A02706p"
                     /transcript_id="XM_456457.1"
                     /db_xref="GeneID:2899714"
     CDS             224694..228644
                     /locus_tag="DEHA2A02706g"
                     /note="similar to uniprot|P28273 Saccharomyces cerevisiae
                     YKL215C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02706p"
                     /protein_id="XP_456457.2"
                     /db_xref="GeneID:2899714"
                     /db_xref="GOA:Q6BZB2"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB2"
                     /translation="MTASDRVVIAIDRGGTFTDVIYKYKGIEKTFKLLSVDPSNYQDS
                     NIEGIRRVLEKVTDRKIPRGSQLDTSIVSSIRLGTTVATNALLERKGARCALVTTKGF
                     KDLLHIGDQSRPDLFALDITKPGVLYEKVIEAEERVTLPAFTVDPNRYDCQDLFDGEK
                     YVRGQTKEIFEILEPLDEVKLREELSLLKKDGIDSIAIVFIHGFNFQAHEKAAGKIAQ
                     ELGFRNISLSHKVLPVIKAVTRGHSTTVDAYLTPIVKEYISNFLSGLKPDYNDHTKIE
                     FMQSDGGLCSYEKFSGLRSLLSGPAGGVVGQAMTCYDQNNKIPVIGFDMGGTSTDVSR
                     YAGDFEFSFESITAGIKIAAPQIDVNTVAAGGGSILFYRNGTFFVGPESASAHPGPAC
                     YRKGGPLTITDANLFIGRLLPKYFPHIFGDAEDQPLDFEVTKQKFEALTKVINRENPD
                     SPKTPQGVALGFLEVANFQMAKPIRELTGSKGHDISGHSLASFGGAGGQHAASIAQLL
                     KINRILIHKHSSILSAYGILVADLVSEKQQPCSEIIDSQSVNILLKKCDKLKEEAIEE
                     LLMESVAPSTISCKLYFNMGYEGSDTRFMVLQPEMNQFLELFYEIHQRELGFNDRSRN
                     VIVSDIRVRVTGNTADNEREISPYDELESTEITEVSKNKAEETVLIYFEGGYQNSEVY
                     FLENLTTGSVVNGPALILDSTQTILVSPQCQATVLSRHIVMDLKSNKIECISSKVVDP
                     IKLAIFANRFMSIADDMSRTLQKISVSANIKERMDYSCALFDNEGNLTANAPNVPVHL
                     GSMSSAIRYQLEYWKDDLHEGDILCTNSPSVGGTHLPDLTIISPVFYDSKLQFVVASR
                     AHHSEIGGSAPGSSSSYARDIVDEGVNIKTWKIVQNGKFDDDGLLKHFVEEPKSHGVC
                     GTRNIDDNISDLKAQIAANQRGINLLLELFKEYGSDVVLFYMRSVKKTAELAVRSFFK
                     DFFQQNRDKIPLKAEDYLDDGSKICVSIDVDGDDGSASFDFTGTSLESYSNLNAPKSV
                     TYSAVIYVLRCLISLDIPLNQGCLNPCTLYVPENTLINPSEFAAVCAGNGMTSQRTTD
                     VLFKAFGVTSATGGCMNGINFGTGGENEKGELIKGFGYTETIGQGSCAGIIEKDGKRV
                     GFDGFSGTQTNMTNTRITDPEVLEQRYPCLLRTFTIRQNSGGKGKWNGGNGLIREIQF
                     NSPVHVSLVTQRRVYSPWGIYGGECGKKGENYLGRNRSNGIIQWIHLPSLAEIEIRKC
                     DILRILTPGGGGFGKPADSDEYWRIGDCSPNSFEHIPLSLGSVGSLKEGSNTSQ"
     gene            complement(<229097..>231232)
                     /locus_tag="DEHA2A02728g"
                     /db_xref="GeneID:2899715"
     mRNA            complement(<229097..>231232)
                     /locus_tag="DEHA2A02728g"
                     /product="DEHA2A02728p"
                     /transcript_id="XM_456458.1"
                     /db_xref="GeneID:2899715"
     CDS             complement(229097..231232)
                     /locus_tag="DEHA2A02728g"
                     /note="some similarities with CA1173|IPF14254 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02728p"
                     /protein_id="XP_456458.2"
                     /db_xref="GeneID:2899715"
                     /db_xref="GOA:Q6BZB1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB1"
                     /translation="MNQGDGSTNGSDLWDALSFFDKPNQSTPIGFDVEKDSNFFFDIT
                     PWEQESASKETIDTDTKKSKNKINKLNVSVDKCANKDKPAGSSTGNKQKEDREIQANA
                     DTRKVAKKSKEKKRDRRLRSRFGCEKCRNKRVKCDEKRPSCGRCLSRGVQCKYKILLQ
                     FREDYESKGKKFGREGVWNKTGSFEKTVKELVSSSKDTHYLDIQNTSALAFVNFTIKD
                     IVQGRRWIPPSIQPSLIPVDIRTSANDNSIGFALNYYIDVISPIFNPVGFKGFNKQYI
                     INMSSKQVLIEPGLNSKWLIQYSQNRNSVFYLVLALGFLYLSKNNTHSLDLKDSRSKW
                     FTSSLVFKHKGMQMISEKMSRFQTTPKSNLHLSTEFLLSLVLLMLYEVADNCNEKWGS
                     YLKICKNVICSEYFEQPKNDIEAYLLQFSLELLNYQETMGRTACKDKNSFFLLHEDDD
                     EEEQAPTLYSPSPTCVRISWMGCDRNLVNVISDITDLSFERFNNICLEDYTILSNELK
                     NRLITMDLGVNIDDYLLDAPVTDFSNISASGSNSVYIDSTLDIEDFCFLLSCEVKRLA
                     GLIYWECCLLNAKPENRYIQTMLIKAYKILTFIIIQNDFKWISTLLWSLFIVSAEISV
                     QSNDCDTLRYLTLKMLNRIQPKSLGNVDMIREIILGIWKGRDIRNCDENSFGYTKKPG
                     IANERISILGSRNDWEIFVANESYKISLA"
     gene            complement(<232229..>233509)
                     /locus_tag="DEHA2A02750g"
                     /db_xref="GeneID:2899716"
     mRNA            complement(<232229..>233509)
                     /locus_tag="DEHA2A02750g"
                     /product="DEHA2A02750p"
                     /transcript_id="XM_456459.1"
                     /db_xref="GeneID:2899716"
     CDS             complement(232229..233509)
                     /locus_tag="DEHA2A02750g"
                     /note="similar to uniprot|P78573 Aspergillus fumigatus
                     Fructosyl amine: oxygen oxidoreductase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02750p"
                     /protein_id="XP_456459.2"
                     /db_xref="GeneID:2899716"
                     /db_xref="GOA:Q6BZB0"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6BZB0"
                     /translation="MDKPGKILIIGAGTFGLSTALHLLRQGEKDVILVDPYAVPSPFS
                     AGNDVNKIIQTTSDDDFYSKLALEALEMWREDNVFNKAFAETGIIYAATGKEQRESID
                     YRYEYLLGRKDKVVKLNSVEDYEKYVPNKEGSKSYPNKFQKWYGYYQEKNCGWAFARL
                     ALENCVEECRKLGAKFVIDSAEELLFSEDGACVGVHTSNGNIIEADRTIICAGANSFK
                     FLNFEQQLLAKCYTLGHIKLTDDEAALLKGMPVVLNLDGGFVFEPDLNNEIKFCNEFP
                     GYVNIVNEDSVPSFKDSIPKEAEDQMRAFLRQVFPEFAEREFSLARICWCTDTPDRHF
                     LICEHPGHKNLVLGTGDSGQGFKYMPNVGKYISQVALKGENSLDKDKKELWRWRPDMG
                     KKRDLKDLQGRYGGSNEVKDLKNVKQWSNGKSHL"
     gene            <234126..>235718
                     /locus_tag="DEHA2A02772g"
                     /db_xref="GeneID:8998106"
     mRNA            <234126..>235718
                     /locus_tag="DEHA2A02772g"
                     /product="DEHA2A02772p"
                     /transcript_id="XM_002769913.1"
                     /db_xref="GeneID:8998106"
     CDS             234126..235718
                     /locus_tag="DEHA2A02772g"
                     /note="weakly similar to uniprot|P25621 Saccharomyces
                     cerevisiae YCR028C FEN2 Plasma membrane H+-pantothenate
                     symporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02772p"
                     /protein_id="XP_002769959.1"
                     /db_xref="GeneID:8998106"
                     /db_xref="GOA:B5RSP6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:B5RSP6"
                     /translation="MITKTDKKESNIDIESVDLQQSEAPDQHHPNFFELELTRKQKLA
                     LFWSKKSPRAKEKRQKFFFWNPPGRSAYEKNLVFKLDCIILSYCCLSFFVKYLDQSNV
                     NNAYVSGMKEALDMEGNMFNWLNQGFLLTYGIFGLFGSLLITKISPHIVLPLFEVIWS
                     VLCLLVITCDTYPKLVAIRCLQGAFSGIVYPACHYILGTWYTPAELTARTAIFVSSGS
                     LGTMFGGYIQSGIHKSLDGKAGLPGWKWIFVIDFLITIPVATFGYFILPGEPSKPRAS
                     RFLNDQDFEFCCKRIEVVENVETVNKFDFSVVKRAIFSWQLYVFVIAYVLSQLTEECT
                     NYWNIVLQDQGFNIYNRNTYPTVQSAVKVVSSLIAGLYSGIRGKKWEIYVIICFFWIS
                     GLATLVKYDVPFGAQFYANSVLGVCAAYSVIIISWANEMCKEDDQLRATVLGSLNFIF
                     VVLDVPYATRVFDTNNAPRFRLGMTIGLTFCCFLFLFNGVLVMFDRYQNRIRDLFDDK
                     FNKDIEVEEIISKDPEKSIISH"
     gene            complement(<236128..>237384)
                     /locus_tag="DEHA2A02794g"
                     /db_xref="GeneID:2899765"
     mRNA            complement(<236128..>237384)
                     /locus_tag="DEHA2A02794g"
                     /product="DEHA2A02794p"
                     /transcript_id="XM_456462.1"
                     /db_xref="GeneID:2899765"
     CDS             complement(236128..237384)
                     /locus_tag="DEHA2A02794g"
                     /note="similar to uniprot|Q92204 Aspergillus terreus
                     Fructosyl amino acid oxidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02794p"
                     /protein_id="XP_456462.1"
                     /db_xref="GeneID:2899765"
                     /db_xref="GOA:Q6BZA7"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6BZA7"
                     /translation="MLGKESKILIIGGGTWGLSTALYLLRDNYTDVTIIDAEEIPSSR
                     SAGNDINKIIRIGYTSEFHSRLELEAAELWRNDPLFKPFFHEVGYLVCTSEEAPLEEL
                     NLIRRIRLDMNRKDWEELNTKEDIISGAPILHKGTLPGWRGYLQRNEGGWVHAANTMR
                     AVANEIRRLGGKFVTDEISSLLFEAGSVKGCRSFTGKEYFADKTILSTGASSVKLLDF
                     KNQLMAKCWTLGHIKLSTEESERFKDIPVIRSLEGGFFFQPDENNEMKICNEFPGYTH
                     YISEQKEPNTSVPEYINTVPVEAEKGIRKLLKETIPDFRDKPIVMSKICWCTDTPDRY
                     YLIDEYPESNGSLILATGDSGHGFQLIPTIGKYISKLAVLGKDGLDKEQQYRWRWRPE
                     TVKDRIQNRYGGEGHVKDLKDIKDWI"
     gene            <238263..>238478
                     /locus_tag="DEHA2A02816g"
                     /db_xref="GeneID:2899766"
     mRNA            <238263..>238478
                     /locus_tag="DEHA2A02816g"
                     /product="DEHA2A02816p"
                     /transcript_id="XM_456463.1"
                     /db_xref="GeneID:2899766"
     CDS             238263..238478
                     /locus_tag="DEHA2A02816g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02816p"
                     /protein_id="XP_456463.1"
                     /db_xref="GeneID:2899766"
                     /db_xref="UniProtKB/TrEMBL:Q6BZA6"
                     /translation="MFVFLYAKILKMENKSHEASIEHNEVLDDVHSRNTVGLMSLGDN
                     KANIKGIPKGALTKHLGRSLCKHSKGT"
     gene            <239828..>243244
                     /locus_tag="DEHA2A02838g"
                     /db_xref="GeneID:2899769"
     mRNA            <239828..>243244
                     /locus_tag="DEHA2A02838g"
                     /product="DEHA2A02838p"
                     /transcript_id="XM_456466.1"
                     /db_xref="GeneID:2899769"
     CDS             239828..243244
                     /locus_tag="DEHA2A02838g"
                     /note="similar to uniprot|Q08972 Saccharomyces cerevisiae
                     YPL226w NEW1 This gene encodes a protein with an Q/N-rich
                     amino terminal domain that acts as a prion"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02838p"
                     /protein_id="XP_456466.1"
                     /db_xref="GeneID:2899769"
                     /db_xref="GOA:Q6BZA3"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BZA3"
                     /translation="MAPQSFDEFLKQQAQQSKGPAVNRGLNNKVYSNRGSTPFQDSYG
                     STPNGSLPGSGSATPNPNSSTASLTSLNTALSKLNVGDTPIQENLWNIEQASKISEVK
                     VEAEAIANIVSESSLSVINEWKLNDIIKSLSKPKNSPLVRESAMIIIQQLVMKFGGQT
                     PSEAYLLQFFSICYDMCADKDKNCVKAAKTAADSLYGIFPVEAAGSIVINTLLSYLSS
                     SAKWNSKMAALDTFDKLIDDVPADLLELKFVNTVPVLTDLSTDFKPELAKHGLKVMMK
                     FVKVLDSLDLQNKFELIVETLSDPKKVPECIKNLSSVTFVAEVTEPVLSLLVPILDKS
                     LNMSSTSNDQLRQTVTVTENLTRLVNNKREIEVYIPILLPGVQKVVNNASLPEVRELA
                     GKALSVLQDAKDEQSDGMFHGRINLTQAREFYTENMDDELKSVAQTLHVDSDEIISNY
                     LAFILQADANVNDWKRLTDYLNMAITDSDNELKEKYVNKVLANLRDLFTAVSTRVYDD
                     EEGAIEIVNADFSLAYGSRMLLNKTNLRLIKGHRYGLCGRNGAGKSTLMRAISKGQLE
                     GFPTPDQLKTCFVEHKLQGSEADMDLVGFIASDPELEGVGRDEISKALLAVGFPQERL
                     DQQVGSLSGGWKMKLELARAMLMKADVLLLDEPTNHLDVANVKWLEDYLIENTNITSL
                     IVSHDSGFLDKVCTDIIHYENKKLAYYKGNLSEFVKAKPEGKSYYTLSDSNVKMAFPP
                     PGILTGVKSNTRAVARMANVTFTYPGAAKPSLENVSCSLSLSSRVAILGPNGAGKSTL
                     IKLLTAELNPNEGKVEKHPNLRIGYIAQHALQHVEQHKEKTANQYLQWRYRFGDDREV
                     LLKESRKISEDEKEQMAKEIDIQDGRGPRTIEAVVGRQKLKKSYQYEVKWKWWLPKYN
                     SWVPKEVLLEHGFNKLLQKFDDHEASREGLGYRELTPTVIRKHFEGVGLDGDIADHTP
                     MGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGGLAIAIRDWAGGVVMISH
                     NNEFVGALCPEQWHVENGEVVQKGTAAVDNKRFEDGDSASPSPAPTPTKKRADDDDSP
                     ANIKIRARKKKMTRNEKKAQTERRRLRYIDWLNSAKGTPRYPDTDDEDED"
     gene            <243553..>244421
                     /locus_tag="DEHA2A02860g"
                     /db_xref="GeneID:2899770"
     mRNA            join(<243553..243596,243713..>244421)
                     /locus_tag="DEHA2A02860g"
                     /product="DEHA2A02860p"
                     /transcript_id="XM_456467.2"
                     /db_xref="GeneID:2899770"
     CDS             join(243553..243596,243713..244421)
                     /locus_tag="DEHA2A02860g"
                     /note="highly similar to uniprot|P23639 Saccharomyces
                     cerevisiae YML092C PRE8 20S proteasome beta-type subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02860p"
                     /protein_id="XP_456467.2"
                     /db_xref="GeneID:2899770"
                     /db_xref="GOA:Q6BZA2"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6BZA2"
                     /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVKQGVTTIGIKSANGVV
                     IATERKANSNLLKAESNNKVELITPDIGMSYSGMGPDFRVLVDKARKLAHTNYKRIYN
                     EYPPVKVMVQEIAKVMQESTQSGGIRPFGVSLLVGGYDKHSNSFQLYQVDPSGSYFPW
                     KATAIGKTSVSAKTFLEKRWNENLELEDAIHVSLLALKESVDGELTGENLDIAIVSDS
                     QEHLLGFKGTNVEGPRFRKLSAEEINDRLDAL"
     gene            <244646..>247324
                     /locus_tag="DEHA2A02882g"
                     /db_xref="GeneID:8998109"
     mRNA            <244646..>247324
                     /locus_tag="DEHA2A02882g"
                     /product="DEHA2A02882p"
                     /transcript_id="XM_002769914.1"
                     /db_xref="GeneID:8998109"
     CDS             244646..247324
                     /locus_tag="DEHA2A02882g"
                     /note="similar to uniprot|Q04500 Saccharomyces cerevisiae
                     YML093W UTP14 Nucleolar protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02882p"
                     /protein_id="XP_002769960.1"
                     /db_xref="GeneID:8998109"
                     /db_xref="GOA:B5RSP7"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:B5RSP7"
                     /translation="MARKNTKNKSSSRKRSSQKVLDAFQIAERAENRSEDDSDNRPGD
                     EDDLEVHDGIMDASKFLANKSKDDEGLSDEELDSDEALGSDDDYDILTSKFSQTIRDK
                     EKKRKLNEKKRKRGEYRDSESEDEEEDEGYASIDESQLVTLSQAWDMDEKDAKSLQKS
                     NDNNDLVLDDAWESESSEEESEEESEEESDDDEDIFKSASENENDDEVDLANTVSQLQ
                     SQLKKPAKERKRLIAEATDENEFNLPTKGVTLSLQDMISAVDPSVSKDAILIDNEDNS
                     KQKALATPLPKRIQERNERQIAYEITNEDISKWEDTVQQNRQAEVLKFPLNPEIKHND
                     TATTFRSSNEPSTELEKKIQGILKDSALTDDRKEATFEEIAAAKLSSEELKKRTNELR
                     LMRELMFRDEKRAKRIKKIKSKTYHKIKKKERLRTQEMVEGSDMESDNEDHDMKRAKE
                     RMLLKHKTQSKWAKSMIKSGLSKDASNRDDLEEMLRQGEKLRSKQLGYEDGDQSDQDV
                     SDIEDEYAKDDETNETDDINRNKLGKGVLAMDFMKSADKRHKQENLKELELLKKLENG
                     GDLDEFQEDATSINVTKNQGRRVYTPSASSMKSDINEVNQKTLNELRDDESNNLENRL
                     SKKFKVVDNSISNKKPNNLSKDVEEEKKSKASDEAEDVNPWLAGNDSEEAMQKSRKIH
                     KVDKTSSKLSKSAQKISKNKKRSASQRDDEDTIIDMHETLKARDIHDDDNENSNDEDK
                     DDGLMFKQKNLIKQAFAGDDVVREFEKEKRQVVKDEGDKVEDVTLPGWGDWAGGKKKA
                     KKIVRKIDGVVQKDKRKDKNLKDVIINERVNKKNLKYQSSGVPFPYESREQYERALRM
                     PVGQEWTSRETHQKLTMPRIITKQGTVIDPLKAPFK"
     gene            complement(<247416..>249089)
                     /locus_tag="DEHA2A02904g"
                     /db_xref="GeneID:2899772"
     mRNA            complement(<247416..>249089)
                     /locus_tag="DEHA2A02904g"
                     /product="DEHA2A02904p"
                     /transcript_id="XM_456469.1"
                     /db_xref="GeneID:2899772"
     CDS             complement(247416..249089)
                     /locus_tag="DEHA2A02904g"
                     /note="similar to uniprot|P54783 Saccharomyces cerevisiae
                     YML086c ALO1 D-arabinono-1 4-lactone oxidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02904p"
                     /protein_id="XP_456469.2"
                     /db_xref="GeneID:2899772"
                     /db_xref="GOA:Q6BZA0"
                     /db_xref="InterPro:IPR006093"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /translation="MRSDIPETLQNFVSTKTVHQTWAKTFFCKPQAIFQPRTVDEIRE
                     LVDQARINGKTIMTVGSGHSPSDMTMTKEWLCNLDRFNQVLKKEEFSGPTRNGEGEEV
                     KFVDLTVQAGCRIYELNRYLKENELAIQNLGSISDQSMAGVISTGTHGSTQYHGLVSQ
                     QVVSIEIMNSAGKLITCSSMENTQLFKAAMLSLGKIGIITHVTLRTIPKYTIKSKQEI
                     IKFDTLLKNWDTVWLDSEFIRVWWFPYSGNCVCWRASKSSEPLSKPRDSWYGTWFGRK
                     FYESLLWISVHICPHLTPLIEKFVFKNQYGDVETLGHGDVAVQNSVEGLNMDCLFSQF
                     VNEWSTPLSSGQDVLIKLNDVIQTAREQNRFYVHAPIEVRCSNLTYSEKPFVDENDEP
                     SLYPNKKWLAKRDRLSPGPIPGNNLRPYLDNSSNLRYDGDGANVTNDQLTLFINATMY
                     RPFHTNVNSQEWYQLFEDIMTNASGRPHWAKNFIGVNGAHRTDQDLRKQLEFGGKTSY
                     SMKGFNPILKKWFGENLVEYNKVRESMDPDNVFLSGKDWAVRNGILIDV"
     gene            <249361..>250707
                     /locus_tag="DEHA2A02926g"
                     /db_xref="GeneID:2899707"
     mRNA            <249361..>250707
                     /locus_tag="DEHA2A02926g"
                     /product="DEHA2A02926p"
                     /transcript_id="XM_456470.1"
                     /db_xref="GeneID:2899707"
     CDS             249361..250707
                     /locus_tag="DEHA2A02926g"
                     /note="similar to uniprot|P54839 Saccharomyces cerevisiae
                     YML126C ERG13 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA)
                     synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02926p"
                     /protein_id="XP_456470.1"
                     /db_xref="GeneID:2899707"
                     /db_xref="GOA:Q6BZ99"
                     /db_xref="InterPro:IPR000590"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ99"
                     /translation="MTKPQNVGIKGIEVYVPSQCVNQTELEKFDGIAAGKYTIGLGQT
                     NMSYVNDREDIYSLSLTVLSKLIKNFGVDTNQVGRLEVGTETLLDKSKSVKSVLMQLF
                     EGNNDIEGIDTINACYGGTSAVINTVNWIESSSWDGRDGIVVCGDIAIYSKGAARPTG
                     GAGAVALLIGPDAPIVFESTRGSFMEHAYDFYKPDFTSEYPIVDGHFSLACYVKAVDQ
                     CYKNYSKKVTKDDNKTVGVFDHFDYNAFHVPTCKLVTKSYARLLYNDYKADPSKFKDL
                     IDEETKKSIDSLTYDQSLVDKNLEKIFVGLAKEQTKTRVQPCLNVPTNTGNMYSASAW
                     ASLSSLLYYVGSEQLQNKRIGVFSYGSGLASTLLSVVVKGDISKITKNLDFDHKLSEG
                     RVTRTPEQYLEAIELREKAHLQKSFKPSGSIETLARGTYYLTEIDDKYRRQYNKKD"
     gene            complement(<251532..>251783)
                     /locus_tag="DEHA2A02948g"
                     /db_xref="GeneID:2899708"
     mRNA            complement(<251532..>251783)
                     /locus_tag="DEHA2A02948g"
                     /product="DEHA2A02948p"
                     /transcript_id="XM_456471.1"
                     /db_xref="GeneID:2899708"
     CDS             complement(251532..251783)
                     /locus_tag="DEHA2A02948g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02948p"
                     /protein_id="XP_456471.1"
                     /db_xref="GeneID:2899708"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ98"
                     /translation="MVRYILMVNSKQIEWNLEQLLVPVTCGNDCEIFHVPKWKQATIE
                     KELFCGSNVRDCLGSQSIATKIFAIFRALQMAQHILYVK"
     gene            <251876..>254434
                     /locus_tag="DEHA2A02970g"
                     /db_xref="GeneID:8998116"
     mRNA            <251876..>254434
                     /locus_tag="DEHA2A02970g"
                     /product="DEHA2A02970p"
                     /transcript_id="XM_002769915.1"
                     /db_xref="GeneID:8998116"
     CDS             251876..254434
                     /locus_tag="DEHA2A02970g"
                     /note="some similarities with uniprot|Q03104 Saccharomyces
                     cerevisiae YML128C MSC1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02970p"
                     /protein_id="XP_002769961.1"
                     /db_xref="GeneID:8998116"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:B5RSP8"
                     /translation="MKVFNFALIGLLAGNLVAATDGLSTWKEKDVKHFLKDRQIDFSE
                     KESFQELSRKAEEEFEKLKNIHRDTVRDDSQQHILATNPKDELTNIFPAHINWNYLFE
                     SNAEHARSVKNWIFESWSTEGLKDFLTNNKIKFDKNYSKQDLIDLAQKEYDNIAEGHD
                     VSGYYPGDWIYQGWSVDRLKQWLQDHELEFDSKDNRESLLSKVKHNNYIASLSNIDNK
                     NSLLDSLDLAQANIFDKAGEIKDDFFDTWSYGQLREWLYYHGFISTRPDVYVEELDAD
                     KLKKIAKSQQNYLVSDIKKWSEKAKKTADPYLSKGADKKKTLDNVINDTFLIGVEKWS
                     KDRLKEFLRSRNVKFSQFASKHQLVDLVKKSKDVKLALKQNANPASWLVENWSTDRIR
                     EWLENKGENVKGTREDLINGISNYVSQHSLAPSDTFDFSANLYKPDLDDYKKSFKESL
                     NKFNEDVKDSGGKAKEALDSAVDSSVADRTMLTAYSIGAEYYKQAAKTLREKYSESKF
                     SIDDALSQAKDASYEYANRFVDDASSKYADNKPVVEEQVKSAGIAASEFANSLSNSLT
                     EQLKSGKAKLNDVTNDPQEHLKSVNEIVEKSIRDKKPIAEQAAKDAYRVAQDYLASAN
                     DAIVKNYGEYKPAAEDAMNTIYGSAKDYANSANEALEKGYGQYRPKAVEAAEKAKEYA
                     DAINEAVGKNFQEYEGKLQDAYKAASDAATAAYAEYKPIVDSTAKNAYDTAKQYAGSA
                     NEAIQSTYAETIPKVENAAKSGWEYLLVSYSNADLRSYLQSFGYNFNLLSTLTRQQLV
                     NLANEQSDIFFGSDTKWDKSIVDVLKDTSDGFQEMIGIKPKEESIWSKVKNSLF"
     gene            <254775..>256253
                     /locus_tag="DEHA2A02992g"
                     /db_xref="GeneID:2899710"
     mRNA            join(<254775..254799,254929..>256253)
                     /locus_tag="DEHA2A02992g"
                     /product="DEHA2A02992p"
                     /transcript_id="XM_456473.1"
                     /db_xref="GeneID:2899710"
     CDS             join(254775..254799,254929..256253)
                     /locus_tag="DEHA2A02992g"
                     /note="highly similar to uniprot|P09733 Saccharomyces
                     cerevisiae YML085c TUB1 alpha-1 tubulin or uniprot|P09734
                     Saccharomyces cerevisiae YML124c TUB3 alpha-3 tubulin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A02992p"
                     /protein_id="XP_456473.1"
                     /db_xref="GeneID:2899710"
                     /db_xref="GOA:Q6BZ96"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ96"
                     /translation="MREVISINVGQAGCQIGNACWELYSKEHGIRPDGYLEDSSDSRP
                     KGGEEGFSTFFSETGSGKYVPRALYVDLEPNVIDEVRTGAYKDLFHPEQLIAGKEDAA
                     NNYARGHYTVGREMLDDILDRVRRMSDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLS
                     IDYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCRRN
                     LDIARPNFDSLNSLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAP
                     VFSKNRANHESNSVSEITSSCFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQNSV
                     AQIKAKTTVQMVDWCPTGFKIGICYQPPTAIPGSELASAKRAVCMLSNTTAIAEAWRR
                     IDRKFDLMYSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGTDSYPEEEEEY"
     gene            <256577..>257491
                     /locus_tag="DEHA2A03014g"
                     /db_xref="GeneID:2899711"
     mRNA            <256577..>257491
                     /locus_tag="DEHA2A03014g"
                     /product="DEHA2A03014p"
                     /transcript_id="XM_456474.1"
                     /db_xref="GeneID:2899711"
     CDS             256577..257491
                     /locus_tag="DEHA2A03014g"
                     /note="similar to uniprot|Q12746 Saccharomyces cerevisiae
                     YML125C Protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03014p"
                     /protein_id="XP_456474.2"
                     /db_xref="GeneID:2899711"
                     /db_xref="GOA:Q6BZ95"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ95"
                     /translation="MEDKRELLKQPLHGIYIPILLMLVGTLIFGVEYLPYTIAIIVVV
                     CSVKFYESYSKRSSMDTLKWKEFELIDKTIVSRNSAIYRFKLKNDDEVLNITPGHNVA
                     CCMEIDGKDEIRYYSPISNQFDTGFFDILVKSYPTGKISKRFAMLREGQTVKFRGPVG
                     RLEYKTNMAKEIGLIAGGSGITPILQVITEIITNPEDQTKISLIFANETHNDILLKSE
                     IDEIAKRYPNFDVHYTLTHAPTGWEGSTGFVTKEMVQKHMPSPDAQNKLFICGPPEMK
                     RSLIDISAELGWEKGVMKSATEDQVFCF"
     gene            <257910..>258968
                     /locus_tag="DEHA2A03036g"
                     /db_xref="GeneID:2899883"
     mRNA            <257910..>258968
                     /locus_tag="DEHA2A03036g"
                     /product="DEHA2A03036p"
                     /transcript_id="XM_456475.1"
                     /db_xref="GeneID:2899883"
     CDS             257910..258968
                     /locus_tag="DEHA2A03036g"
                     /note="similar to uniprot|Q06494 Saccharomyces cerevisiae
                     YPR127w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03036p"
                     /protein_id="XP_456475.2"
                     /db_xref="GeneID:2899883"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ94"
                     /translation="MANTNYQTVKLDDKFGYGTMSLTWTPNPPPFEQSIETIKYVTTS
                     DIGTKLLNGGEFYGMEDKELNLKLIKQFLESNDPKLNSELVISIKGGLKEDLAPDGSK
                     EGVSKSIENIISYFPQDKAVRPTLIFEAARVDPTVPIAQTVSYIADYVKQGKIDGISL
                     SEVGAQSIAKASDEFPISCVEVEFSLLCQDILSNGVLEECSKRNIPIIAYSPIGRGIL
                     TDSTVDNADTFLSSLDKNDFRRLFDKFNPENFEHNMVLVKELHKFAHTKKNTSLESLS
                     LSWILKISGISNFEGIKQVTKILPIPSGSTKERINKNFGEIVDLTDDDLAEIQKICKS
                     HEIKGLRYNKHMEALNFA"
     gene            <259163..>259867
                     /locus_tag="DEHA2A03058g"
                     /db_xref="GeneID:2899884"
     mRNA            <259163..>259867
                     /locus_tag="DEHA2A03058g"
                     /product="DEHA2A03058p"
                     /transcript_id="XM_456476.1"
                     /db_xref="GeneID:2899884"
     CDS             259163..259867
                     /locus_tag="DEHA2A03058g"
                     /note="similar to uniprot|Q09176 Schizosaccharomyces pombe
                     Splicing factor U2AF 23 kDa subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03058p"
                     /protein_id="XP_456476.2"
                     /db_xref="GeneID:2899884"
                     /db_xref="GOA:Q6BZ93"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR009145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ93"
                     /translation="MSYREDRIICTFYTKIGACRHGEKCSRKHVKPSSSDTILLPNLY
                     QNPKLNKNDGEELNPKQVQEYFDHFYKDIFLKFALFGEVYSMVVCENDNNHLNGNVYV
                     KFANEDSAYNAVMLLNQEWFGGRPVHCELSPVESFHDANCRAYESSTCNRGDHCNFMH
                     IHKPTPQLKSSLFKSQEKSTLTKQLQLLRGELTGSSENENVQQDAAGEQISKPAETTS
                     TETVEKLFASSIPSHI"
     gene            <260034..>261479
                     /locus_tag="DEHA2A03080g"
                     /db_xref="GeneID:2899885"
     mRNA            <260034..>261479
                     /locus_tag="DEHA2A03080g"
                     /product="DEHA2A03080p"
                     /transcript_id="XM_456477.1"
                     /db_xref="GeneID:2899885"
     CDS             260034..261479
                     /locus_tag="DEHA2A03080g"
                     /note="similar to uniprot|Q08970 Saccharomyces cerevisiae
                     YPL224C MMT2 Putative metal transporter involved in
                     mitochondrial iron accumulation or uniprot|Q03218
                     Saccharomyces cerevisiae YMR177W MMT1 Putative metal
                     transporter involved in mitochondrial iron accumulation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03080p"
                     /protein_id="XP_456477.2"
                     /db_xref="GeneID:2899885"
                     /db_xref="GOA:Q6BZ92"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ92"
                     /translation="MLKIGLISRSKPSLITLNLRYDNCAFSAGSGFSLRNFSTAYIIR
                     EPQITIPKVYQQYLARRNMSTKKDSDSSNHSHGTIDGESKHQHGDEHSHEHSLLGHSH
                     SHSRHQPNEFLSVNTDTIKHNPAVRITWIGLLVNVVMAVSKGIGGVYFHSQSLIADAI
                     HSISDMFADFLTLATVNVAQKVGSPTHYPLGYGKIETIGSVLVSGVLLFAGVSVGWSS
                     LLQVFEFALPAYMFEYVSMIQIGHSHSHAGLGSGEVGGHSHSHVSDGVSDSSIVANSR
                     PIPNINAAWLAGGSVIVKEMLYRKTMQIAVETNSKVLVANAWHHRVDSLTAVVALLTV
                     AGGNIFNVAWLDSIGGLCVSMLIIKAGWDSFKTSIVELIDKGEDAESEVFSKVHDIIT
                     DEIKNVANNEFKIEKLSVLNSGAITNVYMTLSTSKEFRLKELNQIESNLVTAIKADYE
                     FVRNIFILFKDSEQQKISQDRSTEHSHENKK"
     gene            complement(<261553..>265524)
                     /locus_tag="DEHA2A03102g"
                     /db_xref="GeneID:8998111"
     mRNA            complement(<261553..>265524)
                     /locus_tag="DEHA2A03102g"
                     /product="DEHA2A03102p"
                     /transcript_id="XM_002769916.1"
                     /db_xref="GeneID:8998111"
     CDS             complement(261553..265524)
                     /locus_tag="DEHA2A03102g"
                     /note="weakly similar to uniprot|Q03690 Saccharomyces
                     cerevisiae YMR012W CLU1 translation initiation factor
                     eIF3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03102p"
                     /protein_id="XP_002769962.1"
                     /db_xref="GeneID:8998111"
                     /db_xref="GOA:B5RSP9"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="InterPro:IPR027523"
                     /db_xref="InterPro:IPR028275"
                     /translation="MSSDEASSEALAQEDIKQITLRIKLPACISNEEDLEVPSLLSET
                     LADIRETLNLSAATQNLTNFNVFYQDINLSENFDDLVPLNDILTELGVGEIDSLNLVL
                     KEKPYNLAAIYDHLNKFREVIGLHFLDKYSSEVGVLSGVSKFGDIDLQDVKETEPETQ
                     DDKDKETDETKSTKEDSNQTEEKKSEIVFTAEEKQQIGKITDELISGNTPSLVEFGTF
                     DNISGSIKTPIKSLTVSQWSPVPSFQKLKGDLLYITLQTLENETLNITCHLSGFFVNK
                     SSTINFNPAIKMNENGKVHKDYLLINLVDSLSPSFSKTIQENELVLSRSSKHPESFLI
                     PSNSLMSSPWIVNPSKFANQPDASRSQLPLISNGVDGSGFVKEWNEDFQAIRELPNST
                     INERILREKLLMKSLHEFNKVATETAMNVIKGNLTPLNPNEPKDYHIYLRNGIFYSLG
                     VNATGAFDCTGGNEAARYTSSKDLAAIKLLNRIDAKGIYNLVTCIVDYMGQRVICQAP
                     VPGILDSSHEDENEEEPTDKVCYGLSTDGSKIFSDSSFENVLKPIAEAFHLKPHPVTL
                     LDNVKSQGDLITSKDIKGVKGTDERKYIIDLYRATPLDIEFIESNWDESKETSYPHRE
                     TALRHEAVEEWWKRKVSVLFKAETERLEKEGKLESKDGEKPQIVLPSDQITINTDAFT
                     TIDESSDDQNEVREVSKFIKEHLIEEFLEENSKQISPFDGNHLTSMLHKQGINLRYLG
                     HIAEQACVRKDEHLKKITEARKVNEEEISKRKEESEKKATEGKDQDKEEEKANDNEKN
                     KEDDKEEVSNGEFEPIVANFDSLYRISVQEMVARSVKHLLRKISADIPVYLIPAFVSH
                     FHNCLLGSEINSSPECIIDETLKGFYNATELEFTKLNSNKVIALVANEVLIRFRYELP
                     TDWISTLIRPFQLFREIAIKYGIQWKSQEYAFTNEEFEKVKDKLAVETQVFEAKTSKH
                     KKNKKQQSQLITKSVDRTTIFVTDDIVNFVPIVKDSTYRSSLVDEIFETARAQIFKGE
                     TETGINLLNNLLSVYEQIYGRVHPETSKFYGLLSQYYAELGLKSEACNIARKACILAE
                     RTTGFDSYESITAYINSAFFESTNDDYINALNLYNKAINDWTLVYGDGHPSSVNTYAN
                     LAELLSEHKLFQQANKLFEKAISISTKLNGEESQICGMLRYRYGGTLLGGGDFKSALD
                     QFKSANDIFTKFIGPDDQLSKKSLSFVTNISTYLAYNEHQKSEQKKALAQQASASNGK
                     VKAKSAVEQQLKSSKKGKKNDATQPNPEIASKSVDDILQYIEGKNPKKQLKKKSNNKK
                     SKK"
     gene            <266100..>268001
                     /locus_tag="DEHA2A03124g"
                     /db_xref="GeneID:8998124"
     mRNA            <266100..>268001
                     /locus_tag="DEHA2A03124g"
                     /product="DEHA2A03124p"
                     /transcript_id="XM_002769917.1"
                     /db_xref="GeneID:8998124"
     CDS             266100..268001
                     /locus_tag="DEHA2A03124g"
                     /note="weakly similar to uniprot|Q04511 Saccharomyces
                     cerevisiae YML088W UFO1 F-box receptor protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03124p"
                     /protein_id="XP_002769963.1"
                     /db_xref="GeneID:8998124"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ0"
                     /translation="MEHGNGVEVDGLGNTIKHVAQSVESSKYITFNDLPNEILIQVFS
                     NLDPIQLCSVRLVCKHWNYAVSDKSTWIKSFGLKFGTRQTFPSVSNSKLWISEYLYRL
                     QMYKKWKKAIATHKNYQLLNNEYGLVDFALTNFAQDKLLTFARISGDISMCNLNNGKN
                     QTFIPGNYLLTQITCYAVNWTYLMVGKLNGELYLKNLITSTSSGSNRSSLIKFEDGEN
                     SRNDTITGCCLNYHFDKRKESIDCISSSIKGSLKCWNLGGKLIKKIELNEPIITVKSD
                     FKNYIIAQGQKKTFIIHIRTFEIVSIEMGMSIEEFENSFVDVDYGDSNVVICYESTIK
                     VINFKNLGNVRLKEVILPDDVSILESKFQTVPYSKLHNRDSEIAGSDGLMCANILSDD
                     TVIVWNIRDSATQIVPQCTITPIFNKHHPAIPNDRTYATSIALNNSVIAIGGYNGFTN
                     LYNIFTGDFIRECSIKFPKRLSHMYQHIIPIKDIQLNDSPTSSNGIIICGDAIQYFQF
                     GEPKQQTTTTTKKRLNVGPSNKQVVHQNIKDEIDDYENLQEAKHRRELLFAKYNGDKY
                     DDNDDELSIAIALSESFQNSNGSKAESVDDDEDAQLKLAIELSKSTETEPVDNDDIEQ
                     ILKLSLIDQ"
     gene            <268209..>272084
                     /locus_tag="DEHA2A03146g"
                     /db_xref="GeneID:2899888"
     mRNA            <268209..>272084
                     /locus_tag="DEHA2A03146g"
                     /product="DEHA2A03146p"
                     /transcript_id="XM_456480.1"
                     /db_xref="GeneID:2899888"
     CDS             268209..272084
                     /locus_tag="DEHA2A03146g"
                     /note="weakly similar to uniprot|Q02773 Saccharomyces
                     cerevisiae YML091C RPM2 Protein component of mitochondrial
                     RNase P"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03146p"
                     /protein_id="XP_456480.2"
                     /db_xref="GeneID:2899888"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ89"
                     /translation="MVFCNFVKRVKYSEKIQFFQSSYPYLKNQNALSQFHQFYNSKWF
                     NEDPHPSATPRNFLGIDTGHYGLYFTIFNHDSDKNKRKQHRSSLKYDYDQLAEGNSQH
                     RLFDNFTKFIISQANQDIYNNISYLKTVSRDFLSTLSIIRPKFSVNTTRRFSTVAIRN
                     HQNNQHHQHQINETAYEELIEDKEEDFESNLLHTQISNIEAIYAKQGPTELNLIYPLY
                     QTLKRNCLQLPSIHLYNIVLKSIVERKLDNDARTFENIESRLTNLLTVYQDILVGSSE
                     QVKPNKETYEIVLNELLRGSLQTIELGNMSDCPQSVYNESFIKSQEFSQIGIELFMSI
                     NKIENLDLSMILPQLFSILNVHSNLITKDLFVKILNLNDNVNSESGIYYIGLIGLSRY
                     FSKLQFFQSKEEFYNFIVSTYQSYKNNSQAFEKLTLYEYDVYSILVSSLVKSDNFPLA
                     TKFLDDILVDYKSSLHSFKSSSISKKQISNLLSAYLDSIMSNNYSRENLNKSYNLLMK
                     FNELSYIPELSVTLYNNMINQFVNQYHILENEKYELAKTSPEKIEALSKLQASYYRIM
                     WNLYSYLAIRKDYHHPSDMDSISLILNNKTFNCREYLLSLSIDLGDHEKVFQIIKEIL
                     LKNHLIQDTNVLKKLNNYLYSGSTNNGFNAYYFELMSNIIENQAVHYANNSKLLNNYV
                     SETINYLLLQNNEYNVKLLLKSVMVNETFSDFDLQSDNIYGVSQISKFLIQYINSGIE
                     KVDEPTIFKILHFQSLLINEFENTENHYIQLDSEMNEFKGLLKTHFISSMSYYMTIPG
                     FRVTNDIIDACTCCDFEISSPYSEVAKNHEVDLDYDLNLAFLLNINYNTGIERFIDFF
                     NKGYKFTYSTWKIIINQNFVLTTLEKNTRIGIDEFVNTILQSNFEMHEKNNLLDALIK
                     IENEKVNIHLFKVLLKFPSIINNNLLKTFMQAIYASPNQYLATILNENFEYLIEHTDK
                     REWINGYFKYLIKNKNYNQINKIVESGYPIHDLSLKSSIDIEILQSIFETFIASKKFN
                     EFNTVFKNYFSTPESNRILMNNMNLINVLIKYYTLNGSFNLVLQKFKPIADQSKDTRN
                     LIEFVEFMQTLSGESRPIEISSFNDSNELAINLMKAADLHSMNEMFQQNKKFNKNSLF
                     GLMMNNYIKAATINDSLSTSQLSLVNNFQKSLKFMKLIRFTNISIDNLNLIIKFLAVT
                     KSVDKLSILTNKIIGDNKIADLVNFYFLEFLFTNPTDKLIILQTLRDAFTYLRDPINT
                     YIVNQFCQEQKIDLQDNDFRMVLNDSALC"
     gene            <272262..>273227
                     /locus_tag="DEHA2A03168g"
                     /db_xref="GeneID:2899889"
     mRNA            <272262..>273227
                     /locus_tag="DEHA2A03168g"
                     /product="DEHA2A03168p"
                     /transcript_id="XM_456481.1"
                     /db_xref="GeneID:2899889"
     CDS             272262..273227
                     /locus_tag="DEHA2A03168g"
                     /note="similar to CA1925|IPF18587 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03168p"
                     /protein_id="XP_456481.2"
                     /db_xref="GeneID:2899889"
                     /db_xref="GOA:Q6BZ88"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ88"
                     /translation="MPQTHSTAINSYNSNHSSYDQLRPSFSPKIVDQFLVDLGLGSIK
                     DNKIVYDNKKKILELAAGTGKFTRNLVDHGWSDQLIVVEPSEGMLKTFDKKFPEIRKF
                     QGSSYDIPLPDSSVDSVIIAQGFHWFSDESSLIEINRVLKSTGTLGCIWNFDAPSISQ
                     NLHHPLPETKILYDNIAPEVESKLSVSNSNNVSLKIKEFFALHPWCVEVSEYIYSFDI
                     KVPQYRHGKWKELLCKENKYFSPISKEIFLLYISRVKPEDVYKYWETRSFITDLNADE
                     RLEIQKKVESLVRNVVTENDKTKLNGDNYLEKSMGTHSIVTKVIK"
     gene            complement(<273293..>275488)
                     /locus_tag="DEHA2A03190g"
                     /db_xref="GeneID:2899890"
     mRNA            complement(<273293..>275488)
                     /locus_tag="DEHA2A03190g"
                     /product="DEHA2A03190p"
                     /transcript_id="XM_456482.1"
                     /db_xref="GeneID:2899890"
     CDS             complement(273293..275488)
                     /locus_tag="DEHA2A03190g"
                     /note="some similarities with uniprot|P53745 Saccharomyces
                     cerevisiae YNR059W MNT4 Putative alpha-1
                     3-mannosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03190p"
                     /protein_id="XP_456482.2"
                     /db_xref="GeneID:2899890"
                     /db_xref="GOA:Q6BZ87"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ87"
                     /translation="MRFSIKRLSTYITTIFGLLFIYLFVNFSNFRIRYSDYMIHYSLT
                     KENFKQSDDITRNSIHYTNYEFSLMEEFSKMHDPATFKKNGLSERCGVFFDFFDKKDK
                     DWKLRTFDDATFDKNIVHKNSYFKDELNKLYKTKKNSADPHPDIVTRKENVTINNMFL
                     KRVRETKITENLMADSTTLLRIYGQCFINGPNVGHNEELQETFNRYSRKMFPFFTNKL
                     PVFEGINDEIIEKSFPNMQNGYNGENYEFDGKNVVDFIKRSSNGKGIVISASSSHVKD
                     LVKLIQLLRAMNNEFPIQIVYKGDLNNRAKSNIINAATGEFKDIIDPKNKASSHPESI
                     EASILNNTEKYGSKFPKQDLWFVNIRETIKRNYKYSFPGYTNKILALLFTSFKEVILM
                     DADTIPLVPLQDFFETQEYKETSTMFFKDRSLRDLNDYLETNYFTKLCPTSVNSMDSL
                     FDVKPITNHTLSNPYMTGYRHYQEAGVVMIDKSKHFLGILMMFPLAVWKEPVRSSIWG
                     EKEMYWLGMSIAGDENYQFNKYSAASIGEIVTNPKHKHYPDSDASEICSSHPGHVDKY
                     GRLLWINSGFKYCKKNTHFRDRNKFPFETFLVEEIANLYDSPLKIKHGIVPPDLPILR
                     RPGSPFELRNENLIKDDWKERTKDMDELSDEESIKHKQKEKVNPQKGWNKNSICSSYQ
                     YCAYDIIDSHPHNDGSVEKGHKFVFDDELVSEYDYLGSIWINGRTKSSV"
     gene            complement(<275688..>276878)
                     /locus_tag="DEHA2A03212g"
                     /db_xref="GeneID:2899891"
     mRNA            complement(<275688..>276878)
                     /locus_tag="DEHA2A03212g"
                     /product="DEHA2A03212p"
                     /transcript_id="XM_456483.1"
                     /db_xref="GeneID:2899891"
     CDS             complement(275688..276878)
                     /locus_tag="DEHA2A03212g"
                     /note="highly similar to uniprot|P38219 Saccharomyces
                     cerevisiae YBR025c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03212p"
                     /protein_id="XP_456483.1"
                     /db_xref="GeneID:2899891"
                     /db_xref="GOA:Q6BZ86"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ86"
                     /translation="MAPKKKVVQEKPILLGRPGNNLKSGIVGLANVGKSTFFQAITRC
                     PLGNPANYPFATIEPEEARVIVPSSRFNKLVDIYKPKSEVPAYMTIYDIAGLTKGAHA
                     GEGLGNNFLANIRAVDAIFQVVRCFEDADIIHINDEVNPAADLEIVHDELRLKDIEFA
                     TKHLEGIDKITKRGGQSLEVKQKKEEAELVKKIIQLLEDGGRVANQKWTTKEVEIINS
                     MFLLTAKPTIYLVNLSERDYVRKKNKHLLKIKEWVDAHSPGDLIVPISVSLEEKLAGM
                     ETDDERDAYCKELGAQSALPKIIVSMRQKLDLISFFTGGPDEVREWTIRRWYTAPQAA
                     GTIHTDLERTFILAQVIKYDDLIEYGDEKSVQAAGKLMQKGKDYFVEDGDIIFVKAAD
                     GKAR"
     gene            <277116..>277448
                     /locus_tag="DEHA2A03234g"
                     /db_xref="GeneID:2899892"
     mRNA            <277116..>277448
                     /locus_tag="DEHA2A03234g"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_456484.1"
                     /db_xref="GeneID:2899892"
     CDS             277116..277448
                     /locus_tag="DEHA2A03234g"
                     /note="similar to uniprot|P36532 Saccharomyces cerevisiae
                     YBR268W MRPL37 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_456484.1"
                     /db_xref="GeneID:2899892"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ85"
                     /translation="MLSRVGISRSPLILGVFNVRTLMVSSMLRNNEVKSSCKAGTVLN
                     LKMRKSGDEPVALEDHEYPEWLWDCLDKEKLDQKLKETDFMKWRRKQITKANTAKINN
                     NNFLAKMK"
     gene            complement(<277897..>279186)
                     /locus_tag="DEHA2A03256g"
                     /db_xref="GeneID:2899893"
     mRNA            complement(<277897..>279186)
                     /locus_tag="DEHA2A03256g"
                     /product="DEHA2A03256p"
                     /transcript_id="XM_456485.1"
                     /db_xref="GeneID:2899893"
     CDS             complement(277897..279186)
                     /locus_tag="DEHA2A03256g"
                     /note="similar to uniprot|P32329 Saccharomyces cerevisiae
                     YLR120C YPS1 Aspartic protease or uniprot|Q12303
                     Saccharomyces cerevisiae YLR121C YPS3 Aspartic protease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03256p"
                     /protein_id="XP_456485.2"
                     /db_xref="GeneID:2899893"
                     /db_xref="GOA:Q6BZ84"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ84"
                     /translation="MFSVNRLFQVWGLFQLAAFAVASDGFVKVDFDVYQGLNLSAALS
                     SYSQISRRDGSYDVSLVNERLFYVSKLQIGTPESEVSVLIDTGSSDLWVMSTKNPQCQ
                     DNGGSIDCEKYGTYNESASSTFHDNKTDFSIQYVDQSYAKGTWGTDTISLNEALKLEN
                     ASFAVADDSDSDVGVFGIGFKGLESNPEQYSNLPITMKEQGFIKKIAYSLYLTSAESE
                     SGSILFGAIDHAKYDGELAVIDISKINGDYGYLQIPLTSVSVDVKSNVDSQPSDNTVP
                     STGSSLRSFNNSGAQPIEANNSQALLDSGTTLTYLPDSLVQQVLEQADKNASYSPSAG
                     GYIVSCTLRQPDNSMTFRFNDEKDIKVPFSDLVMQSGQDPNTGKAICLLGLLPSQDVI
                     LGDNFLRSSYTVFNLDDKTISLAQLKQTNDEDIEVIN"
     gene            complement(<279954..>282461)
                     /locus_tag="DEHA2A03278g"
                     /db_xref="GeneID:2899894"
     mRNA            complement(<279954..>282461)
                     /locus_tag="DEHA2A03278g"
                     /product="DEHA2A03278p"
                     /transcript_id="XM_456486.1"
                     /db_xref="GeneID:2899894"
     CDS             complement(279954..282461)
                     /locus_tag="DEHA2A03278g"
                     /note="similar to uniprot|O13585 Saccharomyces cerevisiae
                     YPR089w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03278p"
                     /protein_id="XP_456486.2"
                     /db_xref="GeneID:2899894"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ83"
                     /translation="MDAWADSSAGMVSLTSPEAGIKGGSHILNYSDPLLAKVIEFKKE
                     LQAEVETNIESEESDGKPIVEMMIAACDGDLVTFESVARLHPELINTLYPSENSGISS
                     LIYAICFDQYAIAESILTHHNGDPDLHDTLVNNYTPLMWAVYFNQLDMVKLLLNHQAD
                     PYISPKDDDKTAITLVTPGKTHIYEFFKNHNLLQNQQNSSLDSDDYYESGFQYQDNSL
                     VDDLSNQIKLQSIAATAGYLEDEDHEQPSEDLDEEQRLANDPLLTSLKEFDYEKLSPD
                     QYIKFTDSDIPSLLDYIFDLRTKNLSYQHDTKVPAAILFQLLRYSYLKVDSAELSEFL
                     FDCFTARLRSVTNTKSGVFNMATADDNSNSTGSGDIVLLSYWLSVIQFLHFYLTKSGF
                     YSKFPKFLQELINLVQSLIATLSFSINSRLNLLIDDCILDFTNLVDVSNVLYAKDWNF
                     FKGKRKFHPSTYEDIFDMLYPPSQTELMKPSPIRYIQVLNALDYVLKLHQVNTLIKFQ
                     TFSEVFYYINSIIFNRIISQSKYCTRSKAIQIRLNISTLEDWLRSHNYKNYKPDKIGQ
                     LSKMLGPEHNSIHLSNLLEESNDIKNPHSLSFYYNSLYHIGKTQLQPTIELLQWLQCM
                     SSLTDEESLIITINQFDYLNYYQLYKIMHKLYKYEVNEPKLPKALSNLVKNLQNQKGE
                     SQVSQRNLHYMTQSNFLSKEVYIYLNPNYVFAVALPNLNELINSYGSGIGGVKTLRAK
                     KYQPSLPLSIIDDVDDILTQNKNDVNDTFDYDQDNEAAYDDDDEEEEESERSAKNVSV
                     SQKSSSFKGDELFKEVQLPGSLAHKNWGDDDIESNPW"
     gene            <282668..>283537
                     /locus_tag="DEHA2A03300g"
                     /db_xref="GeneID:2899895"
     mRNA            <282668..>283537
                     /locus_tag="DEHA2A03300g"
                     /product="DEHA2A03300p"
                     /transcript_id="XM_456487.1"
                     /db_xref="GeneID:2899895"
     CDS             282668..283537
                     /locus_tag="DEHA2A03300g"
                     /note="some similarities with uniprot|Q06815 Saccharomyces
                     cerevisiae YPR079w MRL1 Membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03300p"
                     /protein_id="XP_456487.2"
                     /db_xref="GeneID:2899895"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR028927"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ82"
                     /translation="MSRLYQRLGLFAIFLVVCLGLYLIKQSEPNGTLTENGAHLFDTV
                     AHLSLHDNSAKGKVGANVASKQTAEENKKMQEKHKADLALELEPCTVMSPLSHHFIDL
                     SSLSSKGNEGRAMPWASKGYDSGLNFTLGVCSSPFKKTHDANDEVKDITNSSAVGGYY
                     IDPKTGKYVSIGEYSSKPVVRGKKITLSYTGGSYCENMYNKETGEKVRKSTILTFTCD
                     REMLAKASVSYVGSFNDCSYIFEVRSHHACPTAAKADNLAVIWIFFFILLAALLVYFS
                     GGLIYKQIKLQKS"
     gene            complement(<283697..>286522)
                     /locus_tag="DEHA2A03322g"
                     /db_xref="GeneID:2899688"
     mRNA            complement(<283697..>286522)
                     /locus_tag="DEHA2A03322g"
                     /product="DEHA2A03322p"
                     /transcript_id="XM_456488.1"
                     /db_xref="GeneID:2899688"
     CDS             complement(283697..286522)
                     /locus_tag="DEHA2A03322g"
                     /note="similar to uniprot|P32074 Saccharomyces cerevisiae
                     YNL287W SEC21 Gamma subunit of coatomer"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03322p"
                     /protein_id="XP_456488.1"
                     /db_xref="GeneID:2899688"
                     /db_xref="GOA:Q6BZ81"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ81"
                     /translation="MSTQSYKKQDPYSISSSGLPDKMTVFQECLQQFNASPVNAKKCR
                     QLLAKLLRLIYHGEQFPSQESTTLFFSISKLFQHKDLSLRQLVYLAIKELSATSQDIL
                     MVTSSIMKDIQSGDLIYKPNAIRTLSKVLDPSTVSASERLFKNCIVDKNPTVSSAALI
                     SSYNLLPIAKDVVKRFTNETLETVNSFKQFPANQFQLHEYYGSSTTNLPSTSYMYQYH
                     ALGLLYQLRNHDKMALMKLITSLSEGSSLKNSLSVIQLIRYINKILTDDESLLQHLLP
                     ILSGFLKHKSDMVGLEACKTLVGLQHLIKDDDFMKIIDTLQKLLSVPRTATRFAAIRL
                     INRISIKHPEKIMVVNLELENLINDSNRSISTLAITTLLKTMGSNTIESNTGGENVDR
                     LISKMTSLMDEITEDFKIVIIEAIENLALKFPSKHKKLVAFLTDLLRDDGSLQLKSSI
                     VDALFDLIKFLPDVSAKQLILMNLCEFIEDCEFTELSVRILHLLGDEGPTTTNPSYYI
                     RHIYNRLVLENSIVRSSAVISLAKFAVVCKGEVSRNIQILLNRCLIDVDDEVRDRASI
                     SLRFIENSKEELIVTDSKYDLSILENKLTNYLNDESNFDKKFDISEIPMISTEEQRSI
                     EYNNKINKLESSSTTEVSEKDNHKNKSSKKESDNDKQTGDDSASGLLKQQAYAQELST
                     VPEFADYGKLSKSTSTPIYLTDKENEFVVTVVKHFFIESQKLVLQYNITNTLTHLVLQ
                     DVSVIAQPDNELYQEDFIISLQELRPEQTGNVYVSFSAPSIDDEELISAFGNTLSYTN
                     REIIDEEGNIDESDEGWSDEYQIEDLEISPGDFISPLYNSNFTSIFDQLPSEESFVVN
                     LTNAKTLENAAIKLKSNLNMMPLDGSDYVPSDATSHVLKLLGKDLWGGKVGVSVRLAL
                     AGGKVVAKLQVKSETENLTKVVADGTS"
     gene            <286723..>286974
                     /locus_tag="DEHA2A03344g"
                     /db_xref="GeneID:2899689"
     mRNA            <286723..>286974
                     /locus_tag="DEHA2A03344g"
                     /product="putative mitochondrial 54S ribosomal protein
                     RTC6"
                     /transcript_id="XM_456489.1"
                     /db_xref="GeneID:2899689"
     CDS             286723..286974
                     /locus_tag="DEHA2A03344g"
                     /note="similar to uniprot|O14464 Saccharomyces cerevisiae
                     YPL183wa"
                     /codon_start=1
                     /transl_table=12
                     /product="putative mitochondrial 54S ribosomal protein
                     RTC6"
                     /protein_id="XP_456489.2"
                     /db_xref="GeneID:2899689"
                     /db_xref="GOA:Q6BZ80"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ80"
                     /translation="MFALSSIIKRQVVGPTVGRALFNATPKLTVPAVNNSPLSLNSIR
                     GFKVRTSVKKFCKDCYMVRRKGRVYVYCKSNGKHKQRQG"
     gene            complement(<287076..>289055)
                     /locus_tag="DEHA2A03366g"
                     /db_xref="GeneID:2899690"
     mRNA            complement(<287076..>289055)
                     /locus_tag="DEHA2A03366g"
                     /product="DEHA2A03366p"
                     /transcript_id="XM_456490.1"
                     /db_xref="GeneID:2899690"
     CDS             complement(287076..289055)
                     /locus_tag="DEHA2A03366g"
                     /note="similar to CA1933|IPF18586 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03366p"
                     /protein_id="XP_456490.2"
                     /db_xref="GeneID:2899690"
                     /db_xref="InterPro:IPR018857"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ79"
                     /translation="MSLSNIPSMSNNNGRGRTKVATGTTQPNKKSHTKLKSHNRSYSH
                     NKVLNKLSTSSTPLVPTMGSRPNLNRSKSTDGLIRPTNRYGALKKNSRSFTKLASLQP
                     LTKTISNQSIKSNKSTGSLKGMNTAHHLSGLKTSGRKGKAILKLNDNDNDNNDYEDME
                     NDSSHNDNAAENINRNENSRDERALSTSFTNYENENDKQEIKGPSQLPLERSSSAQSS
                     SDDLVTNSNMYGGSLLLSQSTGLTRKINSAYNNNSSASPILTHKTADTHESSMGSTNS
                     ESVSGISFKANPMDNVNKSQNNVAEPVITNKNVIQDNSYQPNQTIFSNLQRNNQAQSN
                     SNKVTDQNGSSSNNAISNDQSLQSYLQQANQPQHNIETRTQQRLWLQRENSLMDVVNV
                     DPNRSNFSSLSLNNMMFAHSYNQSQQNIRDISQTSNQVTGPVTPQSETTPYEMSHNNS
                     VNAITANNAPQPGNDQSNSMSNINGLLTMVQNSHQNSIQSRTEFERLNREYLNVRRHL
                     NPIGESLNRVEQIMKNTKEIKVAKKNSHKKSSSVSSIHSNSTNANTFKEFSPSFQEKE
                     QEISSTLNKLWQEALILTSSSTSSTNSIRVNPPQPSQQPIQTQMQRSHNPRVPSYGQS
                     PYSNLRSPQTPTTRAVKLAAQAQAANTKRLNESHN"
     gene            complement(<289221..>292644)
                     /locus_tag="DEHA2A03388g"
                     /db_xref="GeneID:2899896"
     mRNA            complement(join(<289221..292577,292627..>292644))
                     /locus_tag="DEHA2A03388g"
                     /product="DEHA2A03388p"
                     /transcript_id="XM_456491.1"
                     /db_xref="GeneID:2899896"
     CDS             complement(join(289221..292577,292627..292644))
                     /locus_tag="DEHA2A03388g"
                     /note="similar to uniprot|P53010 Saccharomyces cerevisiae
                     YGL094C PAN2 Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03388p"
                     /protein_id="XP_456491.2"
                     /db_xref="GeneID:2899896"
                     /db_xref="GOA:Q6BZ78"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /translation="MEGWGEISRIAATASSSVIDNSKITSLQFDNQQNLLWCGDSKGT
                     TRSFTPQSTSIPMPYPALHLSQYSKFKTSLGTSPVKQYLNHQKGILSLSHNCVNFNNR
                     RGLTQLSLNSESLKEPGFNNLSCMTFNSNTNNDLVIAGDSLFKVDLLKPNMTTSFNHT
                     GKVSMIDNTLNYLTLGKSNGEIEIFDPVSNQTVKSFYGHNGLLSDIDVQGNYVASCGY
                     SLRPRRNQASQSSYMIDPLVNIYDLRMMRSLPPIPFSAGASFVKFHPKLPNIMIIASS
                     LGQLQFVDIYDQSNVYLYQADLSNVNASTPTTSSNTYLANLEVSGNGEFITFSDGFQN
                     LHLWSFKNNNSKNFINFPSYLEQPDFSPPFQQNHINVDDVVPLSSIGMPYYKDLLLSN
                     YASDLHFTKELSKLPNHLDPELLQNQYSQVLPYNTLKYGKRNLNKFYVPLQNNVSTKQ
                     KLFPKFISEKNGHDSFDNENSNIFEYKLSNKFEVPNCYSNLKIQYSKFGVEDFDFSFY
                     NRTKYSGLENHLDNSYINSLLQLYKYSPVFQNFIIKHLLKEWLPNDLTTIIQNGNPQG
                     SSILNELGYIFDMMNKSHGKNCKTSNFSNVLSQNQVAQMQELINKDDCKNLNAFEIRA
                     IIGKFNKFLLSTCNNDLLNQFNTSLSEITNIGYEIEIKSNGCNINNVNYNSQLTVDLM
                     SPPINKLSILISANSTSATKKNLNILNYLDYSMNQFKTIKCQQCNNSFPHLLEIRQSL
                     VHLPPVISINVNFTGQEFNLIQNFPNWLVPEFYTYGMNNKVSFKLHSNDNLSNKYELL
                     GYVCEINVGSEFLKGKHNLVSYIKIESKWYLFNDFLVMPIPESEVFDLSYHWKKPIIV
                     MYQLANHADFGSFQQQSFAQLPDLNDSILYRDHFAGGIRDSIKREYELLTKDEAPNAG
                     TLIAIDAEFVALNPEELEVHYGGVRNLIKPRNLSLARISVLRGDNGPKQGVPFIDDYI
                     IHTCFIDDYLTSFSGIEPGDLDPSSSTKTLTTLQTSYRKLWLLLNLGCIFVGHGLQND
                     FRCINLHVPKNQIRDTADFFYLPELKRKLSLKFLAYILLKEKVQTGNHDSIEDANTAL
                     LLYKKYLELTAIGEFESTLHRIYMDGQQLRFRVPDS"
     gene            <293041..>293364
                     /locus_tag="DEHA2A03410g"
                     /db_xref="GeneID:8998134"
     mRNA            <293041..>293364
                     /locus_tag="DEHA2A03410g"
                     /product="DEHA2A03410p"
                     /transcript_id="XM_002769918.1"
                     /db_xref="GeneID:8998134"
     CDS             293041..293364
                     /locus_tag="DEHA2A03410g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03410p"
                     /protein_id="XP_002769964.1"
                     /db_xref="GeneID:8998134"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ1"
                     /translation="MSYFVKQCKMSVLCLLTRETVSKVPLHIFYSCPYKYTDFLDYGL
                     DPLSVSKRRLYVFAYKRKLTIFNSSNANMDMSKEHSGKFRTIFGCILQVTYWYKRNQL
                     LQNVL"
     gene            <294173..>294571
                     /locus_tag="DEHA2A03432g"
                     /db_xref="GeneID:8998135"
     mRNA            <294173..>294571
                     /locus_tag="DEHA2A03432g"
                     /product="DEHA2A03432p"
                     /transcript_id="XM_002769919.1"
                     /db_xref="GeneID:8998135"
     CDS             294173..294571
                     /locus_tag="DEHA2A03432g"
                     /note="weakly similar to CA2078|IPF13352 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03432p"
                     /protein_id="XP_002769965.1"
                     /db_xref="GeneID:8998135"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ2"
                     /translation="MLKTLFPSWYKKPIIPAEEIPKKFITNEDKQAVQYTMNDKDSFV
                     DINYKNLSYAEVAALSKSKPMVSKVKKTSKPAKHTNTNYKILTNLGHDDDLADSIVLP
                     EKFKSDIHYKKSKQFKQPSPRNKRNNAVAV"
     gene            <295094..>296677
                     /locus_tag="DEHA2A03454g"
                     /db_xref="GeneID:2899897"
     mRNA            <295094..>296677
                     /locus_tag="DEHA2A03454g"
                     /product="DEHA2A03454p"
                     /transcript_id="XM_456492.1"
                     /db_xref="GeneID:2899897"
     CDS             295094..296677
                     /locus_tag="DEHA2A03454g"
                     /note="highly similar to uniprot|P20447 Saccharomyces
                     cerevisiae YGL078C DBP3 Putative ATP-dependent RNA
                     helicase of the DEAD-box family involved in ribosomal
                     biogenesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03454p"
                     /protein_id="XP_456492.1"
                     /db_xref="GeneID:2899897"
                     /db_xref="GOA:Q6BZ77"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSKDHKDKKRKHSDEATEEVEKKTKVSKKEKKDKKEKKEKKDKK
                     EKKDKSEKKDKSEKKEKKEKKESEDVPTKSSAVVSTGYSQSPALTKLPQSEIDSFLQE
                     NEVTVEDPHNLGLRPLLGFDQIDLDSRIASVISKFPTPTPIQAVSWPYLLSGKDVIGV
                     AETGSGKTFAFGVPAINNILTHDKKGLKVLCISPTRELALQIYDNLVDLTANTPLKCV
                     AVYGGVSKHEQVSSLRNASVVVATPGRLIDLLNDGALSLDSIEYLVLDEADRMLEKGF
                     EQDIKSVMQQTNHANRQTLMFTATWPKEVRELASTFMNSPVKVSIGDRNELSANKRIT
                     QIVEVIEPYDKEKKLLSLLRKYQSGSNKDDKVLIFALYKKEATRIENLLVRNSFKVSA
                     VHGDLSQQQRTSALGAFKAGKTTLLLATDVAARGLDIPNVKVVINLTFPLTVEDYVHR
                     IGRTGRAGQTGIAHTLFTEHEKHLSGALMNVLRGANQPVPDELLKFGGHTKKKAHSAY
                     GAFFKDVDMTKTAKKIKFD"
     gene            <297033..>298718
                     /locus_tag="DEHA2A03476g"
                     /db_xref="GeneID:8998136"
     mRNA            <297033..>298718
                     /locus_tag="DEHA2A03476g"
                     /product="DEHA2A03476p"
                     /transcript_id="XM_002769920.1"
                     /db_xref="GeneID:8998136"
     CDS             297033..298718
                     /locus_tag="DEHA2A03476g"
                     /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
                     YML130C ERO1 Glycoprotein required for oxidative protein
                     folding in the endoplasmic reticulum"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03476p"
                     /protein_id="XP_002769966.1"
                     /db_xref="GeneID:8998136"
                     /db_xref="GOA:B5RSQ3"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ3"
                     /translation="MKFSMVATMVFLSQLLLVSGSISLAKFSPFDSPDFCSQIITPTC
                     NTTFSYIDRLNEQIRPYLTSLVETPYFRYFKLNFDKQCKFWDTQHFCATENCAVEILP
                     PSQYNWSNISNDNLKPSKLGQIKRPESTGLADDSASGAETCEDFDYCHIDDDHQCVYV
                     NLLDNPERFTGYGGSQSYDVWKAIYSENCFPNTNPMSMKDVNAEPEQCVEKKLFYRLI
                     SGMHASIAVHLSNEYLSPGSGNFEPNLKVFMERVGSFNDRLSNIYFNFALISESIVKL
                     SNFPKLLDTIDHGDDFNQHFLSNSDQNYKQLLSNIVPELSSNLLYNSSTLFNPEVVSP
                     TLKDEFRARFKNVSAIMDCVGCDRCRMWGKLQTIGYGTAFKILFEGDNIDKLKFRRIE
                     LVALFNTFDRLSKSIEAINNFKQMYLAHLEDVKKGLVKPGDYEKADAKENGGLDFPFL
                     SSVNFGQDTDKSTKEKTSNSEDLKPAGTSAAKKQPMTFKEEFNKALLEVIDAFFFVIT
                     SYKRLPKTIYNISLFKLNHWWNIFIGREEYNQYMEYQLLQNKEQNDYINLFSN"
     gene            complement(<299028..>299561)
                     /locus_tag="DEHA2A03498g"
                     /db_xref="GeneID:2899829"
     mRNA            complement(<299028..>299561)
                     /locus_tag="DEHA2A03498g"
                     /product="DEHA2A03498p"
                     /transcript_id="XM_456494.1"
                     /db_xref="GeneID:2899829"
     CDS             complement(299028..299561)
                     /locus_tag="DEHA2A03498g"
                     /note="similar to uniprot|Q12127 Saccharomyces cerevisiae
                     YLR110C CCW12 Cell wall protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03498p"
                     /protein_id="XP_456494.1"
                     /db_xref="GeneID:2899829"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ75"
                     /translation="MQYQLLSVAALVASVAAQTTEYAIDTVTENHTTDVTITQCSSHK
                     CDTTVQQQTQTTITTTVDGVKTVLTTVCPLTESGAAAPTSAAGENNEVAPESASESDS
                     YVDVTVTPTVTASTGVEATVTSQATFTSVYNSNGTASSSLEAANTADVSAYEGKANGQ
                     QAMVGLAGLAALAAVLL"
     gene            complement(<300113..>302968)
                     /locus_tag="DEHA2A03520g"
                     /db_xref="GeneID:2899830"
     mRNA            complement(<300113..>302968)
                     /locus_tag="DEHA2A03520g"
                     /product="DEHA2A03520p"
                     /transcript_id="XM_456495.1"
                     /db_xref="GeneID:2899830"
     CDS             complement(300113..302968)
                     /locus_tag="DEHA2A03520g"
                     /note="similar to uniprot|P05085 Saccharomyces cerevisiae
                     YML099C ARG81 Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03520p"
                     /protein_id="XP_456495.2"
                     /db_xref="GeneID:2899830"
                     /db_xref="GOA:Q6BZ74"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ74"
                     /translation="MVSIVTNKGDSTKGEEIIEKRSSTEIEEEEASGKTKVNGGEYPG
                     KQKRSKTFTGCFTCRSRKIRCDLTKPHCRNCSKTGLVCAGYDIKLRWSQPLQFSNKKG
                     NSKSSSVVFNKKNEGDDENANPEFFQRRSVGFVKWDKPYETYDEMDRVLGILHNSGND
                     NMVNAENKTKLLGPFGVFKSSKKRAGTEDLKLTKRKNAGPNYLNAYAASTNPKQTADI
                     EKSTPIATGDDSAPHDQLWLSNELRDDALLTAAALNGDSQFLDFMNNLSPTNNQMLTT
                     GSNTNSRASPNINNYNFSGNQNDFLNLVFHRHNNFYGNNYANNNANSDSNTPVPVTDN
                     QSSTNTAMSNLLNENDGSKTIDPSNQHLYYSNYNTYYYNNPYQLNENLEIQLHASKMP
                     NPTEEESTDIIEGDHTNTTQMPASIMCIVQRPLQPKLGFDLTIPSINNSTTMGLPTTA
                     LQVQPLTRYLLNYYNTQVADLMTVIPLTENPWKTVYFPRALMAIGELSALGKTSNAKN
                     ALLNALLAVSAFNLQSKFPKNSDPMKYYLNLGIRLRNQASLFVKSLLGSNIDSKSGIE
                     SCVLNEKYKDVLCAVMSMISVDLVWGTMQDTNLYIRWCGKVITAKMVNKKKLSSRARI
                     LHRIFSSLKLIQDSTCLDLDNIKDDYETINESGYDVNGDKFFNTLRQNSKSSGKGKIE
                     FIVNNVEQSNIAGNNQMKNTSPLFVNKKLINTKKNDENFATDALYGLPNSLILLFSET
                     VQLLRTKIYHQEIYQDLPINFQQAVNNLEEKLLNWRLDWKLFETDNKDVNDIKAQSER
                     QEEPDEESTRKQDEVDKKFTSPMHEATYHHILSFYYALTIYFNRLINAVPPEEVQPKV
                     EKTLEHLNAIQALIAKDEAAIIPLFWQGFIAGCEATSNDLQMGFKKWGADIAQYLGSY
                     WGARQIMLEVWRRKRMNEPRDDWVSVIRDWEMNLMLN"
     gene            <303396..>305180
                     /locus_tag="DEHA2A03542g"
                     /db_xref="GeneID:8998140"
     mRNA            <303396..>305180
                     /locus_tag="DEHA2A03542g"
                     /product="DEHA2A03542p"
                     /transcript_id="XM_002769921.1"
                     /db_xref="GeneID:8998140"
     CDS             303396..305180
                     /locus_tag="DEHA2A03542g"
                     /note="similar to uniprot|P43550 Saccharomyces cerevisiae
                     YFL053w DAK2 Dihydroxyacetone kinase 2 or uniprot|P54838
                     Saccharomyces cerevisiae YML070w DAK1 dihydroxyacetone
                     kinase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03542p"
                     /protein_id="XP_002769967.1"
                     /db_xref="GeneID:8998140"
                     /db_xref="GOA:B5RSQ4"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ4"
                     /translation="MTLAKHWKFNKDEDIVLSNLKGLCHSNPAVGLIPSEKVIYNLNS
                     DTSKKVTLISGGGAGHEPLHGGFVGENLLDAAVSGAIFASPSTKQIMAAVKTKSNKDK
                     GTLIIVKNYTGDVLHFGLVVERAKSEGYNIDILPVSDDVAVGRRQNEMVGRRGLAGTA
                     LIHKVLGASSSDGSDLKSIAELGHLVNDNLVTIGASLDRTSVPGKAGEEVEFTGPDEA
                     ELGLGIHNEPGHKMSPIPNIDDLVKDMFNKLLSPEDKDRHYVDFDLKNDEYILVINNI
                     GGTSSFELYAIAEHVVSNLPLSKRPKRILISDFVTSLNSPGFSITLLNLSNIAKSNSK
                     YSESKVLGYLDLPTDAPGWKPKSFDAKQWSNESKYIDSPMIHEQRVTSSLKMDSGLFE
                     KALTSALQKLLKAEPDITHYDTLVGDGDCGETLAKGANAILDALKNDKSFKDNLSDPA
                     STLSTITEIVEDNMGGTSGGIYSIFLTALVKHIQDAQEITTEALGKAFHGALYDGLFK
                     YTKARTGGRTLVDTLQPFVDSFSKFGNVQEAVKAAKKGCEATKDLQAKFGRASYVSDE
                     EFKDGEIPDPGAIGLLAIIEGYAEALSK"
     gene            <305302..>307182
                     /locus_tag="DEHA2A03564g"
                     /db_xref="GeneID:2899832"
     mRNA            <305302..>307182
                     /locus_tag="DEHA2A03564g"
                     /product="DEHA2A03564p"
                     /transcript_id="XM_456497.1"
                     /db_xref="GeneID:2899832"
     CDS             305302..307182
                     /locus_tag="DEHA2A03564g"
                     /note="some similarities with uniprot|Q8YN46 Anabaena sp
                     all4724 All4724 protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03564p"
                     /protein_id="XP_456497.2"
                     /db_xref="GeneID:2899832"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ72"
                     /translation="MSEFKSYDIYKEDFFEAIVIGGGTCGLAVSARLCEDYPGSIYTE
                     DEHQRFRWLKQRGNKVNLINHNVSSKTKFKPVPKGSAYTSPKKFHPSEILVLDGVSNK
                     FLGQWDNQFARCQIPYLRSPMFFHPDPVNVDGLVTYSHFVKRDSPKDLMKIENVVGKE
                     YSKHQQKKLLNKNSKKKQFKDPIPTQKFGQFSDKPGLIDINMRDWKDYYRPSTPLFRD
                     FCQDIINRYQLHDVVRKDEVESIEYCFINIIDEGEAGMGFIIKTPSKVFGCKICVLAS
                     GHAGEINYPISPFETKSQFPEGSCHTTHIFSGTVKFPHDRIIEKVSQRKGTSIVIVGG
                     GLTSAQMAHVAILSGVEKVYLVLRGALKIKHFDFHLDWVTKYKNVKKSAFYVKDTDEE
                     RYDMIQEAREGGSINPEYYKKLKMHIKSGKLEIFKHSTVEDKEWNAGSKLWDLTINSR
                     SETKNTIDESDIFYGTNLSNIDYIYYATGISANIKSLPCLKPIIEAYNIETVKGFPCL
                     TDNLQWNDEIPLFVVGKNASLRMGPSSANLDGARLGAERIGWYIQELKSQGKFDWNSK
                     ECKYCSYTESVDDSDDSLDDKLDKLSTNSDKESEIELTSFETQLKLACGELNWFSLLQ
                     EV"
     gene            complement(<307210..>309375)
                     /locus_tag="DEHA2A03586g"
                     /db_xref="GeneID:2899833"
     mRNA            complement(<307210..>309375)
                     /locus_tag="DEHA2A03586g"
                     /product="DEHA2A03586p"
                     /transcript_id="XM_456498.1"
                     /db_xref="GeneID:2899833"
     CDS             complement(307210..309375)
                     /locus_tag="DEHA2A03586g"
                     /note="some similarities with uniprot|P40971 Saccharomyces
                     cerevisiae YDR034C LYS14 Transcriptional activator
                     involved in regulation of genes of the lysine biosynthesis
                     pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03586p"
                     /protein_id="XP_456498.2"
                     /db_xref="GeneID:2899833"
                     /db_xref="GOA:Q6BZ71"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ71"
                     /translation="MSTRILKFDNEKKKKKRDYSKNGCRECKRRKIKCDEAKPACWQC
                     KRLKKSCSYPEVGERVLRASRKLMDNYDSYRAPEGSMPFNTCGHHTTVDTHINPNIRD
                     NQQQTAAYIQPQSNIRELYPPRLAPPSMLNLLNDTHQRIDRDGNGTSSTVEIPERKSQ
                     SSSSTISNDPNNFQNLSEERSGSSYATPATGHPIDNNNMLLLTSDGFYDNPEDLNLLA
                     TDLNDIVNSFMFEANFDTKMHDNDFQSVDTFFDELISKDKEPDGELNMNTNTNEEFDE
                     PIPRHIPIDFIKVKTKREEKYLTGFYDIFAEIILPFNSYDDKVKAFFNPLRDILLKCA
                     SGEPFLLAGILASGAKACFEKTNLPEDEEAFFKYLSKCLKMLEPSLKNRDDKDKKLWA
                     SNIDSVLITVLLLTGINALSSKQEWRPHLRGAKDILLRYSSNSLKYPRLRNSKLMIFC
                     KFMFASYETLAGLSSKFGGTLKESEVDLLICAGDPHEIKALRDLGIVRDDGFNLLCGY
                     HNSCIPHLRDLIKILNKARSKGNKFKPDDTFEYIRLISEFHAQTNIEFVTKKYFLQPS
                     DFKDGIIPDNLLLETVMINNVEHVISWMDICHQIYALASLMIIITHCFQLSYKSAQVQ
                     SLICKLMEPMVFLESYSEDLSSKKVCVMMLQWPMYIAGINCISEEHKQLIMKCFNIST
                     EAGSRSADLTLKKIKKIWDLHTNNREWNVDDDDIDIVTY"
     gene            complement(<310101..>312029)
                     /locus_tag="DEHA2A03608g"
                     /db_xref="GeneID:2899834"
     mRNA            complement(<310101..>312029)
                     /locus_tag="DEHA2A03608g"
                     /product="DEHA2A03608p"
                     /transcript_id="XM_456499.1"
                     /db_xref="GeneID:2899834"
     CDS             complement(310101..312029)
                     /locus_tag="DEHA2A03608g"
                     /note="some similarities with uniprot|P10961 Saccharomyces
                     cerevisiae YGL073W HSF1 Trimeric heat shock transcription
                     factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03608p"
                     /protein_id="XP_456499.2"
                     /db_xref="GeneID:2899834"
                     /db_xref="GOA:Q6BZ70"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ70"
                     /translation="MVRMSSYDDDPIIEIFDNDNSDDIQVINRDNTQYDQNLMNSTGN
                     TPHNYYNDIYDNSQHEHTQQNRQHQPQEQLSSLSSISQSQAETHSNQQEPSGLTPILS
                     SNDYNQLTTVSQPKYTTSLPPLAPLSESVIPNNLNIPPTLSLPKASESQDKKTNTVTT
                     TTKKRKEASSSKTRPAFVMKIWSMVNDPANHDYIRWNDNGKTFQVFHREEFMKLILPK
                     YFKHNNFASFVRQLNMYGWHKVQDISNGTLNKDDKSNDEIWQFENPYFIRGREDLLDK
                     IVRNKTISQESDHLEAGNLNFQSVLNELDQIKVNQFAIGEDLRRVRNDNKTLWQENFL
                     TRERHQQQAQTLEKILKFLAAVYGNSAGKLLEVDNGSIGLDDFNSNNQMTTYNYQQPP
                     QAHNQAPHQPIQVPSMTDQPSQPPSPFNRPRLMLMDQAYQKSPSNNPSPRETAQRNSN
                     SGSIEEIIRSYENTPNDSPNSNVNKIYQQLMNNEPGVSSPRHYFPELNSQNNSYFGVP
                     NTPGQQYIKSGTPLGSSNNTSEVMNGLEQNIFKQGQSIQQVQDWIQKLAAQQQQQQQQ
                     QQQLQNLQSLHQNHKQNSDDYEKPDIDEFDVNEFLDNSNASNSQASNSVNSDSNDASS
                     NKRSIDEVNDGNAKRKKQ"
     gene            complement(<312400..>313908)
                     /locus_tag="DEHA2A03630g"
                     /db_xref="GeneID:2899835"
     mRNA            complement(<312400..>313908)
                     /locus_tag="DEHA2A03630g"
                     /product="DEHA2A03630p"
                     /transcript_id="XM_456500.1"
                     /db_xref="GeneID:2899835"
     CDS             complement(312400..313908)
                     /locus_tag="DEHA2A03630g"
                     /note="some similarities with uniprot|P35192 Saccharomyces
                     cerevisiae YMR021C MAC1 Copper-sensing transcription
                     factor involved in regulation of genes required for high
                     affinity copper transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03630p"
                     /protein_id="XP_456500.2"
                     /db_xref="GeneID:2899835"
                     /db_xref="GOA:Q6BZ69"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ69"
                     /translation="MILIDDVKYSCIECIRGHRSSSCRHHTRPLLQVRSKGRPNVHAN
                     GNPNHRIAVFAEEIDKNDNSGTGHGKGNCENKKIPVVILKASPKHVIDLNNGQIIGPY
                     QDDITIDESSKPPLPIINSNSFINTTSCCLNGISKPKKSCGCCSNKTNKNINKSKILK
                     TYLKKHMKPENERKFIDYSKSIQIKNENDDEDEISGNEHSVIIDNDNNKDNDKINSGN
                     DNLLFDVVKIPSCSIPGSCGCDSNCACEGCFVHGNVSMNNLNNNQFSNLMNYANNNEI
                     KMPHEIMSNYANKLSEMTNSQVENNISRGVTNSDTDINNVFANDILDTHNGTQNVHSL
                     SQLGNIQNGDSLISNANTTSNNQTPNNYTNLVNDHMYTLQTDLAQQQPTNQNHSQKPI
                     QRPLQGYTQGEHQVEKYIESNVCSCSNDCDCFNCETHGIINGMKLDDLFNHMMPGDYK
                     DLINSIGDGTNTSNNSTDTPIIHSSSENVSSNSSESLDVNSGNGKTSNCCRK"
     gene            <314772..>317837
                     /locus_tag="DEHA2A03652g"
                     /db_xref="GeneID:2899783"
     mRNA            <314772..>317837
                     /locus_tag="DEHA2A03652g"
                     /product="DEHA2A03652p"
                     /transcript_id="XM_456501.2"
                     /db_xref="GeneID:2899783"
     CDS             314772..317837
                     /locus_tag="DEHA2A03652g"
                     /note="similar to uniprot|P40825 Saccharomyces cerevisiae
                     YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03652p"
                     /protein_id="XP_456501.2"
                     /db_xref="GeneID:2899783"
                     /db_xref="GOA:Q6BZ68"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ68"
                     /translation="MKVAYLLTQWTLWYSEICSIHPNLVNVIETKLTHTRPLKKLSIF
                     LYGVHQRVISSQIKFMLKTLVHKRIMSTSSNNWPASRVRSTFLDYFKVKQNHTFVPSS
                     SVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFSTLKRAVNSQKCIRAGGKHNDLED
                     VGRDSYHHTFFEMLGNWSFGDYFKKEAISWSWELLTEVYKLEQDRLYVTYFGGDEKQG
                     LQPDLEAKNFWLAVGVAEDHILPGNLEDNFWEMGDQGPCGPCSEIHYDRIGGRNASSL
                     VNMDDPNVLEVWNIVFMQYNREPDSSLRSLPAKHIDTGLGFERLVSILQNKSSNYDTD
                     VFQPIFNKIREITGVRPYTGKFGSEDRDGIDTAYRVIADHVRTLTFAITDGGVPNNEG
                     RGYVLRRILRRGSRYVRKYMNYPIGSFFQQLVPVVVEQNSEIFPEILKNQQDLTEILN
                     EEELSFAKTLDRGEKLFEQYAIIASKTPEQTLSGKDVWRLYDTYGFPVDLTRLMAEEA
                     GLKIDEEGFEKAKEESREASKATNNKAGVSLIKLDVHALSELDGNDKVPKTDDSFKYD
                     IENIKANVVAIYNGSSFVDSISEAGSQAGILLDKTPFYAESGGQEYDTGKLVIDGVAE
                     FSVSNVQVYGGYVLHTGSLLEGSLKLEDEIIATYDELRRWPIRNNHTGTHVLNFALRE
                     VLGDNVDQKGSLVAPEKLRFDFSHKQGLTPDELLKVETISNDYIKENKQVYAKDIRLN
                     DAKEIDGLRAVFGETYPDPVRVVSIGTSVEDLLKDPKNSEWHKVSIELCGGTHVAKTG
                     DIKDLVIIEESGIAKGIRRIVAVTGTEAHQVQKVASDFDKELDHTMGLASGPIKETKA
                     KELGVSLKKLSISVLDKRSLNDKFNKLDKSIKDQLKAVQKEESKKVLEVVNTWLNAED
                     AKDYLVSFVPISANAKAITEAINLLKKQHKSKSIYLITGSDKVAHGCYVSDEAIAKGI
                     DATNLATAVSSKVGGKAGGKGNVVQGMGDKPQGIDEAINELKKLFAEKL"
     gene            <318173..>319852
                     /locus_tag="DEHA2A03674g"
                     /db_xref="GeneID:8998045"
     mRNA            <318173..>319852
                     /locus_tag="DEHA2A03674g"
                     /product="DEHA2A03674p"
                     /transcript_id="XM_002769922.1"
                     /db_xref="GeneID:8998045"
     CDS             318173..319852
                     /locus_tag="DEHA2A03674g"
                     /note="similar to uniprot|P32945 Saccharomyces cerevisiae
                     YPL179W PPQ1 Putative protein serine/threonine
                     phosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03674p"
                     /protein_id="XP_002769968.1"
                     /db_xref="GeneID:8998045"
                     /db_xref="GOA:B5RSQ5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ5"
                     /translation="MGNSPSKNDPSPTNSSANQTLNQSTSSNGELESDESIPPLSGLS
                     GNKLNGSSKTSAIKIVNKNDNKFNSNYYNTNSNTPSSIYKKNGVQISPKKNSKSNGNH
                     DLALDLEIGVSMAKLLSNSSPSAPGSNKLSLPSQQEYSSSFDSEKSEVSTVSPVFTTL
                     GEYKDEDSLSSLGSSGPNDNFGVVKGDLDLDTIVEISLESTPEPRKVPDKSIDQPKKH
                     LDTQISSTSSTSSLQSPVENSNVKRPQVNVDEIIDRLLEIGLKRPNNSSANSSRKNKD
                     KLPLTSQEIKYVLNKSRSIFLDQPTLLRLSPPVKIVGDIHGQFHDLIRIFNSCGYPPY
                     TNYLFLGDYVDRGYKSLETILLLLCYKIKYPENFFMLRGNHESANITKIYGFYDECKR
                     RLPSISGNHKLWKTFVDVFNALPIAATINDKIFCIHGGLSPDLADLKQIENIKRPTDI
                     PDNGLLADLLWSDPDPSIKNFSPTNWPKNDRGVSYCFGKKHVDYFCLKFKMDLIVRGH
                     MVVEDGYEFFDKRKLVTVFSAPNYCGEFDNYGAIMSVDKSLCCSFELIKPQ"
     gene            complement(<320246..>324679)
                     /locus_tag="DEHA2A03696g"
                     /db_xref="GeneID:2899785"
     mRNA            complement(<320246..>324679)
                     /locus_tag="DEHA2A03696g"
                     /product="DEHA2A03696p"
                     /transcript_id="XM_456503.1"
                     /db_xref="GeneID:2899785"
     CDS             complement(320246..324679)
                     /locus_tag="DEHA2A03696g"
                     /note="similar to uniprot|P32568 Saccharomyces cerevisiae
                     YDR011W SNQ2 ABC transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03696p"
                     /protein_id="XP_456503.2"
                     /db_xref="GeneID:2899785"
                     /db_xref="GOA:Q6BZ66"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ66"
                     /translation="MGVDSISNANDGATISSSINEYYGADQEAVEQNDRLELVRSITS
                     GNSRDVLDRLETLSREMSRRTTRDGRIEIDPNNFDLHKILSSFIETSKSQGIKLRNSG
                     VSFKDLTVYGVDESFSVAVTVYDLMKGPIGGIQRAMAKRKIQDRKIVSNVNGYARSGE
                     MVLVLGRPGAGCSSLLKAIGGTDLDLFTGVDGDIRYDGITQKEMLKNFKNDLVYVPEL
                     DVHFPHLTVEQTLRFAIACKTPELRVNDVSREKFIDALKEILATVFGLRHTYHTKVGN
                     DFVRGVSGGERKRVSIAEALACRGSIYCWDNATRGLDASTALEYAHAIRTSTNLLKNT
                     AFVAIYQASENIYETFDKVTVLYKGRQVYFGPVMEAKKYFEDMGYECPARQSTAEFLT
                     AVTDPIGRYAKPGMGNKVPSTAEEFEDYWLKSEQYRILQQEIQEYNDSINEDETRKGY
                     YHSLKQEKMKYSRTNSKFTINYLQQLKLCTTRGFQRLWGDKAYTITQLVAAISQGLIA
                     GSLYYNTPDSVSGAFSRGGVIFFAALYVSLMGLAEVSASFNSRSILMKQKNYSMYHPS
                     ADALASVVTSIPVTLVVTFLFVLIIYFLSNLAADAGKFFTCVLFVFLLSLTMSGLFEA
                     VASLNKTISGANAIAGVLVLASLMYSSYMIQRPSMHPWFKWISYINPVLYAFEAIIAT
                     EFHGRKMECDGMYLTPSGPGYENLSQGSQVCAFKGSVPGQSWVSGDNYLKVAFTYSFS
                     HVWRNFGIMIGFLVFFTCVKALGVEFIRPISGGGDRLMFLRGKVPDSIVLPQDKGQTP
                     GDLETSSSSSNTLEKTNVNSEDKLKIFKNLKSRDVFVWKDVNYVVKYDGGDRKLLDSV
                     SGYCIPGTLTALMGESGAGKTTLLNTLAQRIDVGVVTGDMLVNGKPLDLSFRRRTGYV
                     QQQDIHVESLTVRESLIFSARLRRINDADDAEKLDYVEKIIKALDMEDYADALVGKTG
                     DGLNVEQKKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWAVVKLLRELSNAGQSILC
                     TIHQPSATLFEEFDRLLLLKKGGQTVYFGDIGDHSNAIVSYFEGNGARKCDDHENPAE
                     YILEAIGAGATASVTQDWFETWCNSPEKRASDIERDRLIEELSKQVEDVHDPKEIKQL
                     RSTYAVPYWYQFIIVVRRNALTFWRNPEYIMSKIMLMTMAGLFIGFTFFGLKHSVTGM
                     QNGMFAGFLAVVVSAPVINQIQEHAIKGRDLFEGREKLSNTYHWSLMVIAQCINELPY
                     LIFGSTIMFVSLYFPTQADPSPSHSGMFYLTQGIFLQGFVVTFGLLILYIAPDLESAA
                     VLTSFFYTFVVAFSGVVQPVNLMPGFWTFMNKASPYTYFIQNLITAFLHGRKVHCSDV
                     ELAYFNPPSGQTCQQFAGDFVKARGGYLSEPQATKECGYCTYSIADEYLSSVGAEFSN
                     RWRNIGFYCVYIAFNLCFVLALYWLFRFRKGSIFSIFKRNN"
     gene            complement(<325007..>326467)
                     /locus_tag="DEHA2A03718g"
                     /db_xref="GeneID:2899786"
     mRNA            complement(<325007..>326467)
                     /locus_tag="DEHA2A03718g"
                     /product="DEHA2A03718p"
                     /transcript_id="XM_456504.2"
                     /db_xref="GeneID:2899786"
     CDS             complement(325007..326467)
                     /locus_tag="DEHA2A03718g"
                     /note="some similarities with uniprot|P20052 Saccharomyces
                     cerevisiae YOL001W PHO80 Cyclin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03718p"
                     /protein_id="XP_456504.2"
                     /db_xref="GeneID:2899786"
                     /db_xref="GOA:Q6BZ65"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ65"
                     /translation="MSLLQRVSPFSSPHDRGYLHRTTTTRSISLLSTPKRSPDITMGC
                     AEEENKMTEDQMMEEGAMGRVMPDSFLSQYMKQPQRKNSLSGHEIYFKSIDKHRTDKT
                     YDIYEKYLVKSKSGPARKNEDEAYEKLHQKRNVEEDIIPIIRKRRDEQRTKNKGNEEA
                     IRPAGTVTATESPADTNSYPETKLKQVTKKLAKEFMECTIDDLINLLSRMLRSLISLN
                     DKSVPASISNPQEKSSSSNSVLTRYHSRAPPGISIHTYLTRLTKFNNFTAATLLTTIY
                     YIDLLSHHYQPFFTLNSWTVHRFLLVATMLAQKSMEDFFYTNEHYAKVGGVAISELNC
                     LELDFLNRVDWRCVPAKQLENGKSSIKFAKDVLDLYYAQLIQLMGKNISPDDEVIYFA
                     NEDTSYYEAGEHDVVDDDVEKDDNIEEEDEDDDDDDDEDDDDDDDDDDNDHEAEYATS
                     NTNPSINHEKYDSMGFSVDNSSSPHLKRRFPVNFTD"
     gene            <327078..>328597
                     /locus_tag="DEHA2A03740g"
                     /db_xref="GeneID:2899837"
     mRNA            join(<327078..327125,327686..>328597)
                     /locus_tag="DEHA2A03740g"
                     /product="DEHA2A03740p"
                     /transcript_id="XM_456505.1"
                     /db_xref="GeneID:2899837"
     CDS             join(327078..327125,327686..328597)
                     /locus_tag="DEHA2A03740g"
                     /note="some similarities with uniprot|P43634 Saccharomyces
                     cerevisiae YLR098C CHA4 Zinc-finger protein with
                     Zn[2]-Cys[6] fungal-type binuclear cluster domain"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03740p"
                     /protein_id="XP_456505.2"
                     /db_xref="GeneID:2899837"
                     /db_xref="GOA:Q6BZ64"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ64"
                     /translation="MRSSLSKHFWVAVGRLLQIVSSKKDRVKFLMVIASNMIAAVNPD
                     LRRKNYSHTYVKSLEYRVAKLEQVLKKLQDCPLENHFPISNSLNLSDLVNKDEIYQTL
                     SEYNETSSSVDQSNSTDYGSLSGYDDMIIKTVSASYSESTNSLNDTIKLRKNSGIAVY
                     GSFHFYSHDSFLTKFFGVKYDNNTNPQTYTYFSEELVYSIVALSSKISSIQQVESESY
                     EYYNKARRLVFDKLNVPKITTIQTLLYLAFYDLGEGYNSSAWLLNVIAFRIGRHRISM
                     NPQNWHIKSKEILSAQDIEIRKPIYWGCYTADYLISLLLRRPF"
     gene            complement(327229..327310)
                     /locus_tag="DEHA2A03762r"
                     /db_xref="GeneID:8998073"
     tRNA            complement(327229..327310)
                     /locus_tag="DEHA2A03762r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (CAA) cove score=68.15"
                     /db_xref="GeneID:8998073"
     gene            <331322..>331432
                     /locus_tag="DEHA2A03784g"
                     /db_xref="GeneID:2899840"
     mRNA            <331322..>331432
                     /locus_tag="DEHA2A03784g"
                     /product="DEHA2A03784p"
                     /transcript_id="XM_456508.1"
                     /db_xref="GeneID:2899840"
     CDS             331322..331432
                     /locus_tag="DEHA2A03784g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03784p"
                     /protein_id="XP_456508.1"
                     /db_xref="GeneID:2899840"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ61"
                     /translation="MSSGQQGYEVSALCKINREMKKMHLGHPSHVLALMK"
     gene            <331502..>333376
                     /locus_tag="DEHA2A03806g"
                     /db_xref="GeneID:2899841"
     mRNA            <331502..>333376
                     /locus_tag="DEHA2A03806g"
                     /product="DEHA2A03806p"
                     /transcript_id="XM_456509.1"
                     /db_xref="GeneID:2899841"
     CDS             331502..333376
                     /locus_tag="DEHA2A03806g"
                     /note="weakly similar to uniprot|P39980 Saccharomyces
                     cerevisiae YEL065W SIT1 Ferrioxamine B transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A03806p"
                     /protein_id="XP_456509.2"
                     /db_xref="GeneID:2899841"
                     /db_xref="GOA:Q6BZ60"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ60"
                     /translation="MDNKSTKESELDFSLRSKELNSREASDISLNKGNGNSENSLDEV
                     KEHNKFVYSGAWNKKLLYVAYAVLIITAFVESFANNSTSSLDSYATSSFNEHALIATV
                     AVVYKITAICAYPILAKIADLLGRAEGFTLSMILYSLAYVLYASCQNVDTYVCAEIFF
                     AIGRNGYRIFQLIFIADTSSLINRGILSQLPNAIGAIPSLYAGSYVQDAFLEHSTWRW
                     GYGSFAIILAAFCFPLGGIMFYLDRRAKQNGQKKVYQILENIPKDAKWYEKAYQILFV
                     ELDLIGGVLLLCGFALFFVPFTVTGKSSSYKWHEPKLIVMLVIGFVIFCCFLVWNTKF
                     AKKPFVPTQALKSKTVVIIVVLVALDLCENSSFATYFKTVLQVAGYYSAGAATRIDNS
                     KKVTVDIFNVFGGLLMKYTKRSKIYALIGIPMLVLGHGLLVWFMRRGDGEMASYALLV
                     MAEVFIGFGRGMYQCALQVTIQAIAGIEGIAMSTAFFLAFQSIGSLIGSAISGGIWNT
                     VVLSKLNLYLPEDDKDLAKKIYKSITVAMSYEKGSDIRDGINRAYAETIQIIGWTGLG
                     IIAPMLILMFFIKEVKLSEAKDIYSVSISEEEIKIKEEKEIEIKEEKESLKKNTSRGQ
                     "
     repeat_region   333868..334322
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     mobile_element  334323..334456
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     mobile_element  334771..336721
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     repeat_region   336797..337253
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     mobile_element  337262..339886
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     repeat_region   340072..340359
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     repeat_region   340360..340647
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     mobile_element  340648..341262
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     gap             341622..341721
                     /note="gap of 100 nt"
                     /estimated_length=unknown
     mobile_element  342386..343748
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     repeat_region   complement(343744..344200)
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     mobile_element  345111..346473
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     repeat_region   complement(346469..346925)
                     /note="solo LTR of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     mobile_element  347836..350254
                     /note="relic of Debaryomyces hansenii Tdh5
                     retrotransposon"
                     /mobile_element_type="retrotransposon:Tdh5"
     gene            complement(<350648..>352978)
                     /locus_tag="DEHA2A04334g"
                     /db_xref="GeneID:2899845"
     mRNA            complement(<350648..>352978)
                     /locus_tag="DEHA2A04334g"
                     /product="exosome component 3'-5' exonuclease"
                     /transcript_id="XM_456510.1"
                     /db_xref="GeneID:2899845"
     CDS             complement(350648..352978)
                     /locus_tag="DEHA2A04334g"
                     /note="similar to uniprot|Q12149 Saccharomyces cerevisiae
                     YOR001W RRP6 Exonuclease component of the nuclear exosome"
                     /codon_start=1
                     /transl_table=12
                     /product="exosome component 3'-5' exonuclease"
                     /protein_id="XP_456510.2"
                     /db_xref="GeneID:2899845"
                     /db_xref="GOA:Q6BZ59"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ59"
                     /translation="MSDIPSVSTFDDILPNVVQTVRNSSSLAAQDINFYKSLDSDLSK
                     KIDESAKSLLDISNKLIHCSFDDVKDVPFGKDNISSHANWNPIANVLDNIFEKIDIAF
                     DQAQNANSRKANAEAKGFTYLEDSNTINDSSNKHQGKRMVKPQINFRNKVDNSETHPF
                     KPKISSKPNELKSFDESTKLIVPMKQEESNDIDPEYYVQPYEFEIDSQPYPDSILTKK
                     EPIPSKPWSKTSAIWVDSVDVLNEMISLLSEQSEIAIDLEHHDYRSYYGIVCLMQISS
                     RDQDWIIDTLKLRDDLESLNKVFTNPDIVKVFHGAFMDIIWLQRDLGLYIVSLFDTYH
                     ASKKLGFPKFSLAYLLETFANFKTSKKYQLADWRIRPLSPPMLAYARSDTHFLLNIYD
                     QLRNKLIDAGANRLQEVLYESRQVAKRRFEYTKFRPLSTSGGKVSCPVMANNPKEPFS
                     SILLQYNVPYHKKPLIEALYNWRDALAKRDDESVRYIMSNQLLVSLSSLSQPVDVQKV
                     LGVSNYISDYVRQNAKDLANLIENTLKSMADSDWELVDKWNDISKAADNDKMNISDDD
                     LDKIISRSKAFEDIYAHNKNVLFFDGTELLSNKSALFSELLNNNNDSFSVEYDVEKNK
                     VINHTSGDYKDRLDYASKNLQPNPIIISPEISHRNEQHDEPKKPYIDETHAGKSSTVL
                     KDEEMDPNEVITLRKTQKQKTPKAEIKQTAENDAFDYNNANKILLDSSIRNSSRKEKP
                     KKRSFDPYGKDAEGPKGAKKARRPNTGKTSTFSTKK"
     gene            <353154..>354371
                     /locus_tag="DEHA2A04356g"
                     /db_xref="GeneID:2899846"
     mRNA            <353154..>354371
                     /locus_tag="DEHA2A04356g"
                     /product="DEHA2A04356p"
                     /transcript_id="XM_456511.1"
                     /db_xref="GeneID:2899846"
     CDS             353154..354371
                     /locus_tag="DEHA2A04356g"
                     /note="similar to uniprot|P38344 Saccharomyces cerevisiae
                     YBR267W REI1 Protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04356p"
                     /protein_id="XP_456511.1"
                     /db_xref="GeneID:2899846"
                     /db_xref="GOA:Q6BZ58"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ58"
                     /translation="MQYTCNSCNLAFPAPEDQRVHMKSDWHRYNLKRRVAELPPIDEN
                     LFNSKVSSLSITENGADNNNEEKMKNKAQLTKKEIRRREKEVLQAKKKQILETAREAM
                     IAKMKEQNRDNDSPSESIQEDELISIRDMKLDDNNSDTKNESTPEQQEEHLMKEKLSN
                     SVEIPVTTCLFCHAKQKANFDDIESNIQHMFVMHGLYIPERKYLVDVEGLIKYLGEKI
                     GLGNICLCCSYQGKNIEAVREHMLNKRHMRLPYETEDEKLEVSEFYDFSSTYDDDAVD
                     NKPVNEEDWEDVSEDEEEADDYSDEELSPADSALYPNGHELVLPSGVVVGHRSLARYY
                     RQNLAPERVLSEGQGTVIAAETRHMLNIKDREVLATQKRAWGREKKREDVNDRRAAKF
                     VNNQPHYRDQLLQ"
     gene            complement(<354431..>357064)
                     /locus_tag="DEHA2A04378g"
                     /db_xref="GeneID:2899847"
     mRNA            complement(<354431..>357064)
                     /locus_tag="DEHA2A04378g"
                     /product="DEHA2A04378p"
                     /transcript_id="XM_456512.1"
                     /db_xref="GeneID:2899847"
     CDS             complement(354431..357064)
                     /locus_tag="DEHA2A04378g"
                     /note="similar to uniprot|P40367 Saccharomyces cerevisiae
                     YJL062W LAS21 Integral plasma membrane protein involved in
                     the synthesis of the glycosylphosphatidylinositol (GPI)
                     core structure"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04378p"
                     /protein_id="XP_456512.2"
                     /db_xref="GeneID:2899847"
                     /db_xref="GOA:Q6BZ57"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /translation="MGSSKWGVLFGLLILHVIGYSIFLKGFFPSKVVVPGFNEFHTGQ
                     SPFMEHNEAKFDKLILMVVDAMRSDFLYSDHSHMKFVHQLINENCALPFTSYSNPPTV
                     TLPRLKGITTGGTPSFLDAILNIADDKDNSQSLLNQDSWLHQFQNNSKVFNFFGDDTW
                     LKLFPPEKFFNQYEGTNSFFVNDFTDVDNNVTRHLNDDLFNSKWDALILHYLGLDHIG
                     HKGGPNSIFMRGKQEEMDGIIEKLYKETIDSNTLLVVMGDHGMNEIGNHGGSSMGETN
                     PGLLFASPKFKMLKKNLKSPLAYNNDYKYYNYINQIDLVPTLATLLNFPIPKNNLGIV
                     IKDILGLWKPEAQKSILMENSEQFMNIYEAKHANDTDIINEWKKSQDSGSIDVHYDFL
                     SKIQGLLTSAATEYKYVDIYIGLSILVAMAIVAFGLFNWYFLVQATINPKYNWYFIGI
                     SIVYSIHFHASSLIEEEYQIWWFFSIICLFALYFNNHLKSLKYFWLILVGLRIIRSWS
                     ITGQKFTTPYTFSAYLLQNVDLLWVLNIATYFLTAILIYSQGSLIHCVTLREYESLRE
                     NVKDFGSLVTFIVTFVTCSISFSFKLCQYFNDGKRVPDWLLAFLNWTCESYGITIDPK
                     EKNQLHELNIHLSKILFYCIGVLIIVRIVLGKIRKLHYGLLTDLSNVLTLFLLHQSRP
                     EIVPIFLIFSLVKFSAAKLLANNEIVLRKNIDQLMIIITLFSLCMQNLSFFSMGNTNS
                     LATVDLSNSYNGFKSYDVFLVGVLTYCSNFAGPIFWSLASLQLIFENNVVCFDTKKSS
                     KDLVNLKFLKYQILYVKSLAGFLFYSMAGLSLVASCFNLRFHLFIWSVFSPKLLFFAS
                     WTLLTNILIDTISSLSILALC"
     gene            <357485..>358992
                     /locus_tag="DEHA2A04400g"
                     /db_xref="GeneID:2899684"
     mRNA            join(<357485..357562,357613..>358992)
                     /locus_tag="DEHA2A04400g"
                     /product="DEHA2A04400p"
                     /transcript_id="XM_456513.1"
                     /db_xref="GeneID:2899684"
     CDS             join(357485..357562,357613..358992)
                     /locus_tag="DEHA2A04400g"
                     /note="similar to orf19.3405 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04400p"
                     /protein_id="XP_456513.2"
                     /db_xref="GeneID:2899684"
                     /db_xref="GOA:Q6BZ56"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ56"
                     /translation="MSVTSKANMITRSRKGCLSCKKLKIKCNEAKPSCEYCESTKRQC
                     QYPDMEIMQTNFGVDSRRTRRRRNDDKNLMREMRLNATTKLLQINLLELQLLKFFHEQ
                     CTQFFSFCGVDKNIEYVWSHSVPTIFSQSSLVRNAIYSFSALTLWPFYNIDESLCLDK
                     ISKLLKYDEAVLSGQNGIASGIINKGISVDVTDSLTQASLFEVTTEYFISTLRENQLA
                     ITRHYEGPDIELRTFGSINEAAELTITSILIFSYMCLHPDGVLPIVVFNDDTQVDFIS
                     LSKNIGSIMASARGTLVDTKFGGLFARHSKYRNTNVPRDRYRITRILFDKLDEYFYDV
                     SHTVEIDSISALEYETLKVTIDALNNCLYQADVCNFPIAMFSWILFVSDQYYGLVKNK
                     QPFATKILFVYACLNLIFDFAFIRSRSSFTKFAHWYKEHMDPDEFDQNLYHVAIDHEH
                     QFTVDNFSTIRDFDPVSFSDNLDNVLNKDDIYEWL"
     gene            <359862..>361586
                     /locus_tag="DEHA2A04422g"
                     /db_xref="GeneID:2899685"
     mRNA            <359862..>361586
                     /locus_tag="DEHA2A04422g"
                     /product="DEHA2A04422p"
                     /transcript_id="XM_456514.1"
                     /db_xref="GeneID:2899685"
     CDS             359862..361586
                     /locus_tag="DEHA2A04422g"
                     /note="similar to uniprot|O74248 Candida albicans GPT1
                     Putative polyamine transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04422p"
                     /protein_id="XP_456514.2"
                     /db_xref="GeneID:2899685"
                     /db_xref="GOA:Q6BZ55"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ55"
                     /translation="MGENFKSSNKIHPVVSNILVDDLHITSILSNQNITINVDHEIDK
                     DEALILALGYKQEFKREFSLWTLFAVSFSVLGLLPSIAACFDYQQLVVGMSPVPWILA
                     IIFISSVALSMAEVASAFPTSSGTPYAVSQLAPPRWAPVLTWLTCCSNWLCQITAAPS
                     VNNSCAWLILALKTYNSNDGYSPSYGEVYGLTTGIQIVHGIISSMPTRWLATFNSMGT
                     ITNILFLVIVFVMILGGNDRQDHFNDITKFNSNDTAWKFYNQTDWPMGIAVLQSFLGV
                     IWAMSGYDSPFHLSEECSNANVAAPRAIILTATCGGGIGFLFMIAIAYTLVSIDQIAE
                     DPQGLGQPFVTYLTQILSKKAVNAATALTIISSFFMGCSCMLAASRVTYAYARDGFFP
                     LSRYWKIVNKKTQTPINAVWVNLFIGQLLLLLQFAGDTAIGAIFSVGGISGFVSFTMP
                     TLLKITYANKSFKRGPWHLGRWSRPIGFVSVAFVTVMIPILCFPTVRGDDLTLDQMNW
                     TVIVYFGPMLLSLLWFVIDAHKWYKGPRPNINDEDIVYGNSTIIDGYDNEKRNHNEVI
                     SSKDNDFI"
     gene            complement(<362507..>362977)
                     /locus_tag="DEHA2A04444g"
                     /db_xref="GeneID:2899679"
     mRNA            complement(<362507..>362977)
                     /locus_tag="DEHA2A04444g"
                     /product="DEHA2A04444p"
                     /transcript_id="XM_456515.1"
                     /db_xref="GeneID:2899679"
     CDS             complement(362507..362977)
                     /locus_tag="DEHA2A04444g"
                     /note="similar to CA0973|IPF12662 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04444p"
                     /protein_id="XP_456515.1"
                     /db_xref="GeneID:2899679"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ54"
                     /translation="MYVKEINEEINKRLYYPNRYGNNGSTGWGSYKWLLWLLILIPLL
                     IVVVLFCLRKRKNKGKVHVMDNNQYYQTQQAGGYYNQGQGYPNQQDNQYPPANPDAGG
                     YGGYNQQQGYTEQPGYNGQPGYSEQPGYNGSKVDDINPDEFQRPDGPPPAHYKS"
     gene            <363218..>365494
                     /locus_tag="DEHA2A04466g"
                     /db_xref="GeneID:2899680"
     mRNA            <363218..>365494
                     /locus_tag="DEHA2A04466g"
                     /product="DEHA2A04466p"
                     /transcript_id="XM_456516.1"
                     /db_xref="GeneID:2899680"
     CDS             363218..365494
                     /locus_tag="DEHA2A04466g"
                     /note="some similarities with CA2446|IPF2582 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04466p"
                     /protein_id="XP_456516.2"
                     /db_xref="GeneID:2899680"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ53"
                     /translation="MSFHLVPPPESKLKKNSKKNSNEKIPKKTIIPTNLKIHGNPRPQ
                     LRTSKSSNSSVSSYSDYTPESKNKNAEVNADELSKSLLGLKKSTSSLSLSRMQKKNKN
                     NESQGSHTPVSPRTSGRSKAQSTGAHSNGRSSPMSNRSNSSTLSNLKARRSRSASPSV
                     SQSSSKHQPNVNAANANYMDLDYISRKLDNSDLQRNVSHGRNIIENNNKKKIDAIDFK
                     PIIDLSIVNSYETMKEHMYFPTFQVLKYRNFLNILRDHHQNDPISFASVRNHSLINFI
                     ASYKVGQRIPENVDIKQHDLRFYETLLGTELLRSRTIFRQLIRRDSAKIKNKSMIINC
                     EELVQLNLSNYVRFVFNMPDEIPVPLEQLDSIQRTHYKYKELFKKIGHVLYLMNREVG
                     GDENPESGKTYILQTIRKVSYEYILLEKYLFHIFSKLGDNSLIHSRNLKVLFDKFNNR
                     MQSNNNESIKVLHYNAYFSSQYSWYLSITAPFIRVFEMNSYSEDFELVNNHGNYYRNL
                     NDTKKISFKDSDVDLYDKYFKKLGLDDYLKYRSLTPEKLVALHESIDKSSQKLNNSKK
                     IETDDGLSSTSHKPMNFEYYTESLATISSETFHLIQSRDLALQLTPKNYSVILTEFYR
                     ILQKDGVLEVPFIQLSRNKIMESFSQQHDFSKDEGFMNLNLLEHFNMIPDFLQAILKE
                     LSNIFGEGNVKYHVSLLNSIGELNCFLAKHICFQLFEMFGRLDEYSAKFTNVDDTNSR
                     DINEDGMYYYIYIRAHKK"
     gene            <365665..>367437
                     /locus_tag="DEHA2A04488g"
                     /db_xref="GeneID:2899745"
     mRNA            <365665..>367437
                     /locus_tag="DEHA2A04488g"
                     /product="DEHA2A04488p"
                     /transcript_id="XM_456517.1"
                     /db_xref="GeneID:2899745"
     CDS             365665..367437
                     /locus_tag="DEHA2A04488g"
                     /note="similar to uniprot|P33734 Saccharomyces cerevisiae
                     YBR248C HIS7 Imidazole glycerol phosphate synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04488p"
                     /protein_id="XP_456517.2"
                     /db_xref="GeneID:2899745"
                     /db_xref="GOA:Q6BZ52"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014640"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ52"
                     /translation="MKTVYVIDVESGNLQSLFNAIKRIGGYDVKFIHDAKEFADYNDS
                     IEKLIFPGVGNYAHFIKQLHDRELVDPITKYIESGRALMGICVGLQAFFESSEESDNS
                     EYQGLGYLKFGLSKFNKSDPVFTQRKQLKAVPHIGWNSVNTIKANNTTLSKTTSFFGI
                     NTVNKYYFVHSYAAILKDEQQEKVISEAISNGWDIAFARYGSEIFLAAVSYKNFFATQ
                     FHPEKSGVAGLKVIKSFLEGSRFSEVTTSDAQPVDNIENTLSGLTRRIIACLDVRSND
                     DGDLVVTKGDQYNVRESSGDSDESKVRNLGKPVELATRYYNQGADEVTFLNITSFRNS
                     PLKDLPMLKVLSTAAETIFVPLTVGGGIKDLVDPISGEKVPAAKVASLYFRSGADKVS
                     IGSDAVTIAENYYANNKHKTGTTSIETISATFGSQAVVISVDPKRKYVSSPSETTMET
                     IHIQDPSKYGPAGEKYCYYQVTSQGGRVTHELGALELCLACEDLGAGEILLNSIDHDG
                     SNKGFNLELLRQVKEKASIPVIASSGAGKPEHFQEVFDMDCGIDAALGAGLFHRGEYE
                     VNDVKRYLQKECSMDVRLDDTVEL"
     gene            <367586..>370390
                     /locus_tag="DEHA2A04510g"
                     /db_xref="GeneID:2899746"
     mRNA            <367586..>370390
                     /locus_tag="DEHA2A04510g"
                     /product="DEHA2A04510p"
                     /transcript_id="XM_456518.1"
                     /db_xref="GeneID:2899746"
     CDS             367586..370390
                     /locus_tag="DEHA2A04510g"
                     /note="similar to uniprot|P32383 Saccharomyces cerevisiae
                     YPL268W PLC1 Phosphoinositide-specific phospholipase C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04510p"
                     /protein_id="XP_456518.2"
                     /db_xref="GeneID:2899746"
                     /db_xref="GOA:Q6BZ51"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ51"
                     /translation="MLSSKNDHSVDENSDLLELSDSISPSDISNHSFYGNFKRSSSLP
                     IQSNLPTLFNNLRANDRKESSNSGTSPGRSWLRKLMSPSNKLNDLGSMENTKPGWAGK
                     NANSKSLGDNTNSEEDSYDISLDNERETSAYPFKDIDQVKIPPVFFKEGLSLLKVSHK
                     SKKRTFFQIGEKDFQFSLKNAYASASTTASSGLYRLLTPTSSYQPKNKSYEFSIDDIK
                     AISYQKDASNYRKELHVSKEFESQWLTIIYFDKKKKKLKTIHVIADTEHDLKKLLSVL
                     SGLKKLRNNLAKNYLLDLNDIDETQRNMFIGRSQEENEKEIRKFLSFNDILKYSKRLN
                     INMNPTYLRTIFNFVCADSSVDRGLDFDQFKQFVSILKTRHDITHIWNSTCGENKSMT
                     FDIFKNFMTDVQKESFTEEYLRKIFRKFCIEDKNYWIPENFNNFLLSKYSTSMYNAAT
                     NESYFDHPLNEYFISSSHNTYLMGRQVAGDSSIEGYIKALQRGCRCVEVDIWDGYIDG
                     MDDNDKTNNEPIVSHGRTFTSSISLNNVFKTIKKYAFITSPFPLIISLEINCSIDNQL
                     KVVRTLKEVLGDTLITQPIDDKFTLPTPLQLKHKILLKVKKTSPFSDLIASENGNYVS
                     STTTTTTSFSEDNGSGGVKRRSSFSIRRRKARKITDTLSDLGIYLQGVKFRNFSLPES
                     KTFNHCFSLSEKSINTMLKDDIKCTSIDKHNRKYFMRVYPSNIRLKSSNFLPMKYWSH
                     GVQMVATNWQTYDLGQQINESLFESTNRRGYVLKPEDLRKPLLKSSNRSIVAKRTIKT
                     KFDIEIISAHQLPKPKGSVSAINPFINFDITGASDIVWDRGSAPLRTSIIPENGFNPI
                     WNEKFSGTITTFDDFVFVRFLINASSSISEVEEIQPIGILVCKLFDLKKGYRYLPIND
                     LLGEELIYSTLFVKINYYEL"
     gene            <370571..>371926
                     /locus_tag="DEHA2A04532g"
                     /db_xref="GeneID:2899747"
     mRNA            <370571..>371926
                     /locus_tag="DEHA2A04532g"
                     /product="DEHA2A04532p"
                     /transcript_id="XM_456519.1"
                     /db_xref="GeneID:2899747"
     CDS             370571..371926
                     /locus_tag="DEHA2A04532g"
                     /note="similar to uniprot|P38333 Saccharomyces cerevisiae
                     YBR247C ENP1 Protein associated with U3 and U14 snoRNAs"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04532p"
                     /protein_id="XP_456519.1"
                     /db_xref="GeneID:2899747"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ50"
                     /translation="MGKITVSETKGKVRHNPLYKDIESQGGNLKSAPTSSRSNQKNTE
                     KNEEHFLDAAASRRILQLAKEQQEELEDEENAGKTRPSFLDTYRSQKDEEDEEEDEEE
                     EEEYSEFEEDEIAEEEIEVDEKDAALFEKYFASNGPGNGSINLADKIMAKIQEKETIK
                     ENNSRPVDAVLLPPKVISAYEKIGQILSTYTHGKLPKLFKVLPSLRNWEDVLFVTNPE
                     KWTPHAVYEATKLFVSNLQANEAQKFVEMVLLERFRTSIEDSEDHSLNYHIYRALKKS
                     LYKPGAFFKGFLFPLVDSHCSVREATIAASVLAKISVPVLHSSVALTQLVQRDFKPST
                     TVFIRVLIEKKYALPYQTLDELVFYFMRFRKAAQANDSMIDEEKEEPQLPVVWHKAFL
                     SFAQRYKNDITDDQRDFLLETVRQRFHHAIGLEIRRELLAGKPRTPPQPVKEAIMIDA
                     F"
     gene            complement(<372031..>373809)
                     /locus_tag="DEHA2A04554g"
                     /db_xref="GeneID:2899748"
     mRNA            complement(<372031..>373809)
                     /locus_tag="DEHA2A04554g"
                     /product="DEHA2A04554p"
                     /transcript_id="XM_456520.1"
                     /db_xref="GeneID:2899748"
     CDS             complement(372031..373809)
                     /locus_tag="DEHA2A04554g"
                     /note="highly similar to CA4294|CaERC1 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04554p"
                     /protein_id="XP_456520.2"
                     /db_xref="GeneID:2899748"
                     /db_xref="GOA:Q6BZ49"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ49"
                     /translation="MSFNERTHQFTHSNSQRRASVVYGSIGKGGLFTPSDFIRPHGDN
                     AGISFDDDQGVAPHTPDESSQLLDRPAVLSSRKNRRQSSVTREIVEQERSFLRDSNIK
                     VPSKGSEDDVIDTFEEAIISKKLSTTTASIELKSLVISSIPLIVTFLLQNSLSTVSVF
                     TVGHLGAVELAAVSMGSMTANITGYATIQGIATALDTLCPQAFGAKKYSLVGVYLQKC
                     TALIFTVMAPVLVIWLFFGYGLITLILPDKETAKYAAVYLQYIAPGIPAYILFECGKR
                     FLQAQGIYHISTVVLLFAAPSNLLMNWLFVKHLGYIGAPIAVAINYWLMAIGLFVAVV
                     YFVKPESTPTGLHPLVCWSGLNIRDSFRAWDKLIYLAIPGLIMLEAEFLAFEILTLLA
                     SYLGTVALAAQSIGTTMASLTYQVPFAIGIASSTRIANFLGAGLSSPAKTATRVSLCF
                     GLVISTFNFLVLFCFQTQIAELFTNDKKVIKTVEGVMWLIALMQISDAMNANSAGCLR
                     GQGQTKIGGIVNLVSYYVVGLPLSIYLTFYSNFGGTLHGLWIGSTVALTIIGVVQSYY
                     SLFADFDKLCAEARERTSDEGPGFAV"
     gene            complement(<374040..>374978)
                     /locus_tag="DEHA2A04576g"
                     /db_xref="GeneID:2899749"
     mRNA            complement(<374040..>374978)
                     /locus_tag="DEHA2A04576g"
                     /product="DEHA2A04576p"
                     /transcript_id="XM_456521.1"
                     /db_xref="GeneID:2899749"
     CDS             complement(374040..374978)
                     /locus_tag="DEHA2A04576g"
                     /note="similar to uniprot|P53829 Saccharomyces cerevisiae
                     YNL288W CAF40 Evolutionarily conserved subunit of the
                     CCR4-NOT complex involved in controlling mRNA initiation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04576p"
                     /protein_id="XP_456521.1"
                     /db_xref="GeneID:2899749"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ48"
                     /translation="MYSAAAQPQSQASIPQGHQSDGNIASKNKALNDEQIYQWISELV
                     TGTNRERALLELGKKREQYDDLALVLWNSFGVMTVLLEEIISVYPFLNPPILTASVSN
                     RVCNALALLQCVASNVQTRGLFLSANLPLYLYPFLSTNARQRSFEYLRLTSLGVIGAL
                     VKNDTPEVINFLLTTEIVPLCLNIMEISSELSKTVAIFILQKILLDDQGLSYICTTYE
                     RFHTVASVLSKMIDQLSATTNTQTPQQPSNSSGRLLKHVVRCYMRLSDNLEARKALAN
                     ILPEPLRDGTFSLILQDDVATKRCLAQLLSNINDQQ"
     gene            complement(375126..375199)
                     /locus_tag="DEHA2A04598r"
                     /db_xref="GeneID:8998094"
     tRNA            complement(375126..375199)
                     /locus_tag="DEHA2A04598r"
                     /product="tRNA-Asn"
                     /note="tRNA Asn (GTT) cove score=74.40"
                     /db_xref="GeneID:8998094"
     gene            complement(<375374..>376870)
                     /locus_tag="DEHA2A04620g"
                     /db_xref="GeneID:2899751"
     mRNA            complement(<375374..>376870)
                     /locus_tag="DEHA2A04620g"
                     /product="DEHA2A04620p"
                     /transcript_id="XM_456522.1"
                     /db_xref="GeneID:2899751"
     CDS             complement(375374..376870)
                     /locus_tag="DEHA2A04620g"
                     /note="similar to uniprot|P21827 Saccharomyces cerevisiae
                     YGL097W SRM1 Nucleotide exchange factor for Gsp1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04620p"
                     /protein_id="XP_456522.2"
                     /db_xref="GeneID:2899751"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ47"
                     /translation="MVALERKRKISGSEQPNGTKKFKSATSSFVLHSYSKLPDLNSIP
                     LAKTQPLDVFVWGTGSMCELGLGPSAKTKEVKRPRLNPFLTSEHLGDSKIVDFAAGGM
                     HTLALDSDNRVWSWGGNDSGVLGRDTSKVKEVLKDMDADDSEDDDDGDLNEAESTPGL
                     VENLPKLKGAKIVQLAATDNLSAVLYDNGDVYAWGCFRCNEGLLGFLRDEIKLQKTPL
                     KIKQLKNVVQLARGKDHLLALDSKGIVYAWGNGQQFQLGRRVLERHRYNGLEPKQFGL
                     YNIKYIASGDFHCFAIDHDDQVYAWGLNQFGQCALTDSDGKLEDGSLITSPTIIPELS
                     KKGITHLCAGEHHSMALTGDGSVLSWGRYDMKEVGIPKDKLPESTFKDAHGNARSVPT
                     PTKLQFGLKSDNGVKCKTIACGSHHSFAVTDDGFVYAWGFGDTYAPGLGPLEEDVEKP
                     TRIVNTATKYHDIQQINAGGQFSISGGVKIDDEDKAEDRIEKYEEIDG"
     gene            complement(<377160..>380198)
                     /locus_tag="DEHA2A04642g"
                     /db_xref="GeneID:2899755"
     mRNA            complement(<377160..>380198)
                     /locus_tag="DEHA2A04642g"
                     /product="DEHA2A04642p"
                     /transcript_id="XM_456523.1"
                     /db_xref="GeneID:2899755"
     CDS             complement(377160..380198)
                     /locus_tag="DEHA2A04642g"
                     /note="similar to uniprot|P14180 Saccharomyces cerevisiae
                     YBR038W CHS2 Chitin synthase II"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04642p"
                     /protein_id="XP_456523.2"
                     /db_xref="GeneID:2899755"
                     /db_xref="GOA:Q6BZ46"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ46"
                     /translation="MSNPFDEDEGPFADPQHPSLPHAAFTSDRSSPRRYNRIEDDDDD
                     EASEELMMFPQSTQQSPYRQSPNIFARSVASANRNQGNPLGNAPNLQFGEGTTPRSQF
                     TSRESPKRQRKAEVFIDSDDDEREVADPFSGSPRRSQFGKSVNSSARSERFLEPPQPI
                     FSPETFAEANPHDEDQETITDDKSRNSYDYDSYQKAHELEQRSLYSDSTAYSGPSYTS
                     GEAEESEYFGASIDGEMMHNIDNGYVPTGDKTVTRRKVRLVGGKTGNLVLENPIPNEL
                     KKVLTRTESPFGEFTNMTYTACTSEPDEFVSDGFTIRAAKYGRETEIVICITMYNEDE
                     FSFSRTMHGVMKNVAHLCSRHKSSVWGKDGWKKIQVIIVADGRNKVNSSVLQLLTATG
                     CYQENLARPYVNNKKVNAHLFEYTTQISIDENLKFKGDEKCLAPVQVMFCLKEKNQKK
                     INSHRWLFNAFCPVLDPNVVILLDVGTKPDSRAVYNLWKAFDRDSNVAGAAGEIKAIK
                     GKGWINLTNPLVASQNFEYKMSNILDKPLESLFGYISVLPGALSAYRYIALKNHEDGT
                     GPLASYFKGDDLLNELNDSKKNSKTNFFEANMYLAEDRILCWELVSKRNENWVLKFVK
                     SATGETDVPESIPEFLSQRRRWINGAFFAALYALRHFNSIWLTDHSFSRKFFLHVEFI
                     YQFVSLLFSFFSLSNFYLTFYFLTGSLVDNKNIGNNGGFWIFTLFNYLCICCLTSLFI
                     VSIGNRPQASRRIFKTLVILLTVCALYALIVGFYFVFSTIESYGMGDSSTYVFISIVV
                     SLLSTYGLYTLMSILYLDPWHMLTCSVQYFLMIPSYTCTLQIFAFCNTHDVSWGTKGD
                     NNPQEDKDNQYIIHKNEKGEFEAVVVDVNIEEVYLETLYNIRARRSNKKVLTARPPPP
                     QLEGEDYAKDVRSRVVLIWLLVNLIFIMTMLQVYEPGATDKNIYLAFILWTVAALAFF
                     RAVGSFGYLIQQSARFMVETKSKWSHKREGYAAPNTNALN"
     gene            <380946..>382949
                     /locus_tag="DEHA2A04664g"
                     /db_xref="GeneID:2899811"
     mRNA            <380946..>382949
                     /locus_tag="DEHA2A04664g"
                     /product="DEHA2A04664p"
                     /transcript_id="XM_456524.1"
                     /db_xref="GeneID:2899811"
     CDS             380946..382949
                     /locus_tag="DEHA2A04664g"
                     /note="similar to CA1833|IPF14094.repeat5 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04664p"
                     /protein_id="XP_456524.2"
                     /db_xref="GeneID:2899811"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ45"
                     /translation="MEGNNSNTPFYSHGNNSTSSTLQFTTGTNTTSQISSVGFNNLKK
                     VGTNSSQASTSSTITNRNNPITRLFTKNRSNSTVNPQVIQFDDGMNDHNNSDEDDTST
                     ASTTDPRKPSGSGMFKFSKKNKLKFSSKNGASKPDLTIQTGGHLGLRVPKKILSSSSL
                     DDSSSPTGHGLKVPKKILNPSHMDESPNMNSKRKNSVTSPASTFHNFFHRSHNNSQPS
                     KDLQHVISKDDLISSQQTINNNPNRTAMSLSSNNSNSFITDINFALVYNFTDPDYSVE
                     EYVNSNEHTSFLDIHKKLMVPTDQYLSNKLHKYQTQEVGLGIISDTDGDSEYLSKYLL
                     DFGKNNVAFFNNLISIMKPLFQPSQQKRLSNKIFHPYLGMTLEDVSNYIKDNYLGESS
                     NTPSTESHFLERTPGSKLSKSKSKTKFYTSSSTSTLSLGENFNDILDDFKIREISQDL
                     LTFFIKCMITFDKDFTIYESKTKNRIPVQKAKNNPSPLSIASISEWNRIGEQWSYFNE
                     RIRYYVMGIFHPLQKYLHDIAIQKFNNDPKSVVEVEIENIFLLAFRDVIIIPFLISRN
                     QEYHRLPSSSQKVISEANNIDSPSPIPSYTFSLETVDDTEEILKLQEEQTLKANTKLL
                     KNLVNCFGVLLAHTHDEIGNADGEQHIRNNIFSETFTWLSKLT"
     gene            <383107..>383786
                     /locus_tag="DEHA2A04686g"
                     /db_xref="GeneID:2899812"
     mRNA            join(<383107..383226,383286..>383786)
                     /locus_tag="DEHA2A04686g"
                     /product="DEHA2A04686p"
                     /transcript_id="XM_456525.2"
                     /db_xref="GeneID:2899812"
     CDS             join(383107..383226,383286..383786)
                     /locus_tag="DEHA2A04686g"
                     /note="similar to uniprot|P40359 Saccharomyces cerevisiae
                     YJL072C PSF2 Subunit of the GINS complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04686p"
                     /protein_id="XP_456525.2"
                     /db_xref="GeneID:2899812"
                     /db_xref="GOA:Q6BZ44"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /translation="MVLPAHLQNSLMPSEVSFLAENEYITILPRYSMKKLELIGTKVP
                     TLRGMRREKIPIWIAVILKSQDKCNIVPPEWLNLIYLKEKYEEELKQPHKFSVLPWNW
                     LEISKILLNKAADDLSDPTHQLRSIIQDLREIRLVKSRKGLKELNESNIQLDGLSLLE
                     INELRPFVLTVMNKLRQLHESVNTKTDRGTGNDQDDDMYHDVSDNE"
     gene            <383931..>385658
                     /locus_tag="DEHA2A04708g"
                     /db_xref="GeneID:2899813"
     mRNA            <383931..>385658
                     /locus_tag="DEHA2A04708g"
                     /product="DEHA2A04708p"
                     /transcript_id="XM_456526.1"
                     /db_xref="GeneID:2899813"
     CDS             383931..385658
                     /locus_tag="DEHA2A04708g"
                     /note="similar to uniprot|P40360 Saccharomyces cerevisiae
                     YJL071W ARG2 Acetylglutamate synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04708p"
                     /protein_id="XP_456526.2"
                     /db_xref="GeneID:2899813"
                     /db_xref="GOA:Q6BZ43"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /translation="MSKLRNLNRQFISNLKTHETVTNAKRNLILSILKSTTTKREARN
                     YLNKYQNQFDFSDITFNNGVPSNSLEKRDSQRELFINRFLNKQNPFTNIYDDETKLQK
                     IPLRLALFKIKFQSISLENWKGMAETFKRLIHLGISPIIMLDYDHLPANTFRNNELYM
                     LNQTNKIMNILGKPTEENDLKTIIMRSLFTKKTINDKDLAIDNLESVLIPLYQGVIPI
                     IQPIVYNASTCMQEFIDSNDLLFSLCSSLLTTKNVLSIEKVVMIDPIGGIPSIERNQT
                     SHVFINLSQEYSDIVSELYIGFIKPEYRIFHMNNLKAMNKTLTLVSDKTGNDETTGII
                     TTPDIMSVNNDQLNPIIYNVLTDRSIISSSLPTSHNRTPELSTSILKKGVDVNILDAL
                     NYPKAFTLNNLVQDGSVNKSKLVDLIDDSFGKKLDTEKYFDRINDSLATVVIVGDYDG
                     AAIITWETCSKTNEKIAYLDKFAIASVNQGLPGLADIIFKIILQSHPNELIWRSRKNN
                     PVNKWYFERCCGTLSNPGSQWKIFYTGDIFNKKIDKLKKQGIPGGVNIHGKMHQYSDI
                     TENIPPSFL"
     gene            <385678..>386706
                     /locus_tag="DEHA2A04730g"
                     /db_xref="GeneID:2899814"
     mRNA            <385678..>386706
                     /locus_tag="DEHA2A04730g"
                     /product="DEHA2A04730p"
                     /transcript_id="XM_456527.2"
                     /db_xref="GeneID:2899814"
     CDS             385678..386706
                     /locus_tag="DEHA2A04730g"
                     /note="similar to uniprot|Q03419 Saccharomyces cerevisiae
                     YDR492w or uniprot|Q12442 Saccharomyces cerevisiae
                     YOL002C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04730p"
                     /protein_id="XP_456527.2"
                     /db_xref="GeneID:2899814"
                     /db_xref="GOA:Q6BZ42"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ42"
                     /translation="MNADSNFIIFCNCFLLRSPIMTSILRQRGSCTDVRSSGDATPIE
                     TIPRLHYYHEIDEWQQDNHFIRSGYVKETSSFSNCFNSLFYLHNESINIHTHLLPSFF
                     AFSVIIYYVNYELPIYDNYLGVWEKLNFLQFGMAVTACLLISSTYHCVKSHSDTVSKL
                     GNKFDYFGIVILITCSLNSIVLFSFYDEPFWKFTFIIIFLGLATTCTVLTLDPRFATN
                     VYRPLRSLMFILFGLSGILPLIAAVKLYGYSAAVERSCAGWLVLEGISYISGAVLYAM
                     RVPERFTHVDEDETSLLDKPLSGKFDIFGHSHQIFHVMVLVGAFCHWMSLVGCYHYLH
                     EVILPNAI"
     gene            <386760..>387533
                     /locus_tag="DEHA2A04752g"
                     /db_xref="GeneID:2899815"
     mRNA            <386760..>387533
                     /locus_tag="DEHA2A04752g"
                     /product="DEHA2A04752p"
                     /transcript_id="XM_456528.1"
                     /db_xref="GeneID:2899815"
     CDS             386760..387533
                     /locus_tag="DEHA2A04752g"
                     /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
                     YOR238w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04752p"
                     /protein_id="XP_456528.2"
                     /db_xref="GeneID:2899815"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ41"
                     /translation="MSRHLIILPCHSIWTPGATLGESRDEWSLVSFQIEGYDHLCFKD
                     HILKSLNILEQDKDATLIISGGQTKQESGPISEALSYYQLATKLTNDIELVQRINTEE
                     FARDSFENVLFSLCRYFELHEAYPEKITIVGFEFKRQRFLENHLKQALSFSRNVNYVG
                     NAPTPKDLDEEGQINYFQDLEQQEYKHAVSHFEKDWYSIRSPLLDKKMKRDPFSRYHG
                     YCQSNPKLAKFLVAISDQENQEENLRSNESIQSLLTDFT"
     gene            complement(<387565..>388671)
                     /locus_tag="DEHA2A04774g"
                     /db_xref="GeneID:2899816"
     mRNA            complement(<387565..>388671)
                     /locus_tag="DEHA2A04774g"
                     /product="DEHA2A04774p"
                     /transcript_id="XM_456529.1"
                     /db_xref="GeneID:2899816"
     CDS             complement(387565..388671)
                     /locus_tag="DEHA2A04774g"
                     /note="similar to uniprot|P32449 Saccharomyces cerevisiae
                     YBR249c ARO4"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04774p"
                     /protein_id="XP_456529.1"
                     /db_xref="GeneID:2899816"
                     /db_xref="GOA:Q6BZ40"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ40"
                     /translation="MSKTPIPDEYDDTRILGYDPLIPPALLQHEIRASKESLDVVIRG
                     RIESSEIISGKDDRCLVIVGPCSIHDTEAALEYATRLKKLSLELENDLVIVMRAYLEK
                     PRTTVGWKGLINDPDVDNSFDINRGLRISRQLYSDLTGKTGLPIGSEMLDTISPQYFS
                     DFLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGNLGVALDAVQASSKGHHFMGV
                     TKNGTAAITTTKGNENCFIILRGGKKITNYDPESVAAAKEAINKSTDPNIKLMVDCSH
                     DNSQKDYRNQPKVMESVVDQISKGENALIGVMIESHINEGKQSMPGPKEDKSALKYGV
                     SITDGCVGWETTVELLHNLSKAVQERRQINKSKA"
     gene            <389247..>390491
                     /locus_tag="DEHA2A04796g"
                     /db_xref="GeneID:2899817"
     mRNA            <389247..>390491
                     /locus_tag="DEHA2A04796g"
                     /product="DEHA2A04796p"
                     /transcript_id="XM_456530.1"
                     /db_xref="GeneID:2899817"
     CDS             389247..390491
                     /locus_tag="DEHA2A04796g"
                     /note="similar to uniprot|P47040 Saccharomyces cerevisiae
                     YJL059w YHC3 basic amino acid transporter activity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04796p"
                     /protein_id="XP_456530.2"
                     /db_xref="GeneID:2899817"
                     /db_xref="GOA:Q6BZ39"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /translation="MQLLIPESRIVFASFFIFGLLNNILYVVILSAAIDLVGSATPKA
                     TVLLADIIPSFTIKVMAPFFVGLISYRTRIWMLVGLSSFGMLVISLTSDESINAKIVG
                     ICMASLSSGLGEVTFLQLTHFYQREYSISGFSSGTGGAGLLGSFVFMLLTNMLGMKVW
                     VVLLLFAVLPLGFLMAFYVMLPKARGGGGDEPGYEALDSLDERSDPSSNASFSSSQTV
                     SLKGHVVSTIKNILPLIRPYMLPLCLVYVSEYIINQGISPTLLFPLDELPHWLFSSYR
                     DIYVVYGFMYQLGVFVSRSSISFGIRIKRLYLLSVLQFANVVITVYQSVHDKPFSSVW
                     LLLALIFYEGLLGGFSYVNTFMSVSEEVSKSKREFSMGCVGISDTFGILLAGCINWSL
                     EPHLCSLQVNRGRDWCLNGGSA"
     gene            <390629..>391990
                     /locus_tag="DEHA2A04818g"
                     /db_xref="GeneID:2899818"
     mRNA            <390629..>391990
                     /locus_tag="DEHA2A04818g"
                     /product="DEHA2A04818p"
                     /transcript_id="XM_456531.1"
                     /db_xref="GeneID:2899818"
     CDS             390629..391990
                     /locus_tag="DEHA2A04818g"
                     /note="similar to uniprot|P47039 Saccharomyces cerevisiae
                     YJL060W BNA3 Arylformamidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04818p"
                     /protein_id="XP_456531.2"
                     /db_xref="GeneID:2899818"
                     /db_xref="GOA:Q6BZ38"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ38"
                     /translation="MFVRLLKSNRKFNIRTKTTMSNFDPATLHNPYFNQKSGQKDIWT
                     LINETAAEAQKESGKSIVNLGQGFFSYNPPDFAIEAVNKATSQPQFNQYASARGNPNL
                     LNELSSLYTKEFNRKVGTDEIQITTGANEGMFSIFFGYLTPGDEVIVFQPFFDQYIPN
                     IEMCGGKVKYVQLKFPEKFNGESVSGDDWEVDWEGLTNAITDKTKLIVINTPHNPIGK
                     VFTEEELYKIGKIAIGNNLILVSDEVYENLYYSKSFTRPATLSSLPELAERTLTIGSA
                     GKSFAATGWRVGWVHGPASLIKYVTAAHTRICFSTPAPLQQAVADGLKQAASNKYFEI
                     TRQEYVKKYELFTKVFDELNLPYTSAQGGYFLLVNLSKVKIPNDFEYPADISDKGTND
                     FKLAYWLIKEIGVVGIPPTEFLYPADRQGNGLENCLRFAVCKDNSILEEAVEKLRLLK
                     EYL"
     gene            complement(<392025..>393245)
                     /locus_tag="DEHA2A04840g"
                     /db_xref="GeneID:2899796"
     mRNA            complement(<392025..>393245)
                     /locus_tag="DEHA2A04840g"
                     /product="DEHA2A04840p"
                     /transcript_id="XM_456532.1"
                     /db_xref="GeneID:2899796"
     CDS             complement(392025..393245)
                     /locus_tag="DEHA2A04840g"
                     /note="similar to uniprot|P38347 Saccharomyces cerevisiae
                     YBR271W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04840p"
                     /protein_id="XP_456532.1"
                     /db_xref="GeneID:2899796"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ37"
                     /translation="MDFDPLSLFTPSVTKEDYSEISLSRSLDDYSDNKVLIDFEDNLF
                     QPLHVLDLPLLQLKPPAEVLLMFLKLLSPDEVYNFTKPESVNDEDKKIDTWKTFENKE
                     ITEELLNTALEWLANFCPRFSNKLKLSYIPFLSTSLKRNYESQYNAWLTRIISSQLPW
                     VTDSEFKRIISKEASLRLAENCGRTAQPEIVRKIGLPNLSKYLKGTEYIKLKEPSLTS
                     DNLGLKTWGSSLILANRLINKNNDEYLTGPVLELGSGTGLVGIISSILGYETYLTDLI
                     EIIPNLQDNVQINSIDANVDELNWCDPSSFIAKYGHDKKFNTIVLSDPIYSSKHPYWV
                     VDMVEKFINSKNNNARVLIQIPLRPKFEDERSLLWELMNKNFTEIEHEIESGFDDFGE
                     MGFCFKKFIRKTSI"
     gene            complement(<393627..>394034)
                     /locus_tag="DEHA2A04862g"
                     /db_xref="GeneID:2899797"
     mRNA            complement(<393627..>394034)
                     /locus_tag="DEHA2A04862g"
                     /product="DEHA2A04862p"
                     /transcript_id="XM_456533.1"
                     /db_xref="GeneID:2899797"
     CDS             complement(393627..394034)
                     /locus_tag="DEHA2A04862g"
                     /note="similar to uniprot|P38345 Saccharomyces cerevisiae
                     YBR269C FMP21"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04862p"
                     /protein_id="XP_456533.2"
                     /db_xref="GeneID:2899797"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ36"
                     /translation="MLQKIRPVFRQQILMPLRVDIRCYSKFSTEYTPSPPKLPKEQQE
                     EFEALQKIANSQAAIDQYNEQMETTGSANSDSVDTSAPPKTDIGGFHPEYFKTIPEFE
                     GDVNPVTGERGGPKQDPLKHGDEWSFNGRVTDF"
     gene            <394613..>395782
                     /locus_tag="DEHA2A04884g"
                     /db_xref="GeneID:2899686"
     mRNA            <394613..>395782
                     /locus_tag="DEHA2A04884g"
                     /product="DEHA2A04884p"
                     /transcript_id="XM_456534.1"
                     /db_xref="GeneID:2899686"
     CDS             394613..395782
                     /locus_tag="DEHA2A04884g"
                     /note="weakly similar to uniprot|P53830 Saccharomyces
                     cerevisiae YNL286W CUS2 Protein that binds to U2 snRNA and
                     Prp11p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04884p"
                     /protein_id="XP_456534.2"
                     /db_xref="GeneID:2899686"
                     /db_xref="GOA:Q6BZ35"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ35"
                     /translation="MSDFPDAPPLPSLMSKDPDILKTVDERLSYDKSSSQWFFEVNND
                     NKSTEYYYNFILERWIPTAEIEDNGRKRSREDETIHDEEEENKLAIKNLKKQKLKEMK
                     EQMNKSKADGNKNKSTFENTGVYVSQLPGDITKDELMVTFSKYGLISEDYKTGEPRIK
                     IYHNDGQRDDQRDALIIYHSKESVSLAIEMLDDSSIRPPSDKDQTKIKVQPAEFKKSD
                     SDTTNDKKKTLTYEEKKLLNKKKEMMKKKLSSWDDDEGTIQAGDSDKTNNIKKRIWDK
                     IVVIEKMFRIEELKSDPLLEMDLKEDIQDECNKLNIGNDVTKITIYDVSGIITVKFNN
                     GDSSLKCIESFSGRYYDGLTLKAYLYQGEKFQKTSQDKENEGERLDSFGNWLEKK"
     gene            396142..396212
                     /locus_tag="DEHA2A04906r"
                     /db_xref="GeneID:8998066"
     tRNA            396142..396212
                     /locus_tag="DEHA2A04906r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (GCC) cove score=62.33"
                     /db_xref="GeneID:8998066"
     gene            complement(<396327..>398843)
                     /locus_tag="DEHA2A04928g"
                     /db_xref="GeneID:2899798"
     mRNA            complement(<396327..>398843)
                     /locus_tag="DEHA2A04928g"
                     /product="DEHA2A04928p"
                     /transcript_id="XM_456535.1"
                     /db_xref="GeneID:2899798"
     CDS             complement(396327..398843)
                     /locus_tag="DEHA2A04928g"
                     /note="similar to CA3823|IPF10651 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04928p"
                     /protein_id="XP_456535.2"
                     /db_xref="GeneID:2899798"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ34"
                     /translation="MAGTDSTGKFISEITQQQIFHTFLESLSVDSKSKLLSQNKLVCR
                     NNLDLFFANENLVRCCTINPEYTNFRLLDNKYDDFKIRSLEMNSSGSLMAIIGDTELV
                     VVSLPTSLTASNSSLLQVKSYRIHGIEGQIKKVIWQSIVANDCCLVVLNDKSEIKSYD
                     LSLSSYEPQLSIDLGKDDAFKGEVARSISFGSSANLSGSLTLYVATSSSNIFAIYPFI
                     HKLGKIATTESNVRDLLDESTSLITAVQERFPSKDLVQSSHQSVLNHASMKQYAYISS
                     LYKQFETSFAPRREYRQLLSTNPLELSVLSQELPENFLPIVQGPVTITKDKTLKDLTC
                     IGSNDNISILVSISISAGNETFLSYHSQLKPLIMKWSDVNDQTLKKEEVTPNNNRQSQ
                     VNEKEKNHEKGYIRPKRGFGYIDEVELSNEEEEKIPHINSNEFESKNREIEILFWKDE
                     FTELSTLAIDQIPVSASQDIALSTLNSEGSKISIKIGNSIIYFDCGKWCEELVLDVSN
                     GHIPQNLDVSSKYTLVVDGVQEISSFALIKDTMNETGDFLIILKTQKDNNLEVKQISE
                     NTTPNPDPEIIEIDTIIEKVNHESILIKEPFDELLSELDILKRVNPETLGKSLYMNKE
                     LAGVPIYGTNTEILKNLNHLSTETIQQISKFTSFAIHLNLRVTTQIDELKFQINNLQR
                     IQKLGLDDGILDSKNEKANDLIARQNKINDRIQKLQDKIFDANQKLRYSKSLPLSDAE
                     KLWFKEINSVNAQVSQDTDNAKCLNSVVENMTSQVSKIVNSIKEGEKQTEETQKFENK
                     LKNLQEHHNILKLKQWLQEENDLIVLVKEKLDESFEQLKI"
     gene            complement(<399014..>400399)
                     /locus_tag="DEHA2A04950g"
                     /db_xref="GeneID:2899799"
     mRNA            complement(<399014..>400399)
                     /locus_tag="DEHA2A04950g"
                     /product="DEHA2A04950p"
                     /transcript_id="XM_456536.1"
                     /db_xref="GeneID:2899799"
     CDS             complement(399014..400399)
                     /locus_tag="DEHA2A04950g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04950p"
                     /protein_id="XP_456536.2"
                     /db_xref="GeneID:2899799"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ33"
                     /translation="MRTRRSFATLRKATSNVSLVGDSASVGTNYSAAKLWRFHRHFAS
                     RSNGTEISPVRRTYRKRDRFKAVFTGWGTRYSVYQNDVASSIFDVEPDQIDVHEDTEH
                     GNSDDSLFSVMQQARSNTFFNRIKSGRNSYSQNEIGSESLRPDSVLKMAGSKRLSSRY
                     IKERILHRLARKPPTANGSSETMFEIPPELTKTIASCVLDNRSFVSTEDSLSGNLDLK
                     VNLSSLDYKTQSTPRKETPPDGSLEFTPRYHHEFHIEPPPKNLPKHLHAKWERSQMFK
                     NTARTYDHEKWKSKQSLVNQENNTDDEKPNTDLSITTKSTTKDCDNVSSNLFENVTKL
                     FTPNNSSKVSSCTPSSSKSVFDTTKLFLPATPKIGNLSTVFSLKNRKLSHNSLSSRFT
                     SVASSFQSTSTISSSATACKVSTITNKNFNYPENYSLYSQDTFCYKKTNKYVNNIEDR
                     PQDETFSEFSF"
     gene            <400963..>402126
                     /locus_tag="DEHA2A04972g"
                     /db_xref="GeneID:2899800"
     mRNA            <400963..>402126
                     /locus_tag="DEHA2A04972g"
                     /product="DEHA2A04972p"
                     /transcript_id="XM_456537.1"
                     /db_xref="GeneID:2899800"
     CDS             400963..402126
                     /locus_tag="DEHA2A04972g"
                     /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
                     YGL213C SKI8 essential for protection against viral
                     cytopathology"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04972p"
                     /protein_id="XP_456537.2"
                     /db_xref="GeneID:2899800"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ32"
                     /translation="MGKQYISTASASDAHKSDILGLSVTDRYTITVSSDGYANFWDNK
                     KYELQEPNEIVVKQFVNKMGVHHVVAYESILPASHVKIVLIAFASFDGSISFKYFIND
                     ELSSLTDAEIPFGANSANWSPCFYKDPESKQDYFIVTQANGSALVYYLNIESSKDSAD
                     IGIKLEKFGDLNNANSSLFPNSVAVSPGVDKKVAVGYTNGDVLLYDLTTLKPIYTFRS
                     TDLQVSNKSTSASSIPRVLAFSPGGSLLAVARDNQSAGSITLYDVKYGENVGSLTTPS
                     HSSKTTIGGFAHDGWIMGLSFDESGEILASCAFDNCVRIWNIETREREATINISPSDL
                     EGTNDNELDNSIASGVQFIKKGIRAGANGDSNEGLCVVSFDRAVRWYREAGGI"
     gene            complement(<402169..>402951)
                     /locus_tag="DEHA2A04994g"
                     /db_xref="GeneID:2899917"
     mRNA            complement(<402169..>402951)
                     /locus_tag="DEHA2A04994g"
                     /product="DEHA2A04994p"
                     /transcript_id="XM_456538.1"
                     /db_xref="GeneID:2899917"
     CDS             complement(402169..402951)
                     /locus_tag="DEHA2A04994g"
                     /note="similar to uniprot|Q5WJ75 Bacillus clausii ABC1041
                     2- deoxy-D-gluconate 3-dehydrogenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A04994p"
                     /protein_id="XP_456538.2"
                     /db_xref="GeneID:2899917"
                     /db_xref="GOA:Q6BZ31"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ31"
                     /translation="MLSLFSLEGQVALITGGTNGIGLGMAKGLADANIDQIILTYRSE
                     KPLENTIKVLQEVNPKVKISSIEADFGTGNEDDLVAKIATEAFKKSVSGKIDILINNA
                     GINNRFPFDEFPQDKFDEVLRVNLNIPVKLTKAIGCKMLETKTKGKIVFTASLCSFQG
                     GVDSTAYAITKGGIKQFTAALSNDWSSKGIRVNSIAPGYISTNLTEQIDPKRRETLIS
                     RIPIGRWGNMDDFQGPAVFLCSEASRYVTGETLVVDGGWLGY"
     gene            <403138..>405516
                     /locus_tag="DEHA2A05016g"
                     /db_xref="GeneID:2899918"
     mRNA            <403138..>405516
                     /locus_tag="DEHA2A05016g"
                     /product="DEHA2A05016p"
                     /transcript_id="XM_456539.1"
                     /db_xref="GeneID:2899918"
     CDS             403138..405516
                     /locus_tag="DEHA2A05016g"
                     /note="some similarities with uniprot|Q12748 Saccharomyces
                     cerevisiae YLR381W CTF3 Outer kinetochore protein that
                     forms a complex with Mcm16p and Mcm22p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05016p"
                     /protein_id="XP_456539.2"
                     /db_xref="GeneID:2899918"
                     /db_xref="GOA:Q6BZ30"
                     /db_xref="InterPro:IPR012485"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ30"
                     /translation="MEIGEDIFDRNKRNLEVVSEKLNQLIDREVVNKQTLLEDLSSLV
                     AKTGVDEAQLNSLLDLVFDLKTPTFLKSTQKRFIIKNLLIPNGNYKLSKHIAYRIISS
                     IGVPQIYYKNGKESKSKKLSTGIQICLLEWLICSYHLFGSKVFNNLSMITILVNYLSY
                     EFSRPYVANLIFLSVSNNNRMFKTYFMPNTTHNIAPFKPWHVQCVVDLFNKFPMDEHL
                     KSLLILFKSQYPSIDFTNFARNDSYHLNNLGTLNPRIFVYPNFNYLDKLRDIQAINGG
                     ILTKEQLGQEQIINDNLRYYDNFSASVKKRKRIGNTQKLADVPDLDVIEFGNSSNRSS
                     SVSINDIHSLDSLIGNFENIRLININALFNPQKFGNSRYISDKFKKFYFVLQGLSVDV
                     EQWEKSIRKLDYYIRLSILDNNLSIRDLDILCDKIADFFSFTLGLLFLPSIKDYLCFK
                     FDSPISSDNEYIHKFENLAQRLKFLKYLPVLEFEEFNEDIIQNILTVFDEKSHINAKK
                     SRREQAFITFINELVSLFSTWYSIYAQNSDLELKSAIFKNINGSLPIIYKVLVEKFTE
                     SSITLQISLLRIFTFIQSLDSYHLNEFINASTIVLPQSLFYPLILSNNPLIMSEACGY
                     MAFCKTYKFKEHDTAYKNLQNSYIMDTLNFIWRDKSFYYDEDSTAFSRAMFLDPEFLK
                     NLRKLNIFNFSELLSLHTVGNIFHNPCWSFITTQLIRELEDKTENITIRHAGPITEES
                     VSKLTHISGVEWLPMNYDELKLQVLRSLDSLGYTGIADLLFSSLKTLMNKRN"
     gene            <405660..>408494
                     /locus_tag="DEHA2A05038g"
                     /db_xref="GeneID:2899919"
     mRNA            <405660..>408494
                     /locus_tag="DEHA2A05038g"
                     /product="DEHA2A05038p"
                     /transcript_id="XM_456540.2"
                     /db_xref="GeneID:2899919"
     CDS             405660..408494
                     /locus_tag="DEHA2A05038g"
                     /note="similar to uniprot|P11325 Saccharomyces cerevisiae
                     YLR382C NAM2 Mitochondrial leucyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05038p"
                     /protein_id="XP_456540.2"
                     /db_xref="GeneID:2899919"
                     /db_xref="GOA:Q6BZ29"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR025709"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ29"
                     /translation="MLSIRQSAHIRAPIIRKCVGISKSTSRYSSVDTNQSTKTQINLN
                     ELDGKWAERWRNMSPNGSLHPSKHMVDESAEPFYCLSMFPYPSGMLHMGHLRVYTISD
                     VIARFKRLKGYNVIHPMGWDAFGLPAENAAVERGINPAIWTDSNIQKMKEQMSLMLAD
                     FDWDREISTCSPDYYKWTQKIFLLLFEHGLAYRNEAEINWDPVDQTVLANEQVDSEGK
                     SWRSGALVEKRNLEQWFIGITKYAKDLNEDLKVLDKWPDKVKSMQSHWIGESQGAEIK
                     FLTNDNQFSEIQVFTTRPDTLFSAQFIALALNHPLVEKYAADDPKLAQFIKNCENSAI
                     DSKEGYLIEDVNVSIPITVNNEKNHKYDMRVYAAPYVLGTYGHGAVMGCPAHDERDFE
                     FWKLHNPTIAPLQSVGSLEPNKNENNVLYTNKRGILYDSSVLPNGVQDLGKYNRKSTS
                     KAAHDIVETLERYNLGSKSIQYRIRDWLISRQRYWGAPIPIVHCDSCGPVAVPDDELP
                     VMLPEIEGQSFGKGNPLAKLDEFVNTKCPSCGGNAKRDTDTMDTFMDSSWYFFRYTDP
                     TNTQLPFDHAIASKHMPIDMYIGGVEHAILHLLYSRFISKFLGDIGLWDGKDHRHEPI
                     KQLVTQGMVHGKTYTDPESERFLKPEELDLSNVNEPKIIKSGLLPKISFEKMSKSKYN
                     GADPSECIKKYGADATRAHMLFQAPISDILNWNEEQIHGIDRWLRKVVNLNDVIAESM
                     LNDNGRTNNDNCTEYQNIQLNDITYETIKFNETEFELYNDAQNYVESVSKAIEIDFSF
                     NTIISDFMKFTNSIYAAIKSKDYVNSNLLLDSYKRLLIIMAPVTPCVAEECWEQISKS
                     IRTPWSSIFFQKYPKVNHIESSYTSYNVFVNGKARASFKGQKSLVTMDEHEILQEALR
                     HGSISQYVPDGVVKKMIVKPGMISLLTPKK"
     gene            complement(<408696..>411059)
                     /locus_tag="DEHA2A05060g"
                     /db_xref="GeneID:2899920"
     mRNA            complement(<408696..>411059)
                     /locus_tag="DEHA2A05060g"
                     /product="DEHA2A05060p"
                     /transcript_id="XM_456541.2"
                     /db_xref="GeneID:2899920"
     CDS             complement(408696..411059)
                     /locus_tag="DEHA2A05060g"
                     /note="weakly similar to uniprot|P48237 Saccharomyces
                     cerevisiae YGR150c singleton"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05060p"
                     /protein_id="XP_456541.2"
                     /db_xref="GeneID:2899920"
                     /db_xref="GOA:Q6BZ28"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /translation="MMLRLSVKKRCMSRTIPRISGLQGSIYSSRNIFVVRSQKGKPTL
                     RKSKGSNDGGAVNNKEKLSEWVDSDFERKMKQQEVEYERRLKELKSLTASVARIIKKK
                     EDIEKLQEIPMPSEVNRDAEKIYGSLEVGKEKLASLPENSPSLSGIEKQPEPFNASNH
                     SLITPAIDMPESITKRLGLAIKFLVSKTNINWTMVLQQLKEGGGFQGLPERDIRMFIY
                     SIPKEQISHLIPVLEQLLEEGNVKKSSKIINVFIAGLSHGGYLSDESIAQIEQYCNHI
                     TKINKKGKLSRETYELMIQAYGKNNNLEKINMCLSEMKQNKLEPSQKTFSNILSTCVY
                     KANDHKQAVEIFDSMKFLSQKTKPDTRAYQDIIVSYVNNDNIEKALDLYREMITEKIE
                     INQRIMVALARGCTSRPELRFKAWDFIFDIYNNNWEPTLNTFEYMLYLSAKDGDVALS
                     RAFYSKLNESNAITPRSFSFLLLAYSKSQVSQPGQSIELPPITFHEKGRNFRRNILSD
                     VNLFPASAQNGIPFLPVLDLTSKEEIMAESSAMWAHTLMFNPSFVNTDCANTFLNIAA
                     VMGRLNDFIDRYDSSTFLDRTGLSNDTRIIIEELPDSISSNTDISQTDGESVSSVQSK
                     FDEMSITKSPLLKDVGSNIGLGNRKISRTSLSYVIALKAAARFKNYKFAQRIWSERGT
                     FRKTSNFKDLSRSTKDALDFQFANAMVSCLTKMNLLDDALAILLSTEYQFKWTWKELR
                     ELYQAASDIDHSDACKSIRGIAKRAQINYEGKIRRKDFKRYVMERGY"
     gene            <411286..>416046
                     /locus_tag="DEHA2A05082g"
                     /db_xref="GeneID:2899921"
     mRNA            <411286..>416046
                     /locus_tag="DEHA2A05082g"
                     /product="DEHA2A05082p"
                     /transcript_id="XM_456542.1"
                     /db_xref="GeneID:2899921"
     CDS             411286..416046
                     /locus_tag="DEHA2A05082g"
                     /note="some similarities with uniprot|Q86ZP4 Gibberella
                     zeae CPS1 Acyl CoA ligase-like protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05082p"
                     /protein_id="XP_456542.2"
                     /db_xref="GeneID:2899921"
                     /db_xref="GOA:Q6BZ27"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ27"
                     /translation="MSSSTVVGSAPGRNRGNSNANLHPDIGSVSATDANAITSSKPYN
                     SSTPVGSAGGSSFPGGIAHDIPPDMSLLLQELEEDFTVNKTIDQWTYINRREEIMQSV
                     NKLHQQQQSNIELDSSMLEKPLYPRKAAEIMNENNLSSGYLMGILANRARIYKAEVAF
                     SVLDAKGKEISSITWEKLYTKAVKVAHEINKMALKNSDTVVLLYKDGEVCEFVVAMFG
                     CFMAGVTAIPIHQDISLHEVLDIINLTSTKLVLYSDTVAKELDKLNATGQKIIWPPKL
                     IRWKTTDFGSAKKSDLATWTNKISQQQQAPRESKSDLAYVEFSRSPVGELRGIALSHR
                     TIVHQMNCLDITLSSLPESGGGLQRSYKEYKGNKKVVLATLDIRFSIGLILGILFTVY
                     SGNMLVWVPQKVMEVQGLYANILSKCRASLLLADYLGLKRVTYDYQQSPNSTRYYSKT
                     QKVDFSSVKWVLVNALTIDGEFIEILAQRYLRPLGCQEPENAIIPMLTLSEYGGMVIS
                     LRDWLGGKEKLGIEDADESSSSELSAVSIDKEALSRNIVKVVDTAPSSSDENSADTLR
                     VDAFGFPLPDATLAVVNPESSLLVTKGELGEIWIDSPCLSGGFYGLRKESKSIFHAKC
                     RDANGILEMDFLRTGLLGFTYNGKIYVLGLYEDRIRHRVSWIDQKLYYKLKKNLIIGN
                     GFRYHYSSHLLATLASEVRNVYDCTIFDVFIGNEYLPVAIIEAEVIRKSVDPNNNDNA
                     VTGGGKAQNNSGDGSQANSAVPLNEPVLNSIAQKCFDTLYKHHFLRLYCVLIVDCDTL
                     PKIMRSGGREIANMLCKKRFLEGSLKAEYVKFFVSKSISMIPHGEDVIGGIWSPYVSR
                     LRNSALSRFPNQFSAVDYREKSIDDKTGAPLTDFKSILDILKFRVASAGDAIAFQSID
                     NSGKSASKPLTWKKFEHRVYAVCSYLIDKLSIKPGKYIILMYSLSEEFVIATYACLIC
                     GVIPIPMLPFDSNRIGEDFPAFVGVIRDFDIHEIFVNEEVEKFLKNGPVADALKKMNN
                     KKSTIHKIKNTGKLTKVSNIASLNSKIKRYQGESNFRDDKTIAMVWLNFTSDHYRVGA
                     TLSHKNIIGICKVFKETCNLSSNSSIVGCVRHSSGIGFVQAVFLGVFLGTTTYLSSPV
                     TFAENPLAFFLSLARYKVKDVFVTEQMLKYAALKFTPKGFNLANLKNMMISTEGRVEI
                     DLLRKIAKVFQPTKLSAASMSSVYTHCFNPIISTRSYMTVAPVDLYLDPIALRQGYIS
                     AVNQVDVPNALHIQDSGMVPVCTEIAIVNPENNMICKEGEFGEIWVCSEANLTSFTNG
                     PNGPIDNFSRQQFLGKIQDGNPEMTYLRTGDLGFLHHISITKNSNNDNTNQPESTSFQ
                     PLFVLGKIADTFEVMGLHHFPIDIENTIESCHVDIFKNGSCIFKCAEYTIVVCESRRM
                     RNFASLVPLIANTVLSKHHIIVDIVAFMKKGEFPISRLGTKQRARIIDAWVQGILPVT
                     ASYGVNYGESNMTKLVKEIDAVARDHPITGLKNPALSFYDLDLVDEYEDIFDGNQHGL
                     ALNDGNFDIVDKRKAVFSMSNNSSVSDESLPVHK"
     gene            <416207..>419344
                     /locus_tag="DEHA2A05104g"
                     /db_xref="GeneID:2899922"
     mRNA            <416207..>419344
                     /locus_tag="DEHA2A05104g"
                     /product="DEHA2A05104p"
                     /transcript_id="XM_456543.1"
                     /db_xref="GeneID:2899922"
     CDS             416207..419344
                     /locus_tag="DEHA2A05104g"
                     /note="some similarities with uniprot|P14907 Saccharomyces
                     cerevisiae YJL041W NSP1 Essential component of the nuclear
                     pore complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05104p"
                     /protein_id="XP_456543.2"
                     /db_xref="GeneID:2899922"
                     /db_xref="InterPro:IPR018892"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ26"
                     /translation="MSYDRKRPISPRTIDKGNNGGFGIAKLFNFLKPRSSQQYKQQKQ
                     RQNQIPSRNQQDASHIETDPLVNNFSSSRKRTLSIQSLHNNDVVPRSSTLNSNFGSYT
                     NYYDNLKNENEVLDNDLERRLSTEYGSDLVKESILPTSKPEFRERDDSPMSGLMKPRP
                     SILPEINEKENHEDMPLIIEHEFAPLYKDSDGNLVRPPFINLDPRERYHVLQLKKSIQ
                     ASESLQNRIKYMVNPNETQSKPLYETNKVETSTQTHDLNYLENSLNLSGLKRRLSSKK
                     ECTKNKRAKNSKGYFTGEFLYDDIESNEKSKDKLHGYLGDVTKPKFNNTTAISKNDKS
                     ASVQPRKDESQIFNRFSNQNVKSTDNRIGLDNSLLNNEKVNVSLDSDYVTNAEKISNI
                     IKLKADSSNKPKEKELVQPSSGFKFSINSNDINSIINKKQEDDELVNKSNETLNKDGD
                     GTKPSFSFGASAEKKDNTNQSLLSFDSSGVKKDFSSEPAFSFGARNESDGTSEPTLKR
                     GRVSEEKGVTKPALSFGKPTEKKDDLAKPTFSFGESADKSNGTSKPKLSFGAPSENTD
                     NNKPPVSFGSSSEKDNSNITKTTFSFGATSDKKEDVMKPSLSFGASANKNDGIPKPTF
                     AFGASSENKDDSNSAGKTDEKTDNAIKPSFTFGMSTEKNDTPKPAFTFGASTEKKEDT
                     TKPAFTFGAGTDKKDVIPKPTLTFGAGTDKKDVIPKPTLTFGAGTDKKEDTTKPTFTF
                     GASSEKKEDTTKPTFTFGASSEKKEDTTKPAFTFGAGTEKKDDSPKPALTFGADTEKK
                     EETPKPAFTLGAGSEKKEETTKPAFTFGAPKINETPNPAFTFGANEKKETTPSFSFGE
                     KPAGGIGAPSFGALNQNKDSAPKPFEKPTAPFGSGSTTPNFSFGSRDSTPKPNFSFAS
                     GTGANAMPSNAPQPNNLFNFTGTVNKEGTPDPASIFGGGANNMNTSNIQNGVNGLNKS
                     AESSPFGFNAHQSTPDFKFANGIQQPQFNSGLPADMNNQSFNSTSGMTPPTLSTTPPI
                     IKSNRKIAQMRSRRR"
     gene            <419642..>421276
                     /locus_tag="DEHA2A05126g"
                     /db_xref="GeneID:2899923"
     mRNA            <419642..>421276
                     /locus_tag="DEHA2A05126g"
                     /product="DEHA2A05126p"
                     /transcript_id="XM_456544.1"
                     /db_xref="GeneID:2899923"
     CDS             419642..421276
                     /locus_tag="DEHA2A05126g"
                     /note="weakly similar to uniprot|Q6B265 Saccharomyces
                     cerevisiae YLR380W CSR1 Phosphatidylinositol transfer
                     protein with a potential role in lipid turnover"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05126p"
                     /protein_id="XP_456544.2"
                     /db_xref="GeneID:2899923"
                     /db_xref="GOA:Q6BZ25"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ25"
                     /translation="MADYSSVKYRSGRIQTINAEQEIVLKQVWAHYLKYFGYEVNISS
                     EDIKFKESFIPSTTTIEYGESTGELGFSNGLVKTNTRGSLNSNASLKSSTKKKGFFQK
                     GHAEPPKIPAGSKRMRDIEAQCTTERYIPVIDASEEFKYMYYDYYKQGYESEDESGDD
                     VSDMNSMDTFITASTSITDPGSYELVQGLGKQNVSAQSLGSAPRSFQLKPNTKIIPCL
                     SRYKPEELHASLFKALRNDLFDNYLLRFVRARKFKYDEAIAMLSKSLDWRHNTLEADD
                     FLLEGDAPSYMNGTNKGFIKNFTVGKCYTRGVDKQKNPIVLFKARLNYPSDSPLEGTK
                     RYALVIIEWSRLNLKDISDSRDQCSVIFDLTGFSLKNNDLPAIKFLAEIFEAHFPEIL
                     GSILIHNAPWIFSTIWNLIKNWLDPVVASKIHFTKSTKDLNQFIDSDNLPESMGGKDP
                     YAGEYPEPKAEDCHPPKPKDAVYRQLKKERDENLVKFLETTKRWIESTDSDVSARYLQ
                     DKIDLGTKIAQLYVDLDPYVRIPGIYDRNGSIDLSI"
     gene            <421731..>422888
                     /locus_tag="DEHA2A05148g"
                     /db_xref="GeneID:2899924"
     mRNA            <421731..>422888
                     /locus_tag="DEHA2A05148g"
                     /product="DEHA2A05148p"
                     /transcript_id="XM_456545.1"
                     /db_xref="GeneID:2899924"
     CDS             421731..422888
                     /locus_tag="DEHA2A05148g"
                     /note="some similarities with uniprot|Q08923 Saccharomyces
                     cerevisiae YPL181w CTI6 Protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05148p"
                     /protein_id="XP_456545.2"
                     /db_xref="GeneID:2899924"
                     /db_xref="GOA:Q6BZ24"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ24"
                     /translation="MSRRSGRSKAYPDQSELNSEFPEDDEINNYEAEAEDEVDEEQEV
                     TRCICGQDEVNTRGINPQLHALLWKEYQMKIDNGLFIQCDKCSVWQHGYCVGLFINED
                     VPEKYWCEICKPDLHIFIYDNNETVRSLYKPVNDKRKKLLLENSISQENNNKRNKAKR
                     QAQSNSSPVSASESNKHPRKERRHYDESYDEQLQQALRESAKESGISYDTKNKNKRKK
                     NGDSSDTNKKLKHESEQGQSNAEEAEMNDEIKGDSKLKKSKIKSKSSKSKVAKNPSND
                     STSATMTKEELINQASKPRYVNEKSSIYELRKRTGAILEWLGRSQLELEEEKLNKIEL
                     FSYKDKIDLNQQQIDQDNNKVIDGFNENLQLMEKLTEKILNWEQQFGKYAP"
     gene            complement(<422930..>424774)
                     /locus_tag="DEHA2A05170g"
                     /db_xref="GeneID:2899925"
     mRNA            complement(<422930..>424774)
                     /locus_tag="DEHA2A05170g"
                     /product="DEHA2A05170p"
                     /transcript_id="XM_456546.2"
                     /db_xref="GeneID:2899925"
     CDS             complement(422930..424774)
                     /locus_tag="DEHA2A05170g"
                     /note="similar to uniprot|P38932 Saccharomyces cerevisiae
                     YGL095C VPS45 Protein of the Sec1p family essential for
                     vacuolar protein sorting"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05170p"
                     /protein_id="XP_456546.2"
                     /db_xref="GeneID:2899925"
                     /db_xref="GOA:Q6BZ23"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ23"
                     /translation="MNGNPSALKTKMTLNLSKVSETYFNKLFETKVSPQSTEIKARVL
                     LVDKHTTPIISMSYTQSQLLQNDIVLVEMIENQSNLNVMKHLNCIVYIKPTQESIKNL
                     IKELKSPHFNKYELFTNNTLNKNQLEGLAEADEFEAISQVLEIFQDYLIVNNNLFTIN
                     ISSGQNTIMEESNSLASLLLSLKKCPIIKYESNSIELKKLSSEILYNINSNSNNNLFE
                     DLNKNSDVPPILLLLDRKNDPITPLILPWTYQSMIHELIGINKNMVELAESEEPIILS
                     ESQDPFFKQSMYLNYGDLTDKFQEYVEEYKKQTKQSSIENLKTQNLSELKKVLTRFPE
                     FKKLSNNILKHLNLISELDTQISRQSLWEVSELQQTIICNLENQQVIRTRLLEILDKA
                     TISTENKIKLVLIYSVKFSQNDNDLAVFLNKFHDPTITNPVPTVSQMSLMKNFNKQFN
                     KTPISTNNNNSNNIGKIFNNKKISINSLFNNSTNNSTTNNIYMQYIPKLNELLNELIN
                     QSQNHSNQFHLSTLVPDIVTKQYGNVGDSVQDIIIYIKGGITYEESRLIHDLSLSNNK
                     INLIIGSDTILNSERWLNKMYDDINETHTNQTNTADHGLRTKQLRDIL"
     gene            complement(<424878..>428186)
                     /locus_tag="DEHA2A05192g"
                     /db_xref="GeneID:2899926"
     mRNA            complement(<424878..>428186)
                     /locus_tag="DEHA2A05192g"
                     /product="DEHA2A05192p"
                     /transcript_id="XM_456547.1"
                     /db_xref="GeneID:2899926"
     CDS             complement(424878..428186)
                     /locus_tag="DEHA2A05192g"
                     /note="similar to uniprot|Q06010 Saccharomyces cerevisiae
                     YLR389C STE23 Metalloprotease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05192p"
                     /protein_id="XP_456547.2"
                     /db_xref="GeneID:2899926"
                     /db_xref="GOA:Q6BZ22"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ22"
                     /translation="MYSAKGLSRIINYKSGFNLQQVFYSSISKLRMQSDKYTVLADNS
                     NVEKPILDDRSYRLIKLNSNDLHVLIINDASTDKAAASLDVNVGSFADKNYQVPGLAH
                     FCEHLLFMGTSKYPEENEYSSYLSKHSGHSNAYTAAEHTNYYFELSSDYLEGALDRFS
                     QFFISPLFSKSCKDREIKAVDSENKKNLQNDMWRFYQLDKSTSNPQHPYNGFSTGNYE
                     TLHEEPTSQGLNVRDILLDFYKNHYSSNLMSLVILGKEDLDTLTSWAIDKFSEVPNSN
                     LPRPNYDGELIYNPDHLGKIIKAKPIMDSNKLELSFMVPSDQEANWDSKPASYYSHLL
                     GHESSGSILHYLKQKGWVNELSAGNMKVCQGNSIFVLEFDLTPNGLKNWEAIVVNVFE
                     YLKLVLNGEPKLWLWEELSNMSTINFKFKQKQRAAQTVSKMSNSLYKFTEGSYIPPQY
                     LLSSSILREFKSQEIKEYGSFLNPDNFRILLTSQSLPDLDKSEHWYGTQYSYESISNN
                     LKDQIESAETNENFHYPIPNKFIPKDFTVSKPKSENPLPHPYLIEDNNKFQVWYKQDD
                     QFQIPKGAIEIVLHLANANTSCKSSIYTMLLSQLIDDELNEIVYYASMVGISFTINHW
                     RDGLLIRVSGYNDKLPVLLEQILQKLITFKPKEDRFEVFKFKLNQEFKNFGFEVPYSQ
                     IGTHFLTLLNDKTYPYDLKIDTLNKEINFGELLEFSTNKIWEQGVFGEVLIQGNFNDT
                     KAFEISRAIQGHFTEFKTIRDSQEEINEIVKLKTHIVPSNQRIRYEVALQDKNNINSC
                     IEYFIQISDSFDDVRLRVLTDLLGTVIHEPCFNQLRTKEQLGYVVFSGTRLTRTTLGF
                     RILIQSERSSEYLEYRIEEFINQFDKFVKKGLTDENFAKFKQALKDKKLTKLKNLSEE
                     VSKFWNSIISGYYDFQEREKHVEVLESITKDEFIKFYNDYISADSNVSSRIIVHLKSP
                     SVPKLEKSKLLHSSINNYIYRNEFSISSDVLDSLIEANADDVAKLVEVLTNAIAEKKE
                     NNVSNKDRLKSDLSETINRELTTPVPPQYPSGKLVENVDQFKSTYPVGDIPRPVEPLS
                     NFYYSKQPEDHAHL"
     gene            complement(<428390..>429496)
                     /locus_tag="DEHA2A05214g"
                     /db_xref="GeneID:2899927"
     mRNA            complement(<428390..>429496)
                     /locus_tag="DEHA2A05214g"
                     /product="DEHA2A05214p"
                     /transcript_id="XM_456548.1"
                     /db_xref="GeneID:2899927"
     CDS             complement(428390..429496)
                     /locus_tag="DEHA2A05214g"
                     /note="weakly similar to uniprot|Q03956 Saccharomyces
                     cerevisiae YDR202c RAV2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05214p"
                     /protein_id="XP_456548.2"
                     /db_xref="GeneID:2899927"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ21"
                     /translation="MMQIDRTQMQNVVSEIQTEHADQELHWLISQVITPEFPQIIEAL
                     GICSNLILYNSPQHPDAQKQIERGPEIKLPVSSSKSEALKGIIVRDGAYVTQMTVQLK
                     ESHFNKILNKMTLKKPVLLPQIIGAKKSIDAAVGLIERASSEVLDDNCDQEHTRLIAM
                     FHQMLCEIQIAKNSLQLPTDPELVFPLNVTPASSFSPVLTPNIAVDLYISQAEVCVDL
                     KYLHQVQDHPWCEIDSQGKSYVDKLRDDMRLPSSHVSRSSTPAAPQPLNMADIEQKIH
                     QSASTTPDGSRSQSNFVNNVWNHISLKPKHDPIDYITKCVTYNNMVVMVGKKIEVSSP
                     DPVLVSALTKLDSVEYLVSSFLENLQKVVDSLHQ"
     gene            <429773..>431074
                     /locus_tag="DEHA2A05236g"
                     /db_xref="GeneID:2899928"
     mRNA            <429773..>431074
                     /locus_tag="DEHA2A05236g"
                     /product="DEHA2A05236p"
                     /transcript_id="XM_456549.1"
                     /db_xref="GeneID:2899928"
     CDS             429773..431074
                     /locus_tag="DEHA2A05236g"
                     /note="some similarities with uniprot|Q00312 Candida
                     albicans RBF1 Transcription factor RBF1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05236p"
                     /protein_id="XP_456549.2"
                     /db_xref="GeneID:2899928"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ20"
                     /translation="MSGPSTSSERSTVATNNHPIHPQHQQVHPHQHELARQPDYNQAA
                     VAVAAASGMMAPGAHPDDGSQFHPHQHHYNAAAHFQQQQVQQAQQAQLQQYQMLQQQQ
                     QQFQQQQQQMQAPHHQMGPQHHIQPPLQQHGMHQAPMHEPVGPPVGGSQHVGGDYEGG
                     QYLTSKFMENEIIKTFPSKPELVKFVKNVLNDEEQCKIVINSSKPKAVYFQCERSGSF
                     RTTVKDSTKRQRVAYTKRNKCGYRLVANLYPPEKDKKRAKKPEDDALDKDIDDKLNEF
                     QNQNPMANSTSEIWILRMIHPQHNHPPEPNVNSSSKKKRSKYTRTLVEKPLNRGNSNP
                     VNNFSPNDMVAHQHQHPHQQVHVPHPHVHPHHHDASHTPSVQDPAVIAAMEATPNTEA
                     AEAAVAAAAAMHHQHPPVDPNIDPNVDPSVQEHDHSHGTLR"
     gene            <431431..>434124
                     /locus_tag="DEHA2A05258g"
                     /db_xref="GeneID:2899929"
     mRNA            <431431..>434124
                     /locus_tag="DEHA2A05258g"
                     /product="DEHA2A05258p"
                     /transcript_id="XM_456550.1"
                     /db_xref="GeneID:2899929"
     CDS             431431..434124
                     /locus_tag="DEHA2A05258g"
                     /note="weakly similar to CA5214|IPF19807 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05258p"
                     /protein_id="XP_456550.2"
                     /db_xref="GeneID:2899929"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ19"
                     /translation="MDSNVRSTDLPSTTNDDPHTSTQTIPSNRSISPLTRVPLEENEP
                     TSNSRQESYPSIEASSNGTSRSYTEDSAFGDEENDERQPLLVVRSSESVDEIAKEYFS
                     FENNKAFVYTLLILLGLGFFFYLTFQQSDSLVMSAIDTKFQSLSIMDLNNDGLDFHVL
                     GSVSMHYGNIGNHFYRFFMKLASVIIGSVIVIPNDAVKLFASLQGRNESLHVLNIYPP
                     DIQVDIANNALTEIDFISKSELIKENIVELLNTLEEINDEEVVVKLTGIFDSTIESKL
                     FEYSTKNARFYLDYSLNKTDLAPTVLLDKLTVQQNPENSTEIEFYSTISMDNKFPIKA
                     ELEAIDWDISIAGCNKELVKLGEWHSSSLSIQPDSRVEFDVNGLIREIPDKLLQNCDN
                     NITIINKLVQDYLKGKATAVTISASNNLNNQENLPKWLLYVLNKAGYKLSVSLPYFQD
                     DTMSYIKEYDISSLFLEFLSPKSRESFSYALSSNVSMITTFPGIFDITFGVPRFQNSI
                     SLRDESETLIKGWSNTNNTMDLHRYDDENLLEWDIAVSNFEADSVGPARLGALANNLL
                     NGNDIADSMYLDMILDEVELSMPILTTTLKHLILPSVQLNPPIETINSIDDVIDTLNI
                     TVDNILYVDSSKEELRLMIDCSLLNPTNISIDVPDDTISLQLRYNDTIIGNVSTTDIL
                     IPQTGEYFNMTFNLNLNTTTTHGKVSLEFLIGEFISGYEDLYFSVEGTNTSSSNNHGL
                     SKFLSQIAINDIQVPNVSFSPERVQNLPHPLDHHPKHQSPFLIDATIHIFSSELELTL
                     FNPLENAEIAVKIYQAQASYENTKLGHVQPDQYLLIPPGVYTTPRIPFVMDSNIGMDI
                     LRKALNGSLRVQVLAVFKANIGEFDLSLLYEGSDLSAAIRW"
     gene            <434689..>435369
                     /locus_tag="DEHA2A05280g"
                     /db_xref="GeneID:2899930"
     mRNA            <434689..>435369
                     /locus_tag="DEHA2A05280g"
                     /product="DEHA2A05280p"
                     /transcript_id="XM_456551.1"
                     /db_xref="GeneID:2899930"
     CDS             434689..435369
                     /locus_tag="DEHA2A05280g"
                     /note="similar to uniprot|O13547 Saccharomyces cerevisiae
                     YLR390wa CW14 Secretory Stress Response protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05280p"
                     /protein_id="XP_456551.1"
                     /db_xref="GeneID:2899930"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ18"
                     /translation="MPSSMLKITTLVALASYISTTLAAPPACLLACVAQVEKKSDCTG
                     LNDLSCICSSKGSDVKKCLDDICPDGDANSAKSAFEDSCEGHSSSSSSSSEASSSTKA
                     SSSEASSSTKASSSAASSSDAASSGAASSGAASSGAASSGAASTTEASSQSASNESSA
                     APTQASSQVASDDEESTSLAGVATTVSSSTSGSSVPVVPTQSEDGANVQGLSVGAILA
                     GLAGVALL"
     gene            <435686..>437173
                     /locus_tag="DEHA2A05302g"
                     /db_xref="GeneID:2899931"
     mRNA            <435686..>437173
                     /locus_tag="DEHA2A05302g"
                     /product="DEHA2A05302p"
                     /transcript_id="XM_456552.1"
                     /db_xref="GeneID:2899931"
     CDS             435686..437173
                     /locus_tag="DEHA2A05302g"
                     /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
                     YDL238C GUD1 Guanine deaminase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05302p"
                     /protein_id="XP_456552.2"
                     /db_xref="GeneID:2899931"
                     /db_xref="GOA:Q6BZ17"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ17"
                     /translation="MSESNEVDMAAMKPIPYTLYYGTFIHTPNLGELKVCLKTLVGVN
                     KSGTIDYIHENYDHDGQSALEFFKQEFKKQGNQLDPSELHYVDISDDATKFFCPGFVD
                     THIHASQYPNVGIGLGCQLLDWLKNYTYKLENGFTNPKDEECMKFAYDVYHKIIKKTL
                     ENGTTCASYFTTIDPHTTMLFARLLLKLGQRGFVGKVCMDSNDVFETYQEDHDDCVKS
                     MELITSYYENTNPKGEQLIKPIVTPRFAPVCSSGLLEYLGSLAATKELSIQTHISESH
                     NEIELVAKLFPEFDNYASVYDNFKLLNSSTILAHGIHLNEKERKLIKSRNCSISHCPT
                     SNTFIASGEAPVKKYLYEDKINVSVGSDVSGGYSPSILEVIKQTILVSHHLSIKTRNE
                     TASDPKLSVADAIYMATQAGAKAVGLDNIIGSFDIGKRWDAQLINLNSANSNIDIFPC
                     NVPDLKNINKDTETGIHNLLGKWIFCGDDRNCVMVWCNGRLVINK"
     gene            <437946..>441331
                     /locus_tag="DEHA2A05324g"
                     /db_xref="GeneID:2899932"
     mRNA            join(<437946..438032,438152..>441331)
                     /locus_tag="DEHA2A05324g"
                     /product="DEHA2A05324p"
                     /transcript_id="XM_456553.2"
                     /db_xref="GeneID:2899932"
     CDS             join(437946..438032,438152..441331)
                     /locus_tag="DEHA2A05324g"
                     /note="similar to uniprot|Q12749 Saccharomyces cerevisiae
                     YLR383w RHC18 recombination repair protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05324p"
                     /protein_id="XP_456553.2"
                     /db_xref="GeneID:2899932"
                     /db_xref="GOA:Q6BZ16"
                     /db_xref="InterPro:IPR027132"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ16"
                     /translation="MTVPASDGYRGTKRRTEEDEEGGDMFNPMKGSDDSESESESDSD
                     DELENEDQVDSSPAKAGVIEKIILKNFMCHDSFELNLGPQLNFIIGRNGSGKSAILTG
                     ISIGLGVKASDTSRGSSIKNLIKDGKSTARVTVVFRNEGIEAYKPEEYGSKIIVERKI
                     QRQGSNGYFIRSENLKTISTKKSVLDEILYKFNIAIDNPLAFLSQDKAREFLTSTTDK
                     VKYDYFMAGSLINDIIENYRITSGNIVEVQNKLKLAKTHLDVATKNYDESASLYNKFK
                     KSDSLRKHLELIHAKIYWYNVTVIEKKIQKYKDQLQQASHDIEVIEKKFEEIEQKSNQ
                     REQNVKKLEEKNIAISKEIVESQDSYQEIKMTYQRLKSGINEVINEIKKGEEDIEGFH
                     KDIERCQNIIAKEQQRIDEINGGSKEKLNDSLSELKAKLEDLAQERERVRSELNEAGN
                     YNDSELLDCEKKVNESKEIVSTLQEKKRRILASQKDKYSPWGNNITHLLANIKAINQW
                     HQEPIGPIGSLVSVKEEYSDWRDLINASIGKTLDSFLVCDEHDRKILSDLFKKYRINK
                     NIITRRFESFNFEDGIAYGHTTFLDILSIENENVLYTLIDLNSIEKNVICDDRNRARD
                     LVTYPKILNVYSLLNSKSGQRSSGDRNTFKIDPIYYRLNEPHKLSNKSQSSTNDIKKT
                     DEQVDEEIVKIHKLERRKREIKMKLQNEKQNLENRYETIQKETRRLNDELFKIENSLN
                     ENGDLSKIEALKIQIAEDEAQASQKEGILESLNEDLEKDRSQFITVRENMKKLKQEIQ
                     EQLQLQEDTKKALVECEIERSAMLSETEHYKMTTSKRRDAMVVCETKISQGNERLAPL
                     VLDAESKCPRTQVNITNEDTNESISTEYERAQEAVKEAEKSVGRSYQEIQQELLTNKD
                     TKEVCEERVIDLDKIYRSLSDDLNSRFNYLHTTILKNINEASSSFERSLALRGFKGEL
                     KFDFGEKSLTMLVQTKGDSKKRTVESLSGGEKSFTQIALLLAIWKVMDSKVRGLDEFD
                     VFMDSVNRSISIKLLLSELRKYPKSQSIFITPQDIAVVGDLDSKDVKIHKMNDPRSDN
                     "
     gene            complement(<441418..>443226)
                     /locus_tag="DEHA2A05346g"
                     /db_xref="GeneID:2899933"
     mRNA            complement(<441418..>443226)
                     /locus_tag="DEHA2A05346g"
                     /product="DEHA2A05346p"
                     /transcript_id="XM_456554.1"
                     /db_xref="GeneID:2899933"
     CDS             complement(441418..443226)
                     /locus_tag="DEHA2A05346g"
                     /note="some similarities with CA4879|IPF1660 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05346p"
                     /protein_id="XP_456554.2"
                     /db_xref="GeneID:2899933"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ15"
                     /translation="MWSRYLRKRLLKPPVSNIKRTYSELCQSHNYRNDKTYGQYYDRF
                     NDVKQNPDRNSIRSILDSAFYTTPIDNNDSYLMNDFLETISNIPNHYHTYVQEYLEKL
                     NRNEIRDCLKQNIALQLLLSSNNSDQAEVYQFIVENLHHKLNVNLLEIFIFNLIKAEN
                     ISAATTLLHILLDKIPNFNLSNELWSYYISKTCELGHYLGSCLIYHELIDNHQTRSGE
                     STGINFQNSYIPFLVANSLLEKLGSIFSNNRDPMRINGVLNYHKRFYSYSGHADTYKS
                     LRCSLVEAYSNEGNLGEALKHFRTLAFIFKGHRNYKKNESISTPKMSAFSHFRWRRDN
                     IKNNNYDSISQVPDKIKTSLDFQEEASSKELNMKLFRPDEERNVYTYPGHSYIPVVDG
                     SLRLSDLPYFRSLINSNIQHLMNNSGPERLDSLMNYISGCHFMLHIFINSCLCELGYI
                     NEAFSLLVKLPKIYPKVYSNVLIREEDFIYLFEACKHRFNSLDIDSDYTQFNEAEQTY
                     QLLHEIKLFQESVNQRANVNMFSMKLHEIFISTMLSYRGITLEKISVYLDNLLRLSTV
                     NSPITILIDEPQFNKLKSLCSTANELKYSKLVRMRD"
     gene            <443447..>444571
                     /locus_tag="DEHA2A05368g"
                     /db_xref="GeneID:2899934"
     mRNA            <443447..>444571
                     /locus_tag="DEHA2A05368g"
                     /product="DEHA2A05368p"
                     /transcript_id="XM_456555.1"
                     /db_xref="GeneID:2899934"
     CDS             443447..444571
                     /locus_tag="DEHA2A05368g"
                     /note="similar to uniprot|P39952 Saccharomyces cerevisiae
                     YER154W OXA1 Translocase of the mitochondrial inner
                     membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05368p"
                     /protein_id="XP_456555.1"
                     /db_xref="GeneID:2899934"
                     /db_xref="GOA:Q6BZ14"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="InterPro:IPR028055"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ14"
                     /translation="MFRTCMARSQRAIRIQNVLRPNILSVTPVFLNQTSTVRFNSTKS
                     SEIADKVSEIKNELTSFDHQASPTGYVSDMTSDQLGYLDSIGLAQGYGPTALIERLLE
                     YSHVYTGLPWWATIIVTTVAVRSVMFPLYVKASINGAKMAKIKPELDQVMQELREAEN
                     PQEQVQAAHKRKALMKDNDVHMSHQMFPVLQLPIAYGFFQGLRKMANHPVEGFSTQGN
                     AWFADLTQVDPYCGLQIISAAVVVSMVRLGGETGAAAMNPMMKKVMTYVPILSIFITK
                     ELSAAVVLYFAANSIFSFIQALVLRNKYFRKFAKMPPIVAPASIPGAKQPPATVSEWW
                     KEFNQNMNQNVGKKMKESNTKLGAIHKRKSGISNGFIKKH"
     gene            complement(<444755..>450124)
                     /locus_tag="DEHA2A05390g"
                     /db_xref="GeneID:8998114"
     mRNA            complement(<444755..>450124)
                     /locus_tag="DEHA2A05390g"
                     /product="DEHA2A05390p"
                     /transcript_id="XM_002769937.1"
                     /db_xref="GeneID:8998114"
     CDS             complement(444755..450124)
                     /locus_tag="DEHA2A05390g"
                     /note="weakly similar to uniprot|P39960 Saccharomyces
                     cerevisiae YER155C BEM2 Rho GTPase activating protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05390p"
                     /protein_id="XP_002769983.1"
                     /db_xref="GeneID:8998114"
                     /db_xref="GOA:B5RSQ6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR015767"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ6"
                     /translation="MRKIWSQRKERDKRKSFMSIYSSNEQQEHEKPSGGHGESDGLDD
                     QSTLANSTIGSIPESSESDYTVGTKNSVRSVSTLAKNDYDQHTVKNAWLNVTVGTSSV
                     HDMSENMLRVYRAELKGSHMYLYKPMVLNARRFQLADATEEADQHPDIFNHNNESGVS
                     EQSVAQEDTSNEFPQLTFFRIDMAHPGLKYDFDRRQFLLDSTVEALVHFLLFQTNSLY
                     TISTGQLIETLPLFPDFGAVIRLVLSFLTNLFDSKLKGEFNAQIMTERILRLLSNIEE
                     NFQGFLVRCEVYPIILKIIEVLSDNLQHDDIVHKVQAFKTNLVGKQNSIIESVTYDLP
                     SENPFHALNSNVFINDINVIDFSKTINFIDLNFFKNWNSNIDKSLLLYSSLKDNSAQD
                     FFYKKNPLIFDNDHHIHYLSRLLINHMFIENISGKNNNFLERKARLIEKWIDLGCFLE
                     KSGNMSSWLGIASIILSQPILRLTRIWYLVSPDYIRLLKNDWSPVLFELDRRFLVNGS
                     INSDQISKTSDSLNLKFDDFTSRDSYHIMAPRGLGKIYPKENVIPYFGDLIMNNHSTD
                     INELESIWKRINYSFNRWNEYLSSLTNYDEIIKYNDDVLRRYDNMGFIFSNESLNQVL
                     YLGVNSDDTKPLPAKYKDSSSSNINTDLHKKLLKLIEVNCDSTNLEKIMKLSLLMEPE
                     LPESYLKVPIDTSSANSDGPNATISSISIHSNDSSGSLNTPLNDSNISLPSSQQQSLG
                     DDRASKIPTFNNNYFKIALAKYDDLLLQNISSEQKSKLQSLDSSVIKHNFVIDDELTL
                     RVDDFVTDLESSFINSSTLQGLEDDDDDEIPGLGIDVDDILNSDKFNHIDINDNSEPT
                     IQNEEKPINKNKRSKNYSLISSDSSKFSPHSGYIPKYASIDRLIDLLLIDAKYFNENI
                     SINLSEYRFVFLLNYNSFITTKELLDKLSHRFINSSNAIISIMKKLYLIKNGNVDIQS
                     QLEFPNWNLDTSVNINELGNVDYEALLEIQTNILKVLIVLINNFYSNFVNDLINKKIF
                     IKLLKLFSNEILQWYNSNKIDSHLEKAFENLVKYYKKLKKLFIKKTYRPIEMSKFDEN
                     LIKEFRFSNSLHDVPINRNLPGHKNLNKVEKFLHKFNKLLTTFYKLIKTEDWIKIYKI
                     LENQFEKHSLLGFNLQKASTNDDNMIISNIFNFFESLSDPQEKQLVLKQFPLVFRKLF
                     KLYFKFRSYLLIQLSDLNITVDERLDRMKTLLLMLKISKMKMSDNQFVFEGDQDNIPS
                     CIETAISNVIYLPESRLFASLWIKASMSLNDDSSNLSFDDINSLLPTNISEANFAINE
                     PLLPCFGWIIENLIEANKCPSFHKQIINFNKRYLIYKIIKELCIEDIDGQESNGFNCH
                     ENREFDFLLKLDESLVNRQRIKDFIVGQDKERSRLFRSVLHDQHKILALDNKKKHMRD
                     GSGSNMSINPTSSMHTLSKKSSSSSLRRQSLSYKSNSSSRFKISGIFSKSRPFSLNAS
                     STSERIISSNELPNVESYADPKQKAFLIIPLKNKKIFPVYSLPFAFKIDSDSPNEDSF
                     FQAPNESELNDWLVKLNYANRHWFYSKNLNLKANHSCSTFGIPIEVVCNRDQSLVPRF
                     LVVIFEEIENEGIKDTGIYRISSSVSELNHVKSIIDKTGTISFNERAYNPHTLASCVK
                     SYFRELPDALLIDQVIEGFFTLEKESPEKSDSSSVIENYRQILKNLSTPNYQTLKLLL
                     KHLQKVSQFSEHNKMTASNLATVIGPALTEASNLDCLINNFGFMNSILEKLITNYDYV
                     FQDGS"
     gene            <451205..>452866
                     /locus_tag="DEHA2A05412g"
                     /db_xref="GeneID:2899936"
     mRNA            <451205..>452866
                     /locus_tag="DEHA2A05412g"
                     /product="DEHA2A05412p"
                     /transcript_id="XM_456557.1"
                     /db_xref="GeneID:2899936"
     CDS             451205..452866
                     /locus_tag="DEHA2A05412g"
                     /note="similar to uniprot|P32048 Saccharomyces cerevisiae
                     YNL073W MSK1 Mitochondrial lysine-tRNA synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05412p"
                     /protein_id="XP_456557.2"
                     /db_xref="GeneID:2899936"
                     /db_xref="GOA:Q6BZ12"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ12"
                     /translation="MVSSRMWINRARRYVVGKGGMSLNRKLMSTSESETVNYANRKTI
                     IEQKPQGYYPPIDTIRPNDAKRSRIPNFRQSFEMVDFVQYPSKRYPELYNIEGKITSI
                     RKSGKAMYFIDLIQDGAKVQIMASNKLMQMTAQEFDDAHAFFRKGDFISCVGHPSVTN
                     VGELSLKLCRPINLASPCLNSMTIPDKIKDRGLINSNRVLDYLVNADSKQRLMIKSIV
                     IQAIRQFFVKRDFMEVQTPILGGYGTGANAEPFKTISNALKSTGDGSKYLQLRVAPEL
                     WLKKLVISGFDKIFEIGQNFRNEGIDSTHNPEFTTCEFYQSFTNLNELMILTEELFVE
                     IFDTLKEKKLSLVDEQLPSLSALASGTFPKYEFIPTLESKTGVALPSELTAESLIEYY
                     NSIGLEVPVLKSPSNLLDNLSSIYLESISQDTKTPIFIYNQPSVLSPLAKSAILDYDG
                     RSYDISLRFELFIQGKEYVNSYEEENSPFEQSKKFKLQQLTKTQFNDNEMIIPDWEYI
                     KSMEYGLPPTGGWGCGIDRLCMLFSGSERIEEVLSFGNIRDVVRQ"
     gene            <453073..>455499
                     /locus_tag="DEHA2A05434g"
                     /db_xref="GeneID:2899937"
     mRNA            <453073..>455499
                     /locus_tag="DEHA2A05434g"
                     /product="DEHA2A05434p"
                     /transcript_id="XM_456558.1"
                     /db_xref="GeneID:2899937"
     CDS             453073..455499
                     /locus_tag="DEHA2A05434g"
                     /note="similar to uniprot|P15303 Saccharomyces cerevisiae
                     YPR181C SEC23 cytoplasmic GTPase-activating protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05434p"
                     /protein_id="XP_456558.2"
                     /db_xref="GeneID:2899937"
                     /db_xref="GOA:Q6BZ11"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ11"
                     /translation="MDFYQREENDGVRFSWNCVPRTKLQHQRNVIPLASMYTPLNNKS
                     SIPVAPANDMVVCRQCRSFINPYVTMTEQQPDVWYCQFCQFANRLGQNQVAPSGLSPE
                     CSTIEYSTGRLSKFPPIFFYVVDTCFVDEDLEDAYRSLKESLVISLSLLPENSLVGFI
                     SFGKNVQIHDLSSEGIGKQHTFNGGKEYTLEQIQKSLGLLAAGLRSQSNHNSQHDPIN
                     ELLGPIGRKFLQPVSMAEYQLTSIIENLVPNRFPYPVMKERASRSTGSALNIASLLLS
                     AVLGDTGTTGGHIMCFVGGVCTFGPGRIASNQLKEPIRSHKDIEKAHQTLPSVPINGS
                     NSKPDISLVKSAKKFYEKVTKSLVAMGLSCNIFIGSYDQIGLYEMDEVCYKTGGVVVM
                     SDSFNTAIFKQSFIKFFNKQQEENSEYLDMAFNATLECRTTLDLQIQGLVGNATKLPY
                     RKDNRYIEPIISKVSIGEGNTNTWKLCNTNPQSTYAIYFDKLDSQSIGFSYVQYLFHY
                     QHPSGELRLRVTTVPVTVIADTDITNLELGFDQEASIVLIARESINKLQPIHENSDKS
                     HYDPSDVLKHLDKSLIDYCTRYAVYTKGMLESFRLSAAFALLPQFMYYLRRSPFIRIF
                     NNSPDETSFVRHIFMHEDVGNSLIMIQPTLLSYDVDNFGAIDEETGETNTEPEPVLLD
                     SLSLGPSKVLLLDTFFHILIYHGSKVAQWRKAGYHTMEGYEHFKEFLEAPKREAMEIL
                     IDRFPLPRFIDCDEGGSQARFLMANLNPSTSYASNPNNMYGGQLDVLTDDTNLQSFMD
                     HVQKVIILKK"
     gene            <455675..>456343
                     /locus_tag="DEHA2A05456g"
                     /db_xref="GeneID:2899901"
     mRNA            <455675..>456343
                     /locus_tag="DEHA2A05456g"
                     /product="DEHA2A05456p"
                     /transcript_id="XM_456559.1"
                     /db_xref="GeneID:2899901"
     CDS             455675..456343
                     /locus_tag="DEHA2A05456g"
                     /note="some similarities with CA2444|IPF13883 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05456p"
                     /protein_id="XP_456559.2"
                     /db_xref="GeneID:2899901"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ10"
                     /translation="MKRKWASSDIEKISEKVYKNQSLQILQVPTFKVQKYNVQQLNKL
                     QIPPTLESVSESPKATAWVSDLLHSMFNSTDEIKFDDQDEPCTNGNNGVKVLVFLGAM
                     GKEYITSIRGQLEHYVDSMIFISSSLKLDSCDAGHHSDDQQCLQLSTYFELIDPLGGG
                     AYPLDYLVVVDSQDYIRCRIPIRICRNNFHSPHEKFGVDLERLPSLIEEYMQHFMSIS
                     AITY"
     gene            complement(<456394..>457062)
                     /locus_tag="DEHA2A05478g"
                     /db_xref="GeneID:8998128"
     mRNA            complement(<456394..>457062)
                     /locus_tag="DEHA2A05478g"
                     /product="DEHA2A05478p"
                     /transcript_id="XM_002769939.1"
                     /db_xref="GeneID:8998128"
     CDS             complement(456394..457062)
                     /locus_tag="DEHA2A05478g"
                     /note="similar to uniprot|P53930 Saccharomyces cerevisiae
                     YNL107W YAF9 Subunit of both the NuA4 histone H4
                     acetyltransferase complex and the SWR1 complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05478p"
                     /protein_id="XP_002769985.1"
                     /db_xref="GeneID:8998128"
                     /db_xref="GOA:B5RSQ7"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ7"
                     /translation="MSSSSKRIKNVSIAVPVLYGNHSVRLAPEKRTEKTPPDHTHEWT
                     IFFKPVLDNIDLTPLIKKVTFKLHETYDTPVRSIEKPPYQVTETGWGEFEIIIKLHFH
                     SGAELGINEKNFQIFHGLKLHPFNPQHPPKENGEVHSVLYDELVFQEPTEKVFEILTQ
                     KPSNLLPYKLSDESKRDQEYVRPDEIDELARLDVYINKVREEIENQRDQYKDLEQERL
                     ALLQ"
     gene            complement(<457313..>459262)
                     /locus_tag="DEHA2A05500g"
                     /db_xref="GeneID:2899904"
     mRNA            complement(<457313..>459262)
                     /locus_tag="DEHA2A05500g"
                     /product="DEHA2A05500p"
                     /transcript_id="XM_456561.1"
                     /db_xref="GeneID:2899904"
     CDS             complement(457313..459262)
                     /locus_tag="DEHA2A05500g"
                     /note="weakly similar to uniprot|P32901 Saccharomyces
                     cerevisiae YKR093W PTR2 Functions in transport of small
                     peptides into the cell"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05500p"
                     /protein_id="XP_456561.2"
                     /db_xref="GeneID:2899904"
                     /db_xref="GOA:Q6BZ08"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ08"
                     /translation="MTSVKEINEKDPGKDEYSVDERAEHEVAETHLNANHDNASIVSK
                     EEFEDEGIYDFDDSNNYSTTFVDDHNPMGLRKPTKQEASSLRRVLGRADWACYMICVA
                     EFAERASYYSCQTLLSNFVTNPLPEGSGTGKLMPGSVNPGALGLGVPTATAITYTLTF
                     VAYLVPLYAGYVADSQIGKFRAIWIGVICGFFAHILLVIAAIPAVIEGGNAIVPTAFG
                     IITLAFGTGFIKPNLLPLLLDQYPEESDVVKLLPSGEKVIVDRQKSLERMVLVFYWSV
                     NLGALFPIPSVYIEQRIGFWFAFFIPIIIYLIIPAVFWFVRPRLKKEKLQSSVMVNTN
                     KILKVSFRGNWIKRIRNNTFWDYAAPTNMNARGEEYYSAKKKKPITWTDQWVLDVKQI
                     VNISKVFLYFVIFNLCDAGGTGATPALTAQSGSLTSDGTPNDIYSSFNPITIIFLIPI
                     LDYGIYPLLRRWKIDFRPVLRITFGFLLAALSQVAAAVIQKEIYNQIECGDHATECVE
                     KGIVAPFSAWVSVMPYILSAASECFANTSGYELGYTRAPPHLKGFVQALFLLATALAA
                     AIGDAISPALKDPNLVWYFAALAIVGGVFTVLFYVHFRNLHKIMGQESKLRAIMMRQE
                     NEKEVSEVNNLASITSVPSVAVKQI"
     gene            <460828..>461064
                     /locus_tag="DEHA2A05522g"
                     /db_xref="GeneID:2899681"
     mRNA            <460828..>461064
                     /locus_tag="DEHA2A05522g"
                     /product="DEHA2A05522p"
                     /transcript_id="XM_456562.1"
                     /db_xref="GeneID:2899681"
     CDS             460828..461064
                     /locus_tag="DEHA2A05522g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05522p"
                     /protein_id="XP_456562.1"
                     /db_xref="GeneID:2899681"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ07"
                     /translation="MESYNQNPPEWFTNEMSEIKRDIKYLRRDIKDLKGEFKDLKRDL
                     NKDVKDLKIEFKDLKRDLNKDVKDLKGEFKDLHI"
     gene            <461344..>462018
                     /locus_tag="DEHA2A05544g"
                     /db_xref="GeneID:2899682"
     mRNA            <461344..>462018
                     /locus_tag="DEHA2A05544g"
                     /product="DEHA2A05544p"
                     /transcript_id="XM_456563.1"
                     /db_xref="GeneID:2899682"
     CDS             461344..462018
                     /locus_tag="DEHA2A05544g"
                     /note="some similarities with uniprot|Q9Y7S0
                     Schizosaccharomyces pombe SPCC569"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05544p"
                     /protein_id="XP_456563.1"
                     /db_xref="GeneID:2899682"
                     /db_xref="InterPro:IPR013902"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ06"
                     /translation="MTEQINELFPRLGSCFEDTLTEMIEKKVNDNIQSIVEQTLESLN
                     QNPPEWFTNEMREIKKDIKDLKGEFKDLKRDLNKDVKDLKIEFKDLKRDLNKDVKDLK
                     IEFKDLKRDVKRDLRDFKGDMDSGFKMSEYSHIRLYNMFRRMNGYPATPVPFLNVEAI
                     MNELPPIGSVQDIDSLSKEECQTYLRAYNVEFHPNESVKLKERLRDAVGLAISYDLEF
                     QFGSFQ"
     gene            complement(<462752..>466213)
                     /locus_tag="DEHA2A05566g"
                     /db_xref="GeneID:8998141"
     mRNA            complement(<462752..>466213)
                     /locus_tag="DEHA2A05566g"
                     /product="DEHA2A05566p"
                     /transcript_id="XM_002769941.1"
                     /db_xref="GeneID:8998141"
     CDS             complement(462752..466213)
                     /locus_tag="DEHA2A05566g"
                     /note="similar to uniprot|Q12271 Saccharomyces cerevisiae
                     YOR109w INP53 Phosphatidylinositol 4 5-bisphosphate
                     5-phosphatase or uniprot|P50942 Saccharomyces cerevisiae
                     YNL106c PIE3 Phosphatidylinositol 4 5-bisphosphate
                     5-phosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05566p"
                     /protein_id="XP_002769987.1"
                     /db_xref="GeneID:8998141"
                     /db_xref="GOA:B5RSQ8"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ8"
                     /translation="MMKVVYKENPRTICIRSDTHSLCFEELNTNRSKHLLKESAVAVE
                     LLPNDQITKENGFKPLLKKEVFGCLGLISIDKKAFLAVITGAMTDVAHPVVYESVDKI
                     YSVDFVSLSSDEWDFVSFDTSGLPLASTADEFEAENNYAREPHPCHEMQKLLSNGSFY
                     YSNDFDLTSLIQNRGIQNLRLHHEKEGVRKINLEHYSEEYMWNSFMMCEIFEFRSKLD
                     SYVQSTLDDNRFLTTVIRGFAKTVNLNSSGESMTIISKQSWKRAGTRFNARGIDDNGN
                     VANFVETEFIFNQPTREQITSFTQIRGSVPTFWEQDSTLINPKITLTRSLEATQPIFN
                     KHFTEICQKYGVCHIINLLSKTKPAEVQVSRRYKQLYTGSNRRDEMAFSEFDFHHETK
                     QSSGGFAGATKILPMLYDSLENFGWFVYDSDQGETVTRQDGVFRTNCLDCLDRTNLIQ
                     QVICQSILEHTLQNQRGSREGNHERYAVEDLVNKHNTLWADHGDAISQIYTGTNALKS
                     SFSRSGKMNFAGALSDVTKSVSRMYQNTFLDSKKQSTMDLLLGYDAQNSLPVRIYDPI
                     NEFVQEKLHGEAGSFTTWNDINIFVGTFNVNAAVPHGKVDLASFLFPPENTEIELPDV
                     YAIGLQEVIELNAGSILSSDSSKPSLWAKLLETQLNSQGEPYLLLRTESIASMSLFLF
                     VKKSQVHKVTQVAGSSKKTGLGGIAANKGACGVRFEFGSTSFVLVTSHLAAGTTALVE
                     RYNDYMTIMSGLTFTRNFTIKDHDHIIWFGDLNYRVSLPNDQCRYFIENGAFDELTAV
                     DQLNQEMTRKGAFYGFKEGAIKFYPTYKFDKGTSNYDSSEKQRIPSWTDRVLYMTSKG
                     VDPIKQLNYNSCMNIVVSDHKPVYSTLKSRVKFVDEDKKIKLSKHLYDIYKKEHGDIG
                     EVSLLELSDSMTSSSKPSSLNSDSGFSMDTLSEMNLLDDADTDAPKLPARPMERTNTL
                     PKRIPPPRMSRKQISSDQTKTASNAFPRKLPPTPYNQEVLVPSPSKSISNPLSRSPTA
                     STSASTPPPPPPSRKVGNPVKPPIGFSSTPLISSRSNSATPSRGSPISTPSTTGNEQN
                     QEHPKLNPIVPTKPASLASSKTKSSSSEATSASYIPNSTPATSARSTSSDGNGKSMSE
                     WKPLMPS"
     gene            <467160..>467345
                     /locus_tag="DEHA2A05588g"
                     /db_xref="GeneID:2899906"
     mRNA            <467160..>467345
                     /locus_tag="DEHA2A05588g"
                     /product="DEHA2A05588p"
                     /transcript_id="XM_456565.1"
                     /db_xref="GeneID:2899906"
     CDS             467160..467345
                     /locus_tag="DEHA2A05588g"
                     /note="similar to uniprot|P53507 Saccharomyces cerevisiae
                     YNL070W TOM7 Involved in mitochondrial protein import"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05588p"
                     /protein_id="XP_456565.1"
                     /db_xref="GeneID:2899906"
                     /db_xref="GOA:Q6BZ04"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ04"
                     /translation="MASPNYQITLSDESKERITKVLEYSKTIAHYGFIPFVLYLGWSA
                     TPNRPSLFNLLSPFPSA"
     gene            <467833..>468801
                     /locus_tag="DEHA2A05610g"
                     /db_xref="GeneID:2899907"
     mRNA            <467833..>468801
                     /locus_tag="DEHA2A05610g"
                     /product="DEHA2A05610p"
                     /transcript_id="XM_456566.2"
                     /db_xref="GeneID:2899907"
     CDS             467833..468801
                     /locus_tag="DEHA2A05610g"
                     /note="similar to uniprot|P40464 Saccharomyces cerevisiae
                     YIL134W FLX1 Protein required for transport of flavin
                     adenine dinucleotide (FAD) from mitochondria"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05610p"
                     /protein_id="XP_456566.2"
                     /db_xref="GeneID:2899907"
                     /db_xref="GOA:Q6BZ03"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ03"
                     /translation="MAVEQASNGTMFSRRQVEIISGLVAGFSTTIVMHPLDLIKIRLQ
                     LSPEINTKRFKSLIDVISKINTSATTDFHQYKQAHHSSGIKSAILGRYKLPHTVLQYY
                     RGIGPNIGGNIVGWSLYFTLYAEFKRLIDFSSPTANYFTSSTAAGVTTGLLTNPIWVL
                     KTRILGTTRSDTGAYRSVTDGVKNMLQKEGIRSFWKGTIPGLFSVFQASLQFTFYDHF
                     KQYQLSKKSSTTDTLSTGEYIASSAASKILSTIIAYPSQVIKSRLQNSTTEYKSVIST
                     CKDVWHNEGHWRGFYKGVGTNMLRVVPATCITFVSYETAKDILSHM"
     gene            <468959..>470086
                     /locus_tag="DEHA2A05632g"
                     /db_xref="GeneID:2899908"
     mRNA            <468959..>470086
                     /locus_tag="DEHA2A05632g"
                     /product="DEHA2A05632p"
                     /transcript_id="XM_456567.2"
                     /db_xref="GeneID:2899908"
     CDS             468959..470086
                     /locus_tag="DEHA2A05632g"
                     /note="similar to uniprot|P53942 Saccharomyces cerevisiae
                     YNL072W RNH201 Ribonuclease H2 catalytic subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05632p"
                     /protein_id="XP_456567.2"
                     /db_xref="GeneID:2899908"
                     /db_xref="GOA:Q6BZ02"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ02"
                     /translation="MVLMTLFLITPASRPRDMTESKRKPLSDSEEVDQVATKKRKLEQ
                     ENSPGNNAWVPPSITDISEPLNFDSSTYHSAIPREIKADITAPVVLGVDEAGRGPVLG
                     PMVYGIAYSLESYSKDLQTKYGFADSKTLKDDKRRQLFQMIENEDHELHGHVGWATTT
                     MTAKDISSGMLQTVLGKGSYNLNEQAHDTTIQLIKQVLAKGVNVTKVFVDTVGPPASY
                     QAKLSKIFPTVAITVAKKADSIYPIVSTASVVAKVTRDLNLHFYNIHLPLIHNHALGS
                     GYPSDPNTSKWLHANVDRVFGWCFGLVRFSWQTSKDSLEKNNAVPVVYEAQCIKEDSG
                     YHDVGDFFSSSDSPAANSGPDSSAPSLTIDSSYYGSTNVSL"
     gene            <470311..>471714
                     /locus_tag="DEHA2A05654g"
                     /db_xref="GeneID:2899909"
     mRNA            <470311..>471714
                     /locus_tag="DEHA2A05654g"
                     /product="DEHA2A05654p"
                     /transcript_id="XM_456568.1"
                     /db_xref="GeneID:2899909"
     CDS             470311..471714
                     /locus_tag="DEHA2A05654g"
                     /note="similar to uniprot|P12695 Saccharomyces cerevisiae
                     YNL071W LAT1 Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05654p"
                     /protein_id="XP_456568.1"
                     /db_xref="GeneID:2899909"
                     /db_xref="GOA:Q6BZ01"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ01"
                     /translation="MSALIAASRSTMAFRAVACTKQYSAGYLQLARLYSSGKFPPHTV
                     INMPALSPTMTQGNIGSWSKSVGDELHAGEAIAEIETDKASMDFEFQEDGYLAKILLG
                     DGTKDVPVGKPIAVYVEESEDVQAFESFTAEDAGDASTEAKAPEPEKESKAEESKPEA
                     SEKKSKSESAPAQSKPVAGRIFASPLAKTIALDKGIALKNIKGSGPNGRIVAKDVENF
                     KAPAAAAAAAPSATAAAYEDVPISNMRKTIATRLTQSTQESPSYIVQSQISVSKLLKL
                     RQSLNAAADGRYKLSINDLLIKAIALANLRVPEANSAWLLDQGVIRTYSNVDVSVAVA
                     TPTGLITPIIKNAHTKGLSAISNEIKELGKKAKAGKLAPEEYQGGTITISNLGMNHAV
                     NSFTSIINPPQSAIVAIGTVDKKAVPSNVNEQGFVFDDVMTITGTFDHRTVDGALGGE
                     WIKALKTIVENPLEMLV"
     gene            <472012..>473476
                     /locus_tag="DEHA2A05676g"
                     /db_xref="GeneID:2899910"
     mRNA            join(<472012..472820,472957..>473476)
                     /locus_tag="DEHA2A05676g"
                     /product="DEHA2A05676p"
                     /transcript_id="XM_456569.1"
                     /db_xref="GeneID:2899910"
     CDS             join(472012..472820,472957..473476)
                     /locus_tag="DEHA2A05676g"
                     /note="similar to uniprot|Q12415 Saccharomyces cerevisiae
                     YOR110w TFC7 TFIIIC (transcription initiation factor)
                     subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05676p"
                     /protein_id="XP_456569.1"
                     /db_xref="GeneID:2899910"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BZ00"
                     /translation="MTLKTIYIARHGYRANWLPPPHPPNPTGIDSDPPLASHGIDQAK
                     QLAGYLNSLPAKEQPQFILSSPFYRCVQTSEPICDMLSVPLVLERGVGEWYKKDRGIV
                     PEPANYDVLKPFFSCLRDASEWDRDSTVGVIPSLDGESEEDIFARCVQFWKEFIPIFE
                     AKYPEITTILIVTHAATKIALGMSLLKFHDVYEAIDNDNTVLRAGACSLDKYERGGDD
                     WSIKMNGNCEFLLDGEEMNWNFHSAFEAGSDEDIKARRAEAKRKAEASNTKDKNFYVT
                     IDVPMIGNSNLSQFEDVNQPASQSKQDSKENITSNSKQNYIKSSSHLQVTDLNNKTPL
                     IKLSNSNVNTDNDSINNLSVIDGNIYQTNWTKLVGTELVFDDYGELIGSVREHLKCDE
                     NIKITSKNEKDKKDTDIADDDSDVKVKDEQTSFLLKAIKSAKRKEAEVEV"
     gene            <473632..>474291
                     /locus_tag="DEHA2A05698g"
                     /db_xref="GeneID:2899911"
     mRNA            <473632..>474291
                     /locus_tag="DEHA2A05698g"
                     /product="DEHA2A05698p"
                     /transcript_id="XM_456570.1"
                     /db_xref="GeneID:2899911"
     CDS             473632..474291
                     /locus_tag="DEHA2A05698g"
                     /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
                     YOR111W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05698p"
                     /protein_id="XP_456570.2"
                     /db_xref="GeneID:2899911"
                     /db_xref="GOA:Q6BYZ9"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ9"
                     /translation="MYFNHPLYDWLKQFQFVLASTSPRRLEILQKNLQIQDITIMPSN
                     FEENLSKEEHTCQEYVSNTSLGKGQAVMKQLISQNGPSSVIVSSDTIITCNQEVFEKP
                     QTKETQLEMFRKYCQHPDLEVITSVNVIKYDSATKDSIIKSAIEITKLRFNDELSDEF
                     LQYYVDSEEGLHVAGGFKYQNLGCLLFKSIEGDYFNIVGLPARTTFQLLSDILQPIER
                     F"
     gene            <474993..>475763
                     /locus_tag="DEHA2A05720g"
                     /db_xref="GeneID:2899912"
     mRNA            <474993..>475763
                     /locus_tag="DEHA2A05720g"
                     /product="DEHA2A05720p"
                     /transcript_id="XM_456571.1"
                     /db_xref="GeneID:2899912"
     CDS             474993..475763
                     /locus_tag="DEHA2A05720g"
                     /note="similar to uniprot|P53927 Saccharomyces cerevisiae
                     YNL110C NOP15 Constituent of 66S pre-ribosomal particles"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05720p"
                     /protein_id="XP_456571.1"
                     /db_xref="GeneID:2899912"
                     /db_xref="GOA:Q6BYZ8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ8"
                     /translation="MGKFSNNKKQNADKKIEDIEKDLQLPESSEEELSGEEEGAEIGD
                     ESDEDSEELEGFSSDSDEEDDVDDKETKQHSTTKTSPTEKHIQASGHTVTKKKAVSAA
                     SNPTKSKRGVIYVGRIPHGFYEAEMKKYFTQFGDITRLRLSRNKKTGKSKHYGFIEFA
                     HHNVAKVAAETMNNYLLFGHLLKVHLVEDPNIHEDLFQGANMKYKVIPWKKIGQNKND
                     AARSKEKWDTLSQKWSKKRALKQKQLSDKGIDFDLSTI"
     gene            <475989..>476360
                     /locus_tag="DEHA2A05742g"
                     /db_xref="GeneID:2899913"
     mRNA            <475989..>476360
                     /locus_tag="DEHA2A05742g"
                     /product="DEHA2A05742p"
                     /transcript_id="XM_456572.1"
                     /db_xref="GeneID:2899913"
     CDS             475989..476360
                     /locus_tag="DEHA2A05742g"
                     /note="similar to uniprot|P40312 Saccharomyces cerevisiae
                     YNL111C CYB5 Cytochrome b5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05742p"
                     /protein_id="XP_456572.1"
                     /db_xref="GeneID:2899913"
                     /db_xref="GOA:Q6BYZ7"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ7"
                     /translation="MSEGEDLKAYTLDEVSQHNTVEDLWVVYNGGVYDITKYIDEHPG
                     GEEVVIDVAGMDATEAFEDIGHSDDAREILKGLLIGKVEGGNIKSPVSTATQPESTGS
                     SMPMLAIFVLLIAAGVYFYIK"
     gene            <477120..>478289
                     /locus_tag="DEHA2A05764g"
                     /db_xref="GeneID:2899914"
     mRNA            <477120..>478289
                     /locus_tag="DEHA2A05764g"
                     /product="DEHA2A05764p"
                     /transcript_id="XM_456573.1"
                     /db_xref="GeneID:2899914"
     CDS             477120..478289
                     /locus_tag="DEHA2A05764g"
                     /note="similar to uniprot|Q12723 Williopsis mrakii
                     2-nitropropane dioxygenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05764p"
                     /protein_id="XP_456573.1"
                     /db_xref="GeneID:2899914"
                     /db_xref="GOA:Q6BYZ6"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ6"
                     /translation="MSKYQQSSLFIKRLGLEYPIIQSPMAGISTIKLASVISSNGGLG
                     SIPLASVDARKQSGIDSIDKQLNEFKSLAKTNVVNVNFFCHNHEEQQTPTATQTENWH
                     KLLGKASPSINKDIPSLQKSNISLTEVESNHPELFVQLLEKLVQCKPKVVSFHFGFPS
                     QKAIKFLQENGIMVFVTVTSVKEAKQLIDLKVDGLVSQGYEAGGHRGNFLLSEILDEN
                     LSTFSLFTQIKIIVDNASWKPFIIPAGGIMDGKTIENYLANGASGVQLGTIFLSTPES
                     NSNDFIKNVVSESNDTPTIMTRLVSGKPARCLRTPFIQALIEDCDNLKLDDQPPYGYA
                     YYGYKTMAGLLKDPRYGFYLAGQNYHQISPDFNTEQVFLKLVDELKQAGFDAQAV"
     gene            complement(<478708..>479460)
                     /locus_tag="DEHA2A05786g"
                     /db_xref="GeneID:2899915"
     mRNA            complement(<478708..>479460)
                     /locus_tag="DEHA2A05786g"
                     /product="DEHA2A05786p"
                     /transcript_id="XM_456574.2"
                     /db_xref="GeneID:2899915"
     CDS             complement(478708..479460)
                     /locus_tag="DEHA2A05786g"
                     /note="similar to uniprot|P38340 Saccharomyces cerevisiae
                     YBR261C Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05786p"
                     /protein_id="XP_456574.2"
                     /db_xref="GeneID:2899915"
                     /db_xref="GOA:Q6BYZ5"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ5"
                     /translation="MPVKSIQVNGEYIMDEGLAADSQINYNDAIDYWTGVPASVDGVL
                     GGFGEQTAVPKADIVGSSTFLRKLQTRMTCPDGVEKLTIDMGAGIGRITRDLLWKVSD
                     KCDLLEPVKPFVAQMNNELVGVKNRGKLGDIYDIGMQEWECDANKVGKYWLVWCQWCV
                     GQLPDEELVKFWERCRTALIGNGIGTLIVKENIAPDDDIFDETDSSVTRSDAKFRELF
                     IKAGFKLIASDIQKGLPKELYPVRMYCLKPNN"
     gene            <479654..>480184
                     /locus_tag="DEHA2A05808g"
                     /db_xref="GeneID:2899916"
     mRNA            <479654..>480184
                     /locus_tag="DEHA2A05808g"
                     /product="DEHA2A05808p"
                     /transcript_id="XM_456575.1"
                     /db_xref="GeneID:2899916"
     CDS             479654..480184
                     /locus_tag="DEHA2A05808g"
                     /note="similar to uniprot|Q12146 Saccharomyces cerevisiae
                     YOL146w PSF3 Subunit of the GINS complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05808p"
                     /protein_id="XP_456575.2"
                     /db_xref="GeneID:2899916"
                     /db_xref="GOA:Q6BYZ4"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /translation="MTSNYFDLDDILSDGEKIPCRFNITVPGLGYLEGNPGKSIAKDT
                     KIELPLWLAEILAICELSEDSQQSFIDLSQPDFINYKVINAIKTNAVNIDLHSILTNY
                     YKLSEKWASMFNDVELIEVVMQMLKERSFEINNYASNASKQINNNFIFSLDEFEKKLF
                     KVTSDSNKQMRKWLKD"
     gene            complement(<480322..>483756)
                     /locus_tag="DEHA2A05830g"
                     /db_xref="GeneID:2899871"
     mRNA            complement(<480322..>483756)
                     /locus_tag="DEHA2A05830g"
                     /product="DEHA2A05830p"
                     /transcript_id="XM_456576.1"
                     /db_xref="GeneID:2899871"
     CDS             complement(480322..483756)
                     /locus_tag="DEHA2A05830g"
                     /note="similar to uniprot|P89105 Saccharomyces cerevisiae
                     YOL145C CTR9 Component of the Paf1p complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05830p"
                     /protein_id="XP_456576.2"
                     /db_xref="GeneID:2899871"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ3"
                     /translation="MEDPIDVSFYLGKQAAETIGNLDVPLSNGQIVSINLVEELPEDS
                     NELISFLETENCPKKYWISVATAYAQSNKLNESLNVIKTAMGLSQFNNEDKLSFHSYL
                     SWLYLKFVSSGINKGENLVNATEELNHVSSLDSSKGSVSVLLAKAVLYLYKDQIEPAL
                     DIFDRLLKIDNNNCFALLGKAQIILNKTKNYANALKLYQQVLILNPLMKPDPRIGIGL
                     CFWFLKDEPMALSSWRRALELDPTNLKAKILLNLANFNINFNNSLGDKDFQLNYEKCL
                     KKLADNYKENSNDAIILLTLASYYFSKEEYSLVEKICNKVIHSISGNSASTKLYNPSK
                     VSRFQSNLLSQAAFWLGRVAFAKSDFMQSQKYFHEAIKLNENNLMAKLGLGQSQINRG
                     STEEATITYESILKTNPKCLEVNYSLGVLYSNHKSKRKQEQGISMLERYLRLAKNMGG
                     QPSNKNEDDGSEIMNQEPVALNAFLILSKLHESKDMNQSLTYLNKAIESRKQINQDAP
                     LEIYNNIGVFNFIKHNYEAASNIFQTASEKLKTCNDFKNENGDVLMDLRDDLNVTISF
                     NLARSKELSNESESIEIYESLLKDCPNYFSAKLRLLFLDCVSTNKSTKEEIKQEVENL
                     LDLNASDLEIRSFYGWFVKTFGKKVGMKPDADTNHQKDTLVEYDSHDCYALLSLANIY
                     CIMARDIKGSSQDEKKKKYYIRAVELFTKVLSVDPHNVYGAQGLAIVYIENKESNKGL
                     DILRKIRDSLNDISVYLNLGHVLLDLKQYSKAIENYEIALMRFANNDSKILSFLGRAW
                     LSRGLTEKNLSYLNNALSYSEKALQNATGAKSSLRFNMAYIQFQIAEFISKLPVEQRL
                     IDDIKKGIDNLNTAIETLNSLSSDDEKHPPYPKSELKARANLGTNTLLNRLNACLDET
                     VESVTKSEIRLKEAKELREQETAQLLQEQEERIAKERRIEEEMAKERAKLQEQAQQWA
                     EEARMNVIVDEDDDKLFNKESNMEEKKKRSKKSSTKGTKGKKKGKKRNVVSDSEDDAP
                     SPSEDESEPENDSKRKGEEDDNEEDEIKTSKKRKISKLSKETIEDSDDELDDDLFNEE
                     GDEPTGNDDELPNEDAVEEGQKENNEELPNESVEDEAQNEESQTEAQNENQSQDEQ"
     gene            complement(<483914..>487204)
                     /locus_tag="DEHA2A05852g"
                     /db_xref="GeneID:8998055"
     mRNA            complement(<483914..>487204)
                     /locus_tag="DEHA2A05852g"
                     /product="DEHA2A05852p"
                     /transcript_id="XM_002769942.1"
                     /db_xref="GeneID:8998055"
     CDS             complement(483914..487204)
                     /locus_tag="DEHA2A05852g"
                     /note="weakly similar to uniprot|P53148 Saccharomyces
                     cerevisiae YGL093w SPC105 spindle pole body protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05852p"
                     /protein_id="XP_002769988.1"
                     /db_xref="GeneID:8998055"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="InterPro:IPR028972"
                     /db_xref="UniProtKB/TrEMBL:B5RSQ9"
                     /translation="MNKENMGERPSRSILKNDATLPLLPSTNRLNRRVSFHPEVTLHK
                     INFVPVQVDKRRETIAIIPSSRDNSDSGNSSIESKDDSNSTTSDDNPIGTAHENADEN
                     LGTNGELDNGHNVDRDSDDDLANFEGNADEGEEETMELTGQFVPNPSAATNNTRDEEV
                     DQGDATDTANNADQIETFTKLKHTGVSVDSAANDIDSPPYYQDEDEGDMELTSNIGLN
                     HQNIVRLAENDVDAEKVNAEQPEQDIENHDIPSQAPEMNRDQASATDTGEYLHEDSMD
                     ILTYANGHKSLEYNVEVNNGEDQQTQQQNGNELEETMDITKFYSEINAQSSTSYMEND
                     HFNQEMTMDITKIYHQESRLELINEVPDAEPIMQYNEGSKIPENESIMEFTQEIGKIN
                     ISGEGADSRLGHIHLQENENETNSNNENDEQHQEDNGTNTEQPLEPDSKELMSDNIID
                     EIHTGNEDDDFETDKDEAYKESENLENEAENEGGNEGNEINELHSDNANEQSEQEQDT
                     NISSRYVTNTSVDETIQNTAKDTQDSLYMDLTQLEQDAEPQELAAADTNHEIDQPSQK
                     MQLTQEYGEIKQIQLKRTIDDAEPIPHKYPKIDNHGGINKTITTTIPLADISTESIDD
                     DDELDQNYTPVSLNDFLKDISIRFYDDLEIGIKSVDRISISLPKINNEESYKFDEFVT
                     AMNKMPLLELYDFSCKELTKNIKDGTVLFDQFNQFTMENNPRLFKQYYSSSPNEKLSM
                     KSEFQLIKDYTRLQAKEVWYGWRTQLIKNLIIQLDEKHYTLVQARSLLLENLTLLNGI
                     HEQLKDKFDNLSNQLNQLLQIESNCNDLDSSDLFSLRNELSVTCKQFKENQQNQTIQN
                     KELNKLNSVISDNKALINAFTDEINDVEKSLNRNKKYELSEIELLKLKFNFLQSFTNL
                     NYKYMEGTKLIFNFIGVEVAMEFKDIYDLSNISYSVDQNSSSPFNNSFITTNIAPKLF
                     NVISGSTIIESFQTFKKHWSVLKSIDEDIYAISWKLPIVFIESQDNLINFKIRYYCGK
                     HNFKVELFVSIDLSNLLDYPNNFQIRGQLIKSDTKISQQIILTNLFNDCVHTALVNRD
                     NQILIDGL"
     gene            <488372..>489049
                     /locus_tag="DEHA2A05874g"
                     /db_xref="GeneID:2899873"
     mRNA            <488372..>489049
                     /locus_tag="DEHA2A05874g"
                     /product="DEHA2A05874p"
                     /transcript_id="XM_456578.1"
                     /db_xref="GeneID:2899873"
     CDS             488372..489049
                     /locus_tag="DEHA2A05874g"
                     /note="similar to uniprot|Q12462 Saccharomyces cerevisiae
                     YOL147c PMP27 peroxisomal membrane protein - peroxin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05874p"
                     /protein_id="XP_456578.1"
                     /db_xref="GeneID:2899873"
                     /db_xref="GOA:Q6BYZ1"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ1"
                     /translation="MVADTILYHPTFGKLTRFLDSTPKREKCFRLVVYLSRFLSYYLQ
                     RQGFSPDVVNIFKDLKHHITIIRKGMRFLKPLNHLQAAAQTFDNKLMDPVLQKTTVIK
                     NLGYVGYLSLDSITWLKLMNILSAKRFPTISTWSSRFWLIALIAGVINSLRTLKISNA
                     KLEEKESEEINQKIYAAKRKLVWDFLDMFTCLNSLNYLHFTEGDVGLAGTITSIMGLH
                     DLWKSSK"
     gene            complement(<489335..>489556)
                     /locus_tag="DEHA2A05896g"
                     /db_xref="GeneID:2899874"
     mRNA            complement(<489335..>489556)
                     /locus_tag="DEHA2A05896g"
                     /product="DEHA2A05896p"
                     /transcript_id="XM_456579.1"
                     /db_xref="GeneID:2899874"
     CDS             complement(489335..489556)
                     /locus_tag="DEHA2A05896g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05896p"
                     /protein_id="XP_456579.1"
                     /db_xref="GeneID:2899874"
                     /db_xref="UniProtKB/TrEMBL:Q6BYZ0"
                     /translation="MSSIDSRIHETWSRLKASHNQVQQISVEAPSLEKIIADQPNSDE
                     LEKELKDLVMKWYWNGYYQGFDDNETKPK"
     gene            <489816..>492113
                     /locus_tag="DEHA2A05918g"
                     /db_xref="GeneID:2899875"
     mRNA            <489816..>492113
                     /locus_tag="DEHA2A05918g"
                     /product="DEHA2A05918p"
                     /transcript_id="XM_456580.1"
                     /db_xref="GeneID:2899875"
     CDS             489816..492113
                     /locus_tag="DEHA2A05918g"
                     /note="some similarities with uniprot|Q08287 Saccharomyces
                     cerevisiae YOL144W NOP8 Nucleolar protein required for 60S
                     ribosomal subunit biogenesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05918p"
                     /protein_id="XP_456580.2"
                     /db_xref="GeneID:2899875"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY9"
                     /translation="MNNEDIRELRIHIGNISPKLAENQSSLETRLGKFGKIVKPLELH
                     TKPIQDFYFGFITLELSNVSLEKLKNAFHGILFMGMKLTVGIAKQNFPESWIQDSKRP
                     DLLKLDRIKRDRIQRARTQRINEANTPYFMNNIDGSIVVSSLNIGANAALGYSKSSHT
                     FNDMSGNTKHTQPTQTLVGTKSYSTDTLSKDVACQSYSRTSGKGEIIKGRHRVTKRPH
                     IHFAKGHQTLRILINGELKQIQGYKTKLWGMEKHKTARDLTWKYHNGTWRSGDDHIIE
                     KNTTVKIRDPIIGGPQPIECGIDGEKADNYGADIEVDSEENELKEERNKNTAVLASLF
                     TNYDFDKPMDLSDVDDNGIDEKDIIYDSKGRRKVNRYDYEIEGKEDDDEGDVSKYNID
                     SKKAKELIDSYKQISERPKEEIYFDEDDEGNELDLDALGKQYTTEAISEKYDEDHGFE
                     VVKTSIDVEESDEEMDEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEEEAEAEAEA
                     EAEAEAEAEAEAEAEAEAEAEAEEEAEEEAEEAAAEEAESEEAESEEAEESEEEKEEE
                     EEKEEEDEEEDEEEDEEKEEAEEEEEEEEEEFIPTFGNKAESQVNNTDTLRTLFNPNQ
                     VTSEPQESQFKLALSEEDEDIDDEKEVDLSQQKELLDKIKSKQQQEAEEILTLRAKKY
                     GLFWSHSDSPFLQSQSQLNKVSGSKDLVKLPGEAESLISNAEGESPYEQWFWKMRGEF
                     SRECKRRKRDVLRIFKKKTTKNPVI"
     gene            <492252..>493697
                     /locus_tag="DEHA2A05940g"
                     /db_xref="GeneID:2899876"
     mRNA            <492252..>493697
                     /locus_tag="DEHA2A05940g"
                     /product="DEHA2A05940p"
                     /transcript_id="XM_456581.1"
                     /db_xref="GeneID:2899876"
     CDS             492252..493697
                     /locus_tag="DEHA2A05940g"
                     /note="similar to uniprot|P38179 Saccharomyces cerevisiae
                     YBL082c RHK1 mannosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05940p"
                     /protein_id="XP_456581.1"
                     /db_xref="GeneID:2899876"
                     /db_xref="GOA:Q6BYY8"
                     /db_xref="InterPro:IPR007873"
                     /translation="MTEQSIKDGQRPELPPFTLRNVLNDIYNGILALFTDPFCTRIIC
                     PVVIVLTSLLSKAIIYKVPYTEIDFRTYIQQIQIINDGELDYSLVQGDTGQIVYPAGF
                     VQIYQVLNWLTDEGTDIHAGQTAFGYLLALTNFLVIIAYTMTPDFQPWPVYCLLLSKR
                     LFSIYVLRLFNDCFTTVCMVSVTILLQQAAYWYKKGGSSISFLLTMVAADLYSIAISI
                     KMNALLYFPGFIIVAYFLCGENLLKFGTVLLVIPIVQVLMGWKFLLPFFNDEEASYIR
                     WNYINQAFNFNRKFLYKWTVNWRFVSEEFFLSDVFSNGLLIANASVLIFFIFTRYISP
                     RITCKPVSRLIKDAMVGPFSSTINKNNLLIDPKCGPKLVMLILGSTNIIGILFARSLH
                     YQFLSWYCWQLPFMLYMTGWSLLVCIPLWVVHEWCWNVFPSTPMSSGLLVSILAIVLF
                     GVWYNTNEWFPKLADNEAATIDESGESKKDK"
     gene            complement(<493956..>496046)
                     /locus_tag="DEHA2A05962g"
                     /db_xref="GeneID:2899877"
     mRNA            complement(<493956..>496046)
                     /locus_tag="DEHA2A05962g"
                     /product="DEHA2A05962p"
                     /transcript_id="XM_456582.1"
                     /db_xref="GeneID:2899877"
     CDS             complement(493956..496046)
                     /locus_tag="DEHA2A05962g"
                     /note="weakly similar to uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164C MSS11 Transcription factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05962p"
                     /protein_id="XP_456582.2"
                     /db_xref="GeneID:2899877"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY7"
                     /translation="MSHHSTPHLHNKKTPGGVGGDNGPSASTSTNRGPMDSNTSISDS
                     QAANAKQLLNAYVYDFLIKSRLPQTARIFVNEAEVPSIQNSSASSNNNSPRQVSTGNT
                     KGTSNESTPHTPSGVSQQFPKENNLPCLALAMEAPQGFLFEWWSIFWDVLQAKNNKGG
                     SQLAAQYYQSQMLKQRQQQDLQGLNMQPNMFGPANGQIQQQMQQQLKSSIDQQQIPQQ
                     FNPQQQQLDPQQQQQRYMMQMMMKQQQMSMGGNPVDPQQQQQMFGNMPPNNNLTLQQR
                     MFITQQQQQQQSQNRMQQHAQNQMNNLRQQAVAAQHHQPQQQSVPGQRNSQDVSSHSS
                     PSNVPRMNPQIAQAQNGVQPFQQAQQPMINGNGQAQDTFGQPQAHMGIRMNSSGKPAV
                     PGNQGDNMSIANPNPNDNGAPANRNMNALQDYQMQLMLLEKQNKKRLDIARNNGTADP
                     NGLMGLNPGVMPPQAQLQQHANSQNQNASPAAIVNSPVVNSRPSPTANNAAAVAKRKK
                     DPPAKRGRKPSATSVPSNLKAGNANSSAASAASNNPPNNSNNGPAFKKEYSAPLTPAS
                     ESANDAVSKRKRRNTSTTESPNKQSVTKNIASKERPIPEEPSKDKKNDDILPTTSSSF
                     QGQPNDQIFPVEILGGNNNNDNHLFGAPMNNGGLDDIDFDFNQFLDGSGDNSLNDGMN
                     GFNWGSVDAIENGD"
     gene            complement(<496651..>497175)
                     /locus_tag="DEHA2A05984g"
                     /db_xref="GeneID:2899878"
     mRNA            complement(<496651..>497175)
                     /locus_tag="DEHA2A05984g"
                     /product="DEHA2A05984p"
                     /transcript_id="XM_456583.1"
                     /db_xref="GeneID:2899878"
     CDS             complement(496651..497175)
                     /locus_tag="DEHA2A05984g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A05984p"
                     /protein_id="XP_456583.2"
                     /db_xref="GeneID:2899878"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY6"
                     /translation="MVDSVCYPRRCITVEPFGNQIDVIEKALIEIENQPPRHYTYANQ
                     NTRRNNAVPFIPTMSASQPSFVPSNTSVFGGVPSEMSRGAYSEGYQAVPSVPQMSANT
                     PPKQQPSPKVSTTPSIYTTFDPFQPNFKTDTQLASGSLSGYLSGSLSSTATSSSIWGN
                     NDTHRNLNGAAVWG"
     gene            complement(<497474..>498586)
                     /locus_tag="DEHA2A06006g"
                     /db_xref="GeneID:2899879"
     mRNA            complement(<497474..>498586)
                     /locus_tag="DEHA2A06006g"
                     /product="DEHA2A06006p"
                     /transcript_id="XM_456584.1"
                     /db_xref="GeneID:2899879"
     CDS             complement(497474..498586)
                     /locus_tag="DEHA2A06006g"
                     /note="similar to uniprot|P40066 Saccharomyces cerevisiae
                     YER107C GLE2 Component of the nuclear pore complex
                     required for polyadenylated RNA export but not for protein
                     import"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06006p"
                     /protein_id="XP_456584.1"
                     /db_xref="GeneID:2899879"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY5"
                     /translation="MSFLSSNTAASTTNTSASNGQELINDITINNPPEDSISDIAFSP
                     QQDLLVAASWDKKVRIYEIDPNTGNNQGRAMFEHEAPVFSARWSIDGTKVISGGADKQ
                     VKLFDIASQQTQQIGAHDAPVRAVRFVECGPTNTQVVVSGSWDKTLKYWDMRAPQPVS
                     TVNLPERVYCMDSSQKLLVVGCAERQISIIDLNNPQQIFKNSMSPLKWQTRSISCYPQ
                     GNGFAVGSIEGRCAIQYIDESEQSKFGFSFRCHRKTPTGANTTSALRTSANSESHIYS
                     VNSIAFHPVYGTFSTAGSDGTFCFWDKDAKQRLKTFPAVNCTIPATCFNKNGTIFAYA
                     MSYDWSQGHTGNKPDYPNQIKLHATKDEEIKQKKKR"
     gene            <498850..>501312
                     /locus_tag="DEHA2A06028g"
                     /db_xref="GeneID:2899880"
     mRNA            <498850..>501312
                     /locus_tag="DEHA2A06028g"
                     /product="DEHA2A06028p"
                     /transcript_id="XM_456585.1"
                     /db_xref="GeneID:2899880"
     CDS             498850..501312
                     /locus_tag="DEHA2A06028g"
                     /note="weakly similar to uniprot|P37020 Saccharomyces
                     cerevisiae YJR040W GEF1 Chloride channel localized to
                     late-or post-Golgi vesicles"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06028p"
                     /protein_id="XP_456585.2"
                     /db_xref="GeneID:2899880"
                     /db_xref="GOA:Q6BYY4"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY4"
                     /translation="MSFSVPNSVKVSYDDDEIPILSYTNDTPIATGIRSELNRKEYEN
                     NTYIDWNKESMLEPKSSDVVYRKWATIIVSSIILGYVTTFIDLASVWLNDVKKGLCYG
                     EMDKWSLSNPYSTCPAEDWYDWSQILVGSQGFISNMFINFPIYFVFAGCWIAVAAYIT
                     INRDIFIKQSGIPEIKIIISGFNYDLPVYLGMHTFIYKIFGLILVVSSGLWLGKEGPL
                     VHVSCCILNILYDAIVNKNNQNEAVRRELLSAATATGISVAFNAPIGGVLFVLESMPS
                     FFMPTKVMWNSFLSATTAVVVLTGFKLFTEGENFYEKDLFRVNFGNFSWLFVELIPFV
                     ILGVLGAFYGYIFINFNAKFSSKHFRGRVQEKLCQVFKVSDSWGKYLEILTIVVLTTI
                     LNFPFEMTKLPLHAFLKILFTDCPDDSNTDLDSNSSNFMCSPSNGITSLKLLYIIVQG
                     FFLTSYTYGVNLPGGVLMPSLVLGATTGRLLGIISQALQNQINWDSLATCTQNSCLVS
                     PSSYAVIGAASFMAGITKLTMCVVVIMFELTGAITYVLPIMCSVMISKFVNDWLCNDN
                     IYDAWLKNHFNRYDSNKGEPNEGKGNGLCDFTNLTATVKNRLPDVTIARAMVPIERTK
                     YVCLIPEQPYTNKTLYQFMNDDNHEGYPLIVNESNPISLGYAYKTNIASKLSTIDDAL
                     DDSVISFQIQGLPNHILSQQLHYERSFETKNIIRLDITTENSVIITNDQTPLVLVLEM
                     FEKLSLNYLIIMNHNPHVDQLMSGFIDRFIVSRLINSNFRKLQGEDADSESMQDYDIE
                     NMLEDDHLLSTRLDRMSVELIT"
     gene            <501446..>502678
                     /locus_tag="DEHA2A06050g"
                     /db_xref="GeneID:2899881"
     mRNA            <501446..>502678
                     /locus_tag="DEHA2A06050g"
                     /product="DEHA2A06050p"
                     /transcript_id="XM_456586.1"
                     /db_xref="GeneID:2899881"
     CDS             501446..502678
                     /locus_tag="DEHA2A06050g"
                     /note="weakly similar to uniprot|P32357 Saccharomyces
                     cerevisiae YBL074C AAR2 Component of the U5 snRNP"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06050p"
                     /protein_id="XP_456586.2"
                     /db_xref="GeneID:2899881"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY3"
                     /translation="MASSKPPQTTLVFENLPNEANLNLWLMGIDTQFFNINNIFRGIK
                     LIPAGIHLFHYSIPPGNGTINDNELPSETIISSSSRLGFWFDCKDNDVLILRWDDALE
                     RLNIINPHKDEEQLNYTKCLNSIGDIYSYMVSYPEDASKWLNTSISYIDFEVIQEFLP
                     CDNDMYSGDITSMMPSKEENMVLLDALEKVNPQASSSLEDQSDKELRYTIIQFKINKE
                     NTESVEEVTENYLDKSWYLSQLYGNDIELMFGELQLSFINFVILGNFCSGLQWLNIIK
                     LISMSKNFMKSSQKVALDFLTIFQHHLDKLPKEYLIDDLALNNSLDLQTYVSVLENFA
                     RDMFPKDTWDLNGCCGKMKLSGFIKEKWHRILEINKSKFNIDFEKLDKNRTDENQIEV
                     YDLNDYDENDEDAPAIVG"
     gene            complement(<502766..>503473)
                     /locus_tag="DEHA2A06072g"
                     /db_xref="GeneID:2899882"
     mRNA            complement(<502766..>503473)
                     /locus_tag="DEHA2A06072g"
                     /product="DEHA2A06072p"
                     /transcript_id="XM_456587.1"
                     /db_xref="GeneID:2899882"
     CDS             complement(502766..503473)
                     /locus_tag="DEHA2A06072g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06072p"
                     /protein_id="XP_456587.2"
                     /db_xref="GeneID:2899882"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY2"
                     /translation="MLRISKMCYGVSAKAGYRTATSKPIEFLPSHLVVQKPYDFHAIH
                     TNYGWFIIPKPYYAYRWTTSNIHKAIEDRYPDIKDVPRSHEMLQKVVDDWGQTVDLST
                     KPITTKTTRADIKKQKDDALYRTQLKEDMPSLVTPSKQTTVPKKRSRLGTVTFIHAWN
                     YYFSITHPKYSHLDKKESRREIANEWNAMTTEEKDDYREAYANLLNDGKDIHKGKIVS
                     REEKLKKQFKKKKSDDK"
     gene            <503643..>506591
                     /locus_tag="DEHA2A06094g"
                     /db_xref="GeneID:2899692"
     mRNA            <503643..>506591
                     /locus_tag="DEHA2A06094g"
                     /product="DEHA2A06094p"
                     /transcript_id="XM_456588.1"
                     /db_xref="GeneID:2899692"
     CDS             503643..506591
                     /locus_tag="DEHA2A06094g"
                     /note="weakly similar to uniprot|P47029 Saccharomyces
                     cerevisiae YJL084C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06094p"
                     /protein_id="XP_456588.2"
                     /db_xref="GeneID:2899692"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY1"
                     /translation="MQTPNSPLFPAQKLTLSPSAVSLGGLTGTSSGVGSSTLIPQLPD
                     KPLTETSSIQVYVVPAEKDLFMQGFEPEEYEGRPPTLLRGCLFLRVLKPSKIRSVTLT
                     FKGQQRTDWPEGIPPKKTSYVELNDILSHTWPFYQSGNPLHSANGGADFFQELSKDHN
                     SEVENSTLNVPLPVSRSRSPAAENGLGNFFTRNLSPATSFMRRAASPSSTVNESFSDL
                     TSVLSTETDPLKPALFTPGDYIYNFEHPLHPSIPETSSVTFGEVFYYIEASVVRAGTF
                     KSNLTGKLPINIIRTPSESNMEENEPIIITRDWDDQLRYDIVIGRKSIVLDSYLPLAF
                     RFVPLWGKVALHRIRVYLSENLEYYCQNKKVHRLEPPKKYLLLEHKAKKGKSLLSEKS
                     GQDEDEDDDAEILPKELEFQLFVPRVLSGRIKHEIHPDTSYENIQAHHWIKICLRLSK
                     TDPEDPSKRKHYEISIDSPIHILSSLAAHVNTLLPAYDEHLVLSPSYNVQDHATPPLS
                     PEVIPIDNTTVAGRNISRKGTENSVSLDEVIERPHANFEHITNHNGTFDDSDADMHLE
                     ANLYSPPDDNRPEMASPQALPHSGTFNSPIQRPIHFVRKPSINPPPFQENTNDMLIGV
                     DNLPPPAYEEEDHSLSMSPLRIDESSDRGRSKSNSRFPGLTMTVSHEGPVKNLLSQQL
                     RKSESELSRKYESEDISDNVSSVKPPTMSPIRNAVSPNRRATDATRQSNSSANSSDTG
                     LTNSIISSSQSNETKSTHDQDEMYESSNVHKITNRNEKADANRKFSDDNYVPESTFHE
                     SENKDKSRQSSISSLTSSLDIPVEHTLPLLNHSSSSLLTPQSNFKSMNSSINSLNDRR
                     TSNVHEITKITDLVEGGFNDDLYRVNDNLSHLRNPRIKKHYQNSDHMSETEINKQRQK
                     SFGVINNNDSDMVTRMSSSSESTVHGDDTVGASPLFNSNGGSPSNTNSLFKPLSGSPA
                     PGLNYGFIIE"
     gene            complement(<506871..>507917)
                     /locus_tag="DEHA2A06116g"
                     /db_xref="GeneID:2899693"
     mRNA            complement(<506871..>507917)
                     /locus_tag="DEHA2A06116g"
                     /product="DEHA2A06116p"
                     /transcript_id="XM_456589.1"
                     /db_xref="GeneID:2899693"
     CDS             complement(506871..507917)
                     /locus_tag="DEHA2A06116g"
                     /note="similar to uniprot|Q9C1L3 Neurospora crassa
                     Putative 3- hydroxyisobutyrate dehydrogenase G6G8.5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06116p"
                     /protein_id="XP_456589.2"
                     /db_xref="GeneID:2899693"
                     /db_xref="GOA:Q6BYY0"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029154"
                     /db_xref="UniProtKB/TrEMBL:Q6BYY0"
                     /translation="MISVKQGIRCLSTSSLRMTNYGFIGLGEMGQHMGRHIYNKLEPD
                     DKLYVYDLEPANTKKFVDTVTEASPANKKLVVPLESISDFVHKVDSQLEFIMTMVPEG
                     KHVKSVVEELVQNYKKCATDISGVSTTFLDSSTVDIPTSIEVHKYVKQQIPDFDFIDT
                     PVSGGVAGARKGTLSFMLSRETHEDMSPSLTSLLSKMGTNIFPCGKNHGTGLAAKLSN
                     NYLLAVTNLAVADSFQLAKSFGLDMKNYAKLVSVSTGKSWASVDNCPIKGAYPKENDL
                     PADRDCHGGFITKLARKDLVLATQSAKSNNRFLFLGEVGKKWYDKACEREDLATKDLS
                     VLYEWLEELSEKDK"
     gene            complement(<508189..>508506)
                     /locus_tag="DEHA2A06138g"
                     /db_xref="GeneID:2899683"
     mRNA            complement(<508189..>508506)
                     /locus_tag="DEHA2A06138g"
                     /product="DEHA2A06138p"
                     /transcript_id="XM_456590.1"
                     /db_xref="GeneID:2899683"
     CDS             complement(508189..508506)
                     /locus_tag="DEHA2A06138g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06138p"
                     /protein_id="XP_456590.2"
                     /db_xref="GeneID:2899683"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX9"
                     /translation="MKTLYPFEYSHCVQLLQNSTDNTAYLHLTFSRTCFQHNLNRTIN
                     GLSNYSPQLILFQNSLTCALHSSQLAAYDIGATPVQAKIWGNRMHNQPPRNTHGTTPS
                     KPT"
     gene            <508999..>509889
                     /locus_tag="DEHA2A06160g"
                     /db_xref="GeneID:2899898"
     mRNA            <508999..>509889
                     /locus_tag="DEHA2A06160g"
                     /product="DEHA2A06160p"
                     /transcript_id="XM_456591.1"
                     /db_xref="GeneID:2899898"
     CDS             508999..509889
                     /locus_tag="DEHA2A06160g"
                     /note="highly similar to uniprot|Q10082
                     Schizosaccharomyces pombe SPAC11D3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06160p"
                     /protein_id="XP_456591.2"
                     /db_xref="GeneID:2899898"
                     /db_xref="InterPro:IPR018959"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX8"
                     /translation="MSDNSSQTNIKTKYNLPKPTPAYYPHDGSPIYADKKLYQKIGAC
                     EKTLVEKHLCQPRRGIAVKIPAKSVFRITTPEGPQVCDLNIWNLHNPRERFWAARSRQ
                     LHSAHVSTYDRLWSNLPFLRPLVTITGDSMSDRGQDEWGGRLHDLNGTRCDPYIDQLI
                     SGQENNFHCHSNLLRAVLPHGLTEFDIHDVINVFQVTGLNEYDQYFMEACPAKAGDYF
                     ECFAEQDLLIAISACPGGDLSQWGWGEDGENLEDSKMVDCCRPLGIEVYKINDEKVLE
                     GWVPPNVVGYKGNHGLQNPA"
     gene            complement(<509921..>511324)
                     /locus_tag="DEHA2A06182g"
                     /db_xref="GeneID:8998117"
     mRNA            complement(<509921..>511324)
                     /locus_tag="DEHA2A06182g"
                     /product="DEHA2A06182p"
                     /transcript_id="XM_002769943.1"
                     /db_xref="GeneID:8998117"
     CDS             complement(509921..511324)
                     /locus_tag="DEHA2A06182g"
                     /note="weakly similar to uniprot|P47051 Saccharomyces
                     cerevisiae YJL046W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06182p"
                     /protein_id="XP_002769989.1"
                     /db_xref="GeneID:8998117"
                     /db_xref="GOA:B5RSR0"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="UniProtKB/TrEMBL:B5RSR0"
                     /translation="MIRPSLSHINSLCIRLQTKRYFGNIHVPFQDDLDPANDDDFNLS
                     DFQHYKESKDVIMQKQKLYEDLEQETPEVKIDLQNYTKLREPVIFVSKLKDPYLNLAI
                     EDSIYNDMPIPENDSKENYNRLMFYKNWPCAVIGKNQNPWKEVNLPLLNSLHIPLVRR
                     RSGGGTVVHDLGNVNYSFMTTKPKFDRFKFAEIIRDSVNKYPDLKYKLKVSERGDITT
                     VTQPDGVDYKVSGSAYKLSKGKSYHHGTMLLDSKLDVLGKLLTRDERQLGIVDSMASI
                     NSVKSKVINLELKDEKFIELVSDGFSKNYGIVEKENDVQNEKLPSDSEEYDQNELFNL
                     TDFVEAYSDYARVVNIDETTVLNQQIYDLADELKEWKWKYGSTPKFSHELYNEKFGFT
                     VKFHVKKGAIIDTFELSFDEISNRMISTEKIKESFEFLEQIIETQELTYSGSNVSGFI
                     TNDMISDWIGQSIDGTI"
     gene            <511455..>512321
                     /locus_tag="DEHA2A06204g"
                     /db_xref="GeneID:8998120"
     mRNA            <511455..>512321
                     /locus_tag="DEHA2A06204g"
                     /product="DEHA2A06204p"
                     /transcript_id="XM_002769944.1"
                     /db_xref="GeneID:8998120"
     CDS             511455..512321
                     /locus_tag="DEHA2A06204g"
                     /note="some similarities with uniprot|P38336 Saccharomyces
                     cerevisiae YBR257W POP4 Subunit of both RNase MRP"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06204p"
                     /protein_id="XP_002769990.1"
                     /db_xref="GeneID:8998120"
                     /db_xref="GOA:B5RSR1"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:B5RSR1"
                     /translation="MNRNNVLERHLLTRCYSSEARIEELLSTRYSITGDQRPSLLLMP
                     TGQDVENNKTKALLHQERPKTSDEAHKTKKYNTRIELKNYIKNTLNNQQKVIKKIQAY
                     NRLSKQNGKKKPFPILKLLEHYSIPMYEEFIPISNLWQDYMQNLLFPSANNKLPSLIS
                     ILPKLSSADYHGCLLTVLKSTNRLLVGVRGIVVWDTQHSFILCVPRTKDSKEWNENKE
                     DFTPSEQIGGLKIIPKKGCLFGFDVILPSNEGEEDEDECMGFTVIGSRFEFRSVDRSG
                     KKFKNHNVDDIL"
     gene            complement(<512347..>513252)
                     /locus_tag="DEHA2A06226g"
                     /db_xref="GeneID:2899860"
     mRNA            complement(<512347..>513252)
                     /locus_tag="DEHA2A06226g"
                     /product="DEHA2A06226p"
                     /transcript_id="XM_456594.1"
                     /db_xref="GeneID:2899860"
     CDS             complement(512347..513252)
                     /locus_tag="DEHA2A06226g"
                     /note="similar to CA1647|IPF16663 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06226p"
                     /protein_id="XP_456594.2"
                     /db_xref="GeneID:2899860"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX5"
                     /translation="MSDTPVLSYKKPSSASSRQQSSTPSHPSSPLPKSQFESPRISSA
                     TTSRQVSSRRKALQDFYNIHHQESQDTNIEESISSSETTNNVNFNDPEQLLKFMKSTP
                     VEEILKLRNSITNKLNSHDSAKKSIIYDNYYELIKLSQILGDLSKPKPVAKENTLDGL
                     GIFTNPPNELKTKTKEINDHDLDSIFTDLSKFINEDVQQFNTEFETVVKSLQKDFDND
                     DNDSASSMKGIAENSEKDKFPESINKQQLVKEVNLLLDEDPKNVKQESKNKILNDIQD
                     ILKSLNVHHDELLILQLNKLKSKFT"
     gene            complement(<513451..>514422)
                     /locus_tag="DEHA2A06248g"
                     /db_xref="GeneID:2899861"
     mRNA            complement(<513451..>514422)
                     /locus_tag="DEHA2A06248g"
                     /product="DEHA2A06248p"
                     /transcript_id="XM_456595.1"
                     /db_xref="GeneID:2899861"
     CDS             complement(513451..514422)
                     /locus_tag="DEHA2A06248g"
                     /note="similar to uniprot|P32910 Saccharomyces cerevisiae
                     YNR003C RPC34 RNA polymerase III subunit C34"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06248p"
                     /protein_id="XP_456595.2"
                     /db_xref="GeneID:2899861"
                     /db_xref="GOA:Q6BYX4"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX4"
                     /translation="MADLSEKARTLHNKMLEFPSSTLFNQEQLQDFIQISVLADLLMI
                     AQELINRKLVKLVKQGDELKFQAISLSEASKITSMSEDEAMIYSYIEASGREGIWTKT
                     IKAKTNLHQHIVVRCLKALENQRYIKSIKSVKHPTRKIYMLYNLQPSIEVTGGPWFTD
                     SELDTEFIDSLLTVIWRFVASKTYPTAFQTPSSNNNIYQSSYPANHTGFVNLDTIIEF
                     ITSNNITNIDLAINDVRSLCDVLINDDKLELIKHTNDIFKATWQSVLEAGYGRAYADE
                     SFDKLVDPSVKSLVTNQSFSIFDHFSVIEPSAEQDPDLVYLDSWIYE"
     gene            <514676..>515584
                     /locus_tag="DEHA2A06270g"
                     /db_xref="GeneID:2899862"
     mRNA            <514676..>515584
                     /locus_tag="DEHA2A06270g"
                     /product="DEHA2A06270p"
                     /transcript_id="XM_456596.1"
                     /db_xref="GeneID:2899862"
     CDS             514676..515584
                     /locus_tag="DEHA2A06270g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06270p"
                     /protein_id="XP_456596.2"
                     /db_xref="GeneID:2899862"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX3"
                     /translation="MSSEKLDLNVISSLDELEDNLENQAPQTNPTQAIFKKKGLKGKK
                     SNQRKVSLDFDVSDEEVEQKSFPVIKRTKFKSPHSFVTKSQPFRVGAGHTSIKETRNE
                     DIKYTQEHIRELRGEQMERNEDLMDVDEPVVVETTPAEVLQEFHKNAPIDNNDEDENI
                     IPVIEYDSDDNDNDDNFAAPTANSFPADDDLMPDNDDAFIDDGPLNLADSKKYPKLDI
                     DEDLYDMELPIGEEESEVELDVLKPNVSRVIEPIGITEHLETLKKSIENLKMERLESE
                     SQYANIKTQFDSIGRNKESLLLELIQ"
     gene            <515748..>516776
                     /locus_tag="DEHA2A06292g"
                     /db_xref="GeneID:2899863"
     mRNA            <515748..>516776
                     /locus_tag="DEHA2A06292g"
                     /product="DEHA2A06292p"
                     /transcript_id="XM_456597.1"
                     /db_xref="GeneID:2899863"
     CDS             515748..516776
                     /locus_tag="DEHA2A06292g"
                     /note="similar to uniprot|P05150 Saccharomyces cerevisiae
                     YJL088W ARG3 Ornithine carbamoyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06292p"
                     /protein_id="XP_456597.2"
                     /db_xref="GeneID:2899863"
                     /db_xref="GOA:Q6BYX2"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX2"
                     /translation="MMSMPIKNMIGRRSFSSSAFLKSKPRHLVNTIELSNEELASLVG
                     KAEAFKKQVRSGNSVPIEQHQKLLGKLVALLFSKRSTRTRISTEGAAAYFGAQPMFLG
                     KEDIQLGVNESTYDTTKVISSMTSCIFARVNSHQEILDLCEHSSVPIINSLCDMYHPL
                     QAITDILTIKEAFGKTEGLKLAWIGDSNNVINDLAIASLRSGISVAISIPKDIEFDPE
                     VGKAASEIASDKGLSFDIFHEPSKAIDNANVIVTDTWISMGQESEKQAKMLQFDGYQI
                     TQNMISQGNASSDWKFMHCLPRHAEEVADDVFYSKNSLVFEEAENRLYAAMAVIEAFV
                     VNKGDLLK"
     gene            <517110..>518123
                     /locus_tag="DEHA2A06314g"
                     /db_xref="GeneID:2899736"
     mRNA            <517110..>518123
                     /locus_tag="DEHA2A06314g"
                     /product="DEHA2A06314p"
                     /transcript_id="XM_456598.1"
                     /db_xref="GeneID:2899736"
     CDS             517110..518123
                     /locus_tag="DEHA2A06314g"
                     /note="similar to uniprot|Q12068 Saccharomyces cerevisiae
                     YOL151w GRE2 NADPH-dependent methylglyoxal reductase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06314p"
                     /protein_id="XP_456598.2"
                     /db_xref="GeneID:2899736"
                     /db_xref="GOA:Q6BYX1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BYX1"
                     /translation="MTSVFVSGATGYIAQHIVKTLLEKNYKVVGSVRSTEKGEKLKKL
                     LQSANFNYEVVNDIQKEGSFNDALKHHPEVTVFLHTASPFHFKAKDVEKELLIPAVNG
                     TKNALKAIKDYAPQVKRVVVTSSIAAIKVEAKENDSTFVTTEETWNPISWEEALTNPV
                     LGYRGSKTFAEKAAWEFVEMEKPSFILSTVNPVIVFGPQAFDSEVKETLNTSAEIINN
                     LLKLKPDDPVPPSNNAFIDVRDVAKAHVVAFENEYAANQRLLLSESRYSSQLVLDLIH
                     KNFPEFKSRIPLGTPGVYPDTSKLSKTDNSKTKAIVGFPFIPLEKSVVDTVSQIVAAE
                     KHQ"
     gene            <518833..>520761
                     /locus_tag="DEHA2A06336g"
                     /db_xref="GeneID:8998069"
     mRNA            <518833..>520761
                     /locus_tag="DEHA2A06336g"
                     /product="DEHA2A06336p"
                     /transcript_id="XM_002769945.1"
                     /db_xref="GeneID:8998069"
     CDS             518833..520761
                     /locus_tag="DEHA2A06336g"
                     /note="similar to CA1866|IPF7647 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06336p"
                     /protein_id="XP_002769991.1"
                     /db_xref="GeneID:8998069"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:B5RSR2"
                     /translation="MKVTMGLKFGRRRVLLYSTVFLILLGLIWIGRDVGLDGTKVIDQ
                     IQGISRSRLPTSNFATNETLVIFPRGFELRASRDLRDYYRKHMNHDKNRVFNSVTYNG
                     PPSALTEAVKQIDYHQHDISMYDTTKDISNDFKKCESELNTKFKVDVGKAKKHDDSLA
                     RFVKKFVHQLENDDAMKELANFFKDDLKKQLEDDTVDKHWYKFAGSSVWLQQYGVHFM
                     ISRMLYSPTGNKSNPVMSLIFAQVYNEKWEEFEDIELVIPTIDPITNKKIYKNLAFPS
                     FLPIPFYHQSSYINKRWYGPEDARILLFKNDDGLEEPLIIFNAYHRKVNKQENIEEAA
                     SKVSHEFYRSMFMGWPFRFQHGKENVDGISNAATDDKIYNKVVELRREGTKRLKVQKN
                     WTPFVSVKDRINGGSDESIYFVYRWQSLEILKCQLTGFTHDYAKCKFEYKRKEDLSSD
                     EPVGALRGGTEMISLNKILPSISSKLHPSKEVWVGFARAHLVRCGCGKDMYRPNLAII
                     TREDNQFKISQLSSFFSLDMDVTGWRNPEVLCHPKDPNALIPNGISHWDVSTIKLGKK
                     YVTEDFVTLSLSVADATVHTIQIKNLLQNILSDTSVLSYNQKSGYTDDVVECSLKASN
                     QFCAAYGKEQVKLGKVPI"
     gene            <520908..>524012
                     /locus_tag="DEHA2A06358g"
                     /db_xref="GeneID:8998130"
     mRNA            <520908..>524012
                     /locus_tag="DEHA2A06358g"
                     /product="DEHA2A06358p"
                     /transcript_id="XM_002769946.1"
                     /db_xref="GeneID:8998130"
     CDS             520908..524012
                     /locus_tag="DEHA2A06358g"
                     /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
                     YPL183c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06358p"
                     /protein_id="XP_002769992.1"
                     /db_xref="GeneID:8998130"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B5RSR3"
                     /translation="MSSSSLSGSPNPISSVNEDLFQILQHYGPVTALKIHMNYIICGY
                     GSILKIFKIEKDFTHQLVFNRQILDRNKIHNISVSPCGTRIILSGGRSFIVLNISDLL
                     NTNHASSKEKAINEWITCTEFLDNNTVLILTSHNIVYKVDVSDMESNQHFEIVDRIHC
                     NEKSILYTGSIRIIGEKTLIAAGTVMGGVIVWDLDSRQILHNLTDHEGSIFGVRIDSE
                     GKYIISCSDDRSIKLYDFKSGRLLATGWGHGSRIWNLEFFKCKDSLKIFSTGEDCTAR
                     IWEFESGNPLLKLLDVSDCHLGKHVWSGDLDDDILQLSVTGGADGRIKLHDLTLFANS
                     NKTSYTLETIEKEVGIKFDKNEIVKQYLELPELNLLIVLTSNGKVLSLDQKNKKWELI
                     DLSSEEVNKFKNFGLVRGFIDINVIIICTRSGDLLVLKFDADSQKPVSKTWFLDEHLN
                     GNKVTNFMTSYDKEGNNFYVLIDCPNPKIPFILRKFKFDNHTLVCDGIIHLEQPDQTS
                     FTTTCMTLDSVNKILILGSRYVSFALYDLSTGADLIQLSGLFKKLSKGDTITAISIVH
                     SQTNCIRILVTVRDGIYMYVELNKKDGSFTHQVIHKNKLSKGFVEGGFLHNNELIVYG
                     FKSSYFYVWNETKQLEVASELCGGAHRQWELFRYKNSMSEMKFVYISKSTLNIKSFKQ
                     KFGDGSYGLINDGTHGREIRDIAISPSISPDDTSRLIMTASEDTTIRLGKLFANGEIK
                     NYWSLNEHISGLQRINFLNDTYVGSSAANEEFFIWKLNKLDTGIPTITKYATLKTSQA
                     NPDLRIMDFDSYPFANGFVISTVYSDSNLKIWYFDCVSGKFHLIANDFYTTCCILNVN
                     FLKFNDKIYIMIGTTDGCLSIWDISNIMNNLDTESSEVQKLGTMIIKQHLHQNGIKAV
                     LCLPDMPNGYRVFTGGDDNSLISSTLCFEEESEELILKTNCFVEKAASSTITSLSFGG
                     SNQIVVTSVDQIVRLWKFDDTSLTCSSARYTTIADTGCSDTTKFDDKDIIVVGGAGLS
                     SWSF"
     gene            complement(<524114..>527362)
                     /locus_tag="DEHA2A06380g"
                     /db_xref="GeneID:2899739"
     mRNA            complement(<524114..>527362)
                     /locus_tag="DEHA2A06380g"
                     /product="DEHA2A06380p"
                     /transcript_id="XM_456601.1"
                     /db_xref="GeneID:2899739"
     CDS             complement(524114..527362)
                     /locus_tag="DEHA2A06380g"
                     /note="highly similar to uniprot|P09436 Saccharomyces
                     cerevisiae YBL076C ILS1 Cytoplasmic isoleucine-tRNA
                     synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06380p"
                     /protein_id="XP_456601.1"
                     /db_xref="GeneID:2899739"
                     /db_xref="GOA:Q6BYW8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:Q6BYW8"
                     /translation="MSEQEASNQFFNFPREEENVIKQWEESNAFQRSLEITKDLPPFA
                     FFDGPPFATGTPHYGHILASTVKDIIPRYATMNGHHVERRFGWDTHGLPVEHEIDKKL
                     GITGKEDVMNMGIDKYNNECRAIVMRYADEWRKTITRLGRWIDMDNDYKTLYPEFMES
                     VWWAFKELFKKDAVYKGLRVMPYSTGLTTPLSNFEAQQNYKEVNDPAVTIGFPLVDDE
                     NTWLVAWTTTPWTLPSNIALAVHPEFEYIKIFDEEKQKNFILLESLLSTLYKKPAAAK
                     YKVIEKIKGKDLAGTKYTPLFPYFYESFKDRGFKVICADYVTAESGTGIVHQSPAFGE
                     EDFNAATKAGIIDEKKQPPNPVDDNGKFTNEVSDFAGIYVKDADKLIIKKLTQDGRLL
                     VSTQLKHSYPFCWRSDTPLLYRTVPAWFVRITNIVPDMLKNVERTRWVPSTIKEKRFS
                     NWIANARDWNISRNRYWGTPIPLWVSDDFEEIVCVGSIDELKELSGCDDITDIHRESI
                     DSITIPSKQGKGQLKRIEEVFDCWFESGSMPYSSNHYPFENKDKFLKAFPANFISEGL
                     DQTRGWFYTLTVLGTYLFNTAPYQNVIVSGIVLASDGKKMSKRLKNYPDPSIVLEKYG
                     ADALRLYLINSPVLRAETLKFKEEGVREVVSSVLLPWYNSYKFFKDAADLFKKENNVN
                     FVYDSTLKSTNVMDRWLLASIQSLIKFIHVEMSEYRLYTVVPRLLSLIDELTNWYIRF
                     NRRRLKGYSDEGVDDTRVGLNTLTEALLTLSRAMAPFTPYLSDGIYQRLKPYFTDEEL
                     EKYCVNPNMKDTRSIHFLSYPSVKEELFDTEIEVAVSRMQKVIDLGRNIREKKTISLK
                     TPLKELVILHSDPGYLRDVESLKGYITDELNVRNLVITSDEAKYGVEYTVVADWPVLG
                     KKLKKDAKRVKAALPNVSSAEVQKFAESGKITVDGIDLVTEDLQVQRGLPTEKASHGQ
                     ESRSQQDVLIILDVNMYPELQSEGLARELINRVQRLRKKAGLNTTDDIKVEYNLIKDT
                     INFENVIKDHEGILVKSTKRPLEPFTSDESKVIIDEEQTINDTTFNLRLLRI"
     gene            <527566..>529074
                     /locus_tag="DEHA2A06402g"
                     /db_xref="GeneID:2899740"
     mRNA            <527566..>529074
                     /locus_tag="DEHA2A06402g"
                     /product="DEHA2A06402p"
                     /transcript_id="XM_456602.1"
                     /db_xref="GeneID:2899740"
     CDS             527566..529074
                     /locus_tag="DEHA2A06402g"
                     /note="weakly similar to uniprot|Q10441
                     Schizosaccharomyces pombe SPAC12B10"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06402p"
                     /protein_id="XP_456602.2"
                     /db_xref="GeneID:2899740"
                     /db_xref="GOA:Q6BYW7"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012094"
                     /db_xref="InterPro:IPR012795"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6BYW7"
                     /translation="MISNRLFGEVLRKCFKNGTFPERIVVALSGGVDSLCLTYLLGQF
                     KRIYKPSLQITAITIDHKYRAGSGKEAEKVGVLVRPWGVKHIVKTLEYEDRDIGKITN
                     FEEVAREKRYDIFEQVCRELDVKSLIVAHNLNDQIETFLQRLQQNSSIFGLVGLRTVD
                     HLPISPTSPSENGDSIHVVRPLLSFDKSEIIETCTKNGIRWFEDHTNSDIHLTRRNLL
                     RHIVSEVVPHRLDNQDIPIEECNALSLVSKESLVKTHNEILSLVCEMQHQIANIENHL
                     KLRGLFSLDKKNLSLTVSLPFNILDTYNPMVLSRFFYQNMYLISSVKHYHWSYAKLER
                     HAIPKILRFYNNNKEISPPVSMKLTYLNVLFNIKLDTHNKQMRISLTRQPLMRNEYSQ
                     VCLDCTLNDQWSDWFMFDRRYWIRLKSRNSDIKVSIVPYRHNDVAFRKQLNLAFKGSN
                     NGPLLSILQEGTPVIVTYSHSGHFAALPTYNIYSQEDVIDVEWLAKNNVHSL"
     gene            <529238..>534124
                     /locus_tag="DEHA2A06424g"
                     /db_xref="GeneID:8998139"
     mRNA            <529238..>534124
                     /locus_tag="DEHA2A06424g"
                     /product="DEHA2A06424p"
                     /transcript_id="XM_002769947.1"
                     /db_xref="GeneID:8998139"
     CDS             529238..534124
                     /locus_tag="DEHA2A06424g"
                     /note="similar to uniprot|P23255 Saccharomyces cerevisiae
                     YCR042C TAF2 TFIID subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06424p"
                     /protein_id="XP_002769993.1"
                     /db_xref="GeneID:8998139"
                     /db_xref="UniProtKB/TrEMBL:B5RSR4"
                     /translation="MKMPTTSHTDMIHTLGTPRLSGQAITPKTFRASKSSRHVNHSSQ
                     SIRIAHQRVNIDVDLTQNKLEGFTELTVIPTMGSLKSIKLDCREMKIKNVYINNTRNT
                     NYIYKDVLYINDDKYFEESLDNKSVNLFDMYSDDLTIHQHHLIRQKLNYVFGEINNDP
                     RELPRELHNGNTEELLIFLPDNLKLELADANAFTTPESQVVTPRYPKSKNTMSESQYS
                     FTVKIEFESINPKNGLNFITDKKADRKYWHAYTVNSDYNISTSSWVPCVDNLWDRCTW
                     SLEINIPRTIKDIGNPRIIGSENTNPSEKEHETERTQKYVRNGGHDDFENNADDVEHD
                     GDNVDDDEDDTENYDLVVCTGDFNNVKETPHPIDSSKKVVSWSIFNPVCAHHVGWALG
                     SFQSIILSTPTQEGDEEIKDQVEFEDIEKVTDNSPVTIYFLVGREDMARNTCILANKA
                     IDFFSKEFGSFPFSSYAMVFVQNNASESNNFAGLSVMSDSLLYPSDLIEPMISTTDTI
                     LEGMATQWSGINIVPLSFNDYWCTIGIAKYMALQFIKVLMGTNEYRFKIKKKMNEIVE
                     KDIGKKPLALQFFRFPISDLDLDFLRLKAPIVLYILDKRMTKTDKSFGLSRVLPKLFL
                     QAMSGDLQNGALSTQHFQYVCEKVNRNKLDTFFKQWVFGSGVPIFNISQKFNKKRSMI
                     EMSIRQVQQSDTKKLHPNPESFINDSISHLDDEPSFSIQPVFTGPMTIRIHEADGTPY
                     EHIVDLKDGHVKLDIQYNTKFKRLKKNREDLNEPNTTFSKLGDILTTPEEMDEWGLNE
                     WVKHEEDMLYNDAFEWIRVDADYEWIAQINVKQPDYMFGSQLQYDRDVEAQYEAVRYF
                     GDREKPNTLYCTALTRTVMDDRYYYGLRIAAAQALADISKPDNNFIGIGYLIKIFKEL
                     YCFPGSSIPLSNDFNNFNRFFLQKQIPQILSEVRDENGEVPFVIKNLLLNLVKFNENS
                     NNNFQDCFYMSDLITSLTTSALNAKSALTSQDPLNLLDTSDSINSEKQKFLQDVITEI
                     NRLQKLDEWVPSHQSIIAITCIKSKIRLATHGLLQLSFEDLLYYTLEKYPFDIRIEAF
                     RGLLILGGLKNASVLQYYLKVCLLGATTPYFRGKLIDLLINAICVAAIDGTPSTLDDP
                     EFKTLEKLFDENSRMANNQTNMVIIEDGSNNELNSRRDTFARATLNGAIELLRRDYSI
                     GKGLKILFWELLHTSLLSIYERRNIFNVCQVLYKEIDTFIARVPVPSVPLSELKKKIV
                     LRNMGDGKVVIKREGRFKIQLASRRLTIQEPSKSKVSQEKAKPKPTDVPAVVEHPPET
                     KLKLKLGSTSTTVEPKKDTPRVSKKTEATRDPELVTIDPYAKSKVTIKFKNHTLPSSS
                     LFDFPTQNASSTVGHSVSVQGSTITLKFTSDKIAKVKDILSGKSSKPRYVKILTKDKR
                     IFVSPTPFSSPEEKTVLTDQPNGKFGGESMNPSCKTKSTSSGSSNGKFSGAESTKIKL
                     KGDKSKEQSIESPSESEEKKPRLKIPIKRELKQPERLSSEPVSKPVERSVSPFSRSAS
                     PFSPAPSSQRTNKKTKIYIHPNDEKSASSSAQDEPQVANMDVSDSTENQKPDKSPEDK
                     PKKTNSKPGFKLKLNLKR"
     gene            <534308..>536749
                     /locus_tag="DEHA2A06446g"
                     /db_xref="GeneID:8998071"
     mRNA            <534308..>536749
                     /locus_tag="DEHA2A06446g"
                     /product="DEHA2A06446p"
                     /transcript_id="XM_002769948.1"
                     /db_xref="GeneID:8998071"
     CDS             534308..536749
                     /locus_tag="DEHA2A06446g"
                     /note="some similarities with uniprot|P54787 Saccharomyces
                     cerevisiae YML097C VPS9 Protein required for Golgi to
                     vacuole trafficking"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06446p"
                     /protein_id="XP_002769994.1"
                     /db_xref="GeneID:8998071"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:B5RSR5"
                     /translation="MSYNNHLAFNISKATPTTSTTNAHTTSTPPASNEGASSGGTNST
                     NSKSPFLQNILSKSTPSAGNVSPQLGSRSTVTPTFVNIGDEGSHSSSVKDSQAGNNKP
                     DLIDLFGKFDISNKKGDDEDADQEDKEAKIDINCDEETKDNSHDEKLANEKTNKQEDE
                     MTETSVAKSVEKEGLSEPIESKEIQNAKSTSEMIEKTPTNKPAQVDGNDANIETTSDT
                     NTETHTDINPDTDANTNTDSNTSTNIGTNIGTNADTNADTNADTNADTNTGTNTGTNT
                     GTNTGTNAETNTETNIEANTESQSDETDNEAHNDRDLTDITGNTNEDDSVAEEYSIRE
                     HESTPVESELEDVSESEGITKNIIESQHMSGKSKKNQPLISSDEQYQQSHKPFDFQQF
                     LNHLKKKSADPIVRYIRSFLVSFSRQGHTFTSDQKIKIIRDFKEFMNDKFSLYEPFAS
                     MDDIDLENSREGLEKLIMNRLYEHCFPPEVVAQAPSFIPESIQEDLQNDENFLRQLEK
                     FNWINGTHLDIDLDYLTKHKSKTNKDNLNFIDFAIAELNKINNYRAPRDKIICILNSC
                     KIIFSFLRVSKRETNADSFIPLLILVIIKAKTDNLISNMHYIEHFRNEEWLSHGETSY
                     YLSSLQGAIGFIQNLCFDDLTIDEEEYSAHMEAWEAGEKQRNSRKPIAMPIPQRKDSE
                     LEEFQNSTPIKSGLSPSNVLMTSAEMFTKSLSNFLSPSPHESPRQDDSRPTTEVQGRV
                     EQQHQTHQQSHSQSQSQDQTQSQENTAAMKETYKSLREVFPNLDKAVLKDVVFMNQGK
                     LDESLDACLQLVNDV"
     gene            complement(536841..536941)
                     /locus_tag="DEHA2A06468r"
                     /db_xref="GeneID:8998072"
     tRNA            complement(join(536841..536877,536904..536941))
                     /locus_tag="DEHA2A06468r"
                     /product="tRNA-Lys"
                     /note="tRNA Lys (TTT) cove"
                     /db_xref="GeneID:8998072"
     gene            <537976..>539496
                     /locus_tag="DEHA2A06490g"
                     /db_xref="GeneID:2899744"
     mRNA            <537976..>539496
                     /locus_tag="DEHA2A06490g"
                     /product="DEHA2A06490p"
                     /transcript_id="XM_456605.1"
                     /db_xref="GeneID:2899744"
     CDS             537976..539496
                     /locus_tag="DEHA2A06490g"
                     /note="similar to uniprot|P06101 Saccharomyces cerevisiae
                     YDR168W CDC37 Essential Hsp90p co-chaperone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06490p"
                     /protein_id="XP_456605.2"
                     /db_xref="GeneID:2899744"
                     /db_xref="GOA:Q6BYW4"
                     /db_xref="InterPro:IPR004918"
                     /db_xref="InterPro:IPR013855"
                     /db_xref="InterPro:IPR013873"
                     /db_xref="InterPro:IPR013874"
                     /db_xref="UniProtKB/TrEMBL:Q6BYW4"
                     /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKNSFIKWKQRDIHEKRQQ
                     RNIEIKSILVQLTMYAKLNERVDFLLSDVDEEQLLDDSLIMKKLNDKFDKTEKFDYDL
                     LKKEKGDTLRKGLKDLSFSAEEIDNTPPYNEMIEDLFIQVKEDHPDAAKDAAKLTQYL
                     KEHRAKIDDVLSRQAIKLDDLLYQKSMLISSDDIHTGFDKSFLNKEKEDDQPAPPAPA
                     SQKKTVTTTETINNASNVSPASKEPKSDKDVLDELTLNPSTAEFGKISSTNIDESANY
                     LIRHTHICNEQQKDALIMTAFDHQLQGDTDAARQVIHQSLLLQYVAQLAGVKPNKDSI
                     IKAVKLFCSKINDKSSPARMGFSQDVTNTFNHIKSRCEIIKQEQGTENNDNEEEALIQ
                     LKALDDKTELSVNIPQEGSPEFQIFSTKLSKEMQDAVKTESLDAVNNVFAKLKVEEAE
                     NILEIFNECGVIGINGYIEDENEFKELQKQYNEGMDLEAEKLEEIHEELNTEDTVD"
     gene            complement(<539639..>542134)
                     /locus_tag="DEHA2A06512g"
                     /db_xref="GeneID:2899864"
     mRNA            complement(<539639..>542134)
                     /locus_tag="DEHA2A06512g"
                     /product="DEHA2A06512p"
                     /transcript_id="XM_456606.2"
                     /db_xref="GeneID:2899864"
     CDS             complement(539639..542134)
                     /locus_tag="DEHA2A06512g"
                     /note="weakly similar to uniprot|P38996 Saccharomyces
                     cerevisiae YPL190C NAB3 Single stranded DNA binding
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06512p"
                     /protein_id="XP_456606.2"
                     /db_xref="GeneID:2899864"
                     /db_xref="GOA:Q6BYW3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BYW3"
                     /translation="MSDEPELGTNSRESSNESVHEQEVRDNSEENKDEHEELEQEQSS
                     GEEEEYDPEVERVEDNPETEHEKVDVYDNRNTESSDKQQEEDDDDDDEYDPEGDHDES
                     NTTSEAANVGVNVSNDDDDEYDPESAYEEISVANASEVSPSQQNDPVIDKSDEEDEYD
                     PEVPLNDPESHQREDHGYEPKPKASNIIKGKLPAGLPPKPGLPPKPPVNAAERTPANK
                     DSQQQLKEAYDAIMQSEIVKDPNFVNLSQPEQMKLIMEQLSQRNVNLSGTAIASNPSG
                     VNYDQVYSYNKPFKNLKNPIPLVPVNEFCRRPNITAPMTPEEEKAYDDFIKREAYYMN
                     LQNWDEFPDKSRLFIGNLPANTISKQDLFRIFSQYGDIIQIAIKAGYGFTQFRTAESC
                     LDCIKGESNVPLHNKVMRLDASRPQKSRRPGKPEINNPNLASRGRDRSPDESSGKRGR
                     DEQMPGNRYGYGENKKQKSIVPDCQVYITGKSSVFFIRKVKKAFSSSQVTIDVEDITH
                     GDFNDVISEAAYSGILGTCVIKEAKVDVQTFENTADGGIKFDEYADIDPEVAADILSK
                     AKFKKYGNTASPQPYGNQNQPQTHNQNQNQNQNKNYVAAMNNDFYDNGYGGNRRGGGR
                     NDHHDNRGRSGRNEYGRGRGGRNNNNWESHHGNNNNMYNQSVPYGQPPAPNYGSPQPA
                     FNQPPAAQVDPNSQANLIQTLQGMDPASMQSMIALLQQQQHQHQQQHQHQQQHQQQQQ
                     QSAPQPVQSMGMGQPIGQPMNQSPYGYNQPLNYGQAPPPPQSHTQAPSGQVNSLLSQL
                     QSSSSSGYNPQQQSQPANSTQSLMETLARLSRK"
     gene            <542558..>543619
                     /locus_tag="DEHA2A06534g"
                     /db_xref="GeneID:2899865"
     mRNA            <542558..>543619
                     /locus_tag="DEHA2A06534g"
                     /product="DEHA2A06534p"
                     /transcript_id="XM_456607.1"
                     /db_xref="GeneID:2899865"
     CDS             542558..543619
                     /locus_tag="DEHA2A06534g"
                     /note="similar to uniprot|Q04869 Saccharomyces cerevisiae
                     YMR315W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06534p"
                     /protein_id="XP_456607.1"
                     /db_xref="GeneID:2899865"
                     /db_xref="GOA:Q6BYW2"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BYW2"
                     /translation="MSSENKNLKLAIVGTGIFATDQHLPTIDKLPNLTPAACYNRTKA
                     KAETFASKANIDPSQVYESLEDIIKTDSVDFVDALLPVQYNLDAVKLAVKYNKPICLE
                     KPIAANMAQAKEIVHLANGTDVPISILENWSYLKAIEILNKDVLPKIGDIVSFTYKST
                     GAWNDNNKYLATSWRQNPEHIGGFLSDGGVHQLALLTEVLGEVESVSGLTKQIREESG
                     ADDILFSTMKTKAGAIGTFTYGSSFGATDKSTSFTIYGTNGSAVYDFSPNLSKPTITY
                     QTGPSSQKASKKTVIEVDENDTFVEEFKNFAEAVTKNDKSIVHVTAAKAYHHLAIVAA
                     ALDSSAKNGDSVKVEQPQV"
     gene            complement(<543670..>544704)
                     /locus_tag="DEHA2A06556g"
                     /db_xref="GeneID:8998027"
     mRNA            complement(<543670..>544704)
                     /locus_tag="DEHA2A06556g"
                     /product="DEHA2A06556p"
                     /transcript_id="XM_002769949.1"
                     /db_xref="GeneID:8998027"
     CDS             complement(543670..544704)
                     /locus_tag="DEHA2A06556g"
                     /note="similar to uniprot|Q9P887 Candida albicans Sec20p
                     secretory pathway protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06556p"
                     /protein_id="XP_002769995.1"
                     /db_xref="GeneID:8998027"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:B5RSR6"
                     /translation="MTISSDIDNSFKRLDELQFSVFAKINEIIDDSDPTANQGEESIE
                     LKRIKSTKDANGLIFKFRDMLKVIEINISGVSDDQLSIRYQMYKEKLSNLRIKLRESQ
                     LQSYNSENELIHNQRIAKYSSVIRDNFDESDLRKDLFSGRSTKDDSKVKNKTIQDQIL
                     SHNKSITSALQSTRQLMSTSIVQTELNIDSVEQQTKDLSNLNDKFTDFESLLNKSKNV
                     VRFIEKQDRKDKNNIYLSIGFLLSCSAWVIWRRLLKMPIKFFLWSLFKIFRIFNRMFV
                     NSSSKGDVDVYATVGAISSSLIASSILSSSTGTINLNEEFTMSIEPHGEHKTWEDIVN
                     EATSRIVDEL"
     gene            <544842..>546413
                     /locus_tag="DEHA2A06578g"
                     /db_xref="GeneID:8998142"
     mRNA            <544842..>546413
                     /locus_tag="DEHA2A06578g"
                     /product="DEHA2A06578p"
                     /transcript_id="XM_002769950.1"
                     /db_xref="GeneID:8998142"
     CDS             544842..546413
                     /locus_tag="DEHA2A06578g"
                     /note="similar to uniprot|Q03264 Saccharomyces cerevisiae
                     YMR285C NGL2 Protein involved in 5.8S rRNA processing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06578p"
                     /protein_id="XP_002769996.1"
                     /db_xref="GeneID:8998142"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:B5RSR7"
                     /translation="MGLIMSNISNVPTNEEKNAGVSQKEPIADAKLIQGSKKQKSTKK
                     SRDPSTLTPEYIEEQRRQRNLKKEKKKQELLAQGIDPNAVNTPVELRFKTRELLELPN
                     NVASDDSFKIKIMSYNILAQALIRRKLFPTSGNALKWSTRSQVLLSEFKHYDADILCL
                     QELDFIQYNSYWRKELGKLGYDMKYYRADTKNHGLAIAFKSDKFICKHQSFMYYDKET
                     SGELRPRTATQNIGFLACLEFTPDILTKYSNISRNGIIIGTTHLFWHPFGTFERTRQT
                     YLILKKFKEFRSTMNTLKGNDDDWYGFFAGDFNSQPFDAPYLSITAKPAHYAERARIV
                     LGCSLSYQYSKNRGVIDQEDDNGDEDKENGQEEEGGNIEKFGSNQPKDPVPESFKPTT
                     EQLKLVNSMEDLHNSLDMRAISLYSVGYKLVDPDNAGLDNNRDEPIFSNWAHAWRGLL
                     DYIFVISSWDATRESFSDKVDTVEDVEHNNGVRITKLLKLPLPKEMGPEPSGQPRLGQ
                     YPSDHLCLMAEVALC"
     gene            complement(<546483..>547286)
                     /locus_tag="DEHA2A06600g"
                     /db_xref="GeneID:2899868"
     mRNA            complement(<546483..>547286)
                     /locus_tag="DEHA2A06600g"
                     /product="DEHA2A06600p"
                     /transcript_id="XM_456610.1"
                     /db_xref="GeneID:2899868"
     CDS             complement(546483..547286)
                     /locus_tag="DEHA2A06600g"
                     /note="similar to uniprot|P40484 Saccharomyces cerevisiae
                     YIL106W MOB1 Mps One Binder"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06600p"
                     /protein_id="XP_456610.2"
                     /db_xref="GeneID:2899868"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV9"
                     /translation="MSFFQNFNTHSLRSTRGFKLKQSSPISSPQPVSNSTFPNPPQNN
                     QPYQQEPGQAYQTINLNNGGQSVSSHKDIRHYAEQTLGSDSALIQAVKLPQDEDINEW
                     LAIHVVDFYNQINMLYGAITEFCSPKTCPRMIATDEYEYLWQETNPSSNGMASPKRPV
                     SLPACEYTENLMNWIQNFFDNDNIFPSKIGAPFPQQFPSLVKTIFKRLFRIYAHIYCH
                     HFHEISELGLQSHLNTSLKHYVLFSNEFNLITRKDYGPLEDLVDTMLKK"
     gene            complement(<547407..>548327)
                     /locus_tag="DEHA2A06622g"
                     /db_xref="GeneID:2899773"
     mRNA            complement(join(<547407..548150,548202..>548327))
                     /locus_tag="DEHA2A06622g"
                     /product="DEHA2A06622p"
                     /transcript_id="XM_456611.1"
                     /db_xref="GeneID:2899773"
     CDS             complement(join(547407..548150,548202..548327))
                     /locus_tag="DEHA2A06622g"
                     /note="some similarities with CA0211|IPF4326 Candida
                     albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06622p"
                     /protein_id="XP_456611.2"
                     /db_xref="GeneID:2899773"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV8"
                     /translation="MTVDTLTVKKDEDYFSLKYSYQLQNDNSNLEEQFIIPDKKFSLN
                     VNLHINGTKLHTTDYGSLVEAIGHSFVECRYWKHIDMNTSLFIRGDKTTSFSLDLECN
                     VSTPIINDLLDMKYAFPNSINLLSSIDLDFHFNTFQPKLQLADIVDALNYSLGSLFIN
                     LEFKFPFVFSFYGRKLFKTNYNWLFRNLDEMLCSSPANLPSVIHNKNEAFLQSMKNIQ
                     LKALAEYNTLSIMKECDMSGSKLDACKKYRSRFLDSGLPPTPNLSIKAMVFDLQLFDL
                     KYIESHLNIESIT"
     gene            <548455..>549096
                     /locus_tag="DEHA2A06644g"
                     /db_xref="GeneID:2899869"
     mRNA            <548455..>549096
                     /locus_tag="DEHA2A06644g"
                     /product="DEHA2A06644p"
                     /transcript_id="XM_456612.1"
                     /db_xref="GeneID:2899869"
     CDS             548455..549096
                     /locus_tag="DEHA2A06644g"
                     /note="weakly similar to uniprot|Q07843 Saccharomyces
                     cerevisiae YLL033w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06644p"
                     /protein_id="XP_456612.2"
                     /db_xref="GeneID:2899869"
                     /db_xref="InterPro:IPR016613"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV7"
                     /translation="MNKTKQVVTIGNDLIVKYQVSLLAGLEGLNELSSKKSKFLSLYK
                     KFYKLRNMIDSKPYNKETYQNIIRRKFTMEDFNLKRNILLEGSDKLSELQLFERMINT
                     LAFVHNSTVYLPSEGKEKPAFFFQDLKIPQRMEKSIILTLLKMDQQKPNTIKYDRKYE
                     WIPQIYNKLSQLPDDPDAKEYKSIFKDIDANLIGFRDYELNLMRLNECYRLCL"
     gene            <549308..>549766
                     /locus_tag="DEHA2A06666g"
                     /db_xref="GeneID:2899870"
     mRNA            <549308..>549766
                     /locus_tag="DEHA2A06666g"
                     /product="DEHA2A06666p"
                     /transcript_id="XM_456613.1"
                     /db_xref="GeneID:2899870"
     CDS             549308..549766
                     /locus_tag="DEHA2A06666g"
                     /note="similar to CA2525|IPF4324.3 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06666p"
                     /protein_id="XP_456613.1"
                     /db_xref="GeneID:2899870"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV6"
                     /translation="MGWFSKDTSSTIPNNQVEQRSHQPLDLSGQPAFNSTTANSNGHS
                     SDISHTLEQLTENEAPLKLKELKENSVKANNESVSDFVHARPKNLFVIDGEKEIEESI
                     ICTNNEQGGKTCLKLKYNSVQLFKQMQKLEYFCSLPDDINATYFECRKIT"
     gene            complement(<549961..>550959)
                     /locus_tag="DEHA2A06688g"
                     /db_xref="GeneID:2899691"
     mRNA            complement(<549961..>550959)
                     /locus_tag="DEHA2A06688g"
                     /product="DEHA2A06688p"
                     /transcript_id="XM_456614.1"
                     /db_xref="GeneID:2899691"
     CDS             complement(549961..550959)
                     /locus_tag="DEHA2A06688g"
                     /note="some similarities with uniprot|Q9P3Q3 Neurospora
                     crassa B24P7 Superoxide dismutase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06688p"
                     /protein_id="XP_456614.2"
                     /db_xref="GeneID:2899691"
                     /db_xref="GOA:Q6BYV5"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV5"
                     /translation="MQINIPLILSLLSVSQLALGDKAPKIKKNPKNVVAIADFPFGFD
                     NNVQGNIVFTAKRGKAVNVHVDVTGLPKEGGPFQYHIHENSVPSDGNCDLVGLHFNPY
                     DAPPDCEDQKDDSYCQVGDLSGKHGWIDTTCFETKYNDPYLSLNKKSNSYIVGRSVTF
                     HFANLTKFACADIELASNIRLQSLQDEYNSNSNYDLQELQKDLASGLEFNQDYKEYSY
                     DEDEVDKYEVFDEGPDADDEPEVEDSKPENDYADDDEDNTEDTKSKTKLINDVKSRNT
                     THNATHPHNGTDLIHNGNHSNVSLNEYNSETESGSSTFGLSISLMIGLGVVTGLLI"
     gene            complement(<551414..>552241)
                     /locus_tag="DEHA2A06710g"
                     /db_xref="GeneID:2899671"
     mRNA            complement(<551414..>552241)
                     /locus_tag="DEHA2A06710g"
                     /product="DEHA2A06710p"
                     /transcript_id="XM_456615.1"
                     /db_xref="GeneID:2899671"
     CDS             complement(551414..552241)
                     /locus_tag="DEHA2A06710g"
                     /note="similar to uniprot|Q07821 Saccharomyces cerevisiae
                     YLL027w ISA1 mitochondrial protein required for normal
                     iron metabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06710p"
                     /protein_id="XP_456615.2"
                     /db_xref="GeneID:2899671"
                     /db_xref="GOA:Q6BYV4"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR017870"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV4"
                     /translation="MIAKRIILTNLNHTYKRYASNEAKKGGKRFMQTIPVTTSKNDFY
                     SGLKYPMKKTNLGESTKEPSDSSSKWSKHSLGPMEKVSTKDQSTSAPARRSRASKFSN
                     KTLKNIGKPETAETKSTKEETKNTEAQKPAQPNIISTVTVEPTTPKITENEKPAKKTK
                     QKRTLRPRKALITFSANAVDHLKNLLDQPEPQLIRIGVQNRGCSGLTYNLEYVSEPGK
                     FDEKVEQDGVKVYIDSKALFSIVGSEMDWLDDKLSSRFIFRNPNSKGTCGCGESFMV"
     gene            complement(<552557..>554653)
                     /locus_tag="DEHA2A06732g"
                     /db_xref="GeneID:8998034"
     mRNA            complement(<552557..>554653)
                     /locus_tag="DEHA2A06732g"
                     /product="DEHA2A06732p"
                     /transcript_id="XM_002769951.1"
                     /db_xref="GeneID:8998034"
     CDS             complement(552557..554653)
                     /locus_tag="DEHA2A06732g"
                     /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
                     YLL029w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06732p"
                     /protein_id="XP_002769997.1"
                     /db_xref="GeneID:8998034"
                     /db_xref="GOA:B5RSR8"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:B5RSR8"
                     /translation="MRKVSRAQCANCTCSPGLLSRTHKRSVSLAKQVSMRNSGSGSPR
                     GASRKGSVFTIDAASLCAPDAKEVNTSKRLEKLRLLMAEYDLGVYVVPSEDQHQSEYV
                     SAFDQKRSFISGFQGSAGVAVVTRDVMCMNETPEGLAAVSTDGRYFNQATNELDFNWV
                     LLKQGVKSEPTWQEWSVDQAIQLSLDSGSKINIGVDPKLITYQVFEKFDKVVRDKLSS
                     PKNTKAEVELVAVKDNLIEKMWIDFEDLPSSPASIIKVLDEKYTGRTYSDKIKDVTEA
                     MNKHKCVGLVVSALDEIAWLLNLRGSDIEYNPVFYGYLIITNQQVTLFANNYRFDTKV
                     QAALQADNVNVEPYENFWTKLNSLSKDFNMANKKLLVPKNSSWEIIRNLKCSFEQPLR
                     SPIEDLKGIKNEVELKGARSAHLKDGRALCKFFAWLENELLNKGELIDELQADDKLTQ
                     FRMQEDNFVGLSFATISATGANAAVIHYKPIKGECAVINPHKIYLNDSGSQFLEGTTD
                     VTRTIHFTNPKPDEIKHYTLVLKGNISLGDLKFPEDTTGALIDSIARQHLWSAGLDYG
                     HGTSHGIGAYLNVHEGPIGIGPRPNAASSSLRPGHLISNEPGYYEDGDYGIRIENVMY
                     VKQSGHSYNERDFLEFDTLTRVPFCKKLIDISLLTTEEKAWINKYHQTVWNELSPSFS
                     KTSLEYIWLKKETAPL"
     gene            <555124..>558221
                     /locus_tag="DEHA2A06754g"
                     /db_xref="GeneID:8998049"
     mRNA            join(<555124..555153,555237..>558221)
                     /locus_tag="DEHA2A06754g"
                     /product="DEHA2A06754p"
                     /transcript_id="XM_002769952.1"
                     /db_xref="GeneID:8998049"
     CDS             join(555124..555153,555237..558221)
                     /locus_tag="DEHA2A06754g"
                     /note="weakly similar to uniprot|P32767 Saccharomyces
                     cerevisiae YGL016w PDR6 Member of the karyopherin-beta
                     family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06754p"
                     /protein_id="XP_002769998.1"
                     /db_xref="GeneID:8998049"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B5RSR9"
                     /translation="MNISFEQVVQHIETLYSTRDPDVVNRIQNELQELQRSGDGYQVA
                     GMLMKHSSRNCQFFGALTYAVVINSMGPKLEIDKLEVLVREMEGHICAIVRSGETEAN
                     MFIIRKLFSNLSLVFISNHETYSNPVESLLRSLCGSTDLAQVVGGLQDMQLMVLVMFS
                     SVIVEDISKQERSAEIHAVVESELYRDLIIIYDFLNSTSRSVAIDSLALDCLNSWVTY
                     ISVAECNSQVRYTSVETLITFLFNHFSTQQNPADDEVLKLINKAVGVVTEILEINPRM
                     LTPEMKSYLDNLLFESQNWGAYYIDTIILGEAREMYSEEIDSFINLLITFLQNDILKL
                     SKSIMHTNVQYKIKTLVSLTNFPGTPIEDESVSDQFLAFWEEFINIYVDDIDTFEAIF
                     LNAPNDRQSFFSKRDEIINDVCSIYWNKIHLPELNVLEANKSEFLHYRTGVSDLFIAG
                     YSLLSVPFYEKLTHSITVNILETDENPTKIIDIESTLYLLFKITEDCTFYESQSSILI
                     PYVDSLFESRLLDVIKLYTAGEGIYRYVYSTFVNFLSSIQFYLKGERGSRYLGTIFDL
                     LFSIVLDGPQSLSLNTSRTILKICQECRESLTSFLPNLEVLLVEMLKNLSVDGLIRQR
                     MFNAYTSIAQCLKEPSKFSDILKRMITAIHNRALEVMNSSPQLNENEEDYLLSLLSCV
                     CEVGRACEIPEEVDDFYNEEQKFLVNQYWIEDPMQVKDLNLSIVKTYLLNYAPIINNT
                     TCTEKCCLILKAGIREPIEGPFKFPMDTIFNFISAKIDNCNIDSVPYLYGLIETVVIV
                     NHKFLDQEIVGQLVKRVFTDHIDFLKSDPYTINSAIELFATILERNPSLIVSLPVFEN
                     VIVGFAIDGLKAHEAFIIKSISKFWVALIALKKGTKENQDFIRSMMVNTNLGTLFVFD
                     LLKAFLGTPRSNLDHYYPIFRNLITKYPIELKKWLQVAFRELKNSKLDEKNIDALISR
                     IMATRGQRSANDILKKIWLQLNGLIEFNSRSF"
     gene            complement(<558298..>560160)
                     /locus_tag="DEHA2A06776g"
                     /db_xref="GeneID:2899941"
     mRNA            complement(<558298..>560160)
                     /locus_tag="DEHA2A06776g"
                     /product="DEHA2A06776p"
                     /transcript_id="XM_456619.1"
                     /db_xref="GeneID:2899941"
     CDS             complement(558298..560160)
                     /locus_tag="DEHA2A06776g"
                     /note="similar to uniprot|P22336 Saccharomyces cerevisiae
                     YAR007C RFA1 Subunit of heterotrimeric Replication Factor
                     A"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06776p"
                     /protein_id="XP_456619.1"
                     /db_xref="GeneID:2899941"
                     /db_xref="GOA:Q6BYV0"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:Q6BYV0"
                     /translation="MAEAYGLSSGALKGILSKTERQSFEGKPITVQVTNIKIIDQSLE
                     NGNGDSAVKYRVLLNDGAYSLHGLITSECIPYCEANGFKKTSVIIIKDYSLVTTQKHI
                     MIINNLEVKFQTSNKSTNTLISCDSYYAEHPEDDYLELANKSQKLESAELNQAKAPQQ
                     QQQQPQKASTFQQRHVNAIEQLSPYQNQWVIKARVSYKGDIRKWSNARGEGKLFNVNF
                     LDESDEIRATAFNDLAEKFYQELEEGKVYYISKARIQQAKPQFSHLSHPYELALDRDT
                     NVEECFDTTDVPKIHFNFTKLNQIESCEPNSIIDVIGVLKEVNPVFQITAKSTGKPFD
                     RRNITIVDDSNFAITVGLWNNTAVDFDTSEGSVIAFKGCKIQDFAGRSLTLTHAGSMM
                     ANPDTAEAYQLKGWFDNQGVNENFKTLKNENSSNQNLINNRKSILQAQEENLGMSEKP
                     DFFNIKATVNFFKTENFCYPACNNSLQSSSQQPSTTCNRKVVEQPDGTWRCEKCDINF
                     NEPHYRYILNCSVMDSSGQLWMTLFDQEANKLFGKTAGELLTLREQQTNNENNVFQDL
                     INDITMKEFNFRLKARQDSYNGVVRVRYQAMTINDVDFNAECEHLCSELDSMLH"
     gene            complement(<560479..>561693)
                     /locus_tag="DEHA2A06798g"
                     /db_xref="GeneID:2899942"
     mRNA            complement(<560479..>561693)
                     /locus_tag="DEHA2A06798g"
                     /product="DEHA2A06798p"
                     /transcript_id="XM_456620.1"
                     /db_xref="GeneID:2899942"
     CDS             complement(560479..561693)
                     /locus_tag="DEHA2A06798g"
                     /note="similar to uniprot|P53101 Saccharomyces cerevisiae
                     YGL184C STR3 Cystathionine beta-lyase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06798p"
                     /protein_id="XP_456620.1"
                     /db_xref="GeneID:2899942"
                     /db_xref="GOA:Q6BYU9"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006238"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU9"
                     /translation="MAPPKSYNIETELVFSKSTDQHNASVPPLYQSATFKQNSLSDMG
                     EYDYTRSGNPTRTYLQNHMAKIMKAKHAFAVTSGMGCLDVITRILKPGDEVLAGDDLY
                     GGTNRLLTYLNKKGDLKVQHWDTTNTELFTSKITNNTKMIFLESPTNPLIKVCDVKSI
                     TDYAHRKNPDVVVVFDNTMMSPILMTPLDLGVDIQYESATKYLNGHHDIMAGVIATRD
                     AKLAEKVYFVINSTGCGLSPFDSWLLSRGLRTLAVRVERQQQNCQKIAEFLSSIGFRV
                     RYPGLKSHPQYELHASMCKGAGAVISFETGSIKTSEKIVENTDIFGIAVSFGCVNSLI
                     SMPCKMSHASIDAKTREERDFPEDLIRLCIGIENSDDLINDLTKALLKSGAVKINSKD
                     ELFNAVSVQPKL"
     gene            complement(<562099..>562815)
                     /locus_tag="DEHA2A06820g"
                     /db_xref="GeneID:2899943"
     mRNA            complement(<562099..>562815)
                     /locus_tag="DEHA2A06820g"
                     /product="DEHA2A06820p"
                     /transcript_id="XM_456621.1"
                     /db_xref="GeneID:2899943"
     CDS             complement(562099..562815)
                     /locus_tag="DEHA2A06820g"
                     /note="highly similar to uniprot|Q9UUT9 Yarrowia
                     lipolytica YALI0D00737g nuhm Subunit NUHM of protein
                     NADH:Ubiquinone Oxidoreductase (Complex I)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06820p"
                     /protein_id="XP_456621.1"
                     /db_xref="GeneID:2899943"
                     /db_xref="GOA:Q6BYU8"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU8"
                     /translation="MFRFIPRSVQRSTHRSVVNKRFSSIISIHRDTKEDNKNMSFEFN
                     SENLKRANEIIAKYPPQYKKAAVMPLLDLGQRQTGFTSIAVMNYVAKYLDMPPMRVYE
                     VATFYTMYNRKPMGKYNIQVCTTTPCQLCGSDEVMDAITSHLKIKPGQTTPDKLFTLQ
                     EVECLGACVNAPMLALNDDFHEDLTAEKTIDLLKTLQAGKEPKAGPVSGRDTCEPFSG
                     AKVLLGEKPFDVSTVTRSDL"
     gene            complement(<563213..>564409)
                     /locus_tag="DEHA2A06842g"
                     /db_xref="GeneID:2899944"
     mRNA            complement(<563213..>564409)
                     /locus_tag="DEHA2A06842g"
                     /product="DEHA2A06842p"
                     /transcript_id="XM_456622.2"
                     /db_xref="GeneID:2899944"
     CDS             complement(563213..564409)
                     /locus_tag="DEHA2A06842g"
                     /note="weakly similar to uniprot|Q12303 Saccharomyces
                     cerevisiae YLR121C YPS3 Aspartic protease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06842p"
                     /protein_id="XP_456622.2"
                     /db_xref="GeneID:2899944"
                     /db_xref="GOA:Q6BYU7"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU7"
                     /translation="MQLVYLLVALGIYGQVFAASGGYVEIPLERSSDSMYYVESLRVG
                     KRQQELKNVILDTGSADVVLTGSTYQYEKSLFTPEYVAQYGSSEPFEMFQQNETISGN
                     GWALKGATFGVTNVSDIDSFYGVFGIGYATIEAMDPYENFPMKLESQGLIDYQVYSVS
                     GRESHSSIIFGGIDSGAYKGPLVKTQIGFEVGPSATREYHTATAVTVSSIKVASHNSR
                     TSISTQKLIYTLDTGSNGLMLPEPVYTNLVTAIHAKKQWHDDTPLFHQDSLAAESLTF
                     DITGFPVSIPITDLIDECTAIRGAQYCTLRIGIVDIGTNSYVATLPNSIFKYIYTVFD
                     LQDNQVFMAPYGPLASKSIKHVSNTHFPVETTTAPNYNDVYSTMYQTSDETTVHRSSS
                     TKNCRR"
     gene            <565153..>566931
                     /locus_tag="DEHA2A06864g"
                     /db_xref="GeneID:2899945"
     mRNA            <565153..>566931
                     /locus_tag="DEHA2A06864g"
                     /product="DEHA2A06864p"
                     /transcript_id="XM_456623.1"
                     /db_xref="GeneID:2899945"
     CDS             565153..566931
                     /locus_tag="DEHA2A06864g"
                     /note="similar to uniprot|P53197 Saccharomyces cerevisiae
                     YGL003c CDH1 substrate-specific activator of APC-dependent
                     proteolysis P29.1.f2.5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06864p"
                     /protein_id="XP_456623.2"
                     /db_xref="GeneID:2899945"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU6"
                     /translation="MNNSKNNTASGRNVINNGYSSRRSTLETPRSPSRSTRNLEPPHL
                     NDGGGLPSTSPRRRNQKSIFSDRYIPNRTGIDLQAAFSLSNQEILPEIKNRHDRIDNE
                     IEIRKEEEANQTFSTILKAELFGDNVPMATANLSKNAKVSNSRPNSTGNLNSTASSSS
                     LHSIRSSGMADNASTGGDDGTTGNTRITPPRSTRNNASNNSLTSGSVNTTNHDSNSIT
                     NTPRQTANLFTYQSPKKNRPVSRDLQNELYSLSPVRQESQKLLLSPQKKPRNISKVPY
                     RVLDAPELSDDFYLNLVDWGQQDILAVGLGDSVYLWDGSTQSVDRLCNLSNKDKVTSI
                     NWIGSGTHLAVGTSKGLVEIWDATKIKCVRTMSGHSLRVSSLAWNEHILSSGSRDRSI
                     LNRDVRIESHYVNKFEAHKQEVCGLKWNVEENKLASGGNDNKLFIWDALNTKPLYQFN
                     DHTAAVKAISWSPHQRGVLASGGGTADKTIKTWNTLTGSLTNNVNTGSQVCNLIWSKN
                     SNELVSTHGFSRNQIIVWKYPSMQQIAQLTGHTYRVLYLSLSPDGETIVTGAGDETLR
                     FWNVFDKNKNDEPPSSVLLDAFSQLR"
     gene            <566958..>568667
                     /locus_tag="DEHA2A06886g"
                     /db_xref="GeneID:2899819"
     mRNA            <566958..>568667
                     /locus_tag="DEHA2A06886g"
                     /product="DEHA2A06886p"
                     /transcript_id="XM_456624.2"
                     /db_xref="GeneID:2899819"
     CDS             566958..568667
                     /locus_tag="DEHA2A06886g"
                     /note="similar to uniprot|P53090 Saccharomyces cerevisiae
                     YGL202W ARO8 Aromatic aminotransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06886p"
                     /protein_id="XP_456624.2"
                     /db_xref="GeneID:2899819"
                     /db_xref="GOA:Q6BYU5"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU5"
                     /translation="MLNKLLNGVIPPFNFCHNLDRYYDRRFDNAVKVLTCTFSGDFRI
                     LQVMYLLLIIYYIRTYILLYFIICNKHIDSTKKDMSKPEAKDLSHLLSEEAKSRKNSP
                     LKAAFKYYKQPGMTFLGGGLPLSDCFPFNKVTADIPSVPFSEGISAPLSDENKTVVEV
                     YKRAEMNKTEDKQIELARSLQYGHTEGQAEIIDFLKEHTEKIHNVPYKDWDLIASVGN
                     TQSWDATLRSFVTRGDSILVEEYSFSSALETAHAQGVNTIPVPMDAKGILPEALEKQL
                     DQWVGPKPKLLYTICTGQNPTGSCLSAERRRAIYKLACKHDFIIIEDEPYYFLQMEDY
                     TTDEKSRASNKVDSHDEFVKALVPSYISMDVEGRVIRLDSFSKVLAPGLRFGWIVGQA
                     KLLERYVRIHEVSIQCPSGFTQSICNSLLQKWGQKGYLDWLMGLRADYTHKRDVAIDA
                     VNKYFPKEVVSFIPPVAGMFFTTTIDASKHPKFKSEFNEDPLQVENAVYEQALKQGCL
                     MIPGSWFKADGKSNPPQPELPENPASKNTFFFRGTYAAVPLDQLVIGLEKFGKAIKVE
                     YGL"
     gene            <568838..>571855
                     /locus_tag="DEHA2A06908g"
                     /db_xref="GeneID:2899820"
     mRNA            join(<568838..568874,568935..>571855)
                     /locus_tag="DEHA2A06908g"
                     /product="DEHA2A06908p"
                     /transcript_id="XM_456625.2"
                     /db_xref="GeneID:2899820"
     CDS             join(568838..568874,568935..571855)
                     /locus_tag="DEHA2A06908g"
                     /note="similar to uniprot|P32479 Saccharomyces cerevisiae
                     YBL008W HIR1 Non-essential transcriptional corepressor
                     involved in the cell cycle-regulated transcription of
                     histone H2A H2B H3 and H4 genes"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06908p"
                     /protein_id="XP_456625.2"
                     /db_xref="GeneID:2899820"
                     /db_xref="GOA:Q6BYU4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /translation="MHILKLPWFGHKAENKQIECYSVSINSDGSRLASGGLDGNVKIW
                     DTKSILHFKNYEAEPATLNNKNGINLDTLNSDIIRRPLCSMSRHNGVVTSVKFSPDGR
                     FLASGSDDKIVLIWEKDEEQANRPKQFGEAEADLEHWTVRKRLVAHDNDIQDICWSPD
                     GSLLVTVGLDRSIIIWNGLTFERIKRYDIHQSMVKGIVFDPANKFFATASDDRSVRIF
                     RYYRKLSESSINNYEFQMEHIVIDPFKKSPLTSYFRRMSWSPDGQHIAVPNATNGPVT
                     SVAIINRTNWGTDISLIGHEAPCEVCCFSPRLFEYDDSNDSQKNKNGMGNFTTILATA
                     GQDQNLVVWTTRQSKPLVVAHDIVSGSITDMCWAPDGQTLYFSCLDGSITCVSFEDNE
                     LGKVVSENMNDLQLHRYGADRESATFPESVEQLLLEEKSEVTEHKENKKLAITKPPTT
                     ILKSRPEEVRPKEVSPKINNLTPKQVNKLTQSITITKNGKKRVAPLLVSSSSKISVPV
                     LGTSGKVTKKFQIGSKLSQTSYFLPRLGVSTSVQGLKSKNLVHEFNQTNEANNDDQDN
                     DNEDMGIDSAKVNDNPKDALNQSVSDATLRRQRNKIKRAILETRYPSCFQLISTLPDN
                     LFNNQAILNSKVNQILNNNFNSKRENNNEIISGSSIDAIDEDLIFSVIVTGIQSIEDR
                     SSIIINDAYDANTSITSIVEVRNGPSWKVNEDDITDFEYGDRIDFQDPTRVIVSNDQN
                     HTKRSYTVFFPYKVQHVLPIIKNRILTFYVLASFNGTIQIISAKSGKYVTASMEVGNN
                     VILLKQEGDYLMCVTNQGLIFVWKLPNLPVERFLTGVVRGISLAPILNNMVEVPSIEK
                     KNLNKRHANIPQLMMPNVRKLDVDTRNGSPLAILEDNNEVYKFSLDLMVWIKVVDPWY
                     FLALTDSPVDSFKTGNCIDSLLHKSYKSFEEDVKRSKIGLYIYNNSEETNELQKVMEA
                     RFKQSIELAGQIA"
     gene            complement(<571903..>572553)
                     /locus_tag="DEHA2A06930g"
                     /db_xref="GeneID:2899821"
     mRNA            complement(<571903..>572553)
                     /locus_tag="DEHA2A06930g"
                     /product="DEHA2A06930p"
                     /transcript_id="XM_456626.1"
                     /db_xref="GeneID:2899821"
     CDS             complement(571903..572553)
                     /locus_tag="DEHA2A06930g"
                     /note="weakly similar to uniprot|P53192 Saccharomyces
                     cerevisiae YGL020C MDM39 Protein involved in determination
                     of mitochondrial structure"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06930p"
                     /protein_id="XP_456626.1"
                     /db_xref="GeneID:2899821"
                     /db_xref="GOA:Q6BYU3"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /translation="MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAP
                     KLGDSKFIALDQKNVELAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETS
                     ASRSYISKYIGYMILVTTTLPIWFFRVWFRKAVLFYFPTGVLPHYLEWFLALPFITTG
                     GVGLTIWMSAVNNVVSSVIFLVKFPFEKEVPFPSKEVGNEKTSINKEEVSGTPAAN"
     gene            <572785..>573636
                     /locus_tag="DEHA2A06952g"
                     /db_xref="GeneID:2899822"
     mRNA            <572785..>573636
                     /locus_tag="DEHA2A06952g"
                     /product="DEHA2A06952p"
                     /transcript_id="XM_456627.1"
                     /db_xref="GeneID:2899822"
     CDS             572785..573636
                     /locus_tag="DEHA2A06952g"
                     /note="similar to uniprot|P43639 Saccharomyces cerevisiae
                     YGL019W CKB1 beta (38kDa) subunit of protein kinase CK2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06952p"
                     /protein_id="XP_456627.2"
                     /db_xref="GeneID:2899822"
                     /db_xref="GOA:Q6BYU2"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU2"
                     /translation="MSSDPEEDYIPWIQQFCELFGHDYFVPVSQDFIEDDFNLTGLSS
                     QVPYYREALYTILDYQVETADDNGSNGTSNNKGSKTELPNKALLAHSAELLYGLIHAR
                     YIISKPGLTAMASKFERNEFGSCPRYYCDGMHLIPVGSTDIPGQETVRLYCPCCNDIY
                     LPSSSRYLNIDGAFFGTTFPGLLVKMFPEIENQCRNRVYKVNQNDFGLRLFGFQISEL
                     SASGPRMKWLRLHPRTSQEKEEFNNCELSVPSEFDESDVPFNSDSEMGDPEDNDDDDK
                     TMASEGN"
     gene            complement(<573795..>574490)
                     /locus_tag="DEHA2A06974g"
                     /db_xref="GeneID:2899823"
     mRNA            complement(<573795..>574490)
                     /locus_tag="DEHA2A06974g"
                     /product="DEHA2A06974p"
                     /transcript_id="XM_456628.1"
                     /db_xref="GeneID:2899823"
     CDS             complement(573795..574490)
                     /locus_tag="DEHA2A06974g"
                     /note="similar to uniprot|P53193 Saccharomyces cerevisiae
                     YGL018C JAC1 Molecular chaperone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06974p"
                     /protein_id="XP_456628.2"
                     /db_xref="GeneID:2899823"
                     /db_xref="GOA:Q6BYU1"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:Q6BYU1"
                     /translation="MLRKACTYVPRVGTGLVNSRFYSNATTIKSYFDLFPQTFPDHGP
                     PNESFMINPRRLRREYRTLQSEHHPDIVIGSAALSKSGDNGVDDKFSSLLNKAYSTIS
                     NPYSRIAHLIEVNHPDHLDITQDDISKRLISDFQSSSDERSMEYKNMLMMVLEAHESL
                     ELATQDQDLEALSEENDERIVESEEAIGKLLETKPLNWNGIMMEAVRLKYWINIQKGI
                     KDWEPGKPVNITH"
     gene            <574648..>575346
                     /locus_tag="DEHA2A06996g"
                     /db_xref="GeneID:2899824"
     mRNA            <574648..>575346
                     /locus_tag="DEHA2A06996g"
                     /product="DEHA2A06996p"
                     /transcript_id="XM_456629.1"
                     /db_xref="GeneID:2899824"
     CDS             574648..575346
                     /locus_tag="DEHA2A06996g"
                     /note="similar to uniprot|P53769 Saccharomyces cerevisiae
                     YLR323C CWC24 Essential protein component of a complex
                     containing Cef1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A06996p"
                     /protein_id="XP_456629.2"
                     /db_xref="GeneID:2899824"
                     /db_xref="GOA:Q6BYU0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /translation="MAMFKKRFIKKSEDGKVAKPKRKLDVDGFESDSDDVLEKETKSS
                     SQGIKKHKPINGTKKPTRDVEHGQNSSTGNALSNPSLDQATTDKSAGEKSVGPIKPPP
                     ISIKTTTITDFQPDVCKDFLQTGYCGYGDTCKFLHIRDESKQRKPIEKEWETVTEQQK
                     PDKSKEQVPYRCVLCSKDYTSPVKTECNHLFCQKCFMNRYRNLKKPNCFICGKDTGGV
                     CSPVSKKELEKLIS"
     gene            <575522..>576250
                     /locus_tag="DEHA2A07018g"
                     /db_xref="GeneID:2899825"
     mRNA            <575522..>576250
                     /locus_tag="DEHA2A07018g"
                     /product="DEHA2A07018p"
                     /transcript_id="XM_456630.1"
                     /db_xref="GeneID:2899825"
     CDS             575522..576250
                     /locus_tag="DEHA2A07018g"
                     /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
                     YLR326w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07018p"
                     /protein_id="XP_456630.2"
                     /db_xref="GeneID:2899825"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT9"
                     /translation="MSNVQDQLEGLPGYDIVMDYWNDYAEEHIKVGKNPYEDENGNKL
                     RLPKNTTKEEQKIWKRVQSTAWVHDKCFLGSCGVGMDCGLGSVPLVVALFPVLGPLVM
                     YGLHARLIHIVTNEYKLPNKLVLQMESQIAFDLLISLPPILGGFLAWLNGCSTRNAGM
                     IYNYFAYVSSEREKNKQPTYVGTGDISEYLRSPEPAYTNTARQNNYQSSNNGGKSISA
                     FKKKPPANNTNTIKVGNQQQSGFV"
     gene            <576333..>577545
                     /locus_tag="DEHA2A07040g"
                     /db_xref="GeneID:2899826"
     mRNA            join(<576333..576405,576464..>577545)
                     /locus_tag="DEHA2A07040g"
                     /product="DEHA2A07040p"
                     /transcript_id="XM_456631.2"
                     /db_xref="GeneID:2899826"
     CDS             join(576333..576405,576464..577545)
                     /locus_tag="DEHA2A07040g"
                     /note="similar to uniprot|P33412 Saccharomyces cerevisiae
                     YGR007W MUQ1 Choline phosphate cytidylyltransferase
                     hypothetical startno similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07040p"
                     /protein_id="XP_456631.2"
                     /db_xref="GeneID:2899826"
                     /db_xref="GOA:Q6BYT8"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT8"
                     /translation="MFERPEGIENCRIWMDGCFDFVHHGHAGAMLQARQLGKELYVGI
                     HSDEDILKNKGPVVMTLKERVKAVEACKWSTQPVPDAPYVTDPKVMDGYGCKYVVHGD
                     DITTDANGEDCYQEVKDLGKFVVVKRTPNISTTDLVGRMLLMSKDHHFQPIRDIDNHS
                     LLDKKDNLDKFAKYATDETGLKPGSGVYLNIDTDKELHTLVEPSKEILNKYKSIAYVD
                     GGFDLFHPGHIEALRLVKQNALKDGCAIIVGVHDDHTINNVKGLNYPIMNIFERALCI
                     LQCAYVDGIVLGAPFSPTSQFLSKLPGTVAAVYHGPTQVEEEPYAEAKQNGLFKEIGP
                     HEFANINTEFIVHRVLNNKEAYEARQKAKGWKADHEAQLRVQEQSRHKSS"
     gene            complement(<577662..>578111)
                     /locus_tag="DEHA2A07062g"
                     /db_xref="GeneID:2899827"
     mRNA            complement(<577662..>578111)
                     /locus_tag="DEHA2A07062g"
                     /product="DEHA2A07062p"
                     /transcript_id="XM_456632.2"
                     /db_xref="GeneID:2899827"
     CDS             complement(577662..578111)
                     /locus_tag="DEHA2A07062g"
                     /note="similar to uniprot|Q06177 Saccharomyces cerevisiae
                     YLR327c RBF9 or uniprot|P16965 Saccharomyces cerevisiae
                     YGR008c STF2 ATPase stabilizing factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07062p"
                     /protein_id="XP_456632.2"
                     /db_xref="GeneID:2899827"
                     /db_xref="InterPro:IPR006861"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT7"
                     /translation="MDISHPTLFSLGHKSRLKYKIIPSINRGSNKHSFEVLEAKQIKI
                     AQLYIIYIFNKYKMTRTNKWTVHEAKSNSKWFTHHGPINCDPTKVKKSGAGKGNWGKP
                     GDEMKDDTDMDMVTMFGQSQRRNSNHSQNEQDMKMLNEQLDHSMFAM"
     gene            complement(<578158..>579612)
                     /locus_tag="DEHA2A07084g"
                     /db_xref="GeneID:2899828"
     mRNA            complement(<578158..>579612)
                     /locus_tag="DEHA2A07084g"
                     /product="DEHA2A07084p"
                     /transcript_id="XM_456633.2"
                     /db_xref="GeneID:2899828"
     CDS             complement(578158..579612)
                     /locus_tag="DEHA2A07084g"
                     /note="similar to uniprot|P16639 Saccharomyces cerevisiae
                     YGL017W ATE1 Arginyl-tRNA-protein transferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07084p"
                     /protein_id="XP_456633.2"
                     /db_xref="GeneID:2899828"
                     /db_xref="GOA:Q6BYT6"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT6"
                     /translation="MKPGPDLPMVISRPHYISGRDCGYCNGKKEDYHALESQKTTNGD
                     KESQSITIGCQVEQMTCQHYDELINQGFRRSGTFLYKPDLLRGCCRLFTIRTDVTQLK
                     VTKAHRKTINRFIRAISDEPDTKEGNKHFDLHSLVKEEQKSTRFHTKYEPSKFSKEKF
                     ELYKKYQVHIHNDEPSDVTERSFKRFLCDTPFPEKEVMGSSDDWETLNHWVKRWSPED
                     NTPSNRVGPTHECYYLDGKLIAISILDFLSTGVSSIYFIWDPDYAHLSLGTLSGLREI
                     IMCSELQLGYYYLGYYIEDCAKMNYKSKFGGELLDLCNEVYFPLPAVGEFIKNGRFFV
                     VGDANDSDETAYSNELELENTGHPMAVSGSEFDNKSLVDVSEKIYANDSIYDDANKAL
                     AILQKSYGIGSASDSVYKLPAVVPGIIPIWQILEWFHSGAIDNDLPVSIFTMMTADLK
                     ECDFGQLNPIGKSIVIDCIRLFGLEKFQDCIILV"
     gene            <579807..>581018
                     /locus_tag="DEHA2A07106g"
                     /db_xref="GeneID:2899779"
     mRNA            <579807..>581018
                     /locus_tag="DEHA2A07106g"
                     /product="DEHA2A07106p"
                     /transcript_id="XM_456634.1"
                     /db_xref="GeneID:2899779"
     CDS             579807..581018
                     /locus_tag="DEHA2A07106g"
                     /note="similar to uniprot|P41896 Saccharomyces cerevisiae
                     YGR005c TFG2 TFIIF subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07106p"
                     /protein_id="XP_456634.1"
                     /db_xref="GeneID:2899779"
                     /db_xref="GOA:Q6BYT5"
                     /db_xref="InterPro:IPR003196"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT5"
                     /translation="MSGSTKTSPVKKAAKQAGSNEKVATDKGDAVSNGNSITKDQNSN
                     EAEEPDHSILSDPEDYLEEDESLDMNLTNGEQKVWLVKLPRYLAEKWSNIDELSGEQL
                     GRVKIKQSGRNGNNSGKLQVKLVLNESAMNEEIPHEYDISMLNTQVRNSYVFSEENLT
                     KFKQELTEVAEMPEQPSLQPVDKKKIQNKPQKFFRIQKNKEGQDGKPVKKFVPYVKTI
                     PKKTALAGKVCHDCQIIPSKSDTKYSQVSMKRQNIQPTKPRPKVTLLDEIPGVVQSNA
                     GPSIKGNNTSVFLKSNPAKSKNGEGRAIRMPKKDLLDLLFRLFEEYEYWSMKGLKERT
                     RQPESYLKESLDSIANLIKKGPYTSKYNLKPEYRRLRDAERAARLGLVINEENEEKED
                     EEEDIEMEDVI"
     gene            complement(<581146..>581692)
                     /locus_tag="DEHA2A07128g"
                     /db_xref="GeneID:2899780"
     mRNA            complement(join(<581146..581376,581687..>581692))
                     /locus_tag="DEHA2A07128g"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_456635.1"
                     /db_xref="GeneID:2899780"
     CDS             complement(join(581146..581376,581687..581692))
                     /locus_tag="DEHA2A07128g"
                     /note="highly similar to uniprot|P49167 Saccharomyces
                     cerevisiae YLR325C RPL38 Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_456635.1"
                     /db_xref="GeneID:2899780"
                     /db_xref="GOA:Q6BYT4"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT4"
                     /translation="MAREIKDIKEFVELARRSDIKSAVVKVNKALNANGKKIKQTKFK
                     VRGSRYQYTLVVNDAAKAKKLQQSLPPTLEIKNL"
     gene            complement(<582025..>582924)
                     /locus_tag="DEHA2A07150g"
                     /db_xref="GeneID:2899781"
     mRNA            complement(<582025..>582924)
                     /locus_tag="DEHA2A07150g"
                     /product="DEHA2A07150p"
                     /transcript_id="XM_456636.1"
                     /db_xref="GeneID:2899781"
     CDS             complement(582025..582924)
                     /locus_tag="DEHA2A07150g"
                     /note="weakly similar to uniprot|P33411 Saccharomyces
                     cerevisiae YGR006W PRP18 Splicing factor involved in the
                     positioning of the 3' splice site during the second
                     catalytic step of splicing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07150p"
                     /protein_id="XP_456636.2"
                     /db_xref="GeneID:2899781"
                     /db_xref="GOA:Q6BYT3"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT3"
                     /translation="MDFSSLLSKEIDKKRKLADETKKNKKVKAEDEVNIIEADTVPRA
                     TNSDTSEKNNRQVYTPEETTLINSISDEQLDAKLEQLGERCNTGSTKLDKIRKVEVLL
                     RLQKKNEVYRIQLEKEEATDRTIKLEDIASSDAREKLHTQVRMYVKYMVKEWENDVQS
                     KTEGFSSIRDDEEREGEEESVARQSSMLLDTKKDLVRLLYKLRTQKLTDSMSTSLCTI
                     MYYLQVRDYRRANESYMKLSIGNVAWPIGVKGVGIHERSAASKITGENKQNSANIMLD
                     DKTRRWITAIKRLISFAERKWPI"
     gene            <583182..>584795
                     /locus_tag="DEHA2A07172g"
                     /db_xref="GeneID:2899782"
     mRNA            <583182..>584795
                     /locus_tag="DEHA2A07172g"
                     /product="DEHA2A07172p"
                     /transcript_id="XM_456637.1"
                     /db_xref="GeneID:2899782"
     CDS             583182..584795
                     /locus_tag="DEHA2A07172g"
                     /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
                     YLR324w PEX30 Peroxisomal integral membrane protein or
                     uniprot|P53203 Saccharomyces cerevisiae YGR004w PEX31
                     Peroxisomal integral membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07172p"
                     /protein_id="XP_456637.2"
                     /db_xref="GeneID:2899782"
                     /db_xref="GOA:Q6BYT2"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT2"
                     /translation="MSGKQSNHNGENLGNKSSGSKVHSSPNSGKVEGSGESKDNTAEI
                     RAVFTSSDSKQDEESKSRPQTSPLLSSTPPSVAKSLVRSYPYLLIVNKFLSIITWTND
                     DYWINIILVCLYSLAILYFENLVTWSGHLIIVGIITLYALLNNKIIEETNLHPTLDDV
                     VQALTTTCIKADMLLNPITSLSLTAYDIKRLLFTTVFLTPLYLIVTFLLVKPRIILLF
                     TGLHILTYHSSYSRVARKMLWKIKLVRVLCFYLTGLDFSQARNHSLFAAAFAKVHKNA
                     GHSLDLSSEASNKPVRFTYVIYENQRRWLGIGWTSNLLSYERTPWTDEFLNESSSLES
                     FQLPNNENNDYSFGAQQSQQLSGSDTTWRWVDKTWRLDLTNDGAITLQNNKRSKTTAN
                     PATDEGYIYYDNTWKKPSTEDSFSKYTRRRRWIRTAELVFNGSSDKTPSTEEEISSNS
                     ASIPGSSNSTTGAETGNSTKSAKKRKSLRFVDPESDTTDEKTDGPESLAQVEKELAAD
                     EQDTKDLKRGVEELTSMAQEADFAGKKND"
     gene            <585306..>586220
                     /locus_tag="DEHA2A07194g"
                     /db_xref="GeneID:2899848"
     mRNA            <585306..>586220
                     /locus_tag="DEHA2A07194g"
                     /product="DEHA2A07194p"
                     /transcript_id="XM_456638.1"
                     /db_xref="GeneID:2899848"
     CDS             585306..586220
                     /locus_tag="DEHA2A07194g"
                     /note="similar to uniprot|P78609 Pichia jadinii Uricase
                     (EC 1.7.3.3) (Urate oxidase)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07194p"
                     /protein_id="XP_456638.1"
                     /db_xref="GeneID:2899848"
                     /db_xref="GOA:Q6BYT1"
                     /db_xref="InterPro:IPR002042"
                     /db_xref="InterPro:IPR019842"
                     /db_xref="UniProtKB/TrEMBL:Q6BYT1"
                     /translation="MQSELLDSSYGKGNVKFLKVKKNPHNSKEQDVLEANVQVLLKGN
                     FDVSYTKADNAPIVPTDTVKNTILIEAKTTNVWPIERFAAHLAKHFTEKYAHVSGIEV
                     SIVQSKWTKYEVDGKIHPHSFKHEGPETRRTFLTYCRSNKKLTITSSIKDLTVLKSTG
                     SMFYGYNVCDYTTLKPTKDRILSTDVDASWTYDPKQVTSLDQVLTQADKGLFDSTYDS
                     ARKVTLDLFALENSASVQATMYNMSHKILELVPEVGTVSYALPNKHYILFNLEWKGIK
                     QNDELFYPSPDPNGLIKSTVGRKTQSKL"
     gene            <586382..>587701
                     /locus_tag="DEHA2A07216g"
                     /db_xref="GeneID:8998054"
     mRNA            <586382..>587701
                     /locus_tag="DEHA2A07216g"
                     /product="DEHA2A07216p"
                     /transcript_id="XM_002769953.1"
                     /db_xref="GeneID:8998054"
     CDS             586382..587701
                     /locus_tag="DEHA2A07216g"
                     /note="similar to uniprot|P36101 Saccharomyces cerevisiae
                     YKL027w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07216p"
                     /protein_id="XP_002769999.1"
                     /db_xref="GeneID:8998054"
                     /db_xref="GOA:B5RSS0"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B5RSS0"
                     /translation="MSCHSKVWMLVVATALVTTGVVEGFHRYMDSRDNVKSPPSTKQI
                     TETNKDYSEELIQEQLARNYAFLTEGGMEKVRNQNIVVVGAGGVGSWVTTMLVRSGVG
                     KIRVIDFDQVSLSSLNRHAVANLKDVGISKVECLRNHLLQIAPWIEIDTKNQLWNIDV
                     AEELIFGEDFKPTYVVDCIDNIDTKVDLLTFCHEKKLPVISSGGAACKSDPTRVNISD
                     ISKTEEDPLSRSVRIRLKKRGIISSIPVVFSAEKPDPRKAQLMPLTDAEIAKGEVDQL
                     SAIKNFRVRILPVLGTMPGMFGLTLATHLITSISGYPVEPIEGKNRYKVYDGILQSLA
                     GQQSRIGKLDQRVPIALNDVNYILEEVFHGKSPISNYSTRLTLSRWDPRKELSYQNVV
                     IMTKEEQKLHEDRVLKGGELLTEVYTKEILDRVEQRFSEERFYSQFR"
     gene            <587847..>588557
                     /locus_tag="DEHA2A07238g"
                     /db_xref="GeneID:2899851"
     mRNA            <587847..>588557
                     /locus_tag="DEHA2A07238g"
                     /product="DEHA2A07238p"
                     /transcript_id="XM_456641.1"
                     /db_xref="GeneID:2899851"
     CDS             587847..588557
                     /locus_tag="DEHA2A07238g"
                     /note="weakly similar to uniprot|P37293 Saccharomyces
                     cerevisiae YGR147c NAT2 N-acetyltransferase for N-terminal
                     methionine"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07238p"
                     /protein_id="XP_456641.1"
                     /db_xref="GeneID:2899851"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS8"
                     /translation="MSRMNLLSRIQIPVKPLFSRSPGQIVTRQIPKNQFLKRFQSTLK
                     SGKPTPPPQAPNKPKSLKHLMKEYGYAGLGVYLAISFIDLPICYVLVHSMGKEQIEYY
                     ENKVKQTFGYGVSDEELQKKHEISKIEEMNEQSNSEEVNENGSFFTMLLSQFSWTEFA
                     IAYGIHKSLIFIRLPITAAITPGIVKGLRNWGFKIGSDKLSTTASIAKGTIKDITASS
                     QKFGTRPNGKKKWFSWFF"
     gene            complement(<588854..>590050)
                     /locus_tag="DEHA2A07260g"
                     /db_xref="GeneID:2899852"
     mRNA            complement(<588854..>590050)
                     /locus_tag="DEHA2A07260g"
                     /product="DEHA2A07260p"
                     /transcript_id="XM_456642.1"
                     /db_xref="GeneID:2899852"
     CDS             complement(588854..590050)
                     /locus_tag="DEHA2A07260g"
                     /note="similar to uniprot|P38702 Saccharomyces cerevisiae
                     YHR002w Mitochondrial carrier protein LEU5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07260p"
                     /protein_id="XP_456642.1"
                     /db_xref="GeneID:2899852"
                     /db_xref="GOA:Q6BYS7"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS7"
                     /translation="MIPTTNRNKLNMNCNEESTPFEPVRVIDKQSLDYVLRSGVSGGL
                     AGSAAKTLIAPLDRVKILFQTSNPEFLKYRGKFSGLFRASKRIWSNDGFYGLFQGHSV
                     TLLRIFPYAAIKFVAYEQIRTILIPTDLHETAIRRFMAGSLSGLASVFFTYPLDLLRV
                     RMAFETKHLHNDDIRANSRQHIIAQHRGRLSTTVREILNERPPHKVNDPTWFKLMRQN
                     LPPSVMSLSNFYRGFAPTILGMIPYAGVSFYTHDLIHDILRSKYLSKYTVQSAGALSH
                     SISTSSSSNRVIRKSSSNKDQINSRDSRLPLKAYAQLLAGGLAGMCSQTAAYPFEVIR
                     RRMQVGGAVNQGQHLSFKSTAKIVYRESGFRGFFVGLSIGYIKVIPMVACSFYVYERC
                     KMFFGI"
     gene            complement(<590610..>591854)
                     /locus_tag="DEHA2A07282g"
                     /db_xref="GeneID:2899853"
     mRNA            complement(<590610..>591854)
                     /locus_tag="DEHA2A07282g"
                     /product="DEHA2A07282p"
                     /transcript_id="XM_456643.1"
                     /db_xref="GeneID:2899853"
     CDS             complement(590610..591854)
                     /locus_tag="DEHA2A07282g"
                     /note="some similarities with uniprot|P38830 Saccharomyces
                     cerevisiae YHR124w meiosis-specific protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07282p"
                     /protein_id="XP_456643.2"
                     /db_xref="GeneID:2899853"
                     /db_xref="GOA:Q6BYS6"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS6"
                     /translation="MMTLPNDEPTISPDDAATAAAVAAASTAAAAVAAIPQLKDDDHS
                     LHHQFVQQHHHQLQEQHAHQQHALQQHHQHHQHHQHPHEHDHDQLNSQLNHQLQQHNL
                     AHHQLNHTPHHHLEMLAQANEEDFLDSTNRKVAPRSSDLFKVGPQFSETRHHQDIYCK
                     RNDMDVNPILEARIDRGFEVGENGTWIGYKRNYFTLVASFSLENFNFDRFIQNKFYTY
                     EKSSKNGESVGENKVEISYFAIRLVAKCSDDDVAISLVQHTAKRDKGPQFPPPIYPAV
                     PGDLPDHETVRASCNKRNGNKIENMNKVFYFDRAEYYHNTNLDTLKDDSVLKNYPSDS
                     IARVARFERIQFTSSIRLKSTSVNSRYFTLHVELLGIIENEDCQIQPILLSSIETPPL
                     IIRGRSPSNYHKDRTSGYRGHI"
     gene            592634..592706
                     /locus_tag="DEHA2A07304r"
                     /db_xref="GeneID:8998080"
     tRNA            592634..592706
                     /locus_tag="DEHA2A07304r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=74.95"
                     /db_xref="GeneID:8998080"
     gene            <592873..>598215
                     /locus_tag="DEHA2A07326g"
                     /db_xref="GeneID:2899855"
     mRNA            <592873..>598215
                     /locus_tag="DEHA2A07326g"
                     /product="DEHA2A07326p"
                     /transcript_id="XM_456644.2"
                     /db_xref="GeneID:2899855"
     CDS             592873..598215
                     /locus_tag="DEHA2A07326g"
                     /note="similar to uniprot|Q04952 Saccharomyces cerevisiae
                     YMR306w FKS3 or uniprot|P38631 Saccharomyces cerevisiae
                     YLR342W FKS1 Catalytic subunit of 1 3-beta -D-glucan
                     synthase or uniprot|P40989 Saccharomyces cerevisiae
                     YGR032W GSC2 Catalytic subunit of 1 3-beta -glucan
                     synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07326p"
                     /protein_id="XP_456644.2"
                     /db_xref="GeneID:2899855"
                     /db_xref="GOA:Q6BYS5"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS5"
                     /translation="MHSQTSADAYREFSIYQSMGSGIYDALEGETEMNGVENGGMIEE
                     VDGEEDNGIVSEVSDIEGSTYCNGIKEEATPYPSWCIQNGAPINKDEIWQIFLTLGNM
                     FGFQSDSQSNIYDLFMTSLDSRSSRMSCKLALLSLHADYIGGEHSNYKKWYFAAHFEL
                     DENVKVNEKQWRWFKDFAKFKSKSNTPYNLNDIQDTSCLLAMEYNWRLRMKNYTDEDY
                     IYQIALYLLIWGEANNLRFMPECICFIYKCAFDYFESAELDTKANEFEFLDTVVTPIY
                     SYIRNQQYELVNNVWKKSEKDHSDIIGYDDVNQFFWYRGNLEKIMLLDKSLLYEYPRN
                     QRYTKFKSIKWKKLFYKTYSERRTWLHLFTNFSRVWVIHVTMFWYYTCFNSPTIYTKN
                     YVQLLDNKPAPQVQWSAVALGGTVACLLTILATLIEWLFVPRKWPGAQHLFFKLVLLV
                     LITIINAGPSVYIFLFLPIDKYSKIGHIVGIIQFVISIITFLYFAIESPNRLFNFFLK
                     KNSNIIKTEIFTSSFPKLHLRNQIYSYLLWVCVFLAKFSESYFFLTLSLRDPIRVLSI
                     MEMTRCKGDIFLGNLLCKQQARFTLILLYVTDLVLFFLDTYLWYIICNCIFSIGLSFS
                     LGISIFTPWRNIFSRLPERIFSKIIYLNGTSKIDSALLISQIWNSIVLSMYREHLLSI
                     DQVNKLVYQQINVSNEESMDKTYLRSPLFFILQDDNSLNLHDFFTASKEAERRISFFA
                     QSLSSPLPEPFPILAIPAFTVLIPHYSEKIILSLREIIKEDKHSKVSLLEYLKSLHST
                     DWELFVEDTKILSLVSSQPLDLGEADFPSEQSLNHKHESDLVNNQISDLPYYCVGFKD
                     SSPEYTLRTRIWSSLRCQTLFRTISGFMNYEKAIKLLYKLENYDLDSNSYFDVDTELN
                     EFVQRKFKLLISMQRFQKFHENELNDAELLFGIYPQIQISYLEEEVNGDQTTYYSTLL
                     NVSEKDSYGNYKKKYRVKLSGNPILGDGKSDNQNNCIIFYRGEYIQVIDANQDNYLEE
                     CLKIKSVLAEFEEIDMDPSSEYVPGIFSENLKDPVAILGAREYIFSENIGVLGDIAAG
                     KEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGVSKAQKGLHLNEDIYAGMTA
                     VCRGGRIKHCDYYQCGKGRDLGFGTILNFTTKIGAGMGEQILSREYYYLGTQLPIDRF
                     LSFYYAHAGFHINNLFIMLSVHLFMLVLVNLGSLKHESVVCMYDSNIPFTDLQVPLGC
                     YNLQPVLNWVSRFVLSVFICFFISFIPLIFQELIEKGFIKAIYRIFHHFVSLAPFFEV
                     FVCQIYAKSLKDNITFGGAKYVATGRGFATSRISFNTLYSRYASTSIYSGSTVFLIVI
                     FASLSMWQPSLLWFCITFVSMCLAPFIFNPHQFSWGDFFIDYREFLRWLSRGNSSWHR
                     NSWIGFIRSHRAKYTGYKKNALGEVGQRINDASRRPSRWNSFIDQIVIPLICIVCYLV
                     PYMFINAQNGVSNPSRVNPLFRIIILCFIPIIFSILITLLLFVFSCTLGPILSCCCTR
                     VPSFIASFAHLMSVLINLVNFEVFLYLEGLNFTRTLCGFICMIAIQKTILQFTMSICL
                     SRELKDDYSNRAWWSGKWITSGLGWLVITQPLREFIVKICEMNLYAYDFILAHCLLFV
                     MGPVLLIPFIDKWHSSMLFWFKPTKQFREPILSKRQRRKRKLKILKYSFLFFTLMLCF
                     IALILAPVLAESYIPNFRRQLPSFIAEIIQPNHQNNNDTGDNAPRTVLRAKPNQ"
     gene            <598359..>600218
                     /locus_tag="DEHA2A07348g"
                     /db_xref="GeneID:2899856"
     mRNA            <598359..>600218
                     /locus_tag="DEHA2A07348g"
                     /product="DEHA2A07348p"
                     /transcript_id="XM_456645.1"
                     /db_xref="GeneID:2899856"
     CDS             598359..600218
                     /locus_tag="DEHA2A07348g"
                     /note="weakly similar to uniprot|Q10951
                     Schizosaccharomyces pombe Byr4 protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07348p"
                     /protein_id="XP_456645.2"
                     /db_xref="GeneID:2899856"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS4"
                     /translation="MNSINRNPKPISRKPSSFRSGLNITPTTNRAGRFSSKSDLLARF
                     QDNEDNNEEDNIFEGDAFEDLPIEDEFKTLKISANELETLRLKKDRVSNDSNNINNRI
                     HQFQDEDPDDLGFGDEDFVRDDLQLNYRTTLNEPDDDELKLSPGTISTSSPKPRMRSK
                     SLSEYSEDTNDTDVTSQFNDDDFDDINDVDDIFGNEESGIYSSGGNGNTSKANRHLLM
                     KQQKLQNDAEIEERELFKKYKRLANDETNTLKLKDFTFYDHNPIDTDALENEKTVDYE
                     YTKDDFENFEDGFDTDVPIKLDVDKLKQYARGNKTVNIKSSMPNFNNKNNLSKAKKYK
                     STMDLVNEFETQHPVFNNNNKIIRKLDRIPSFYNKNDAMKSNNSKLNHDIELEKQQLL
                     NKYMEITEKQNRLNNRHRKKNLSMKHPNGKNKRIGLVRYLNDNPIPQSNNNSKMKYNP
                     VNKKWEGNDIELVKFENLNVPKPSLISFSEFKNNMKDKKLQGNMVYDPDQLKWINLNK
                     DEDNVFQGLPDLPDLQINKRSVPNSPTKTVGRGVSAFTQRTGSTNSIASNSPNSNEFE
                     VPPRLIEKFHKEEMKLSKKINYWFQQENYDLINSDFNHNYFWEIRKMVIDNED"
     gene            complement(<600415..>602070)
                     /locus_tag="DEHA2A07370g"
                     /db_xref="GeneID:2899857"
     mRNA            complement(<600415..>602070)
                     /locus_tag="DEHA2A07370g"
                     /product="DEHA2A07370p"
                     /transcript_id="XM_456646.1"
                     /db_xref="GeneID:2899857"
     CDS             complement(600415..602070)
                     /locus_tag="DEHA2A07370g"
                     /note="similar to uniprot|P22146 Saccharomyces cerevisiae
                     YMR307W GAS1 Beta-1.3-glucanosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07370p"
                     /protein_id="XP_456646.2"
                     /db_xref="GeneID:2899857"
                     /db_xref="GOA:Q6BYS3"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS3"
                     /translation="MLFKSLISSALLATSALVPSAVAEDLPEIEVVGNKFFYSNNGSQ
                     FFMKGVAYQQNTANSSDVSFVDPLADAEACKRDIPYLEELQTNVIRVYALNVSLDHTE
                     CMSLLQDAGIYVIADLSQPDESINRKSPEWNLELFDRYTGVVDLFQNYTNVLGFFAGN
                     EVTNDKTNTDASAYVKAAVRDTKAYIKAQNYRTIPVGYSANDDSDIRDSLADYFACGS
                     EEERADFFGINMYEWCGSSSFKKSGYESITKQYKNLGIPIFFSEYGCNEVSPRKFEEV
                     GTIYGDDMTDVWSGGIVYMYFQEENDYGLVSVSGSSVSTLKDFSYLKAELASISPSAA
                     QSSSVGSASVTSCPTSTSNWSAATKLPPTPDKEACDCMAKSLTCVVDSDVSSDDYEDL
                     FDYVCSKVDCDGINGNGTTGDYGAYSPCSDKQKLNFVLNLYYEENGSAKSDCDFSGSA
                     TTQKANTASSCSAYLKSAGSSGVGTISGSIQTTKHTGITKTGSSSKSTSGSGSGSGSG
                     SSSSSSSTNTGSSSGSHQISLGLATKSLLVGAVSIFGFGLIFA"
     gene            <604534..>605658
                     /locus_tag="DEHA2A07392g"
                     /db_xref="GeneID:2899858"
     mRNA            <604534..>605658
                     /locus_tag="DEHA2A07392g"
                     /product="DEHA2A07392p"
                     /transcript_id="XM_456647.1"
                     /db_xref="GeneID:2899858"
     CDS             604534..605658
                     /locus_tag="DEHA2A07392g"
                     /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
                     YML048w EFF2 involved in glucose repression"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07392p"
                     /protein_id="XP_456647.1"
                     /db_xref="GeneID:2899858"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS2"
                     /translation="MSDEKILNDVSESEDTGYLESYIRFNDDLEKDYCFQIKVDKRYR
                     DLLEIFKSLPIALRPNVFHYSKPIGFQVSTCPGYLTEDGSLLFSYETGMEKFLKKVSF
                     DDKIADTIWPGQLILPVWEFNSFAFYSFITLLVCWLYTDLPDFISPTPGICLTNHMTR
                     GASYLATYFGQHKLAHALIVDIEDPVGIIGQCLFFVFHLIKVLVIFLLFHLGTFNPIR
                     MNRFSGTKVPTDISREQLIELGWTGSRRATPDEYKEYYRDYKIKEHGGMVQAHQAGVF
                     DTLKNLGIYLGEGEGFNTPMDSKSTMADLCDEENDKFTLSYDYLAQLGAFFASYIEKE
                     GVDLADTIKQFRRFGLLHCTDSVKKAVQQRKIFGDSKINK"
     gene            <606159..>608462
                     /locus_tag="DEHA2A07414g"
                     /db_xref="GeneID:2899859"
     mRNA            <606159..>608462
                     /locus_tag="DEHA2A07414g"
                     /product="DEHA2A07414p"
                     /transcript_id="XM_456648.1"
                     /db_xref="GeneID:2899859"
     CDS             606159..608462
                     /locus_tag="DEHA2A07414g"
                     /note="highly similar to uniprot|P05694 Saccharomyces
                     cerevisiae YER091c MET6
                     5-methyltetrahydropteroyltriglutamate--homocysteine
                     methyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07414p"
                     /protein_id="XP_456648.1"
                     /db_xref="GeneID:2899859"
                     /db_xref="GOA:Q6BYS1"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS1"
                     /translation="MVQSSILGFPRIGGQRELKKVTESYWQGKVGVNDLLSKGKELRS
                     HNWKLQKEAGVDVIPSNDFSYYDQVLDLSLLFNVIPDRYTKFELAPIDVLFAMGRGLQ
                     RKATDSTPAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNTEAGLKPVDEYLEAKAL
                     GIETRPVIVGPISYLYLGKADKDSLDLDPISLLDKILPVYKQLLAKLKEAGAKEVQID
                     EPILVLDLPKEIQAKYADAYKALAGSDVPEIVLATYFGDVRPNLSAIKGLPVSGFHFD
                     FARVPEQLDEVVAALGDKQTLSVGIVDGRNIWKTDYSKASAFVAKAIEKVGKDRVVVS
                     TSSSLLHTPVDLQNEKKLDATIKDWFSFATQKLDEVVVLAKNASGEDVSKELAANAQS
                     IKSRQESSITTNPKVQERLATVNESLSTRKVPFAERLPSQQTKYNLPLFPTTTIGSFP
                     QTKDIRINRNKYTKGELTAEQYEEFINKEIETVVRFQEEIGLDVLVHGEPERNDMVQY
                     FGEQLEGYAFTTNGWVQSYGSRYVRPPIVVGDVSRPKAMTVKESVYAQSITDKPMKGM
                     LTGPVTCLRWSFPRDDVSQKVQALQLGLALRDEVQDLEKAGITVIQVDEPAIREGLPL
                     RSGKERSDYLNWAAQSFRVATSGVENDTQIHSHFCYSDLDPNHIKALDADVVSIEFSK
                     KDDANYIQEFSNYPNHIGLGLFDIHSPRIPSKEEFISRIEEILKVYPANKFWVNPDCG
                     LKTRGWEETKASLTNMVDAAKHFRGKY"
     gene            <608943..>610111
                     /locus_tag="DEHA2A07436g"
                     /db_xref="GeneID:2899946"
     mRNA            join(<608943..609133,609217..>610111)
                     /locus_tag="DEHA2A07436g"
                     /product="DEHA2A07436p"
                     /transcript_id="XM_456649.2"
                     /db_xref="GeneID:2899946"
     CDS             join(608943..609133,609217..610111)
                     /locus_tag="DEHA2A07436g"
                     /note="similar to uniprot|P34223 Saccharomyces cerevisiae
                     YBL058W SHP1 UBX (ubiquitin regulatory X)
                     domain-containing protein that regulates Glc7p phosphatase
                     activity and interacts with Cdc48p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07436p"
                     /protein_id="XP_456649.2"
                     /db_xref="GeneID:2899946"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6BYS0"
                     /translation="MSNQEQDQLIDQFVTVTNSSKSLAEQYLARNENDLINAIEDYYA
                     TSSNTENSGIDNTKPKQPKADLNNNEDDDEEDKTDTNFFTGGEKSALQVEDPNKRGDK
                     KKEKSIIDQIFQRAKEQMDQPDERPSSNQDQPEEVRKFTGTGFKLGGENEPSEQVADM
                     NSRLPKKPSKVTREITFWKQGFTVGEGALHRYDDPNNASVLQELNAGRVPMSLLDVEF
                     GQDVDVSVFKKTDEDWVPPKRKVGGFSGQGQRLGSPVPGESCGASPAPEAQPEPTKET
                     KPEDKGEGDSLVQIRFANGKKTSHKFNSTDSITKVYDFVRTHPFTESDKSFILTHAFP
                     VKPIEESNDLTVGDAKLKNAVIVQRWI"
     gene            <610405..>613701
                     /locus_tag="DEHA2A07458g"
                     /db_xref="GeneID:8998100"
     mRNA            <610405..>613701
                     /locus_tag="DEHA2A07458g"
                     /product="DEHA2A07458p"
                     /transcript_id="XM_002769954.1"
                     /db_xref="GeneID:8998100"
     CDS             610405..613701
                     /locus_tag="DEHA2A07458g"
                     /note="similar to CA0260|IPF13683 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07458p"
                     /protein_id="XP_002770000.1"
                     /db_xref="GeneID:8998100"
                     /db_xref="UniProtKB/TrEMBL:B5RSS1"
                     /translation="MMIKIIRPNVKIRVLNLSSYIRISLQIQKRCINTTIPCTYRSKL
                     GIPNIFGANESIVQLNNDSANGTNEFNDYSSIDDLQISLKNFMTSKPAFINAYNDYRK
                     KDLSVTRKFGELDEFISGIPKPNYRAIVSTNENMPPNTGSFIEIIDPSTSCVTFGVVL
                     EGSQTKFNENYNKLLVLTVDNKIEKIYPQDVSFHLSQVLDPHWIKTLRVIENRHDSTF
                     GNRLVLADILKLFLDKSLNRLQRLQDPNNNQFSIVFSQYATPFQMKSISLPDIYESFK
                     LSDPVLSDINSSYYNQSAFLLSCHLGMINSPEMWLVSSCYGTNKLTNLVKEGCSNEIT
                     SGSRYFVNSITNMESLSKLFDDFENPIYLAKYNTFLTTLFGEQTSQNPKSFDDLNVYF
                     NIWEGKYFLNIITVMKFFIIYPHSLIRDRIEKLTILGGQSMDPCTTYKFLEDLKIYNN
                     RRHQMTDIYLSANIMGKSLLSQLSISSINDLRPTSTQAESDNFMNEKITDKFPHLRKS
                     KVYYQDHIVYGLPFGKSIDSKQKSSLLAVSLEKINSRKYLINIHIPDMITKLSPSSNL
                     FDEIASSSLNMKSLTKLINDSNINIFDSDLIDKLSFPDHNLRETSDWFSVGDVSQRSN
                     KYDSGNKSNNNVTCMTVSFVYNKYESNPFSDLEEKISFSFDSLNSVSIKNIDWNTLEK
                     CLNGVTEVSPFTLFKERASRSKDKNNAELDDDDIHNMNFIFNVMKSHIKIRNLDGASN
                     VDPSIAFQNNDSSNLLKELSIVNKYEDQEKVLTTIESKTLENQLELSKSKFFINELDK
                     FVGKLTSRYCLMHDIPILTHHQDILESLNNESNPELIMKRETRDLNDEAYISHNNLFL
                     PNYHANSYFQTLIARDSSGYVSMSAYLIGLNYLTKPNIEVFADENLSFVPLGINDGYV
                     RMFGVFTDYEVLLNQFQILSHIQKFSQGNNPAFFKDNEHSAIIRQFSYLKRYGYKLNG
                     PLSHDALNHQLHKILNSYKLCDHLGTVHKHFWTLKLLEQRLLQETSLDSGTTGVTYDC
                     IITRAGYEIPSISKKIARGYCSQLNIEIDIMIPLDREVTIGNQIICDKVMFLDPIGGH
                     CVLRESQLLH"
     gene            <613874..>615492
                     /locus_tag="DEHA2A07480g"
                     /db_xref="GeneID:2899949"
     mRNA            join(<613874..613879,613954..>615492)
                     /locus_tag="DEHA2A07480g"
                     /product="DEHA2A07480p"
                     /transcript_id="XM_456652.1"
                     /db_xref="GeneID:2899949"
     CDS             join(613874..613879,613954..615492)
                     /locus_tag="DEHA2A07480g"
                     /note="highly similar to uniprot|P00899 Saccharomyces
                     cerevisiae YER090w TRP2 anthranilate synthase component I"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07480p"
                     /protein_id="XP_456652.1"
                     /db_xref="GeneID:2899949"
                     /db_xref="GOA:Q6BYR7"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:Q6BYR7"
                     /translation="MFSKIQPSLEALTSIVQSHQDDENKPNLYPIYKYVTADDLTVHK
                     AYLKLAKLNDPKRSPSFLFESAVNGDTVDRYSFIGLNPRKVIRTGEDERLFPKEHCNV
                     DPITILEKELAKYNQIQLPGLPKFSGGAVGYISYDCIKYFEPKTRKPLEDVLQLPEAV
                     LMLCDLIVAFDRVYDRFQIINNVAVTDSNDLQASFNKAAEAIDNVEKILRSESTPEEI
                     NPKQPPIKANQTFTSNIGQEGYEGHVSTLKKHILKGDIIQAVPSQRVARPTSLHPFNI
                     YRHLRTVNPSPYLFYIDLIDFEIIGASPELLVKADEKGKVVTHPIAGTVKRGKTNEED
                     EANAEILRSSLKDRAEHIMLVDLARNDINRICTPESNKVDRLLTIERFSHVMHLVSEV
                     SGTLRSDKTRFDAFRSIFPAGTVSGAPKVKAMELIGTLEKEKRGVYAGAVGHWGYDGK
                     TMDTCIALRTMVYKNGIAYLQAGGGIVFDSDEYDEYVETMNKMKANNQTIIDAEKVWI
                     EKVGQE"
     gene            <615764..>617452
                     /locus_tag="DEHA2A07502g"
                     /db_xref="GeneID:8998104"
     mRNA            <615764..>617452
                     /locus_tag="DEHA2A07502g"
                     /product="DEHA2A07502p"
                     /transcript_id="XM_002769955.1"
                     /db_xref="GeneID:8998104"
     CDS             615764..617452
                     /locus_tag="DEHA2A07502g"
                     /note="some similarities with uniprot|P40059 Saccharomyces
                     cerevisiae YER088c DOT6"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07502p"
                     /protein_id="XP_002770001.1"
                     /db_xref="GeneID:8998104"
                     /db_xref="GOA:B5RSS2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:B5RSS2"
                     /translation="MKSSEDESSPSMSSNTANAKNFSRTPTSWDASDDILLMHLKDQQ
                     KLGWKEIASNFTNRTPNACQFRWRRLKSGNLKNPPKSSSGLGSPASGSKVPATSGLKK
                     SKKGPGNARSVSPSNDSPSAFSSYSPITTATFTGYDNNINNALAGLNALSNTPSNISS
                     PMPNYHIGTNTNSSTPGLNSPDGGNRSHSLGHNHFDNSPRSEVSLDPQSHHGTTTNSG
                     GGYYADISIDPTMNLPHNQAHPHTPGHLTPRNSTSQGSQANSNRSNHQTHPIPHNVHN
                     NSIIQIVKDDRTSVSSATRASVSSLPSKSMNIPHHQSNNSALAHLPILFGGGSSISGP
                     SRNASVSGIPSTYQSTTVSSIRNGSVGSSGYYSRSGSVVIPFTGDKRDDENLKPDLKK
                     ADFPANTKKTPNKTHNSQKNTSKSSTPNAQATIFKIPWSMEEDELLINRRNRELSFAE
                     LSILLPQRTEGEIWSRIDYLEKLRNGHRSSTSREHRKGRQSSIGLDDDDDFYDEVDDV
                     IDGIDVSEDDDEDDDVLVDDDESLHHGTRKRKKRRTSSAVNPLAVGETLRRKLK"
     gene            complement(<617578..>618186)
                     /locus_tag="DEHA2A07524g"
                     /db_xref="GeneID:2899951"
     mRNA            complement(<617578..>618186)
                     /locus_tag="DEHA2A07524g"
                     /product="DEHA2A07524p"
                     /transcript_id="XM_456654.1"
                     /db_xref="GeneID:2899951"
     CDS             complement(617578..618186)
                     /locus_tag="DEHA2A07524g"
                     /note="similar to uniprot|P34222 Saccharomyces cerevisiae
                     YBL057C PTH2 mitochondrially-localized peptidyl-tRNA
                     hydrolases"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07524p"
                     /protein_id="XP_456654.2"
                     /db_xref="GeneID:2899951"
                     /db_xref="GOA:Q6BYR5"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:Q6BYR5"
                     /translation="MSQQNLSHLLSVGVISLITGFCISQYCGTKQCSRSKLKDSKKIP
                     KVPVENLSTEDESEYEDDSEDESIDIDSTPLNDVPGEVRMTLIVRQDLKMGKGKAAAQ
                     CSHATLALYKKISNPESEAYNPEMVNRWEYGNGQAKITLQVPNQEEMDTLFAQAISLD
                     VNAYIVHDAGRTQIAAGSATVLGLGPAPKLVIDQITKDLKLY"
     gene            complement(<618321..>619025)
                     /locus_tag="DEHA2A07546g"
                     /db_xref="GeneID:2899952"
     mRNA            complement(<618321..>619025)
                     /locus_tag="DEHA2A07546g"
                     /product="DEHA2A07546p"
                     /transcript_id="XM_456655.1"
                     /db_xref="GeneID:2899952"
     CDS             complement(618321..619025)
                     /locus_tag="DEHA2A07546g"
                     /note="similar to CA1056|IPF17503 Candida albicans
                     IPF17503"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07546p"
                     /protein_id="XP_456655.2"
                     /db_xref="GeneID:2899952"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q6BYR4"
                     /translation="MSDDLDRVLSTEESALVKDREIERVLNCCPWDYYSILEINPLKK
                     DIQLQNQIKRTYRKKTLLIHPDKVSNPNAPHAFDRLKKAELVLSFDIPESESEIESQD
                     DTSKLYVNEKKRLLAIYNDAENRLLRSKKIIQGDTYSEENYKQILQIVTEILNEEIKQ
                     EEIERNFQQQQEAKKMAELKKVQQERELKKKLANKWEDERDIRVNNWRSYTNKIEKPK
                     SKSKKKSGNSKKNVLA"
     gene            <619154..>620437
                     /locus_tag="DEHA2A07568g"
                     /db_xref="GeneID:8998125"
     mRNA            <619154..>620437
                     /locus_tag="DEHA2A07568g"
                     /product="DEHA2A07568p"
                     /transcript_id="XM_002769956.1"
                     /db_xref="GeneID:8998125"
     CDS             619154..620437
                     /locus_tag="DEHA2A07568g"
                     /note="similar to CA1055|IPF17504 Candida albicans
                     IPF17504"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07568p"
                     /protein_id="XP_002770002.1"
                     /db_xref="GeneID:8998125"
                     /db_xref="GOA:B5RSS3"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:B5RSS3"
                     /translation="MLTRLSLRVFSHFKASRMTFATSNEWKPRYFDIGVNFSDSMFQG
                     CYNGSTTPKHPADIDKVIARAHLFNVNKMLITASSIQESEEHFALCKEHPGMFYSTVG
                     VHPCTVAQEFYQKDEEMNEFTEELVPDVENRLNKLRDLVKLGYENGYVKAFGEIGLDY
                     DRFHYASKEQQITMFGKQLEVISSLKELKLPLFLHMRSACDDFISIIKPFIDRGDILK
                     GNGVIHSFTGSKEELEKLSELGFYIGINGCSLKTDDNLEVAKLIPKDKLMIETDAPWC
                     EIRKSHSSYKYITPYPNQFYPEISMEEPKPSSVEDESNGTHVQGKQKQKQKQASKQPQ
                     IKFDDFLPFPTIKKEHFAKHQNIIDTIAKQRNLEKITQPIGEFAYPLIRSRNEPVFVG
                     YVAEIMCELYDIKDPKDIADFIDLIYENTCKLFQI"
     gene            complement(<620543..>622939)
                     /locus_tag="DEHA2A07590g"
                     /db_xref="GeneID:8998126"
     mRNA            complement(<620543..>622939)
                     /locus_tag="DEHA2A07590g"
                     /product="DEHA2A07590p"
                     /transcript_id="XM_002769957.1"
                     /db_xref="GeneID:8998126"
     CDS             complement(620543..622939)
                     /locus_tag="DEHA2A07590g"
                     /note="some similarities with uniprot|P34218 Saccharomyces
                     cerevisiae YBL052C SAS3 Histone acetyltransferase
                     catalytic subunit of NuA3 complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07590p"
                     /protein_id="XP_002770003.1"
                     /db_xref="GeneID:8998126"
                     /db_xref="GOA:B5RSS4"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B5RSS4"
                     /translation="MTPKHNLLNSLRITNNKIYEDISLGHDVTDRSQRRKPPNNSYSI
                     KKLVRSTMNGVDVADSKSSVGVNSNVTIIRPITKHFYVKIRYDRNNRKSRNILKIPIR
                     RKLESKEHSLKDKNTNKATKYTGDEFSRELPYKGILKFPDCIINDTDPTRKDRELFHK
                     LYHEGEQLRKSNQIDETPTVEEISAMHGSTESTPAPTGNNYLKSQIKKIQFRDYEIDT
                     WYTSPYPEEYSQSKILYICEHCLKYMSSPISYERHQLKNCNLSNNHPPGIEIYRDLDT
                     NIAVWEVDGRKNINYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEIDKENPTKYHFV
                     GYFSKEKLSNSDYNVSCILTLPIYQRKGYGNLLIDFSYLLSRHEFKFGTPEKPLSDLG
                     LVSYRNYWKITIALKLKELHSKYLNNTNNDKNSNTLSISIENLSKLTGIIPSDVVVGL
                     EQLDSLIKNPITNSYGIVINLQKINYIIEKWKNKKYVCLNYSKLLWKPMLFGPSGGIN
                     SAPAMPSNPVSNLNNSTNFPSQPVINNSISNIVNFLKDDINNPYSFEEEASKEIECYL
                     DLGQEKEDINLRDNDIDDYIICYPGIDVNLRKKSTPVRQPPKINLLIESGKEPSMSPD
                     TRDVKGVNDLMDDEDIFEDEDEGVVSDESEDYVEDSDIGDEDEEEEEIGEVNEAEQQG
                     GDEVNYSSEQIDDVEEIRIPDYISDQDATNDNFDKTVAQPEGLPLTDRLEYDNPNIHE
                     TRKTRSHSNRQAVGPETLTRDTRSRRSPPDHDVPIRTTRFGRQRVHITEESPRLRRRR
                     "
     gene            complement(<623471..>625018)
                     /locus_tag="DEHA2A07612g"
                     /db_xref="GeneID:2899955"
     mRNA            complement(<623471..>625018)
                     /locus_tag="DEHA2A07612g"
                     /product="DEHA2A07612p"
                     /transcript_id="XM_456658.1"
                     /db_xref="GeneID:2899955"
     CDS             complement(623471..625018)
                     /locus_tag="DEHA2A07612g"
                     /note="weakly similar to uniprot|P39966 Saccharomyces
                     cerevisiae YER089C PTC2 Type 2C protein phosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07612p"
                     /protein_id="XP_456658.1"
                     /db_xref="GeneID:2899955"
                     /db_xref="GOA:Q6BYR1"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6BYR1"
                     /translation="MGQILSQPVTEKISEHGIDKHLAYGISCMQGWRVNMEDAHATIL
                     NLYDLKNEGKGAVSDKAQDNSSSGKSGTDNDTTEEHTSFFGVYDGHGGEKVAIFTGQH
                     LHEIIKSTKAFQEKDYVNAFKEGFLNCDQAILNDDEMKEDDSGCAAVSVIITPRQVIC
                     GNAGDSRSIMSINGFAKALSYDHKPSNEGEKSRICSAGGYVDMGRVNGNLALSRGIGD
                     FEFKKNIDLPPEEQTVTCYPDVIQHNLDFTKDEFVVLACDGIWDCLSSQQCIECVSRG
                     LYERKPLQDICEEIMELCCAPTSDGSGIGCDNMSMSIVALLDESRNESLDQWYDRVIK
                     RIELSQSEDEESQFYGNISGEYNDMYKQMYGEYFEIGQQSQNSNTKSAGNNSSYYSMF
                     GGLPGLRNGPGLNQNEDEEENELSNEPTEEIQEDGTAADLAGNGAISLQKLLASNAIT
                     NENGVIYLDTSSAQSLLAHFGMSGEDDEYEGNDVHDKHIEEEEVEEDDDQESKSKIEE
                     EPQDDEE"
     gene            complement(<626009..>628060)
                     /locus_tag="DEHA2A07634g"
                     /db_xref="GeneID:2899956"
     mRNA            complement(<626009..>628060)
                     /locus_tag="DEHA2A07634g"
                     /product="DEHA2A07634p"
                     /transcript_id="XM_456659.1"
                     /db_xref="GeneID:2899956"
     CDS             complement(626009..628060)
                     /locus_tag="DEHA2A07634g"
                     /note="similar to CA1071|IPF16624 Candida albicans
                     IPF16624"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07634p"
                     /protein_id="XP_456659.2"
                     /db_xref="GeneID:2899956"
                     /db_xref="GOA:Q6BYR0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BYR0"
                     /translation="MDLRNLSSTPNQLDSVMQRRPSLSSLSSASGYASSNYGGNTTPQ
                     ISKQRMSQARNFGNGNSNSSTNLQSAWLNQGQISSVSGQPSNQPSNQHVVNTVGPWVE
                     QQQAQQQAGVASLSGLDSKVIPPNLNDKNSSSINDNDNDNEVKQNAANDNNDDDDDDI
                     DDDDELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFT
                     STDETSSVVGLLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSTSN
                     ASLASLLSAASTTAATKNLSVNGTSNNQTERLFITFPSASGNLPLPPSELNLNDPEIL
                     ELYSQLILFRDDMAKSIFELAFPSSLGIAHRKILSILCSYLNLLELYDNGLIIIRRKQ
                     GQPAHLTQQSSAPQHSSSMMNLNQLPGIVSNPPNGVTPAAHPELLRSQSQSALQMPRL
                     RQQSSTPIQQNFPQYQQQPQGQQQSQLSHPQASGSQSQAQPPHQSQSQQQSQRPLYSS
                     NISQVQPYNMFQQPPAGHGQSQQVATPSMGSSSAAALLRSSNNRSYVDVRSTPPLSTT
                     FSQPPQSGNESPTPQHYHFANSNSNNQISQPTTPLANPDINSRFAPFGQHAHLTGSFS
                     SLHNSTNNASSQGPPNPQASQTNEEFADPEVFANKFNSINLSGNYENSNMSNSGIWGP
                     K"
     gene            <628604..>629034
                     /locus_tag="DEHA2A07656g"
                     /db_xref="GeneID:2899957"
     mRNA            join(<628604..628606,628759..>629034)
                     /locus_tag="DEHA2A07656g"
                     /product="DEHA2A07656p"
                     /transcript_id="XM_456660.1"
                     /db_xref="GeneID:2899957"
     CDS             join(628604..628606,628759..629034)
                     /locus_tag="DEHA2A07656g"
                     /note="highly similar to uniprot|P52871 Saccharomyces
                     cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
                     component, involved in protein translocation into the
                     endoplasmic reticulum; homologous to Sbh1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07656p"
                     /protein_id="XP_456660.1"
                     /db_xref="GeneID:2899957"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ9"
                     /translation="MSSSSAQAPGGLRSAAKRRIAADKKAQSSNAMPLSTRSAGAGGS
                     SATMMKLFTDEAQGLRVDPLVVLFLAVGFIFSVIILHVFAKITGKFSS"
     gene            complement(<629195..>630925)
                     /locus_tag="DEHA2A07678g"
                     /db_xref="GeneID:2899958"
     mRNA            complement(<629195..>630925)
                     /locus_tag="DEHA2A07678g"
                     /product="DEHA2A07678p"
                     /transcript_id="XM_456661.1"
                     /db_xref="GeneID:2899958"
     CDS             complement(629195..630925)
                     /locus_tag="DEHA2A07678g"
                     /note="similar to uniprot|P39965 Saccharomyces cerevisiae
                     YER087W Probable Prolyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07678p"
                     /protein_id="XP_456661.2"
                     /db_xref="GeneID:2899958"
                     /db_xref="GOA:Q6BYQ8"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ8"
                     /translation="MIGIRAGRYRHLCVRFTHTSTVPKLYLNNVELSGNDLTGIPTHE
                     LFTKFGFINHPKPGLVHWLPVGLAISQNVSRVIHRRMRECNAEEINLSLLSSSQLWQE
                     TGRWDNSELFKLKDSSKNDFCLVATCEEEITKLIGANLNSYKNLPLLYYQINEKFRDE
                     KRPRSGLLRGREFLMKDAYSFDLNEEAAMKTYNKVVDAYYKIFQDLRIPFVKADADTG
                     EIGGTLSHEWHYLHKVGEDTLFTCDECGNSSNIEKALSYPEDVDDSVDASVQYFMTKD
                     KSTLVCAYYPTDRTIEASFVKEEVPDLDLNETNQDSILKEFSDEDTLISKKIIRMMDS
                     RLNSRSNFPDFPIKFINRSLITTLTDIPIVTAVEDEICAKCEEGHLKLHRAIEVGHTF
                     YLGDKYSKPLKCEVEVPNQDGSQQLTNVLMGCYGIGISRIIAAIGEINKDSTGFRWPS
                     VIAPWNVTVVQSPKFDDSKGIKVYNLLNAASISYRLDDRSKIGLGKKIKQSHMVGIPL
                     TVILGNQFPLVEVEIRGRRYTDDLSWKRLYESRDFEWEVVTDADGNDIKHLVHIDGVA
                     RAINSLLIDM"
     gene            complement(<631125..>632525)
                     /locus_tag="DEHA2A07700g"
                     /db_xref="GeneID:2899959"
     mRNA            complement(<631125..>632525)
                     /locus_tag="DEHA2A07700g"
                     /product="DEHA2A07700p"
                     /transcript_id="XM_456662.1"
                     /db_xref="GeneID:2899959"
     CDS             complement(631125..632525)
                     /locus_tag="DEHA2A07700g"
                     /note="weakly similar to uniprot|P53707 Candida albicans
                     CSP37 37 kDa cell surface protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07700p"
                     /protein_id="XP_456662.2"
                     /db_xref="GeneID:2899959"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ7"
                     /translation="MSKGTKSLLALAATGGAVYWYDQNVSEILPRQQRIPPQPASTGE
                     KINRNINRQVDKLDNKKDELVDKVSSFTNEQQREAQKASESTLDSIKNSRLVNNISGS
                     VTDSRRRIEANVDQDKNVLYKLTDKYIDFVNDIGGSTTNQVDQLKSTAKSDKKRAEDK
                     ANSWFNWFGDKKDEAANNLDNNYDQAKRDAEKKKNEWFSWGSQKKDEAADRANAEAEN
                     LKKEKNAWSAWGSKKTDEVADKAAEEKKAWTSWGSKKADEAADKAAAEKNAWSSWGSK
                     KVDDATDKANQEAERLGKEKDAWTSWGSKKVDEATEKANQEAEALRKEKDAWASWGSK
                     KADEAADKFNEETERLKKEWENADKSGNSTAQQYTRGAKNSERAFGDAGDPLSASYVQ
                     GKERAIGNYEAAKKNLEDLTNKANANVKSLFQKAEPSSDERLKQAQEDFNSAFHNLRS
                     YGADVVEQIESNFKRN"
     gene            <633269..>633541
                     /locus_tag="DEHA2A07722g"
                     /db_xref="GeneID:2899960"
     mRNA            <633269..>633541
                     /locus_tag="DEHA2A07722g"
                     /product="DEHA2A07722p"
                     /transcript_id="XM_456663.1"
                     /db_xref="GeneID:2899960"
     CDS             633269..633541
                     /locus_tag="DEHA2A07722g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07722p"
                     /protein_id="XP_456663.2"
                     /db_xref="GeneID:2899960"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ6"
                     /translation="MPKEQFVSFIRYCHYSFVRNIILNLCGNTYQTNCDLFRFRTVRS
                     MTGSIVSKLTWIKFSGLDHLNSLGTLGNEELQCCAAVNGFISQNGP"
     gene            <634673..>636244
                     /locus_tag="DEHA2A07744g"
                     /db_xref="GeneID:2899962"
     mRNA            <634673..>636244
                     /locus_tag="DEHA2A07744g"
                     /product="DEHA2A07744p"
                     /transcript_id="XM_456665.1"
                     /db_xref="GeneID:2899962"
     CDS             634673..636244
                     /locus_tag="DEHA2A07744g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07744p"
                     /protein_id="XP_456665.2"
                     /db_xref="GeneID:2899962"
                     /db_xref="GOA:Q6BYQ4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ4"
                     /translation="MMRTTDKKQNDRSASVQTSIAAEGNNTDVEDNVITSVMSPQTGK
                     LVNITADGDVAMNYTMDEKEVEMDEATNKRILRKIDMYLMPVMCLLYCFQFIDKMANS
                     FASIMGMREDLHMVGNQYSWSGTSFYLGYLVLEFPVSLLLQRFPVSKTVSTFIILWGF
                     IMCMHSVPEYPGFIALRTILGMLESSITPAFVILTSQWYKREEQFIRTALWFGCNGLG
                     QIIGAGAISYNLFVNADSYSMEAWKLLFIITGVLTIALGFLIMAHIPDTPTKAWFLTE
                     EEKHLVVQRIRSNQQGFGNKHFKKDQFIEAITDIQTWLFAIFTISNNIPNGAVTNFSS
                     ILISGMGYSTSESLLMQMPQGTCMTCGCIGIACGTLLYPYRFFWAAVGISISLIGSCM
                     LSFAGPYKAQYAGLCLWNVAPVGFICMLSIIASNSAGHTKKVTVNAITLIAYCVGNLI
                     GPQTFIEAQAPEYAGGKIAIVVCIAISLATLFCIWFVFWARNKKLDANLNTKVENLEF
                     ADLTDKQNPNFRYAL"
     gene            <639390..>641903
                     /locus_tag="DEHA2A07766g"
                     /db_xref="GeneID:2899645"
     mRNA            <639390..>641903
                     /locus_tag="DEHA2A07766g"
                     /product="DEHA2A07766p"
                     /transcript_id="XM_456668.1"
                     /db_xref="GeneID:2899645"
     CDS             639390..641903
                     /locus_tag="DEHA2A07766g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07766p"
                     /protein_id="XP_456668.2"
                     /db_xref="GeneID:2899645"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6BYQ1"
                     /translation="MGMGSTTIDLSVDYDTQCGESLYKLWKITNNQIRCPKISSTERL
                     SNRSWRMLNQKVLLNNEANSDVMKDLYVDSLSDLKPKSSQFLSSRPSLFSNTSKSTLF
                     SHSSKNSSVGEKNEIEEIENGSEDVSDISDISDILEEDDYASSDSDEQDKKVNESNIQ
                     KINTYDQPEPNFAFGYFPPQLDIQNKEAEIKPPLNRSKTSFVRGFSPNHISVASSCSK
                     SKESLSLSAKKDINADGVDENMCRTNRNIFYIANSPSPPENNDTNRNSINSNRNGSHK
                     PVNESSPLLSKTGGSFDNVSPSKIKRQDSLFNNLQEQNNQVNSNDDDYLSTDISEEDD
                     DDSSDEDQSDVENDAKNTICESTSNNNPFSDDFDDQPGNMNESPDTAAKKKSQTHDSD
                     MIIKDHGKSNDNDSEWLSISSEDEKNYEPIPHEKLVFDKRLNPMSNNSSMSTDIIPIQ
                     DNEKRGSSPPISKPRSLLSSLFLNEMASSSSTSSFSTTNAKPLLKRSSTTGIITIDQT
                     NHGSNKGNSNKKSNKINRPSILFSRKHTSLTDISKNYPHYQNDLVQKHILNDYTNDQD
                     NEDNEDDFSGKQKSIVGVSDFNVTTKATDISNTNSINNDNSNTKVNDNEHNDNITLAS
                     SLNKYSDSLSNNSIKSLLSRSSLNLSQLFNSKNKSKKDLNVSTEKQESLKPTSRNPGS
                     SQGSDCSKSLSPSLLPMSPNSRTASTQKQKLDPYFKDRAGVNSNSNFNSTTSAVTNPD
                     PNLKVDPHPIAKSESNLTTNSEDNINVNNPRSIKLSPKSTRRSMLSTELSKSLKESIL
                     IDYKLGKIPLPLKVINDGDFVNKNSDTSECLDDYHLRGW"
     gene            <642043..>643845
                     /locus_tag="DEHA2A07788g"
                     /db_xref="GeneID:8998059"
     mRNA            <642043..>643845
                     /locus_tag="DEHA2A07788g"
                     /product="DEHA2A07788p"
                     /transcript_id="XM_002769958.1"
                     /db_xref="GeneID:8998059"
     CDS             642043..643845
                     /locus_tag="DEHA2A07788g"
                     /note="similar to uniprot|P53863 Saccharomyces cerevisiae
                     YNL227C JJJ1 Protein with a DnaJ-like domain that may
                     function as a cochaperone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07788p"
                     /protein_id="XP_002770004.1"
                     /db_xref="GeneID:8998059"
                     /db_xref="GOA:B5RSS5"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:B5RSS5"
                     /translation="MKTCYYELLQVESTATDLELKKAYRKKALQLHPDKNPDDIEGAT
                     ARFALVRAAYEVLSDPQERSWYDSHKSQILRDEDTFEVDENELVIPSISVEEILRYFN
                     PSFYTTIDDSQVGFYNVVSRLFERIAAEEISHAKHQGLAKYEKYHDDASNVNVIDESM
                     LLYPKFGNSKSDYISHVRPFYNTWLSFQSVKAFNWKDEYRYSMAPDRRTRRLMERENK
                     KARDAARKEYNETVRSLVAFIKKRDMRVKQGISEYEKQKKKKQQEELEDQIKNNRQDE
                     LRKLATQNKFEIQDWQQLSVEELHELEQMLDEEYNSSSDSEFDEYEQTGDENFFECFV
                     CNKYFKSEKQFETHEQSNKHKKVVSKLKWEMQKEGIELGIDKDDVDLDEFETASSGLD
                     SEDDDIDTEDDNLSEVSDSPNDNLGQDNRVNSPQVIEHADNTIESIEFEVDDEINSDF
                     EDGAEPIIVPQASLRKSKNKNKNKKSTPAYSDDENDDLQRELSKLTSNLNGVALDDDS
                     DWSTNPKGKKNKKKRNPTADSETASPQPQAALPKKKKYTESDDLPTHVPKGSDICVVC
                     KELFTSRNKLFQHVKTTGHAAPLPQAKKGKKKKN"
     gene            complement(<643884..>646310)
                     /locus_tag="DEHA2A07810g"
                     /db_xref="GeneID:2899654"
     mRNA            complement(<643884..>646310)
                     /locus_tag="DEHA2A07810g"
                     /product="DEHA2A07810p"
                     /transcript_id="XM_456670.1"
                     /db_xref="GeneID:2899654"
     CDS             complement(643884..646310)
                     /locus_tag="DEHA2A07810g"
                     /note="similar to CA1960|IPF15232 Candida albicans
                     IPF15232"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07810p"
                     /protein_id="XP_456670.2"
                     /db_xref="GeneID:2899654"
                     /db_xref="GOA:Q6BYP9"
                     /db_xref="InterPro:IPR000467"
                     /translation="MPKRGGRKSHPKKDKGGGGGGSNFGRFKTNKNKKKTGMGSSKNH
                     GTPRSTNIDIPELMDLDDNVYIPEIDTKVSQSSMKNLSRRPGRRHLYEEVGYTDKHIE
                     DTLRQPLRNRPIEFVKAKQVYDPSADLFKKLGKSGIPKVHQDLLDSMNSPPSQEAHVP
                     ESPILDILSEESEDDAIDEVVAHLASSNTSLDSDLVGRGEISKTNDEGESDDVEEEIE
                     EEVEDENESEHNEHRGIESQTESEQDEQDEQDEQDEAEEVEEEEEEAFIIDDTGDAEI
                     LKDHNPVKPQTSLLIQSKLPKSSTQNDIDNIGGGLDYDPVLNIGKVSLQTKRDENGQS
                     TTELMSVNQLNKISTKGFIDEKKMLPNMEKNVSDISDDDFGGYKDYIAQVMRDGKLEV
                     DSDEYESETNFDIMASSSDNDDDDEDNDEGEKDPSEIEYGFLPEDYEFDVSQVSISNV
                     RFGINNQLYTKCAELTGSDDQFLWIDEDDLVDYVLSKGVREHRLNSFMKFITKGLIDE
                     EAIEVPNYSDVYISETSEDEEEGANSEDENLAAMIAFTKSQQQSFMDLDIPSTERLKT
                     KGKGKKKQLDLDRMQLDIDMRESLQDQYQVHRQAKRSKKQRREDARYEGGIAKHDLLV
                     KYPYSLHIKDICYEFETFLHDTSRDSMNFPPLDPHGNKTVIKISNFYNMKSLKCGTGL
                     KSFVKVSKNRKTFHYLPRYDQIGNVSRQRPIFNRIDQKRPKDEITRSDGNSKKDRSRG
                     RNKSESSAQSREGDIVGASAPEIGTNNIGRKLLEKLGWSKGEGLGAHGNKGISEPVVA
                     KIKKSKTGLK"
     gene            <646494..>647972
                     /locus_tag="DEHA2A07832g"
                     /db_xref="GeneID:2899646"
     mRNA            <646494..>647972
                     /locus_tag="DEHA2A07832g"
                     /product="DEHA2A07832p"
                     /transcript_id="XM_456671.1"
                     /db_xref="GeneID:2899646"
     CDS             646494..647972
                     /locus_tag="DEHA2A07832g"
                     /note="weakly similar to uniprot|P53867 Saccharomyces
                     cerevisiae YNL223W ATG4 Cysteine protease required for
                     autophagy"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07832p"
                     /protein_id="XP_456671.2"
                     /db_xref="GeneID:2899646"
                     /db_xref="GOA:Q6BYP8"
                     /db_xref="InterPro:IPR005078"
                     /translation="MSNRDSSEHGDSSNKIASNECNEATKLGFNFTQLWSQITTTYSL
                     IDRNDSNMFNRDERVESEQEKKSVVILGKKYDDISVDDGVIEQDIYSKIWLTYRTGFE
                     PIAKCLDGPQPLSFVQSMVFNRNPISSTFNNFHGLLDNDNFTTDVGWGCMIRTSQALL
                     ANTYQLLFLGRGFSYGRDRSPRHDEIIDMFMDEPRAPFSLHNFIKVASESPLKVKPGQ
                     WFGPNAASLSIKRLCDNVYESNGTGRVKVVISESSNLYDDIITQMFTTLNPVPDAILV
                     LLPVRLGIDKVNPLYHASVLELLALRQSVGIAGGKPSSSFYFFGYKGNDLLYLDPHYP
                     QFVRNKTSVYDTYHTNSYQKLSVDDMDPSMMIGILIKDINDYEDFKSSCTKSSNKILH
                     FHPTSEKADRRGSLSEFKRKNSEFVCIESKDVQRREDFITIDNVSRDDLNNMEGFIDM
                     ADEFDSEIDQNNKDDNFDDDEPVNVSQTSIGEEYTSTAGSRP"
     gene            <648333..>649004
                     /locus_tag="DEHA2A07854g"
                     /db_xref="GeneID:2899647"
     mRNA            <648333..>649004
                     /locus_tag="DEHA2A07854g"
                     /product="DEHA2A07854p"
                     /transcript_id="XM_456672.1"
                     /db_xref="GeneID:2899647"
     CDS             648333..649004
                     /locus_tag="DEHA2A07854g"
                     /note="similar to uniprot|P53538 Saccharomyces cerevisiae
                     YNL222W SSU72 Transcription/RNA-processing factor that
                     associates with TFIIB and cleavage/polyadenylation factor
                     Pta1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07854p"
                     /protein_id="XP_456672.2"
                     /db_xref="GeneID:2899647"
                     /db_xref="GOA:Q6BYP7"
                     /db_xref="InterPro:IPR006811"
                     /translation="MVSDSLKICTVCAANNNRSMESHKQLKDAGYNVRSFGTGSAVRL
                     PGPSVDKPNVYEFGTPYDDIYRDLTSQEYHKMYESNGLIRMINRNRHIKRAPEKWHNN
                     ASAGKFDLVITCEERCFDLVLDDLMVRLVNKDQADTEIKQAVHIINIDIKDDYENAVI
                     GGKGILKLVNMIHEFRNTNKQRRLDHDFDDESDTILEDQMMKLLAKWQQEHTHLPTLY
                     SVAYY"
     gene            <649155..>651461
                     /locus_tag="DEHA2A07876g"
                     /db_xref="GeneID:2899648"
     mRNA            <649155..>651461
                     /locus_tag="DEHA2A07876g"
                     /product="DEHA2A07876p"
                     /transcript_id="XM_456673.1"
                     /db_xref="GeneID:2899648"
     CDS             649155..651461
                     /locus_tag="DEHA2A07876g"
                     /note="similar to uniprot|P41812 Saccharomyces cerevisiae
                     YNL221C POP1 Subunit of both RNase MRP"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07876p"
                     /protein_id="XP_456673.2"
                     /db_xref="GeneID:2899648"
                     /db_xref="GOA:Q6BYP6"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="UniProtKB/TrEMBL:Q6BYP6"
                     /translation="MPPKPNISNKKAKLYNSRSIRAELTDPSFNEGKLSVPDFLSSRN
                     FEIKSFELSQLNSKYASSTRCFQSLPRKLRRRTASHNVKRIPKRLRNRALREMQNSIN
                     GLPPKKKHLRGRELYRLKMSKRLLKLASRIKSLRSIPSEDIQNKPLKLRQKLKILDEQ
                     IKSLCKNTAKPTLNNKMGSYDNTGINAFASKPRGNLKYAKRQNNFVWIPTHVWHAKRF
                     HMIKKWGYQIPLEPTQKCFKSTNRASRNETIIYDTSYYDCLIVETVNSAEANTFLNII
                     TKLKGDIPKKILSGHKCYDDWLFKDGKRIGMGLVFSVEDLNKILIRVHPSLYDEFFEY
                     VKSLLKVSETGNNVFDCRYSLGSIELNGPKSVNSLSKVLHLNSSDPITKNWFELAKLN
                     DPNSVPNGTTFSFNIKDPRFFKSPTNVPYNTDVVNFNDLIVRLSQERTIDIDTLDVLL
                     DNGKRNNTYCDQLSTKEISREFQKDKVVQKMHEFPVLITKLKSSNNWTLICPWYWTLP
                     IWLKLNQIHHISTGGIKQLHQINFEHCRASYPIDFQFLKEGYLENKFKSTIAEAQYAK
                     KPKSKRPKYEISEGIISPFGCDWDFLQKMIFASSLSNNSTLCTKNQFGNFDENLIRKV
                     ESVNDVIALVKQCQSNDQIPIELYDKHNPQHIKFINKSSFEHMDEFPKVPVLQINLQI
                     QGRGSIQDNSRIYRIPSETRNQYLRGTFDHCPPPTDLIGFVTSGSYNLNLGFASGIGC
                     IVASHKDELVLVRNVGSSLTRLAKWSII"
     gene            651586..651722
                     /gene="SNR19"
                     /locus_tag="DEHA2A07898r"
                     /db_xref="GeneID:8998122"
     ncRNA           651586..651722
                     /ncRNA_class="snRNA"
                     /gene="SNR19"
                     /locus_tag="DEHA2A07898r"
                     /product="U1 RNA"
                     /note="SNR19 (U1 RNA)"
                     /transcript_id="XR_003013363.1"
                     /db_xref="GeneID:8998122"
     gene            <653106..>653429
                     /locus_tag="DEHA2A07920g"
                     /db_xref="GeneID:2899657"
     mRNA            <653106..>653429
                     /locus_tag="DEHA2A07920g"
                     /product="DEHA2A07920p"
                     /transcript_id="XM_456674.1"
                     /db_xref="GeneID:2899657"
     CDS             653106..653429
                     /locus_tag="DEHA2A07920g"
                     /note="similar to CA2885|IPF7204 Candida albicans IPF7204"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07920p"
                     /protein_id="XP_456674.1"
                     /db_xref="GeneID:2899657"
                     /db_xref="UniProtKB/TrEMBL:Q6BYP5"
                     /translation="MQFSKVLIPAALAAYVSASNVTVTTDVVVTDYTTYCPEPTSVVV
                     NNKTITVSEATTLTITGPCTIPTTYTTSNAETSAPSVTSVENGAGKAVVGAAAGVAAI
                     AAALF"
     gene            complement(<653958..>656588)
                     /locus_tag="DEHA2A07942g"
                     /db_xref="GeneID:2899658"
     mRNA            complement(<653958..>656588)
                     /locus_tag="DEHA2A07942g"
                     /product="DEHA2A07942p"
                     /transcript_id="XM_456675.2"
                     /db_xref="GeneID:2899658"
     CDS             complement(653958..656588)
                     /locus_tag="DEHA2A07942g"
                     /note="similar to uniprot|Q01477 Saccharomyces cerevisiae
                     YER151C UBP3 Ubiquitin-specific protease that interacts
                     with Bre5p to co-regulate anterograde and retrograde
                     transport between endoplasmic reticulum and Golgi
                     compartments"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07942p"
                     /protein_id="XP_456675.2"
                     /db_xref="GeneID:2899658"
                     /db_xref="GOA:Q6BYP4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6BYP4"
                     /translation="MSTSSNTSNSGPNRFRSDAASFSPSVPSPGVMNQQMQQQQHIYP
                     QYMYGTPQMVPNQYYPYMTPYMMHPNAPYSDFNPYTQAYGGYPMQMPQYPGQPYPGMP
                     NMSGGGNMNMNAMMNNRPKMNHNNKSKPYISNSNRSRSSSTVSSNVPNQYQHHQQTPP
                     VSHPHPHPHPQDQWKHENKPENPADEKAQTDQRKSDTSSSTDTNHETSKQVKKHVTLE
                     STTKKGQEKTPSTSSNKPMSYPLYFNETAQDFIKSQQSIASERNQLVKQKNERLNEFI
                     RSENNEKQSLVINRNSNITIIDYNTNTTHKTIENNNYNTHRPNDNDDNNSNKFNDNSN
                     EVDLEGEDSTDINKDNKSANWASFLQTTATVPAKKSKSQPKPSTGPSQISASSSTTGI
                     SPSTNNTQVNNILALDSSQPLGILMLKIMFDNNYSVMNSYNNCPIFRVKPRGLTNTGN
                     ICYMNAILQVLLYCEPFNKTLKLVESKSIGSLSQKSTTPLLDIVIKFWKEFSQPSSMK
                     PISPDNFYMSLITHEKFSHLKWGQQEDAEEFLGYFLDGLHEEFVGSIKGLNTPQTDLL
                     IQQFQQQNEDIDQLKLNAFKLNIKNTMKIIKKSKSENQDTTHQEEVSDHESNGWSEVG
                     SNNKKISAKRTVEIEPSPITTIFGGQFRSVLQIPKNKESQSITLDPFQCIQLDISDSS
                     ITTVEDAFKQLNEPENIPYKSSSNKEVIAKKQTFIDQLPNILIIHLKRFSYQQEKEKE
                     STPSNEQSSNTSSNGSRPLGSIEKLRKKIEYSHHLTIPNEVLSPLYKHSGNISNHYKL
                     FGVVYHHGVSAEGGHYTSDVLRKSSVFDNEEESNDKKVDNQWIRIDDTQITELEKDEV
                     LNGGDEETTKNAYILFYQKT"
     gene            complement(<656986..>658131)
                     /locus_tag="DEHA2A07964g"
                     /db_xref="GeneID:2899655"
     mRNA            complement(<656986..>658131)
                     /locus_tag="DEHA2A07964g"
                     /product="DEHA2A07964p"
                     /transcript_id="XM_456676.1"
                     /db_xref="GeneID:2899655"
     CDS             complement(656986..658131)
                     /locus_tag="DEHA2A07964g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07964p"
                     /protein_id="XP_456676.2"
                     /db_xref="GeneID:2899655"
                     /db_xref="UniProtKB/TrEMBL:Q6BYP3"
                     /translation="MQGSDENSFNDDDDFLLQENSAILSILPSLIQDLFHWESHLEIL
                     LKFLQNQIEASEVLEESQTIQLQAIYSQIQEISEKGMVENCHQKDVLVIDENKSILLA
                     FTFGRAFADALSILSDPRNINIVVYCEEGTDENLVNELGANYLQGKFESTGSNACLPI
                     SVKVTQVKQIRESSKGRVSKKRMAEIGQRLAHLNLEKMLHNAGLTINDAGELTTIPKS
                     TSILNIPTNTSKPTTMFSANSVERTRLQKELDAAVATKRESYVVDLKSWYCSCDEFQA
                     SYVPQTTPDTSDNDSDTHCPISPYDTLSTPAGLYMMDTDDLIAKCHDNPITRYFRSLS
                     PHNQTRHLSKLPICCHLIALSIAATNSPHTHRYFTILSSDNVWSMLT"
     gene            <658274..>659722
                     /locus_tag="DEHA2A07986g"
                     /db_xref="GeneID:2899653"
     mRNA            <658274..>659722
                     /locus_tag="DEHA2A07986g"
                     /product="DEHA2A07986p"
                     /transcript_id="XM_456677.1"
                     /db_xref="GeneID:2899653"
     CDS             658274..659722
                     /locus_tag="DEHA2A07986g"
                     /note="weakly similar to uniprot|P40161 Saccharomyces
                     cerevisiae YNL206C RTT106 Regulator of Ty1 Transposition"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A07986p"
                     /protein_id="XP_456677.2"
                     /db_xref="GeneID:2899653"
                     /db_xref="GOA:Q6BYP2"
                     /db_xref="InterPro:IPR013719"
                     /translation="MSNDQKWIKSLPSDLQNQVNALVEAHPPSLTVIHKLCEYFKTNA
                     SEHEDKRRKLSSDPEIKSEGHVPEALSGPKSEVPGQIHEQEIIFELPQISFQSPIRKK
                     LNLIFHLLVEPGQSPKPVMSLALPTTYVPEISIHNLASSIRLCVLLPILGNSTNNTKR
                     NIGLLCFWIHDDAASDPNKNDPIICQVNFDQVKKQLIKAGKIPAEAETQLKEMNESNQ
                     SQDGIKAINEAIINFLQKQFQLCGIHMINYLPSSSATKNKLTINTDAGVAVSSNANSV
                     NDLVMVEAYKGARDGAVLMLTANEYNQPYIIFGFKKPILIFDISKVQHVSYSNITRLT
                     YSMIVTVVNEKKDSKVETLEFGMIDQKYFQIMDEFIKSQGINDNSFDEDLREKVTTNA
                     NSGEGEQASEQAAPADSDDEEEDGTFQVGQEEEGESSVDEEYDSNAGSDGDSDVGEEE
                     DDTNENNEGANPAASTEADDVVTQSKEEDDEQ"
     gene            complement(<659942..>660286)
                     /locus_tag="DEHA2A08008g"
                     /db_xref="GeneID:8998129"
     mRNA            complement(<659942..>660286)
                     /locus_tag="DEHA2A08008g"
                     /product="DEHA2A08008p"
                     /transcript_id="XM_002769959.1"
                     /db_xref="GeneID:8998129"
     CDS             complement(659942..660286)
                     /locus_tag="DEHA2A08008g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08008p"
                     /protein_id="XP_002770005.1"
                     /db_xref="GeneID:8998129"
                     /db_xref="UniProtKB/TrEMBL:B5RSS6"
                     /translation="MVVASPAGLLVSGFLGLITRRMQVSIIGKEYPRSFNRVPGYLYS
                     VGAFVGGYLIFSNIVENNRELLDRRLSILREQRALKDAFHEFKEEPDHRFIAEKRGRF
                     FKLMDKFSTTDK"
     gene            <660705..>662027
                     /locus_tag="DEHA2A08030g"
                     /db_xref="GeneID:8998115"
     mRNA            <660705..>662027
                     /locus_tag="DEHA2A08030g"
                     /product="DEHA2A08030p"
                     /transcript_id="XM_002769960.1"
                     /db_xref="GeneID:8998115"
     CDS             660705..662027
                     /locus_tag="DEHA2A08030g"
                     /note="similar to uniprot|P10356 Saccharomyces cerevisiae
                     YER152C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08030p"
                     /protein_id="XP_002770006.1"
                     /db_xref="GeneID:8998115"
                     /db_xref="GOA:B5RSS7"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B5RSS7"
                     /translation="MSKSTQPLINFFKGHPTNSLLPSKEIANSYKNVLLEYDYTKYDN
                     DPLNRHALTYGADAGNLDTRKAISKWNDKYFGRNGTDPDCINLTGGASYGFANILASM
                     TDTKDITRRGFIVSPTYYLITPSFIDAGFEDKLTAVVETPGQEYEIDLKFLEEQLEFY
                     DRGLPPVGNKEINIISDPSGRPDRKLYRYVIYIVPTYSNPGGLVYSAKTRTKLIELAR
                     KHDMLIVSDDVYELLNYTDADTPIPRFCYLDRDSLPEDFKFGNSISNATVSKLLAPGL
                     RFGWQETPTPNLVQQLAITGANLSGGTPGQLASIVVQDLITSGQADIIIAGLIKVYKS
                     RAQTMIRSIKKYLPACTNVYGGEGGYFLWVTINADIDHTKIVDMLKEEHNIILASGNN
                     FEVCGDEKGWGKNSVRLSVSFLNEHEIEKGIRKWGDVLRRKHIEVFKN"
     gene            <662497..>663663
                     /locus_tag="DEHA2A08052g"
                     /db_xref="GeneID:2899656"
     mRNA            <662497..>663663
                     /locus_tag="DEHA2A08052g"
                     /product="DEHA2A08052p"
                     /transcript_id="XM_456680.1"
                     /db_xref="GeneID:2899656"
     CDS             662497..663663
                     /locus_tag="DEHA2A08052g"
                     /note="similar to CA0676|IPF13097 Candida albicans
                     IPF13097"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08052p"
                     /protein_id="XP_456680.2"
                     /db_xref="GeneID:2899656"
                     /db_xref="GOA:Q6BYN9"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN9"
                     /translation="MHFYFPDWVIKYKEHQISALSLYSYILDWSIYILILVIFMVYGT
                     LLAPRYHEFSLSDSTLMYSYRSEKETVIPLYMLIIIAVVIPIIQFVFCSIYNRHTLSG
                     ARRAWDIFSGLMALSGSMATQLMITCILKNICGLPRPDLISRCQPTQTEMLIYGQLAT
                     VEICETFSRDSVGPSLHILQEGFRSFPSGHSSTVFCGMVITSLNFAGKLQIFDKRGIS
                     FKVLLAICPIMVACFVSCTRISDNRHFLRDVIGGSVIGTHVAIWFYLQYFPSIFNLEN
                     CGRAYPPRRIGVANFFNNVGGFWKIRDVLPGAYVERVLNNPGIIPQLSSELQPGESIS
                     AMEIVDLSTNISFFNKLTSLLPDKYINLNNTDPILPVWTSRSADNDPPIIPKST"
     gene            complement(<663739..>664773)
                     /locus_tag="DEHA2A08074g"
                     /db_xref="GeneID:2899643"
     mRNA            complement(<663739..>664773)
                     /locus_tag="DEHA2A08074g"
                     /product="DEHA2A08074p"
                     /transcript_id="XM_456681.1"
                     /db_xref="GeneID:2899643"
     CDS             complement(663739..664773)
                     /locus_tag="DEHA2A08074g"
                     /note="similar to uniprot|Q9P827 Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08074p"
                     /protein_id="XP_456681.2"
                     /db_xref="GeneID:2899643"
                     /db_xref="GOA:Q6BYN8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN8"
                     /translation="MSSNEVISIPTTSVSKDNVVYYNVNIKMPLRSSSVSRRYSEFTR
                     LVDQLCYEIGINNKDFPYKLPSKASIWSMTNKNAVVSERQIELTSFLNQLLKDKDLQN
                     HPLVHDFLQLPASFKVTSSMFERKGKDASITELIIPDAQAIDSHKWLEYSRLFKYHIN
                     DLRDSYNTAGNISMKVDIRDKINKIIKPNLAQLSGSLTNLLNNQMIDKREYNKRQVLL
                     ESLKTDLDELFGELDALNSKNSNKQTLFSNSRRVLGGANTADNAKETNETLPLDNQEL
                     LQSQLQIHSQQDQDVAQLRKLIQRQKEIGQTINTEVEEQNELLDQFNEDVDKTTDRLQ
                     VARKKARNIL"
     gene            <665114..>666823
                     /locus_tag="DEHA2A08096g"
                     /db_xref="GeneID:2899659"
     mRNA            <665114..>666823
                     /locus_tag="DEHA2A08096g"
                     /product="DEHA2A08096p"
                     /transcript_id="XM_456682.1"
                     /db_xref="GeneID:2899659"
     CDS             665114..666823
                     /locus_tag="DEHA2A08096g"
                     /note="similar to CA0678|IPF13094 Candida albicans
                     IPF13094"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08096p"
                     /protein_id="XP_456682.2"
                     /db_xref="GeneID:2899659"
                     /db_xref="InterPro:IPR019431"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN7"
                     /translation="MSSEYQSIPQEEGSSSSNAISNEVNRSSMNDRHSSTESIISTDA
                     ERQPLVDRESGNHRYLSPDDPLVSPINLYKIRVLRVSLLTIFAINCVLFFAFLLSDFI
                     AIPGLNNRGKSFLELDLVILNILTNLVTLWCFVVPAYYERVLGYISASLLLIDFIIMF
                     SIPRMRDQFGVIGTFVLLWTLANVVLNCFADFWVEKGKLYLERKYTGREETRKSISEL
                     FVIAVKVLFKLFLLWLIWCISLSLWLQAFDSHEKPWGKMIPVDNDQFKVHLACYGDVH
                     APPGDINATDNKEKQPIVLIEGGQLDSSEVVQEWVEELYHLGKIDRYCIWDRPGYGFS
                     DSAPSPLSIGIVSEYLIEALRKERLEGPFSLVGFDIGGLYARMFASRSSGNIHSLLLV
                     DSWHEDLLKIRPFSGSNMKNENKRVFKNILELMDTKTGLKLWLKGLVSPLGIVSNINW
                     FFHPKRHSSNSRIFGSDMYYSSKYIRARLQEQVTASILSYNEMAGTDLHDIPVSVISS
                     DFMIKNSLNWGKWQRSLTKLSDQTIEWVVAENSNHLIWRSPKGKAQLQQLLLRLVSEK
                     SNY"
     gene            <667210..>668739
                     /locus_tag="DEHA2A08118g"
                     /db_xref="GeneID:2899660"
     mRNA            <667210..>668739
                     /locus_tag="DEHA2A08118g"
                     /product="DEHA2A08118p"
                     /transcript_id="XM_456683.1"
                     /db_xref="GeneID:2899660"
     CDS             667210..668739
                     /locus_tag="DEHA2A08118g"
                     /note="similar to uniprot|P53924 Saccharomyces cerevisiae
                     YNL116W DMA2 Protein involved in regulating spindle
                     position and orientation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08118p"
                     /protein_id="XP_456683.2"
                     /db_xref="GeneID:2899660"
                     /db_xref="GOA:Q6BYN6"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN6"
                     /translation="MIGESTSGDVNPVLTRNMSTNKSTPVSSPSLSFRSSPPENNNEG
                     SQVQGGNLTNGEVASSTNPPGVSVDRNSRTSTPNENANATSGTYIPTDGPSSNISSAN
                     GPGQFENIGPTNGSSTNIISKTSSNATNNPPAPTRRSSFGLGFLSSLTNSIRSQHNTS
                     SASETPHNFMSNSPTIANLNNYSMSLSEPIEPVISEDAMPPPNDTNASESSNSDFDHN
                     AELNNLSNLNDEAIDGDRTRVAVNNPSEDQLVEGSNKGVENGIDKDGYFSVRLTPLID
                     YSSSASGLYFSPIIRKVKPTNSITIGRYTEKNKSAAHAPQGSSAPIVFKSKVVSRTHA
                     LFQCNEDGQWFLKDCKSSSGTFLNHIRLSPASQASTLMPLIDGDIVQLGMDYRGGTEE
                     VYRCVKMRCEFNKSWQRKVNQFNLEIHQKLKNMAIGSNDNDIAMNPINKALVSENLSE
                     CAICLLELEPCQALFISPCSHSWHYKCIRPIIIKSYPQFYCPNCRSMCDLETDIEDEG
                     E"
     gene            <670000..>671739
                     /locus_tag="DEHA2A08140g"
                     /db_xref="GeneID:2899661"
     mRNA            <670000..>671739
                     /locus_tag="DEHA2A08140g"
                     /product="DEHA2A08140p"
                     /transcript_id="XM_456684.1"
                     /db_xref="GeneID:2899661"
     CDS             670000..671739
                     /locus_tag="DEHA2A08140g"
                     /note="similar to uniprot|P47186 Saccharomyces cerevisiae
                     YJR160C MPH3 Alpha-glucoside permease and similar to
                     uniprot|P47186 Saccharomyces cerevisiae YDL247W MPH2
                     Alpha-glucoside permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08140p"
                     /protein_id="XP_456684.2"
                     /db_xref="GeneID:2899661"
                     /db_xref="GOA:Q6BYN5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN5"
                     /translation="MSAQHVEDIDKPGVVIEVNPLNKNMTDDSMAHEAQDFMDKFLDM
                     SENAKDNDRKEKYMPLKEGLKTFPKAAMWSVILSTALIMEGYDTNLLNSLYAFPDFAK
                     KFGEYSESDGSYQIPAKWQTSLSMCVNVGEIIGLFIAGIIADRIGYRKTLIGALMLTT
                     GFIFIVFFAVNVEMLLAGELLLGLPWGAFQTLTVSYASEVCPTTLRVYLTTYVNVCWV
                     FGQLISSGILRGLVSSDIEDVYRIPFAVQWVWPIPIAIGIYLAPESPWWLARKNRIQE
                     AKHSIKRLLTVNEHLPDKEILAEAMVQKIQMTLKEEALTNNGESFLDCFKGQDLRRTR
                     IAAIVWVSQNLTGSSLMGYSTYFYQQAGLGQNMSFTFSIIQYCFGIVGTLGSWLLSQK
                     AGRFTIYFYGLCSLFCILFVVGCLGINPTESSSWGVGSLLLVYTFVYDLTIGPLCYCI
                     VAEIPSTKLRTKTIIIARNAYNIAGIVVAIITPYMLNPTAWNWKAKTGFFWSGFAFFA
                     AIWCWFDLPETKGKTFAELDQLFENKVKARQFKKTEVEVFNTDELIERLGEDGIKDLV
                     VTDASKDEFSEKV"
     gene            complement(<671913..>673868)
                     /locus_tag="DEHA2A08162g"
                     /db_xref="GeneID:2899662"
     mRNA            complement(<671913..>673868)
                     /locus_tag="DEHA2A08162g"
                     /product="DEHA2A08162p"
                     /transcript_id="XM_456685.1"
                     /db_xref="GeneID:2899662"
     CDS             complement(671913..673868)
                     /locus_tag="DEHA2A08162g"
                     /note="weakly similar to CA5555|CaSUC1 Candida albicans
                     SUC1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08162p"
                     /protein_id="XP_456685.2"
                     /db_xref="GeneID:2899662"
                     /db_xref="GOA:Q6BYN4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN4"
                     /translation="MISPKHNYIEEDLGALDFNGILLRPCDGCALRKVRCNRQKPCSQ
                     CIKHNVSCTSKRIKKKCGPKQIHKKTKETIQRLNLENGVEPGLQATATKTSDTKIFTV
                     DKLLPYLQIYQTWYYGAWPVLSVAHMVAKMVQDEGKDQSEMNTEIDAAYVLACSVCAD
                     IATQLTFLSDTLHVRDLPTGVEAKDFADEALRIRSRINYRLNPNIDTLLSSFFLYDYY
                     VNVKDYKSVAITYLRETLTFAQILGLHNPKTYFNQTPATVHRMKKIYYMLMITERFLC
                     IEENIPVLLTPSIPFPALEDEEYPEILSGFTELVRIFSIPDKSFFDKLAEESSNSSNL
                     KLFQKSLFQLSNPPTQNWIVNVQNNLQNVSISPLIPDTQKLNIILSQHWMRALGWHIA
                     NQNELLIRDSDENHCLNPQFPLRIAKDFLKSTENLSSFAFESNGSGVCVKLLEIANAL
                     ADSVSDSTVYKYDAYNSYDALGAIFQLVGKFKRDILLPVDLYNKIDTIISDKTIAKFP
                     AAYITEVDDEASSRIASSNSSNENNSSDNVSEIVNDLPQTNNATNKLFSPYTQMTMGI
                     GLSPGTILPTLSSSNLAALQLQYHQQPNNIPFYDQHQEHKQQETHHYELPLLDLDRNV
                     MSGSNVYVKDPKIRFDSGIDFDDLYNL"
     repeat_region   complement(674819..675201)
                     /note="solo LTR of Debaryomyces hansenii Tdh2
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     gene            <675428..>676258
                     /locus_tag="DEHA2A08206g"
                     /db_xref="GeneID:2899663"
     mRNA            <675428..>676258
                     /locus_tag="DEHA2A08206g"
                     /product="DEHA2A08206p"
                     /transcript_id="XM_456686.1"
                     /db_xref="GeneID:2899663"
     CDS             675428..676258
                     /locus_tag="DEHA2A08206g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08206p"
                     /protein_id="XP_456686.1"
                     /db_xref="GeneID:2899663"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN3"
                     /translation="MDDLLNQKNQDIVLLAPGNSVNLEVPTINIDTNQENNGINESNV
                     EEANVYLSRLKLNNAPGEEQRQGEIYLTKLKQQAAENKIGTNLHHQRLRDSTIEVREN
                     VDHINQYLFLDENGQPQDADNTTFDFGNPALNQMYSLIRRDLNALTNRMDRKFSGVDR
                     KFRGMDRKFSEMKRLIMSQENRSQNKLLASGGDTDSPNAYLPICNDRGQHPTDCGLEP
                     LTSLDQINRMNGILTDQYLSFYHLGTTRLVSEKKARLMEYIGIHERIVVNSVRGAPPV
                     "
     gene            <677709..>678539
                     /locus_tag="DEHA2A08228g"
                     /db_xref="GeneID:2899664"
     mRNA            <677709..>678539
                     /locus_tag="DEHA2A08228g"
                     /product="DEHA2A08228p"
                     /transcript_id="XM_456687.1"
                     /db_xref="GeneID:2899664"
     CDS             677709..678539
                     /locus_tag="DEHA2A08228g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08228p"
                     /protein_id="XP_456687.1"
                     /db_xref="GeneID:2899664"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN2"
                     /translation="MDDLLNQKNQDIVLLAPGNSVNLEVPTINIDTNQENNGINESNV
                     EEANVYLSRLKLNNAPGEEQRQGEIYLTKLKQQAAENKIGTNLHHQRLRDSTIEVREN
                     VDHINQYLFLDENGQPQDADNATFDFGNPALNQMYSLIRRDLNAQTNRMDREFRGMDR
                     KFRGMDREFSELKRLVRSERNRSKNKLLASGDNTDSPNAYLPICNDRGQHPTDCGLEP
                     LTSLDQINRMNGILTDQYLSFYHLGTTRLVSEKKARLMEYIGIHERIVVNSVRGAPPV
                     "
     gene            <678933..>679103
                     /locus_tag="DEHA2A08250g"
                     /db_xref="GeneID:8998105"
     mRNA            <678933..>679103
                     /locus_tag="DEHA2A08250g"
                     /product="DEHA2A08250p"
                     /transcript_id="XM_002769961.1"
                     /db_xref="GeneID:8998105"
     CDS             678933..679103
                     /locus_tag="DEHA2A08250g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08250p"
                     /protein_id="XP_002770007.1"
                     /db_xref="GeneID:8998105"
                     /db_xref="UniProtKB/TrEMBL:B5RSS8"
                     /translation="MFSTLDASSFSELNNIKIDPTEDENRVKHRQIQMKNIVSGSRVR
                     SKTGCICCRRRK"
     gene            <679251..>680801
                     /locus_tag="DEHA2A08272g"
                     /db_xref="GeneID:8998107"
     mRNA            <679251..>680801
                     /locus_tag="DEHA2A08272g"
                     /product="DEHA2A08272p"
                     /transcript_id="XM_002769962.1"
                     /db_xref="GeneID:8998107"
     CDS             679251..680801
                     /locus_tag="DEHA2A08272g"
                     /note="similar to uniprot|P26370 Saccharomyces cerevisiae
                     YDL170W UGA3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08272p"
                     /protein_id="XP_002770008.1"
                     /db_xref="GeneID:8998107"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:B5RSS9"
                     /translation="MKAKKTNKLTGMKAPEVDNMTNNINEAKKGKIIDAVDTTNFPIQ
                     TDTNLSPFFKAVLGSPGELSPMQLGEIEDIPSSVMSYNETNDIDFSEFSNILLSPSST
                     FSLYLDEPGLRLLEYFENKVAKILCISPESSNYFLKTFVSVAMTEESIMHALAAWGGV
                     FSEGASSELVNYHMSQATILIHERHLANSKLNKHGYYVAVCYYLIAIGIEICSGDVSK
                     WYKHFNACTELLRSYGGLAKFLKDFNYSNNVKWLIASFQFHDIMSSVTLSSGTSCSMK
                     NYNNLFKNYNLLDIGDYGIDPYQGCIQPIYLILGEIMNSYVELKEERKKLKASILHLS
                     LEDSNSSEIDGLMQQRIEHYNIVSTRYDELLNKVQLARPNEKQIASIMNNKEELDLHL
                     TLFELYRLTCQMYLLLYIKQTQPSSSEVQMLLLTSFAYISTLVESPMTASLSMSLLIC
                     GISCCNHSDRNYIRTKFTKIYDKYKAGNVRRVWDIVEESWRRNPDGNICIDWVEICEQ
                     YGWKLPVC"
     gene            complement(<680871..>681905)
                     /locus_tag="DEHA2A08294g"
                     /db_xref="GeneID:2899666"
     mRNA            complement(<680871..>681905)
                     /locus_tag="DEHA2A08294g"
                     /product="DEHA2A08294p"
                     /transcript_id="XM_456689.2"
                     /db_xref="GeneID:2899666"
     CDS             complement(680871..681905)
                     /locus_tag="DEHA2A08294g"
                     /note="weakly similar to CA2824|IPF17888 Candida albicans
                     IPF17888"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08294p"
                     /protein_id="XP_456689.2"
                     /db_xref="GeneID:2899666"
                     /db_xref="UniProtKB/TrEMBL:Q6BYN0"
                     /translation="MSLPPYEASIGNEGYPDDVKKFGPSDDVKSPDPPAYNQEIGLPE
                     NPNLIQRGIIFCNMNMTTDVLTFTSEDAVAKYKSFKKVPADSDNFKHVLDLQQQGIGM
                     PLMEAQFTIMPSFGNGKFVTIYKFIAPPPGSGRLFDKKIDKYKFCSVRKKIGPHYSRY
                     TFKISPNADNPSETFEFSTFFHNKLPIADVTKYGGSDKRYRWVHSEYHPILSNFTYSL
                     YSLDEHQTSMIDNMDAQSQKLDKKNPLVNNSFGQLFKFPSRRIKENYLSSVKFGELIH
                     LKEKFIISSFQETAKLLLHIERSTQPINLESTNSVSVHELIIICMSYVFKRREEIRIE
                     RRRAARRSGG"
     gene            complement(<682524..>683555)
                     /locus_tag="DEHA2A08316g"
                     /db_xref="GeneID:2899667"
     mRNA            complement(<682524..>683555)
                     /locus_tag="DEHA2A08316g"
                     /product="DEHA2A08316p"
                     /transcript_id="XM_456690.1"
                     /db_xref="GeneID:2899667"
     CDS             complement(682524..683555)
                     /locus_tag="DEHA2A08316g"
                     /note="weakly similar to CA2824|IPF17888 Candida albicans
                     IPF17888"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08316p"
                     /protein_id="XP_456690.2"
                     /db_xref="GeneID:2899667"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM9"
                     /translation="MSLPPYESSKGNEGYLDDVKKSGPPDDVKSSGLPAYDLEYGLPE
                     GPNFIRREFIFCNMHWTTDTLAFTSSDSVTKYKSFKKVPADSDNFKHVSNLQQQGIGM
                     PLMEAVFSWTHSFGNGKFATIYKYLPPSPGSGRLFDKKRDRYKFCSVRKKAGPHYSRY
                     TFTISPKPENPSETFEFSIFFHSKLPIADVTKCENSDQRYRWVHSEYHALMSNFTYSL
                     YALDEHQTSMIDNIDAGSQKLDKKNPLVYSSLGQLFKFESTTIKDEYLSSVKSGELIH
                     LKEKIMITSYQETAKLLLHIERNSHSTDLESVNSVELHELINMCMSFVIKRREELRIE
                     SAIATVSSA"
     gene            complement(<684237..>684605)
                     /locus_tag="DEHA2A08338g"
                     /db_xref="GeneID:2899668"
     mRNA            complement(<684237..>684605)
                     /locus_tag="DEHA2A08338g"
                     /product="DEHA2A08338p"
                     /transcript_id="XM_456691.1"
                     /db_xref="GeneID:2899668"
     CDS             complement(684237..684605)
                     /locus_tag="DEHA2A08338g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08338p"
                     /protein_id="XP_456691.1"
                     /db_xref="GeneID:2899668"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM8"
                     /translation="MKDKAIQEKKLILFVNLEHLLNIWFCFMGRMILQTLRVFPSKKK
                     GNFSYCNYVYLYHQYFRFCHALGCSTGDSGRGSCRFGGNNFTSLSVLGYASGPVLWGP
                     LSDVRRKVFLSLSSFFYLRI"
     gene            complement(<685312..>685572)
                     /locus_tag="DEHA2A08360g"
                     /db_xref="GeneID:2899669"
     mRNA            complement(<685312..>685572)
                     /locus_tag="DEHA2A08360g"
                     /product="DEHA2A08360p"
                     /transcript_id="XM_456692.1"
                     /db_xref="GeneID:2899669"
     CDS             complement(685312..685572)
                     /locus_tag="DEHA2A08360g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08360p"
                     /protein_id="XP_456692.2"
                     /db_xref="GeneID:2899669"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM7"
                     /translation="MVTVKNGGLGHNCWFSTSRGETRAEHWFNIRQESEEGIWSSGRV
                     GEEKKEWWYCAGCLISVASGYFATKQMVVGSGRRVEMFIILK"
     gene            <686403..>687749
                     /locus_tag="DEHA2A08382g"
                     /db_xref="GeneID:2899670"
     mRNA            <686403..>687749
                     /locus_tag="DEHA2A08382g"
                     /product="DEHA2A08382p"
                     /transcript_id="XM_456693.1"
                     /db_xref="GeneID:2899670"
     CDS             686403..687749
                     /locus_tag="DEHA2A08382g"
                     /note="weakly similar to uniprot|P33749 Saccharomyces
                     cerevisiae YKL062W MSN4 Transcriptional activator related
                     to Msn2p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08382p"
                     /protein_id="XP_456693.2"
                     /db_xref="GeneID:2899670"
                     /db_xref="GOA:Q6BYM6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM6"
                     /translation="MPVNAAIMTGEFGIPASQPGELNINDEVFLRQNEYDLIGSEVMG
                     EENMGVFEELASNISSRSSLANMPVGQTTYSTTNTTPELSSPPKSHPVSRSSFSLPID
                     QLNLLSLKSMSSTQSSKSPSPEYNLYSVIRENPEEEKTINPRQLFSEDIDIGAASASA
                     ASAPTDKRTDETEGTSARGYILPSSSSPSLSTLFDGTQRASYPKAKSHSISMGSDITA
                     SKKFDFIMNNECFNAISYWINDTLQNVNSKMNDDDEELGGAEEIMVNPTGIIKSNYYK
                     RRNSIQLVTPSSYNQHNSFDDEARVQKKKRRKSYNHDYAKSMTKQDTPAASSANNPEP
                     VGTVHNRPNPDTIKEPSNDNRSFSNDEDEQDKPFPCPDCAKQFKRSEHLKRHIRSVHS
                     NIRPFHCKYCEKKFSRSDNLAQHLKTHYKVNTNGTTTIIYGNPNLHNRGGRKKHSD"
     gene            <688889..>689719
                     /locus_tag="DEHA2A08404g"
                     /db_xref="GeneID:2899672"
     mRNA            <688889..>689719
                     /locus_tag="DEHA2A08404g"
                     /product="DEHA2A08404p"
                     /transcript_id="XM_456694.1"
                     /db_xref="GeneID:2899672"
     CDS             688889..689719
                     /locus_tag="DEHA2A08404g"
                     /note="similar to uniprot|Q8TS14 Methanosarcina
                     acetivorans MA0993 Chloride peroxidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08404p"
                     /protein_id="XP_456694.2"
                     /db_xref="GeneID:2899672"
                     /db_xref="GOA:Q6BYM5"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM5"
                     /translation="MTGSAKLKLSDGTELFYKDWGTGDPIVFSHGWPLTSDAFEDQMM
                     FLALKGFRVIAHDRRGHGRSSQPWEGHTMDQYADDLAELVDHLGLKNAIHVGHSTGGG
                     EVARYIGRHGIGKVSKCVLISAVPPLMVKSEENLVGTPIEVFHDIRDNVSKDRSKFFK
                     DLAFTFYGLDRDESEASTGFIDSFWMQGMQGSIKALYDCVAAFSETDQREDLRNMNIP
                     TLVLYGDNDQIVPPISSSKAAIKFLPQAKEKVYAGAPHGLCSTHKKLVNEDIYRFITH
                     "
     gene            <689875..>690045
                     /locus_tag="DEHA2A08426g"
                     /db_xref="GeneID:2899673"
     mRNA            <689875..>690045
                     /locus_tag="DEHA2A08426g"
                     /product="DEHA2A08426p"
                     /transcript_id="XM_456695.1"
                     /db_xref="GeneID:2899673"
     CDS             689875..690045
                     /locus_tag="DEHA2A08426g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08426p"
                     /protein_id="XP_456695.1"
                     /db_xref="GeneID:2899673"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM4"
                     /translation="MGYKKGSLSFAFTFKRSVVKAQGEILTEVGSSFQKHTLLLMLVF
                     QLFTWMNYLVST"
     gene            complement(<690141..>691199)
                     /locus_tag="DEHA2A08448g"
                     /db_xref="GeneID:2899674"
     mRNA            complement(<690141..>691199)
                     /locus_tag="DEHA2A08448g"
                     /product="DEHA2A08448p"
                     /transcript_id="XM_456696.1"
                     /db_xref="GeneID:2899674"
     CDS             complement(690141..691199)
                     /locus_tag="DEHA2A08448g"
                     /note="similar to uniprot|Q6FDV9 Acinetobacter sp
                     ACIAD0849"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08448p"
                     /protein_id="XP_456696.2"
                     /db_xref="GeneID:2899674"
                     /db_xref="GOA:Q6BYM3"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM3"
                     /translation="MSKTEFDTKSPVLVTGATGYVAGWIVKKLLEAGVTVHAAVRDPS
                     NHDKLNHLEELKNSTNGDLKFFAADLLKEGSYAEGMAGCKVVFHTASPFTSKITDPQK
                     DLVDPAKLGTRNVLETANKTESVSRVVLTSSCAAIYGDNKDLVSLPNGTLDESVWNNS
                     SSLSHNAYSYSKTVAEKEAWSICENQSKWDLVVLNPSLVFGPGLNSNATSESFSIMKS
                     FGNGSMNRGTPDIGIGIIDVRDLADAHLRAAFIKNAHGRYIISAHNTSFLEIGKSLSP
                     EYDSYPIPKSAAPKFLIWLVGPFVDKNLTRRYIRDNVNYKWKADNSKSIKELEIRYRP
                     LKDTVSDFFQSIIDAKQI"
     gene            complement(<691722..>691868)
                     /locus_tag="DEHA2A08470g"
                     /db_xref="GeneID:8998145"
     mRNA            complement(<691722..>691868)
                     /locus_tag="DEHA2A08470g"
                     /product="DEHA2A08470p"
                     /transcript_id="XM_002769963.1"
                     /db_xref="GeneID:8998145"
     CDS             complement(691722..691868)
                     /locus_tag="DEHA2A08470g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08470p"
                     /protein_id="XP_002770009.1"
                     /db_xref="GeneID:8998145"
                     /db_xref="UniProtKB/TrEMBL:B5RST0"
                     /translation="MYSGAPCSTMCGTIGGTIFDAFHRVCRTIVFGDALFYNMRMNSY
                     IVTI"
     gene            <692193..>694682
                     /locus_tag="DEHA2A08492g"
                     /db_xref="GeneID:2899675"
     mRNA            <692193..>694682
                     /locus_tag="DEHA2A08492g"
                     /product="DEHA2A08492p"
                     /transcript_id="XM_456697.1"
                     /db_xref="GeneID:2899675"
     CDS             692193..694682
                     /locus_tag="DEHA2A08492g"
                     /note="similar to CA3147|IPF9803 Candida albicans IPF9803"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08492p"
                     /protein_id="XP_456697.2"
                     /db_xref="GeneID:2899675"
                     /db_xref="InterPro:IPR024527"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM2"
                     /translation="MSQSVYQVNGKPLSQTALYQQRLRQGVYQSPSNVSVGVNTNASD
                     TAALLAASSDLTVKPSYERTIAQDAHTAALSAKRDESSLWTRDDEARTATMKSVGSGY
                     TGVTGVVNGGSIYKVATKNSTGTMSTRLDPVKDYRHGLAAKGSAAALNIAKINQVATH
                     NSNKSLNSRFNPDLDYRSGLAGHHRPAEFLDQEEEDLAASGATASLKHGGSTSSGAAS
                     QVRSKSFKSTDVAYGNLLVAANSKAQDRLKSLNSSTSKDFREQAKEYAGALAIAQKNS
                     DERMKNNKAGMVDLGGGLTMSLTDLDAKAALVVGPVLSDIESKAVAQREADEQTKTKH
                     AKLVGLHQKSKQEEQARKERERKDIEKEKNVRVTANEERKKDEDSKYVDYQASRNEEV
                     EGKVGELKALELKYAEEKESLLAEKQENQDRIDAEEKELNDNRSKELKELQAEKDDIL
                     KPTLDELEEENTKLETIVNSKNEITEEVEKSKALNKEYDSKLAELTNNLEKVKIEIEE
                     YTMELELATQKYEETSKETDNLRQTSIDELKQAEDSHNELDSKISDLDATKSKHLEDK
                     VSQRKEIESKLDERVKNEKEINKELPEHLQKDIDENKLRDTGSLFDEPKYEDDEEDEA
                     ETPQPSKSKSVGVSGVKEIPLVDDKELETGAVVPGKSKSETKAKDTEKKSKSTAGTAT
                     KESKKPQPKASNAKSPTKAKPASNQVANESPKKASGFKRFTKYFSGSLQEPPASTKKA
                     ESKSTKIDDKTKSTKDTAKDATKNTKASSSKDTSKKESTSVAKDSSKDSSKVADQKDE
                     KLAKKESEGSGVDIDDLSSSKNQGGVFKEEI"
     gene            <694978..>695478
                     /locus_tag="DEHA2A08514g"
                     /db_xref="GeneID:2899676"
     mRNA            <694978..>695478
                     /locus_tag="DEHA2A08514g"
                     /product="DEHA2A08514p"
                     /transcript_id="XM_456698.1"
                     /db_xref="GeneID:2899676"
     CDS             694978..695478
                     /locus_tag="DEHA2A08514g"
                     /note="similar to CA3146|IPF9797 Candida albicans IPF9797"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08514p"
                     /protein_id="XP_456698.1"
                     /db_xref="GeneID:2899676"
                     /db_xref="GOA:Q6BYM1"
                     /translation="MSAEPSQFNKLLTKYDFKLASASEEYRNRRKRQMMLFMGSAAIT
                     IFTSRLAYKSTITRQYVPSLFQGNHAPPLSYNFTSDAAVAVGTGTLLCGSVSSMVIFG
                     TCWIIDVSNFQEFGWKMKSLMGGYEKQKELAKLPMDEESAFLQDSLNDILDGKYDFDE
                     TTPAEK"
     gene            <695957..>696478
                     /locus_tag="DEHA2A08536g"
                     /db_xref="GeneID:2899677"
     mRNA            <695957..>696478
                     /locus_tag="DEHA2A08536g"
                     /product="DEHA2A08536p"
                     /transcript_id="XM_456699.1"
                     /db_xref="GeneID:2899677"
     CDS             695957..696478
                     /locus_tag="DEHA2A08536g"
                     /note="similar to CA3148|IPF9808 Candida albicans IPF9808"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08536p"
                     /protein_id="XP_456699.1"
                     /db_xref="GeneID:2899677"
                     /db_xref="GOA:Q6BYM0"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6BYM0"
                     /translation="MARISTSSSNRNLPSSNALRRQREREEQIRRGRVGQSSANHSRQ
                     SSVNRQRETGIYQNQPGDPPTAKATSTKRKRRYKPGTNAIREIRQFQKSTDFLISKLP
                     FSRLVREIAENYIGASYGIRWQSNAVLALQEASEAYLVHLLEDTNLCAIHAKRVTIMQ
                     RDIQLARRIRGHI"
     gene            <696980..>698281
                     /locus_tag="DEHA2A08558g"
                     /db_xref="GeneID:2899678"
     mRNA            <696980..>698281
                     /locus_tag="DEHA2A08558g"
                     /product="DEHA2A08558p"
                     /transcript_id="XM_456700.1"
                     /db_xref="GeneID:2899678"
     CDS             696980..698281
                     /locus_tag="DEHA2A08558g"
                     /note="some similarities with CA1042|IPF18784 Candida
                     albicans IPF18784"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08558p"
                     /protein_id="XP_456700.2"
                     /db_xref="GeneID:2899678"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL9"
                     /translation="MATITTSTTGKKKIVYKQDTDGVFRLKKIPTDGGVFGKDRDSKN
                     AAEDHLNELIGCTYQVSNSSTEEPSNVSPTPETVSVCPKDTEYVSTDYPVTPKRKPIK
                     RRNTNASTPPVRLKVPNIKISTEAFEKITGIHVPSFVAGCMVTLVFVSSSPLISHYTS
                     MIFNVVKLGLFWVILIGGITWYSGVVKLQDSETMGAFVNGIKDTFLETEIDEEEEEKD
                     IEHDMHSGSMHEQSENYSRKNSSEFAIPNAVPRRRSASPVKSARVPLTSVTPFKSTPS
                     KQDSRFQSTPELVAGEHSSPPKLNRFHTSDPKGYQNQPKKGSIFSLGKSRRPSNNSLE
                     LTKTKTNQSIPSVESIDSSSSRHSPIRQHYSHHDDPEELPFINEVKLISSEDDFGNMP
                     DPLPPINNINRSNSVMSKQSVLGTRANYNKFLANVHGNDGD"
     gene            <698562..>699977
                     /locus_tag="DEHA2A08580g"
                     /db_xref="GeneID:2899752"
     mRNA            <698562..>699977
                     /locus_tag="DEHA2A08580g"
                     /product="DEHA2A08580p"
                     /transcript_id="XM_456701.1"
                     /db_xref="GeneID:2899752"
     CDS             698562..699977
                     /locus_tag="DEHA2A08580g"
                     /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
                     YMR033W ARP9 Actin-related protein involved in
                     transcriptional regulation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08580p"
                     /protein_id="XP_456701.2"
                     /db_xref="GeneID:2899752"
                     /db_xref="GOA:Q6BYL8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027665"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL8"
                     /translation="MPLFRESSFLVVHPGSQYTIFSFGLQDPLSPPQYKIPSVVYQDP
                     NTREYKSKKNEGEELIEVHPIKESKIIDLDAFNYLLKIILQSVITNNPVVTINQIPLL
                     LIAPSLAWSRSNIEYVTKYVIESLEFTAFNIIDLSIACNFGMGSSASSCVVNVGHESC
                     QIMPVIGYQSIKYAGTYLNGVGGKTINEEVQKLLPNLSNKQIDALKTSGIFEAVNDHD
                     SSFYSVADLNTIGENNEEEEDFDVAKIVTEQNGNLPKSDPGANEGEEKKQDEKSNSEL
                     EKNFFLDPDTNEKIYVGKERFQGASKLVNSIAEAIYESLLLIPDLEKRQECYDNLIFV
                     GSTFKIPGLKQALLIKLTTDYLVRSPGESTANDDTTAINSAIVAYQQAEELNESNGES
                     NFILSQVPTAIRTAKHPDYFPEWKQPKEKGGSWEDVYFLGAEIYAKQIFGGNSNQGGE
                     LFLDADGYEERGPQGIWDATI"
     gene            <700185..>702434
                     /locus_tag="DEHA2A08602g"
                     /db_xref="GeneID:2899753"
     mRNA            <700185..>702434
                     /locus_tag="DEHA2A08602g"
                     /product="DEHA2A08602p"
                     /transcript_id="XM_456702.1"
                     /db_xref="GeneID:2899753"
     CDS             700185..702434
                     /locus_tag="DEHA2A08602g"
                     /note="similar to uniprot|P04819 Saccharomyces cerevisiae
                     YDL164C CDC9 DNA ligase found in the nucleus and
                     mitochondria"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08602p"
                     /protein_id="XP_456702.2"
                     /db_xref="GeneID:2899753"
                     /db_xref="GOA:Q6BYL7"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL7"
                     /translation="MVLRHCINQLTRPTKLSFKYCILKPIFLMPQQQSLARFFSASGN
                     LPKTKPSVDKADISESDKPSISEIKRKASSTIPENVEKKLKVEATEAVDSDPSEVSEE
                     DTKAQELSDASKLIKLSEKEQEKHTCTEASSKIHYSELTELFEKIEQESSRLKITAFI
                     SQFYYQILEHATSDKLVKIIYLCINRLGPDYEPDLELGLGETLLIKAISECYGRPPSK
                     IKKDYQEVGDLGIVAQKSRSGQPTMFKPTRLDIVTVFENLTKIAKSTGKDSQSKKIST
                     INKMLTACEMKSNEAKFLIRSLEGKLRIGLAEKTVLIGLAQAFVNYENKSNKKISPEK
                     LAQAEDIIREAFSRIPNYEIIISNAYEHGIFNLLDYCILTPGIPLKPMLAKPTKSVSE
                     ILDRFQGEEFTCEYKYDGERAQVHLLPTGEVRIYSRNSEDMSQRYPDLISIIKDFLKT
                     QEISGKHSMVLDCEAVAWDRETNKILPFQVLSTRKRKDVEEKDIKVHICLFAFDLLYY
                     NDKPLITTSLAERRKVMFENLRPIEGKFQFATFKNTTNLDELQHFLDQSVKDSCEGLM
                     VKMMNGTDSYYEPSKRSRNWLKLKKDYLAGVGDSLDLVVIGAYIGKGKRTGSYGGFLL
                     ASYNQDSGEYETTCKIGTGFSDEDLVSIHARLKPTEIQRPKPYYVYDTTNSNAVPDVW
                     FEPTTIFEVLTADLSLSPIYKAAHQQYGKGISLRFPRFLRIRDDKGTEDATSSTEVSE
                     FYERQANLN"
     gene            complement(<702547..>705039)
                     /locus_tag="DEHA2A08624g"
                     /db_xref="GeneID:8998041"
     mRNA            complement(<702547..>705039)
                     /locus_tag="DEHA2A08624g"
                     /product="DEHA2A08624p"
                     /transcript_id="XM_002769964.1"
                     /db_xref="GeneID:8998041"
     CDS             complement(702547..705039)
                     /locus_tag="DEHA2A08624g"
                     /note="similar to uniprot|P32784 Saccharomyces cerevisiae
                     YBL011W SCT1 High copy suppressor of choline-transport
                     mutants"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08624p"
                     /protein_id="XP_002770010.1"
                     /db_xref="GeneID:8998041"
                     /db_xref="GOA:B5RST1"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:B5RST1"
                     /translation="MPYVGKGLLHSRRQTLIGCEDEIGATTMTNAHSSSEDAGEALLQ
                     SNGQANLSDKVNMDLNDDNGNKASRGRKASASGDSFVRNKEMDEFEHRQRQWYRMVIF
                     DLVLWMFSVVCDCFFREIRPRGAFRLPRQGPVIFVAAPHANQFVDPIILMGQVRKEAQ
                     RRVSFLIAAKSYKQRIIGFLSRCQFSIPVIRAQDNLKKATGKIFIDVESDPCRVTGKN
                     TKFLSECAVRGMLALPQSLGASEISEIISDTELVIRKEFKRTDQITTLLKNGTSFKSA
                     DRIDQKKVYQIVFRHLSLGNCIGIFPEGGSHDRTDLLPLKAGVAIMALGAMEYNPDCN
                     VKIVPCGMNYFNAHKFRSRAVIEFGHPIDIPKELVKKYSNPETNRESVKELLDLITTG
                     LKAVTVTCEDYETLMVVQAARRLYAGNFVQFLPLPLVVEMNRRLVLGYQTFRNEEQIK
                     NLKEKIIIYNNQLKQLYLPDHHVEACDESHKLRVLPILLFRIVKLFLLMLLALPGATL
                     FSPVFICTKWYSTRKAKTALANSTVKIKANDVVATWKILISMGIAPLVYSFYASIGTW
                     YCHRYKKFEDWNVSLFFVWFILYMLGVIVTYSALLTGEQGMDIFKSIRPLYLSITSGS
                     SIKDLKKLRNELSEEITYVVNHFGPDLFPNDFNLLKLKEHLKISDNVDYVDSDEEEER
                     KTQEVRKRRMKNRKAARRKQASDDSISGLSLDEKNSSSVSDGISLMNSDNSLTNIPMF
                     SDYHLHMNAKNPDIKIEQQSVVHSSASIADDFNYKVHNSPAGKPSVSRYDSNSHIELN
                     FGNLKEEQPSKSKLSDKIKYKIRESRDKAAGN"
     gene            <705804..>708503
                     /locus_tag="DEHA2A08646g"
                     /db_xref="GeneID:2899757"
     mRNA            <705804..>708503
                     /locus_tag="DEHA2A08646g"
                     /product="DEHA2A08646p"
                     /transcript_id="XM_456704.1"
                     /db_xref="GeneID:2899757"
     CDS             705804..708503
                     /locus_tag="DEHA2A08646g"
                     /note="similar to uniprot|Q02207 Saccharomyces cerevisiae
                     YKR009C FOX2 Multifunctional enzyme of the peroxisomal
                     fatty acid beta-oxidation pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08646p"
                     /protein_id="XP_456704.2"
                     /db_xref="GeneID:2899757"
                     /db_xref="GOA:Q6BYL5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL5"
                     /translation="MSEISFKDKVVVVTGAGGGLGKQYCLEYAKRGAKVVVNDLGGSL
                     KGDGGNSSAADDVVEEIKKAGGIAVADYNNVLDGAKIIETAVKSFGTVHIIVNNAGVL
                     RDASFKKMQEKDFKFVIDVHLNGAYKVTQAAWPYFRKQQYGRVLNTASPAGLYGNFGQ
                     ANYSAAKLGLASFAETLAKEGEKYNIKANTIAPLARSRMTESILPPPVLEQLSPAKVA
                     PLVLYLTSDANELSGQIFEVAAGFFGQIRWERSGGALFKPDETFTAEAVAKRFNEIMD
                     FDDSKKPELLKNQHPFMLNDYKSLITAANKLPANDVSGAPTVSLKGKVVLITGAGAGL
                     GRDYALWFAKYGAKVVVNDFKDPSKVVDEIIKSGGEAHGDKHDVASDSQAIIDNVINK
                     YGTIDVLVNNAGVLRDKSFAKMSDADWEIVQKVHLFGTFNLVRLAWPHFLEKKSGRVI
                     NITSTSGIYGNFGQANYASAKAAIIGLSRTLAIEGAKNNIKVNAVAPHAETAMTLTIF
                     NEDDKNLFHPDQVAPLLVYLASDDVPVTGELFEVGGGWIGNTRWQRAKGAVSKDEHTA
                     PEFVRDHIKDVIDFSTGTFNPRSTEDSSMAILSAVGDDDDDEDDEDDDDSDDEDDVNE
                     RTYTYGDREVILYNIGIGANSHELKYVYENDSDFQVIPTFGHLVTFLSGKSTHSFAKL
                     LKNFNPMYLLHGEHYLKVEKYPIPTEASMLTEFKPLAVTQKGTNSIVVHGSKTVDAKT
                     GELLFTNEATYFIRKCEGETKVYGDRKAFATKQFNAPNSSPDFTIDVKISEHQASLYR
                     LNGDRNPLHLDPEFAKGANFDKPILHGMCTYGMSAKVLLDKFGPFDEIKGRFTGIVFP
                     GETLKVLAWKQGDIVIFQVHVVERKTIAINNAAIKLINNKAKI"
     gene            complement(<708649..>710958)
                     /locus_tag="DEHA2A08668g"
                     /db_xref="GeneID:2899704"
     mRNA            complement(<708649..>710958)
                     /locus_tag="DEHA2A08668g"
                     /product="DEHA2A08668p"
                     /transcript_id="XM_456705.2"
                     /db_xref="GeneID:2899704"
     CDS             complement(708649..710958)
                     /locus_tag="DEHA2A08668g"
                     /note="similar to CA0578|IPF9605 Candida albicans IPF9605"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08668p"
                     /protein_id="XP_456705.2"
                     /db_xref="GeneID:2899704"
                     /db_xref="GOA:Q6BYL4"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL4"
                     /translation="MKDGSDDMISDNSAGLNHHTSVSRKARFMDSRSTTTKRDRPLSS
                     YFDSPSNTKPIEASDYFSLKGDGINHLHINDEREDKDEDSHEFTSPLVNRKPFRNLSN
                     FVNNLEFTGMKKKLASSKKSLTRSMTSVAKYSNKEREKKEDEVEKKLQNESDDVTNNE
                     PNIIGGSPTQMVPRNKSIRRIHSMCQTTKEKETYNMEDNSHLPKTTINTFKVDNDLLP
                     RINEDELFRILNGDYKEEFDEYVVIDCRFNYEYDGGHIMNAINITSQQGLEERFIRNN
                     TNDSSKRRLYIFHCEFSIFRSPTMASHLRKCDRILNSNNYPKLTYPDIVVLEGGYKGF
                     YDKYKSHCYPQAYIEMKDVNHQKTCELEMGKVRQANKLPRAKSYNHFLGNNSLSNTHN
                     RSNSFTTITSHAENLKILKRQRSTSKFNLSNNDTDNEISIPGTQDLSDNRLTRASTFT
                     YTPSIFNSSPANSPNIMSNRGMDSDFQPPSALFKSGGHQKSFSNSSNFSSSSISINSS
                     SSSICSDLAFSSTDSLTDSYSSPVGEMPEFFEPKGHNLTSYLKMNTNNSFYNHLHANK
                     PSLIKPISRKPSGPIPQLPAQQRNIISSSSINASTTSDTTIVHQNSKNLPNSSFKFPL
                     SSNSKNKASRNLSRINTNTKHLSNSSLSNIFAVPTAASSPIMNSPLSTATPISTTDSS
                     KSHLSIIDPINDTPVDFSVPSSAKRPFHPRRRSGSILSSGGGIHRFLDLDIDEVEEEE
                     EEITEDNDRTLTDIKLNKISDFIQKSPFN"
     gene            complement(<711675..>713720)
                     /locus_tag="DEHA2A08690g"
                     /db_xref="GeneID:2899705"
     mRNA            complement(<711675..>713720)
                     /locus_tag="DEHA2A08690g"
                     /product="DEHA2A08690p"
                     /transcript_id="XM_456706.1"
                     /db_xref="GeneID:2899705"
     CDS             complement(711675..713720)
                     /locus_tag="DEHA2A08690g"
                     /note="similar to CA0577|IPF16051 Candida albicans
                     IPF16051"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08690p"
                     /protein_id="XP_456706.2"
                     /db_xref="GeneID:2899705"
                     /db_xref="GOA:Q6BYL3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL3"
                     /translation="MDISTLSIENDPKSNRKVINKTYRITKKIGQGQFGKVLLAENIG
                     KHNVQKSCTTVAIKTINRLDKTRLITKTYLNHTTKIKREIQIMKECNHPNVVKLYQVI
                     DDLKYDKILLVLEYCPFGEIDWKKYNHYNEKYNKKDGITLNKILRDVVNGLEYLHDYK
                     KIVHRDLKPSNLLISADKTIKISDFGVSLILENNANDDKELGKSMGTPAFFAPELCQF
                     VNNRLSMINDSFKAKNKIDSRIDLWSLGVILYCLIFNDLPFNGFNEFGLFKNIVNKDL
                     KFPRVRSTTHTTKNDLKELNLLKDLIEKLLTKDPTKRITLEKVKQHGFTIFDITPSEQ
                     DTFQDFNRQIIRQDGSLTTKIKRLFVSKPESPVSPKLPVDKPEPNADALEPVDDLLDS
                     YFDDSSSLGSYEETTEIDTTNLLESLETKESTPPVENKPNNLLNLEFLSKDNKSHKRT
                     NKNTPSPLQLSQPSPQPYASRSASSSSSHFQSPLSPSSPIANAVTIGADSPSSIKSMF
                     SPSKRFFARNKSKELASPNKKTHTISSLSNTSSLKSKNSDKKTAVYNDLMEPPPIFGT
                     TSSLSSTNQSPSSTCSRKNSISSSKSSGLSRITSSSSSLNLNAYLTDDAYSLSSMKDP
                     AITENSKGNNNKASNNSHQGVTDDDPDEDVDETLILPDHEQSDMKHYSSMSDFLDRI"
     gene            complement(<714067..>715437)
                     /locus_tag="DEHA2A08712g"
                     /db_xref="GeneID:2899758"
     mRNA            complement(<714067..>715437)
                     /locus_tag="DEHA2A08712g"
                     /product="DEHA2A08712p"
                     /transcript_id="XM_456707.1"
                     /db_xref="GeneID:2899758"
     CDS             complement(714067..715437)
                     /locus_tag="DEHA2A08712g"
                     /note="similar to uniprot|P53096 Saccharomyces cerevisiae
                     YGL194C HOS2 Histone deacetylase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08712p"
                     /protein_id="XP_456707.2"
                     /db_xref="GeneID:2899758"
                     /db_xref="GOA:Q6BYL2"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL2"
                     /translation="MSIPANQSPTFTKDKKTQENTPLYLANSTSKLPNVSYHYNPQVS
                     QYHFGPHHPMKPFRLMLTDHLVISYKLYEQMDLYTPRRATKEELLEFHAEDYIDFLQT
                     ITPEKTLKMSDQKLAQFNIGDDCPVFDGIYDYSSIYAGASLDASRKLISGMSDIAINW
                     SGGLHHAKKFEPSGFCYVNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYVTDRV
                     MTVSFHKYNGEFFPGTGSVDETGLGKGKNYAVNVPLKDGIDDDSYIRLFKSIMEPLIT
                     KFQPTCIVQQCGADSLGYDRLGCFNLNIRAHGECVKYIKSFGIPMLVLGGGGYTPRNV
                     SRLWCYETSVLNDVTLDHTIPNYLPTHDWFGPDYSLHPQLDGRIDNKNSKKYLESVKQ
                     EVLEQLRYLTYAPSVQMQEIPPDITGLTEEEEDIIKELNSMNDDKDVRIMKNIKDEAR
                     SSEMVN"
     gene            <715702..>716509
                     /locus_tag="DEHA2A08734g"
                     /db_xref="GeneID:2899759"
     mRNA            join(<715702..715708,715773..>716509)
                     /locus_tag="DEHA2A08734g"
                     /product="DEHA2A08734p"
                     /transcript_id="XM_456708.1"
                     /db_xref="GeneID:2899759"
     CDS             join(715702..715708,715773..716509)
                     /locus_tag="DEHA2A08734g"
                     /note="similar to uniprot|P21243 Saccharomyces cerevisiae
                     YGL011c SCL1 20S proteasome subunit YC7ALPHA/Y8"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08734p"
                     /protein_id="XP_456708.1"
                     /db_xref="GeneID:2899759"
                     /db_xref="GOA:Q6BYL1"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL1"
                     /translation="MSGSAGFDRHITIFSPEGRLYQVEYAFKAINSSNITSIGVTGKD
                     SAVLISQKKIPDKLLDPETVSYIFKITPSIGLVATGSIADARAQALRARSEAAEFRYK
                     YGYEMPVESLAKRMANLSQLYTQRAYMRPLGVALTFCQVDFEDEDRGSQIFKCDPAGY
                     YTGVKAVATGPKQQEATTYLEKKFKKIEHVKGDWKDTVEFAITALSSVLGTDFRKNDI
                     EIGVATEEGFRILNPEEIDERLVTIAEQD"
     gene            complement(<716706..>718109)
                     /locus_tag="DEHA2A08756g"
                     /db_xref="GeneID:2899760"
     mRNA            complement(<716706..>718109)
                     /locus_tag="DEHA2A08756g"
                     /product="DEHA2A08756p"
                     /transcript_id="XM_456709.1"
                     /db_xref="GeneID:2899760"
     CDS             complement(716706..718109)
                     /locus_tag="DEHA2A08756g"
                     /note="similar to uniprot|P25340 Saccharomyces cerevisiae
                     YGL012W ERG4 C-24(28) sterol reductase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08756p"
                     /protein_id="XP_456709.1"
                     /db_xref="GeneID:2899760"
                     /db_xref="GOA:Q6BYL0"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:Q6BYL0"
                     /translation="MSSDEDITTPLVEERREVKPGYLPKEEIEWEFGGPVGALGMMVG
                     FPLLMYYMWISAQFYDGKPAWPAENQTWKEFVAGDLFQYFVKYGIPSFKSWFIFTLFI
                     LVQAAFYLTLPGIWTKGQPLTHLNNKQLPYYCNAIWSFYTSLAIALVLHFTGLFRLTY
                     ILSHFGEIMTTAIIYGLTLPVILYLVCIHVTGDYHRMTGNHIYDIFMGAPLNPRLGKY
                     LDFKMFFEVRIPWFILFFLTLALNLKQFEEYGYVSPQALFVLLAHWLYANACAKGEEL
                     IVPTWDMAYEKFGFMLLFWNIAGVPFTYCHCTLYLAYHDPKEYQWSIGYNIAIYVILL
                     VAYYFFDTGNRQKNSFRRQMAGNTSIRKTFPYLPYSDLENPKYIKCANGSYLLTDGWY
                     VYARKMHYTADYTQSLTWGLICGFASPFPWFFPVFFLIVLIHRALRDTRKCERKYGED
                     WDRYLEACPYMFIPYVW"
     gene            complement(<718663..>721089)
                     /locus_tag="DEHA2A08778g"
                     /db_xref="GeneID:2899761"
     mRNA            complement(<718663..>721089)
                     /locus_tag="DEHA2A08778g"
                     /product="DEHA2A08778p"
                     /transcript_id="XM_456710.1"
                     /db_xref="GeneID:2899761"
     CDS             complement(718663..721089)
                     /locus_tag="DEHA2A08778g"
                     /note="weakly similar to uniprot|P25339 Saccharomyces
                     cerevisiae YGL014W PUF4"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08778p"
                     /protein_id="XP_456710.2"
                     /db_xref="GeneID:2899761"
                     /db_xref="GOA:Q6BYK9"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK9"
                     /translation="MTTNLQSRSASVSNQGDAEEPSSFLPGKAGASKNVGNNLRSASI
                     GSSFFNKDASNFFNPKDAANTTSSSMDDEFVKETNENPPNPPASSDLDIVDALGTLNL
                     DEEFELTNKDTGNAKEKKGTQSSNEAAKQRDTATSNTPFSQHAQFLYAGNSNTNDGNN
                     NYHQQFYSQYPAQQGSLTPNSSIGTFVPSTFGHVNTPSSTWSNTFIPSSAPPFAYGNS
                     NAASANALNVKPFELPDDGKSKDKRANGENVIPGLHLPFTTTPPPLDTFGGVLNSQIP
                     FGANVPIGMESYGFQEGYKLAEGSSSESEVENSIPSDRTKGSSNQQQFMSGSIRMDGA
                     QAASVNEYQSIVGNEGSHSNNQFNNLPDNLNFPMLNVGQMVPPSAQSGTPNMWNQIPM
                     NYNSNVNSQQHSFVNNRVPQNQAISGQGVNGGRFNNNGNHNNNNNRRNHYNSNDGMNV
                     HRKMHINNKRKGDDASKYTNAKLEDFTGQIYSLCKDQHGCRFLQRQLDLGREAASNPN
                     ADLENTQILTNDIAATMIFNEIYLKIIELMTDPFGNYLIQKLFENVSADQRIILVKNA
                     SPEFIRIALDPHGTRALQKLIECITTEEESRLIINSLSPRIVALSRDLNGNHVVQKCL
                     QRLKPEENQFIFETASLHCNEIATHRHGCCVLQRCLDHGNLAQRKQLSLKVAENATNL
                     SLDPFGNYVVQYVLSRGDDESIRIILDHIKANVVSLSLHKFGSNVIEKSLRINKLTDS
                     LIDVLLLNKERFSEMLNDAFGNYVLQTSLDVANVRDLGKLSQALQPLLPNIKNTPHGR
                     RIMIKIQNIL"
     gene            complement(<722029..>724719)
                     /locus_tag="DEHA2A08800g"
                     /db_xref="GeneID:2899762"
     mRNA            complement(<722029..>724719)
                     /locus_tag="DEHA2A08800g"
                     /product="DEHA2A08800p"
                     /transcript_id="XM_456711.1"
                     /db_xref="GeneID:2899762"
     CDS             complement(722029..724719)
                     /locus_tag="DEHA2A08800g"
                     /note="highly similar to uniprot|P05030 Saccharomyces
                     cerevisiae YGL008C PMA1 Plasma membrane H+-ATPase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08800p"
                     /protein_id="XP_456711.1"
                     /db_xref="GeneID:2899762"
                     /db_xref="GOA:Q6BYK8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK8"
                     /translation="MSGTEPTNEKVDKIVSDDEEEDIDQLIMDLQSHKGLDDEDDDEA
                     VDDSSFKAVPEELLKTDPTTGLTADEVTKRRKKYGLNQMSEDKENLVLKFVMFFVGPI
                     QFVMEAAAILAAGLEDWIDFGVICALLLLNAFVGFVQEYQAGSIVDELKKTLANFAFV
                     IRDGSLIEIAASEIVPGDILQLEDGTVIPADGRVVSEDCHLQIDQSAITGESLAVEKR
                     FGDATYSSSTVKTGEAFMIVTATADSTFTGRAAALVNKAGASGGHFTEVLNSIGTLLL
                     VLVIVTLLPIWVACFYRTVRIVPILRYTLAILIVGVPVGLPAVVTTTMAVGAAYLAKK
                     QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTGCLAASR
                     KKKGLDAIDKAFLKSLIDYPRAKAALTKYKLIEFQPFDPVSKKVTSIVESPEGERIIC
                     VKGSPLFVLKTVEDDHPIPEDVHENYQNTVTEFASRGFRSLGVARKRGEGHWEILGIM
                     PVMDPPRDDTAQTINEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYDADRLGLSG
                     GGDMAGSEIADFVENADGFAEVFPQHKYNAVEILQSRGYLVAMTGDGVNDAPSLKKAD
                     TGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVVYRIALSLHLEI
                     FLGLWIVILNQSLSIDLIVFIALFADVATLAIAYDNAPYDPMPVKWNTPRLWGMSIVL
                     GIILAIGTWITLTTMFMKKGGIVQNFGGLDGILFLQISLTENWLIFITRAQGPFWSSI
                     PSWQLGGAILIVDIIATCFTLFGWWSQNWTDIVTVVRTWIFSFGVFCVMGGLYYLMSG
                     SEAFDNICNGRPAKPHKDNRSVEDFLMSMQRVSTQHEKST"
     gene            complement(<727242..>730319)
                     /locus_tag="DEHA2A08822g"
                     /db_xref="GeneID:8998065"
     mRNA            complement(<727242..>730319)
                     /locus_tag="DEHA2A08822g"
                     /product="DEHA2A08822p"
                     /transcript_id="XM_002769965.1"
                     /db_xref="GeneID:8998065"
     CDS             complement(727242..730319)
                     /locus_tag="DEHA2A08822g"
                     /note="similar to uniprot|Q875J0 Candida albicans CHS8
                     Chitin synthase 8"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08822p"
                     /protein_id="XP_002770011.1"
                     /db_xref="GeneID:8998065"
                     /db_xref="GOA:B5RST2"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B5RST2"
                     /translation="MSGTNKADISDDDDLFGDNEVRRSSFEQGDDEEQLVPNPFYYDQ
                     FQPHQQYSVPQLQSGNLQLMQPSMHGHQHQGSASTFVDENNDYSIEKLGSEASLSTTS
                     TFPNRSKTVAFRESEPEYPPTAYSPGKTMNHYAEPLHYDMERVDTYDFDNPSMALRPY
                     SQVLTFTGDDYMINPLEDADDDEDLDPFGDDESLFSETGEEIIRRGTTIKRSNTTISR
                     RDTLKRKNSMATGLSLVDEEDDFKPRLNYTKTIKKAKLVNGNYVIDAPAPKSLLDTYG
                     RKITDSGREMSFMRYTAVTCGPSNFMKYKYNIRQALYTPPRETEIMVCITMYNEDEIL
                     LARTLKGIFDNIKNLTNRNDSKWGEDSWKKIVVCIISDGRVDLNKRSQELLTALGLYQ
                     DGYAKSKINDKSVKSHIYEYTSTVGIETINDKIHFCTNSSPVQFLFCLKEKNTRKINS
                     HRWCFQSFAPILKPKVIMLLDCGTKPSKDAFYHLWKSFNDPNVAGACGEMRAALGPNR
                     KYLANPLVAAQNFEYKISNVLDKPMESVFGFISVLPGAFSAYRYEALLNVDGEGPLEK
                     YFKGEFLHQETQVIEDEEDDEKTLKEKNFQEAGIFTSNMYLAEDRILCFELVAKKNHN
                     YVLRYVNEAKAETDVPEVIDEFVLQRRRWLNGSLFAAAYAVFHWTKIWKSNHSLLRKL
                     FLQLEFYYQLITLLVSWFSIASFFLVFRILTANLGAKDMNFDVGKYLAVIFLWFYVGS
                     VVCTFVLSFGNTPRGTRKFYLVIACIFAVLMVYMLFAAIFLAVHTVQAALKSHKDDFT
                     VSLLFTDTKFRDLIVSVVSTYALYFVASLMYGEPSFMVTSFLQYLLLSPSYINILNIY
                     SFCNIHDVSWGTKGSVQARDLGSAKSADNDKENIVTIVPGVSEELNETYLNTLESLRT
                     LPPPPLEVNNKKRKDDSYYAFIRTVTVLVWMLTNAILIAIVLEAGGVDTLTSSDSTSI
                     SGNSEIFLTIILWIVAGLAAFRFIGSSVYLILKVFRPLKWRIRARKAARTQNY"
     gene            complement(<730622..>734872)
                     /locus_tag="DEHA2A08844g"
                     /db_xref="GeneID:8998082"
     mRNA            complement(<730622..>734872)
                     /locus_tag="DEHA2A08844g"
                     /product="DEHA2A08844p"
                     /transcript_id="XM_002769966.1"
                     /db_xref="GeneID:8998082"
     CDS             complement(730622..734872)
                     /locus_tag="DEHA2A08844g"
                     /note="similar to CA5751|CaVPS8 Candida albicans VPS8"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08844p"
                     /protein_id="XP_002770012.1"
                     /db_xref="GeneID:8998082"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR025941"
                     /db_xref="UniProtKB/TrEMBL:B5RST3"
                     /translation="MGSISDEQADDNTSQSPPNLGVPATSRKNILSPSISVDSTISNG
                     STPIRKHRFDDRAQTWISLALRSHKHEFSRDSSPFDLTNSIISDDSQDMLKLTETPKI
                     TEIINSPSFRATYGLVECIEPSNIYIAVGTEKGFIVGFNYHQGVEYILTTEEERKDNK
                     EQFEGGSVSAISFSSDSSYLVAGYSRGAIITWNLSSTSTTSAGCIKPYYIIEPTTLEN
                     RFTRNVQGHLHNNRINSVCFIGSSRSQLISSDVSGLVFYHHGFKKFMKKYFQTQKILG
                     RNDANIVDNGGRYIIYGCEMLPLGSAHQITDYLGLIAVMTGNVLAIVSVLSLNNPSMI
                     NMRVHFKIGRTKHSNKTGTSEGCLSWYPCMKNENNKLQNAKLAYAWNNIVTILEVDNN
                     SLPENLIHIIADLKDKDKAIPVLPIQKTCKWISSNKSNSIVSLKWISNNILFAYIQEP
                     LNSELTLTALHYTFDKGKRRLVRVGQNSLRGLQIASSKVSIESNNRDTHSTRKQNCIN
                     LFNNSIKAFKNRLLVLVDDDTNKKLFIGRSISWADKLLGLLASREYSKALSTANDFYN
                     SKNNGQLVLADLPENQELRREMLKPYLVNIMKESINNIFGAEGSDYGFHLATYLDIVS
                     YLYKYDESLSDELYFILETVFEVLNNQFLFFDTIESYILSGKIMTLPPLILKKLIEYY
                     TLNEKGELLTEMICILDVKTLDIDLAIQLCKKYKLRDCLIYIWNFILGDYATPFADFI
                     KDICNLDVDVDNDNEDCLKVFSYMSYILTGRQYPTEKFIDVSQENPAKKSIYKLLFSA
                     TSIRYPNDDSDILVAGSEETIFPYLYSLLQFNSFETLSTINEFFEDSILNDDNNSHLT
                     RQYIIEALFDIYEVNETTFTDFDRCQLAIFVARNYPKYSQFIRLSESVLSSIIDDLCT
                     VTNQDIKYDCELALQSLLPLYEPDGELFLLDKLKSARFYSVLISIYRSKGKYSNVLKT
                     WLEKSQQESTENDTLSGILEEAFIYTKSHADKIDLVTFIKRNFQQILIVNIPDFVTLI
                     NKYYPSLHSEALTINSDQYFYEYMYVLLDIVDLKSINIENMPQIVGRYMKVLCDYNPS
                     KLYSFVETANLILARDTNEFESVKKTFQQKGLIESLTILLISQSKYEESLNVLLQSMD
                     RLIDSAISNQKKEDLLSKFANCLGRAMDICEIEDTYVEHDGDMYLNERLWLTLIENCV
                     KMSNIAATKRLKSKNNEYQNVSEFLDRCIHDCFKRISESKLNPNVSENEKKEKSFLVI
                     FNRFLENSTKDSKMTTISNIRDILREVFISYSYENEILSISLKMLNESIGESLDLIKL
                     DNLKAWTIKSKWCTSCGKTMWGPDVPKEHFMAWEDRQREALILAQGLGNTVIGAPFND
                     KKYHNCELIFFKCNHGYHMSCLENLGSKRSKSCVLCLQ"
     gene            complement(<735109..>735843)
                     /locus_tag="DEHA2A08866g"
                     /db_xref="GeneID:2899695"
     mRNA            complement(<735109..>735843)
                     /locus_tag="DEHA2A08866g"
                     /product="DEHA2A08866p"
                     /transcript_id="XM_456715.1"
                     /db_xref="GeneID:2899695"
     CDS             complement(735109..735843)
                     /locus_tag="DEHA2A08866g"
                     /note="similar to uniprot|P53198 Saccharomyces cerevisiae
                     YGL002W ERP6 Protein member of the p24 family involved in
                     ER to Golgi transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08866p"
                     /protein_id="XP_456715.2"
                     /db_xref="GeneID:2899695"
                     /db_xref="GOA:Q6BYK4"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK4"
                     /translation="MVHFQSLNRSHVFLVGILLLIQFSFPIQGLLHFYTDAGARRCFY
                     KELPQGTLLIGRYKLEIFDEDAHEFYSPLDKLNTGILIDVEEKFDTDHRVVHQKGSPR
                     GQFTFSALESGEHRICFTPKSFYKRRWLDGGGNDVDALKDSRFKKSRIMVDFSIRDGE
                     IFDTKHSIKVNTLTEQVNSINDKLTDIKREQEFIREKEESFRDQSERTCERVIRWSIV
                     QIGALVITCVYQMIALSSFFVKEKVS"
     gene            <736065..>737432
                     /locus_tag="DEHA2A08888g"
                     /db_xref="GeneID:2899703"
     mRNA            <736065..>737432
                     /locus_tag="DEHA2A08888g"
                     /product="DEHA2A08888p"
                     /transcript_id="XM_456716.1"
                     /db_xref="GeneID:2899703"
     CDS             736065..737432
                     /locus_tag="DEHA2A08888g"
                     /note="similar to uniprot|P39706 Saccharomyces cerevisiae
                     YAR003W SWD1 Subunit of the COMPASS complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08888p"
                     /protein_id="XP_456716.2"
                     /db_xref="GeneID:2899703"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK3"
                     /translation="MNLSLQDPFAVAKEYPENLTHTLQYGHSVVIQFNHKGDYLASGL
                     SDGSIVIYDLTSNGGIVAHLENGGHTRPVSSISWSGCGRYLLTSSQDWCCNLWDLNRV
                     NRDEGDELEDGPIIRRVKFDGPIWSAMLHPNNHFLITASLYEDSPVFVDLSIESDIKV
                     HRLNTVPLPLQQREEGAEQPAQADDSDEEKASRKKKKDKHMTLVTTFTPGDGTYIFTG
                     TSKGWLNIISTETLQLVHSIKIANSNIKNLVVSPNGRKLAINSSDRIIRQINLPDMIN
                     ITDPNHWEFEVEHKYQDVVNRLQWNSVTFNHNAEFLIASTFGQSSQDLYMWETSLGSL
                     IKILEGSNEELIDVKWNYHRCTVGSTGLDSGSIYLWSIQFPQKWSALAPDFVEIEENI
                     DYEEKEDEFDYINEDILNKRRMEEEDLIVDIVTKETVDARGFDVAQDSFIIPIDYDQQ
                     PGDFV"
     gene            <737901..>740012
                     /locus_tag="DEHA2A08910g"
                     /db_xref="GeneID:2899701"
     mRNA            <737901..>740012
                     /locus_tag="DEHA2A08910g"
                     /product="DEHA2A08910p"
                     /transcript_id="XM_456717.1"
                     /db_xref="GeneID:2899701"
     CDS             737901..740012
                     /locus_tag="DEHA2A08910g"
                     /note="similar to uniprot|P41813 Saccharomyces cerevisiae
                     YNL068C FKH2 Transcription factor of the forkhead family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08910p"
                     /protein_id="XP_456717.2"
                     /db_xref="GeneID:2899701"
                     /db_xref="GOA:Q6BYK2"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK2"
                     /translation="MSGTSTPRKRTLGDLNDGEVPNFEDPLDVVNAVISTLQTPVEKT
                     NVAMTYANDKNLATEVQAYAKIAGQDWTYYVKSLSIPIGRNTDNPGGSSQPLVDIDLG
                     PAKVVSRQHAMITYNLDLRYWELKVLGRNGARVDGQKVPFGENHSTPLHSGAILDIGG
                     TQMMFILPDSPPNISQKMLSTCLAKYNANLNKSKRKSISDFPQQHTIPINPSNQIKSF
                     QMFDKAQLTQSPSSASATSLQNNLDQDLSKEEAKDIKPPYSYATMITQAILSNDDGVM
                     SLSEIYNWIASHYAYYKYSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISES
                     YKEDFLTKIQSGSLSKARRGSSVSRQLQLHLATHQNLPESQKYYAKDDPSRSNSFDQR
                     FNHERNSSLPKLGQPMQYQQAPSNPMQHNPLSYISNQQPQNGSFGVPPPRSYGYQHPP
                     PPQLMYGSHMMHQNQNDSPSIQQVPGNKNELSSPIRQLSDINTTTPKLPKVSGNHLFN
                     LPPPPPSTHSMGTSAPQAHHSRSNSYNHQHQLTENNSNSYNTSGNNQTSESNTTNTNA
                     QNVSSGPTTNTSDLALGFTSPKKIAPLEAFTPERGSKSSSNKLGVANGVNTNQSSPAF
                     WNFVQFSTPNAQTPLKGNDQNNQLSPTLNRRVFGSNGYAKEKSEKGDLSPLKSRNSHD
                     DNSKADNADELNTQKNEEINA"
     gene            complement(<740265..>744035)
                     /locus_tag="DEHA2A08932g"
                     /db_xref="GeneID:2899778"
     mRNA            complement(<740265..>744035)
                     /locus_tag="DEHA2A08932g"
                     /product="DEHA2A08932p"
                     /transcript_id="XM_456718.1"
                     /db_xref="GeneID:2899778"
     CDS             complement(740265..744035)
                     /locus_tag="DEHA2A08932g"
                     /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
                     YML049C RSE1 RNA splicing and ER to Golgi transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08932p"
                     /protein_id="XP_456718.2"
                     /db_xref="GeneID:2899778"
                     /db_xref="GOA:Q6BYK1"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR017986"
                     /translation="MSVDNESLYLYNLTIKHPSSCIASIVGQFLGNKKSQEIILANST
                     SIELWKADSNTGKLEKIYQQASFGIIQGIDKIRLVGTQKDYVVITSDSGKLVVLEFDI
                     EKLQFVPLFQEPHSKNGLRRTSPGEYLCVDPHNRAILIGAIEKNKLVYKVQSNDEGKL
                     ELSSPLETFSKHTLTLQICAMDTGFENPMFAAIECDYNARQQDNGEEEDAGEASLLLN
                     YYELDQGLNHVVKHKSNEKIPGSSSHLIPLPDFIGGLLVCSKSTIIYAHPSKDKLYLP
                     IPIRSNTNETLIVNHVIHRLKKNNFFILVQSQLGDCFKITIDHDEVNESIENINITYF
                     DTIPLSQSLNIFKSGFLFANVATNNKLFYQFEKLGDDNNNTTLQSCNFSDYNSIFELD
                     ISKRSFKVAGLENLALVDIMETLNPITDGALIETLRPEVPDPFKQLTALSSHSYLKTL
                     THGISTNTVVSSPLPIKPTAIHTTRIFAESANDEYLVISSTLSSQTLVLSIGEVVEEV
                     NDSQFVTNEPTINVQQVGKSSVVQIYSNGIRHIKHTMRNDTIEKKYTDWYPPAGISII
                     QASTNNEQVIIGLSNREICYFEIDPHDDQLVEYQERLEMSGGSISALAISSSSISKLQ
                     RKSSYAIVGCSDETIQAISLKPHNCLEIVTLQALSANSSSIAMVPHGYSTSVHIGMEN
                     GLYVRVTIDEITGKLSDTRIQFLGSKPVQLSVIGLPQLQQNGLLAISSRPWIGYYSKG
                     DFKMTPLLNTNISNGASFYSEDIGGEGIVGIDDNNLIILTISNTDGEESGLNVNDDFI
                     INSVKLRYLPRKMNVDSPGDNEISSSSYIYIIESEYGITSPFPVTVLPDNQKESTNEN
                     IDTPEIDQDYYDAFGFERSRHSWASCVEVIDFNNQEIVQTIELPKNESAISLCRLQFE
                     SQQTKNQEYLIIGTTQDQKFLPNSYSNNYLYTFTINKSSNKNKSQNEILEFVHKTELD
                     YQPTAIIPFNGRLLVGMSNFLRLYDLGQRQLLRKASSNIEYLKNIIRLTHQGGSRIVV
                     GDSSMSTTFVKYDSTENQFIPFADDIMKRQITALVTLDYDTIIGGDKFGNIFVSRVPE
                     TISQQSDKDWSLLRYQESYLNGSGSRLKNICEFYLQDIPTSFTKGSLVMGGKESIIYT
                     GIQGTLGLLLPLSTENEVKFLGDLQLLLRKYFDYNFDDFDKDKNGYNLLGKDHLKFRS
                     YYNPVKNVMDGDLIERFYELSQSMKIRIGTELNRTPREIEKKISEMRHRSAF"
     gene            complement(<744923..>746482)
                     /locus_tag="DEHA2A08954g"
                     /db_xref="GeneID:2899694"
     mRNA            complement(<744923..>746482)
                     /locus_tag="DEHA2A08954g"
                     /product="DEHA2A08954p"
                     /transcript_id="XM_456719.1"
                     /db_xref="GeneID:2899694"
     CDS             complement(744923..746482)
                     /locus_tag="DEHA2A08954g"
                     /note="similar to CA5756|IPF1065 Candida albicans IPF1065"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08954p"
                     /protein_id="XP_456719.1"
                     /db_xref="GeneID:2899694"
                     /db_xref="GOA:Q6BYK0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BYK0"
                     /translation="MSEKETNTNVELDSSVESSDHYHHDDSHLELKKHSPEEIAASGK
                     WYDRRFIRGIPQYSDSMVQIVMLSFVVFMTPGMYNALSGIGGAGISDRATADNANVAL
                     YSCFATIGFFAGTICNYFGIKACLIGGGTGYFLYSSSLLCFYHTENKGFVIFSGAYLG
                     ICASCLWAAQGTIIMSYPTEDKKGRAIMIFWVIFNLGAVIGSVIPLANNINNKGSAVG
                     DSTYIAFMVLMFCGSLIAMCMLPMNKVWKSDGTRVMNKKFPSWKQELIDLYRMLVSEP
                     RIFFVFPMFFASNWFYTYQFNDFNAGRFNIRTRSLNSLLYWLSQMFGAIIFGSILDLK
                     CFRRSTRAKIGYIILTVISLAIWGGGLKFQLGFTREDVTSPDAAGEIPPKFAPIDFED
                     GSYIGPMFLYIFYGIFDSMFQTYLFWVLGSMSNNPKKTALYAGFYKGLQSAGAAIAWR
                     LDALEKPYMDLFASSWGLVNGSLLIALPLIWFKITDHTDIEKDGLTKVVTDNEIKSVK
                     SFPQEGTIEVV"
     gene            complement(<747400..>748920)
                     /locus_tag="DEHA2A08976g"
                     /db_xref="GeneID:2899700"
     mRNA            complement(<747400..>748920)
                     /locus_tag="DEHA2A08976g"
                     /product="DEHA2A08976p"
                     /transcript_id="XM_456720.1"
                     /db_xref="GeneID:2899700"
     CDS             complement(747400..748920)
                     /locus_tag="DEHA2A08976g"
                     /note="highly similar to CA5757|IPF1067 Candida albicans
                     IPF1067"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08976p"
                     /protein_id="XP_456720.2"
                     /db_xref="GeneID:2899700"
                     /db_xref="GOA:Q6BYJ9"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ9"
                     /translation="MTKISCDIESDRVAELDKLLGLIKPKILHYIDKADPNSSNYETD
                     SLGKYHSPEFLKNQFTDDKQLDSGIKGDYEKLSSTIDQVLKYSVNTWNPGFLDKLYAS
                     NNPIGVISDLILSILNTNSHVYTVSPALSVLENYIGKKYAQLFFDDDQETCGGLTFSG
                     GSWSNITSMQIARALKYPDTKENGNTNYKFAIYTSEHCHYSVVKGAILLGLGSSNVFK
                     VKILPDGSMDVNNLSEVIERSVEQGYTPLYINGTAGTTVFGSYDPFEEISKVAKKFDC
                     WFHIDGSWGGNVVFSQTHKSKMKGSKLADSVTVNPHKMLGIPATCSFLLLPHVSHFQK
                     SMSLSAPYLFHGRESDDDSIENYDLADGTMGCGRRADSFKFYMGWLYYGKEGFANRVD
                     HAFAIAKDFVEKISKNPKFKLVIGSEKDLPACLQVCFYYKPSDYTDHDNTEITRFISR
                     ELHKRGRYLVDFSPNPTDKNNEGEFFRVVFNSPTLTDSVVDDLINSIIEVGAEYKK"
     gene            complement(<749509..>750039)
                     /locus_tag="DEHA2A08998g"
                     /db_xref="GeneID:2899706"
     mRNA            complement(join(<749509..749884,750029..>750039))
                     /locus_tag="DEHA2A08998g"
                     /product="DEHA2A08998p"
                     /transcript_id="XM_456721.1"
                     /db_xref="GeneID:2899706"
     CDS             complement(join(749509..749884,750029..750039))
                     /locus_tag="DEHA2A08998g"
                     /note="highly similar to uniprot|Q02772 Saccharomyces
                     cerevisiae YJR034W PET191"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A08998p"
                     /protein_id="XP_456721.1"
                     /db_xref="GeneID:2899706"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ8"
                     /translation="MGASCKDQKKALAICLQRSPCVLIERNTPKKCLSDPELKKDLPE
                     LCIANFRAFMECRNGMFDMRKRMKGNAPLSTGKYDDTYENLSSGNFEAHEEMKKLEVL
                     NRNLSRQRLLREEQERARLAGTLEKN"
     gene            <750399..>754733
                     /locus_tag="DEHA2A09020g"
                     /db_xref="GeneID:2899801"
     mRNA            <750399..>754733
                     /locus_tag="DEHA2A09020g"
                     /product="DEHA2A09020p"
                     /transcript_id="XM_456722.1"
                     /db_xref="GeneID:2899801"
     CDS             750399..754733
                     /locus_tag="DEHA2A09020g"
                     /note="weakly similar to uniprot|P47104 Saccharomyces
                     cerevisiae YJR033C RAV1 Subunit of the RAVE complex which
                     promotes assembly of the V-ATPase holoenzyme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09020p"
                     /protein_id="XP_456722.2"
                     /db_xref="GeneID:2899801"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ7"
                     /translation="MTINFVPGEVNNSPYSVSQGLWKSHHIIAYGSGNNLIIYATTTD
                     STKHKKSDHLQTIYLEADPYAIDVNSSNGFIVISIGNNIVVYKPLNEYMSKPQWSHAL
                     EFDNVDSTMISCLQWAPLEDELIVGSKETLALYHIYDEYGSLRYEKRWHSIQANPIIN
                     IKITNNSNKIITLSGNYERLVKVWSRINYGENTLFELSYLNHPLNTYVTDLKWKYRIP
                     SDSINTVDSSMANIKNIRGYIDNGNDDNDIIYTLTNDNILRVWAAYEFSGHNHFRSWA
                     SLDLSECFVDDEIISMVTIDNFHLQKTLIPQIEAGNGSSNIYKYFENQNLNDLDLLFV
                     ISKQGKVAIYSILNISLTPPNAIKFERLDQSNMSFDKNSFPNGINYTKFENLTKEIIQ
                     SEEFLINLKPIIFPELEFLDNSDSSTGLSILIHDRLKNTIRFNAFEFKNILKSDSSVL
                     GAKLIDKFQGHTKSIRKLVKSYSSSASNNIVFSISNFPEHNYLWEPLSIGSSNTESMT
                     ITKKFQVNLNHGSNINEKNQGIWDSVLLNDIEPPNKIGRHHLVVALEKNGLISLWDCN
                     ALTLDIQEAALLERLEILNSINERIIREPRAFVITEFPNESNHTKEYCIIAIFENDLI
                     KAWKLIININTQPLSTSLKPLNINNLPQDEKIHQIALIDSFESKGERNLVSVIDKQDK
                     VKFFAINFAKSRDSLEWIETYRLHTNISEATKIHGASIINKFAIVDKTGSRLTIWDTK
                     SGVLEYEETFDDSYGAVTDLDWTFITSNSERSTSNAILSVGFSRFVLLYTQLRYDYTN
                     KIPTFAVLKKIDISNYTSHEIGDSIWLDDGYLVIGCGNQFFIDDKWVKLGSSANNSLD
                     STIRQLMVGYTNIENEDYDSSQKETKSTYDMIYDIEQLVRILNGPLPVYHPQFLIQCL
                     FMHQISLVKDVFVRLFQILRKGDSIQWDLSMDLTNEVLENNESRQSGASTPSLSSKID
                     IINDAFSSKFDSSGIHIFNSFNDNLSDLLIEKLMKISLPLLTRHQQITLISIISIVKE
                     LGKYLMSLDENGLRFLMGFKLFQLSSKQSKLTTRDISWALHSDNKEMLLTMVEEYFKN
                     RLKWENVKQIGLVYWVETIRLTKIMESCARNEFSDTRDPSGRVSLFYLAIRKKQVLIG
                     LWRTVSHTEQQKMLKFLANDFNESRWKSAALKNAYVLMGKHRYIDAAYFFLLADALKD
                     CCNIIATKLNDVQLAIAIAKIYSATSKGTISEGEIIKNLIENYMVPEVLKNGDRWITS
                     WIFWELEEHEISIQALIKSPIEIINHHKAKFSDDCSKNYISKITPRFSSMSFLKDDPV
                     LIILFHALRQKTIKYLKGSLSIAPDEEFNFIIKVCSIYTRMGCDYLAVVLIRNWSFLK
                     YDESKNEIKWSNHTTENTNQSNEQQNTLSFTENGIHPENMTQKINAQPPPPTAFQEPD
                     MSAFDFGF"
     gene            complement(<754777..>755379)
                     /locus_tag="DEHA2A09042g"
                     /db_xref="GeneID:2899802"
     mRNA            complement(<754777..>755379)
                     /locus_tag="DEHA2A09042g"
                     /product="DEHA2A09042p"
                     /transcript_id="XM_456723.1"
                     /db_xref="GeneID:2899802"
     CDS             complement(754777..755379)
                     /locus_tag="DEHA2A09042g"
                     /note="similar to CA1644|IPF9345 Candida albicans IPF9345"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09042p"
                     /protein_id="XP_456723.2"
                     /db_xref="GeneID:2899802"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ6"
                     /translation="MFERSRFVSLHYYGKIFLENLQFACLFIIPLYLIVFTVPLVVNP
                     DTIDQFKINFKVVLLSKPFCEVKSEECQKLLDPEYGNPSLLLKTSFSDYELVYIRHYS
                     IDYLDNILITLVDKSFFRPLILMIKKPTNPAEWWSKVLESLRVVMAIGNAMIFHAIKG
                     VLVSKMWVFFIFGAITTIYDSWASLIQTLSGVLRSANTIF"
     gene            complement(755482..755554)
                     /locus_tag="DEHA2A09064r"
                     /db_xref="GeneID:8998061"
     tRNA            complement(755482..755554)
                     /locus_tag="DEHA2A09064r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (CCT) cove score=66.21"
                     /db_xref="GeneID:8998061"
     gene            <756870..>760286
                     /locus_tag="DEHA2A09086g"
                     /db_xref="GeneID:8998063"
     mRNA            <756870..>760286
                     /locus_tag="DEHA2A09086g"
                     /product="DEHA2A09086p"
                     /transcript_id="XM_002769967.1"
                     /db_xref="GeneID:8998063"
     CDS             756870..760286
                     /locus_tag="DEHA2A09086g"
                     /note="similar to uniprot|P38929 Saccharomyces cerevisiae
                     YGL006W PMC1 May be involved in depleting cytosol of Ca2+
                     ions"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09086p"
                     /protein_id="XP_002770013.1"
                     /db_xref="GeneID:8998063"
                     /db_xref="GOA:B5RST4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:B5RST4"
                     /translation="MVALNPNKYGQNLGVEPQKFQDESDQASTSSASPLTGEPYSIGP
                     DDLAELHDPKSMKKLYELGGIDSLSANFTTSIKGGINDEDQHDMKKRMEYYGKNKLPT
                     KVRKNFFELCFDALKDKVLILLSVAAVISLALGLYETFGQGVMYDDEGNALPKVDWVE
                     GVAIMVAVAIVVLVGAANDFQKERQFAKLNAKKEDRELIVIRNGSQKMISIYDLMVGD
                     ITNLQTGDVLPADAILISGEVECDESALTGEAKTIRKSPAEEAMQFYESQLPTNEDIG
                     SSSIKFEDPFLISGAKVLSGLGNAMVTAVGPNSIHGRTMASLNHENETTPLQLRLDNL
                     AEGISKYGFLAALVLFIVLFIRYCVNIAPGGKFNLLKSAEKGKKFVDILITAITIVVV
                     AVPEGLPLAVTLALAFASTRMAQNGNLVRVLKSCETMGGATAVCSDKTGTLTENRMRV
                     VKGFFGNQEFDDTVGSDGPRSSDMFSQMLDNLKVFYCTNVAINSTCFVNSEYDEEKAK
                     LAKQKPKRQSLIKHLLTNSNDRQKRQVEFSQNNEPYLGNKTESAMLILADEKLNLFGK
                     RSLEQQRQDSSSDVVQVLPFESSRKWSGVVMKIENGFRFYCKGAAEIIFKNCGYQFDS
                     NGDIIRMDRNLRDAALTKIDQYANDALRAIASCHRDFVGISSWPPQELVKDIKSEADA
                     ELLINVSGNLEDDRKMMIMDSIVGIQDPLKEGVPESVLRCKQAGVSVRMVTGDNLITA
                     KAISKSCNILTSEDLSNEYAFMEGPAFRKLSAQERDKVAPKLRVLARSSPEDKRILVE
                     TLRSQGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTDIVQA
                     IKWGRTVASSIKKFIQFQLTVNITACLLTFVSAVASSENKSVLTAVQLLWVNLIMDTL
                     AALALATDKPDESSLRKKPAGRHTPLISVSMWKMILGQSTTQLIVTFVLHFAGKSIFF
                     GSRPATNHENQQLDAMTFNAFVWLQFWKLIVTRKLDEADGVSKVRDRLTRDNLDFTQH
                     LFRNWYFIGIAAIIGGAQVLIMFVGGAAFSITRQTPAMWGTALICGFLSIPAGLILRI
                     IPNEWVVAIFPTKAFNIFIYYAGFKFLRSKKKAKSGVNDDLERFSSSDKD"
     gene            complement(<760431..>761180)
                     /locus_tag="DEHA2A09108g"
                     /db_xref="GeneID:8998084"
     mRNA            complement(<760431..>761180)
                     /locus_tag="DEHA2A09108g"
                     /product="DEHA2A09108p"
                     /transcript_id="XM_002769968.1"
                     /db_xref="GeneID:8998084"
     CDS             complement(760431..761180)
                     /locus_tag="DEHA2A09108g"
                     /note="similar to CA5760|IPF1072 Candida albicans IPF1072"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09108p"
                     /protein_id="XP_002770014.1"
                     /db_xref="GeneID:8998084"
                     /db_xref="UniProtKB/TrEMBL:B5RST5"
                     /translation="MTQVNDESLSMFFDSDFNPSNYVDALFQSISNNKSQSQIYSKNN
                     LQSLSNKCSNLVTHLDYHTSELSNDLISQIETLQNSSKIITQGLNNDEVLNASNDMTR
                     LQYFINTLNNSILLLQTDIKQVNEELNVNNESQPESINSLIKLKGIKNNLNQVLVIFE
                     RLNSITMNNPDSTTVESFQSSLNTLYETIRNQLTNEENEINQLLVTNIKELINLLPFF
                     QNLTNFYPIYKKFTNKLNIDLDHYLSTNKHS"
     gene            <761294..>762478
                     /locus_tag="DEHA2A09130g"
                     /db_xref="GeneID:8998075"
     mRNA            <761294..>762478
                     /locus_tag="DEHA2A09130g"
                     /product="DEHA2A09130p"
                     /transcript_id="XM_002769969.1"
                     /db_xref="GeneID:8998075"
     CDS             761294..762478
                     /locus_tag="DEHA2A09130g"
                     /note="weakly similar to uniprot|P53196 Saccharomyces
                     cerevisiae YGL004C RPN14 Putative non-ATPase subunit of
                     the 19S regulatory particle of the 26S proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09130p"
                     /protein_id="XP_002770015.1"
                     /db_xref="GeneID:8998075"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B5RST6"
                     /translation="MDLLTIQDSFEEVISDIQNGRLEQDKFWVARRSIESEENQDFWY
                     INVTKQGMKDDGNKIKFMCGKDKKYQLQVDEKIYNLQSFYRKVNLANNRISSVAVSSD
                     SERFIVGTKKGELIIYNLRTDTVEQKIPEAHFEDITMLKFFPSDKVVMSVGIDLKIKL
                     WGLTGELVRTMSNQVKEITEIGLLGKTGRNFISGSKDGSIDMWECGHGQVIYSFKRIQ
                     NNNDPVNCFVLGRHESTGSKLSELEVETENQCVYVGFDSGIIQQFNIGDHCQTSVRFE
                     DGNAGVSSIDISDNILVSGYNDGQLKVWDIAGGNMVFKYQLNSHFPISTLKVLHRQDD
                     TITVLVYNGPETLLKLEIDLKSEVVNQTYLIGMEENFSVHDVALNKDNIIIASDQLTV
                     YK"
     gene            complement(<762813..>763196)
                     /locus_tag="DEHA2A09152g"
                     /db_xref="GeneID:2899806"
     mRNA            complement(<762813..>763196)
                     /locus_tag="DEHA2A09152g"
                     /product="DEHA2A09152p"
                     /transcript_id="XM_456727.1"
                     /db_xref="GeneID:2899806"
     CDS             complement(762813..763196)
                     /locus_tag="DEHA2A09152g"
                     /note="highly similar to CA1558|IPF15679 Candida albicans
                     IPF15679"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09152p"
                     /protein_id="XP_456727.1"
                     /db_xref="GeneID:2899806"
                     /db_xref="InterPro:IPR003033"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ2"
                     /translation="MSDITVDGFNASPLFKDLSEALQDDKIKQKAISGVKATLVLTLK
                     NKEGKEQSWLLDLKKDGTVKKVDSVPKSDVQLILKDADFVKLATGKSNGQKLFMNGKL
                     KIKGNMMKATSLEGVFKAIGPKAKL"
     gene            <764375..>764962
                     /locus_tag="DEHA2A09174g"
                     /db_xref="GeneID:2899807"
     mRNA            <764375..>764962
                     /locus_tag="DEHA2A09174g"
                     /product="DEHA2A09174p"
                     /transcript_id="XM_456728.1"
                     /db_xref="GeneID:2899807"
     CDS             764375..764962
                     /locus_tag="DEHA2A09174g"
                     /note="similar to uniprot|P40470 Saccharomyces cerevisiae
                     YIL127C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09174p"
                     /protein_id="XP_456728.1"
                     /db_xref="GeneID:2899807"
                     /db_xref="GOA:Q6BYJ1"
                     /translation="MSFTSKTSKSHAEATVNKLFSSLLPGTQGTTSKQSSSLSSAELL
                     SIEIENKNKLSKEELKKIHKQNKFKQHKKIKKALEDEKRFNKLAKYHLIKHHKTGGEL
                     SEEEAKYLKKLVKKNVNSLNRVSEIDDMEIKSELDQVRQDILKINKEKHDKKAKRIQN
                     KKTKDFNSKVAKGMISYPGLTPGLAPVGLDDSDDE"
     gene            complement(<765032..>768346)
                     /locus_tag="DEHA2A09196g"
                     /db_xref="GeneID:2899808"
     mRNA            complement(<765032..>768346)
                     /locus_tag="DEHA2A09196g"
                     /product="DEHA2A09196p"
                     /transcript_id="XM_456729.1"
                     /db_xref="GeneID:2899808"
     CDS             complement(765032..768346)
                     /locus_tag="DEHA2A09196g"
                     /note="weakly similar to uniprot|P40469 Saccharomyces
                     cerevisiae YIL128W MET18 DNA repair and TFIIH regulator"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09196p"
                     /protein_id="XP_456729.2"
                     /db_xref="GeneID:2899808"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:Q6BYJ0"
                     /translation="MQSSESIHDIPTLINQFIASADDSDVSITYSKELAELIEKDEMT
                     LLKFIQSLGPNLTSDSDLIRSKSIQCMSESLKCLNVNKLSKQDINVLFEFLLAKFEDI
                     FCLGHILSSLNSLISFKNFIFGMNNNVEKLLTNILNNYDPKKHLAKVRYEPFRTLNAL
                     VTIDPVYFQSSSRVSDLMVKTFIHVASGEKDPRNLLLSFDTNTKINEVFEFDPLNEVH
                     KDLISELFDVCFCYFPISFSPPPNDPYKITAQDLKLKLRNTIASQSYFAKESFADLIE
                     KLTSTNPVIRNDVLKTLLLCVENYKLETVAEYWVTIWNALKFEVLHNDVSIFKPYIDV
                     IVPEDYDEEIDDSDEFKPLITTLVIIKKLANRMTDFGELENLLTTITNELKSNLVTIN
                     DKSFKQSVLLLSVLASDSSAGFNFIIKFLFLQEIWGKYINADEDSSIEEVPSELDKTE
                     DLVLNTSKQKELIDNLGFVLTSYNVLLGNLENQDEFIENNNLKLYKDHLLIFMGQLLQ
                     ASSNLEKTLKCKVIQQLIKLAQLKGFLNVQECTLILGYFSNILLDTANSKSKNWEKDQ
                     VTKEIVNGLIKLMNSEGASNNDKTALVIDLILPHLLEILPSTDSLSNFKKLLEIIGEL
                     CTNYQFLEVLSIRLLNRLTNYDQFNIDQFEVFRNITNLLVESIKKVQVSKQFLMNSWY
                     KNFVPRFINCLLEILKVKDDHILIELSGDLIGLIVKYNDKSKHQEILNDFVAMFLLDK
                     ANGFNVNVNVIHQQKPLINLFNKILANIDKACVVQLNDTFTMNELTDRIIGLCNSRGD
                     EYSRLGYLQNLSLLVNKFLQSNEFIEEKLKLTFENISNISKFDSVLSQDQIESFEVIV
                     WILKSLILKIDTLGIEYINRLISLLSCENRQMQQLTAKSFNILMIDLPIFTNQQIGGK
                     TKIISGVQNLNVRLLYKQKVFGILLPKIIEGYNISNIRNKENYLISLSLILNNVPHSI
                     LKSYLSQILPLILNSLNLPNPIILNASLATCEIIIDESPDLVIPHLSTLIPKLVGLSM
                     GKIVVEKSLVNNEEVRLTSLNCLQKVFSNIELKYIIPFQKSALNKLTPGLDDKKRTVR
                     KLCCDVRQTLFELGKY"
     gene            <768772..>777180
                     /locus_tag="DEHA2A09218g"
                     /db_xref="GeneID:2899809"
     mRNA            <768772..>777180
                     /locus_tag="DEHA2A09218g"
                     /product="DEHA2A09218p"
                     /transcript_id="XM_456730.1"
                     /db_xref="GeneID:2899809"
     CDS             768772..777180
                     /locus_tag="DEHA2A09218g"
                     /note="similar to uniprot|P40468 Saccharomyces cerevisiae
                     YIL129C TAO3 Transcriptional Activator of OCH1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09218p"
                     /protein_id="XP_456730.2"
                     /db_xref="GeneID:2899809"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI9"
                     /translation="MIEIPDLDESSPYQYVLDQSQVQRSQQPQQPQQPQQSHHIRHIS
                     DITGDYRRNTTDEPTDSAASEVKKYALYESSEGPMPDQEDENSEDPHIQDQHSRQFRQ
                     FQYPNEANGVGDSDLPAPPVPKAIASSIDNLSYVPGLDSLASLALSEESNDTNAQIIE
                     YNTAQPLFMNQINMTGAPTSDTPRVHVVEQHGYGQETFKLQDPPLIHDKYSLQNTEHD
                     KEEDKLGELGYIKKGDASNSNLSLSQQLASPMSQFPIHDYTKESPQLPPPLSTITNKR
                     LTLSNGEEFSYMRKELATYSKTPAEYTLHIVFTQFVRHAERKLNLCLDYPLMEEPPVV
                     EILAEGVDSQFDKIVASLGYIARRKPKPVIDSVMFWRKSKSEVASMAASEVEKILSTA
                     KSNLSKAQHNDNIPASNPVINKNSNTGNKAKRSLSLMRTKSISKMTGHSRNQSTSSTM
                     SNQTTLKSPNLTQMKSSESVPFKQRNLYDDQITQARETAIQADRKSLASIYILCRVLI
                     EVVKQASPEVMGNDLGDKLEEIVFTQLKTTDPTSKNESLVRSSNWNLFAELLGYMSEK
                     RFLSVSDRFIANLERIPPKIKHEDEPKLYLLIQGMSYLKLTNYPLETFEESAEFIQSL
                     AKFFEKSNNESIIFAYCEVLSNLLLPLASILTAETNHPTWVEAIEKIYNKASFTWKNV
                     NKPINSNIMLNKLKPNSSYNIVNFNNSWAYSIHLMTSALSVSRKELFSDTWFDIIEHN
                     MFKLKPKVEISDKSTFIVCVARLVWVYVYRLNDTLNNTIKKLDNLFNLLFFNSSATSK
                     KQQWLVADKNLINALVEFIRIIGFQHLNYALDNVLTKLLKLSFNGVSLENAYPEKIML
                     VVKSYLTILEDYEHGDKPCFPTDDVFNSLSVSQNHNASSTSKFVKSRDKRFKSNEIML
                     IAKNSTNAFSHEEICRNLAVLLKLLDGQYGSGIWSSDSSSSSTPLSSTSKSQATFSAF
                     HFGIDFSYQPTKDLHMELFATLIEAIPWTLVPFNGEKSSACGLPFKNVVDILTRNAVH
                     ANPVVSKAALGSLKKLASRKNPNSLITIFAKFAFQFSDKPGPSYNSDYINSSESHKLL
                     KVYVELLSCWLKQFNKIEEDEGNKKSSNPLAQDDELMNKDVLNDLYQINYKSEDLSNS
                     NIVKAKRSDELEWKTIITVIEEIEGNGLFFLCSQDSQTRHYGISILKLVEQFDQAIYN
                     MSDTVQKQNEPTGVTRNRLSKGHSRSSSKFAADVGTRLIHVLEDTDFLGLIKPFKNEL
                     SMPERSRLTKLKNKKNILVKLAESDYGIDSTLWFRLYPKLLDIFFERCPMPVAMCRSI
                     VCVRMVQMYEFVFEFSESYKNYTSSLFGKSSANIPPEVLVNQWRLYLIFACCSLTSTN
                     EQKISFPSQPTHGRKKSMQMFIQHQKITSAKSVFRMVLPFLRSQQPMVRDAVISGLTC
                     ININIFKTLLENLPESVNEWNINSKGRDEAEDRLRIEVIHILCNITNRFKSDVFIYSD
                     EWMIANLVSIIKNVKSFLSVPLVQTDVEFQRLRRYFCGFLENVFIGLQDNSDLDKWLP
                     FEARIGCFNFLKEWCGVGDSADVTEDRYNTMVKRVKQLKETTSTVAILEVEKKALQFA
                     SLSTMAILCSGPIKQKIEVVGKIAVMSFDISELMDWVRALICSDDEKINEMGEMALKN
                     ILQLNLNNDELYQKVLRQCYSRQSSSKVTVSFFTIFVDIIMKLKQFDGIPFDIICLST
                     VMIGHEEYDVRFSAIKLLVFLEEKFYNSSVVDSFSECVCSKSKLVYQKALFDISTHFA
                     SLHPESAYIRISHLTMFFDDVDDWSRRNTLTCLRPWISTIELKRTEDTQDIPDQNSKS
                     KSLTNKLDIPSVMVLNNLIEITVKFSSTVSNEVEALWVALGSNLNNFDKIFEFIMNNC
                     LEGKNPLMVKLSCQIVDYLTFCQPNPVSIVDKFMENLQPKAMVPSQPSTNYLTSVASP
                     EFPYISNLWDIIPYNEKDAVFSSGQLSMVFLVDVFTIQNDRMIERLPLLLHVAFSLLD
                     HYLNIVQESAGSLLIHLIHTLAPKEPKSAETIEALRQRDHFKYLWVYDDLNNDKKGAR
                     TPKNMDLLARNILEILTPVVPTLQDDWSRVSLHWATTCAVRHIACRSFQIFRSLLSFL
                     DQGMLKDMLHRLSNTISDETLDIQGFAMQILMTLNAITAELNSEKLIDFPQLFWSSVA
                     CLSTVHEQEFVEVLSTMSKFVSKIDLDAPDTVSCLISTFPPKWEGKFEGLQQIVMVGL
                     RSATAWEASMKFLDKLNHLKDSEIIGTGDSRLLMSVLANLPRFLHALDQKTISKDIEE
                     TANVMSKMADNCGKPALARILVSLSKNRFRSKKDFLVQTVSSINNIFFPEYEAQVLVL
                     LLGFLSNRTPWIKLETMNLLKHIFPLVDLERDEFVGVGADLISPLLRLLLTDYAEPAL
                     EVLDEAVIISGSQLDKDVLRMSLGNSSMKKEYEKTATLFGIPEESGWAVPMPVVTAAS
                     TRNNVYAVFSTCTEATYVDENDEESNDDENIQFHMEDYYAPVVDHGDAASASVEEPDA
                     SLSNMWAALDDFDSFFTKDTDQNGPLPISTLAARRDSYNHHIHSASIDTKYSNSSDPT
                     TFMDSAPQVYDNKASLILNRSLARTKSNTSFKNNLADSIGASEHVSPGASTMYKKSYI
                     PFRHSKHPIKTKNESYITPKMPTSSTFDPEYTISPKSLSLSNSTLSPYEDEASSPIIK
                     NMESTSPSINETPTRFENLIGGSKRKTKKTNRFSPNYNNATASPNAPHHYWGSNKHAD
                     ASLVSNSSTPPSSTQTSQRLIQKSKDKKKRVA"
     gene            <777336..>778358
                     /locus_tag="DEHA2A09240g"
                     /db_xref="GeneID:8998102"
     mRNA            <777336..>778358
                     /locus_tag="DEHA2A09240g"
                     /product="DEHA2A09240p"
                     /transcript_id="XM_002769970.1"
                     /db_xref="GeneID:8998102"
     CDS             777336..778358
                     /locus_tag="DEHA2A09240g"
                     /note="similar to uniprot|Q12000 Saccharomyces cerevisiae
                     YOR091W RBF46"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09240p"
                     /protein_id="XP_002770016.1"
                     /db_xref="GeneID:8998102"
                     /db_xref="GOA:B5RST7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:B5RST7"
                     /translation="MAPKKKPQISDKNKAKAKTKAVGDKTFGLKNKNKSKKVQGQINQ
                     IEAGADGGLAKKKEAEAKRRAAEKKAAEEAKKETAALYGIQQPKVPFGVDPKSVLCEF
                     FRKGVCAKGPKCKFSHDLNVGRKDLKKDLYTDARTEKEEDTMDKWDEEKLRKVILSKH
                     GNLKTTTDIVCKYFIDAVENGKYGWFWVCPNGGNECKYRHSLPPGFALKTKEQKRLER
                     LASESAPKISLEEFLELERGKLDRSKFTPITLDTFAEWKKKQIAKKADEKKREEERNG
                     RKVLTGREIILNKFADKFYTEEDNTDQGTEWDLSEFRKNLPETEDSFKDYGDGIVDFE
                     KKPNQE"
     gene            complement(<778503..>780509)
                     /locus_tag="DEHA2A09262g"
                     /db_xref="GeneID:2899727"
     mRNA            complement(<778503..>780509)
                     /locus_tag="DEHA2A09262g"
                     /product="DEHA2A09262p"
                     /transcript_id="XM_456732.1"
                     /db_xref="GeneID:2899727"
     CDS             complement(778503..780509)
                     /locus_tag="DEHA2A09262g"
                     /note="similar to CA1501|IPF13217 Candida albicans
                     IPF13217"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09262p"
                     /protein_id="XP_456732.2"
                     /db_xref="GeneID:2899727"
                     /db_xref="InterPro:IPR017210"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI7"
                     /translation="MQRNGSPPDTSREQTEPPTPTPQSPNLSRRQRLLGLAKATRDSY
                     MPKISSIASGVSSRALGGDYYDENGNVRLPKDATIALFPAYTRKTEDGKYHVDVKGWL
                     SCPGVMSRKNRLILSLAKQITRYSSNPTTAKQAINELENDKLEPDVITPSDDASSDLE
                     SINSKDSSINTISQNENKPLQASVTNSSVRSSTPSFNDDLLKERLSNFIARSIASAEL
                     VISIGSQDRLDLNELEHNSVITDGYGHFEACVEVNYEPSVIQVKAATDESIFSFQDIM
                     LIPSEGLGLISDIDDTIKLTGVTGDKRELMRNLLLNDVSSWSIPPVVKWYSQLYDHKC
                     ISFHYVSNSPWQLFSSIHKYFEEVKLPLGSVHLKQYTGSFISSLMEPSSSRKKRALSK
                     IAEDFPKKKFICVGDSGEHDLEAYADLARSYPSRIIAIYIRCVEDSLSDIDDKKILKE
                     LTRLTSKKKPKAISKQLSSKPNNDEIENLIDLTDDTPHFAADRSKKLPPMIPHKPITL
                     QGNKLGRKPPLPIRDELKKSHTDTELAHSNSTDSTSSNGKESSWKDLTTIQKDSDDSP
                     PPTPLRRPTSFTSKANAEGFTTASNHDYNVFDNLQDVYDTHNYYELEDVDKKGAQWIR
                     RVVTALEALEGTDTRIKFFTDDEHDFFTSSIDIVKDYVHRNNSN"
     gene            <781271..>783115
                     /locus_tag="DEHA2A09284g"
                     /db_xref="GeneID:2899728"
     mRNA            <781271..>783115
                     /locus_tag="DEHA2A09284g"
                     /product="DEHA2A09284p"
                     /transcript_id="XM_456733.1"
                     /db_xref="GeneID:2899728"
     CDS             781271..783115
                     /locus_tag="DEHA2A09284g"
                     /note="similar to uniprot|P38822 Saccharomyces cerevisiae
                     YHR114W BZZ1 SH3 domain protein implicated in the
                     regulation of actin polymerization"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09284p"
                     /protein_id="XP_456733.2"
                     /db_xref="GeneID:2899728"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI6"
                     /translation="MSLQEVSIGNDLKDSFKPTSKWVNNGINWINDIEEFYRERATIE
                     KEYASKLSELCKKHFEKKAKNSTSLSVGDEPQITPGSLESASLVLWNEVLTQTEAIAE
                     EKVSFSREINTKLGDNFSSLKNKTGRIAKQIESIDEYLVSEKTKTEDEVNKAKKQYDS
                     LCESTESARQKTEKSSSEKHQQKLQEKEVAMNIGKNEYLIKINIANRLKDKYFYQDVP
                     ELLDYFQELNETRVGLLNKLLKNASIIERNSNDRIKEKLHIIDSTIDQNNPKLDVAMF
                     IKHNAFDWKEPQDFYFIPCAIWHDDESLITKEPELTELKRRLNVCSSDIAKYEDSCIE
                     SKQSLEELTASRKAELTNLTLKFDTKFNNSLSLLQRFLKTDSERIKNEVEIEVIQNFA
                     GDKDLSYFEVREKKKSKFGFLRGKKHSSSSSGGAVANDNSSDIHSLHTVKSGTSQKSH
                     AGLFSLRRNRGQSNASSASTGPKGKALYQYDATGDDEASISPGEQFDVVDEDDGSGWT
                     MIRTNQGNEGLVPTAYIEVTMGAPSAPSVNSGGKKKGPSVAPKRGAKRVQYVEALYDY
                     QADGDDELTITAGDKIALVQADTDGSGWTEGELNGVTGMFPTSYVKEA"
     gene            complement(<783407..>783973)
                     /locus_tag="DEHA2A09306g"
                     /db_xref="GeneID:2899729"
     mRNA            complement(<783407..>783973)
                     /locus_tag="DEHA2A09306g"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_456734.1"
                     /db_xref="GeneID:2899729"
     CDS             complement(783407..783973)
                     /locus_tag="DEHA2A09306g"
                     /note="highly similar to uniprot|P26786 Saccharomyces
                     cerevisiae YOR096W RPS7A Protein component of the small
                     ribosomal subunit or uniprot|P48164 Saccharomyces
                     cerevisiae YNL096C RPS7B Protein component of the small
                     ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_456734.1"
                     /db_xref="GeneID:2899729"
                     /db_xref="GOA:Q6BYI5"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI5"
                     /translation="MSAASKILSEKPSELELQVAQAFVDLEGQSDLKAELRPLQFKSI
                     KEIDVNGGKKALAVFVPCPSLAAYRRVQTRLTRELEKKFPDRHVVFLAERRILPKPSR
                     RSRQQQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDSTAV
                     DYKLDSFQQLYQKLTGKQVVFEIPSDVY"
     gene            <784462..>785220
                     /locus_tag="DEHA2A09328g"
                     /db_xref="GeneID:2899730"
     mRNA            <784462..>785220
                     /locus_tag="DEHA2A09328g"
                     /product="DEHA2A09328p"
                     /transcript_id="XM_456735.2"
                     /db_xref="GeneID:2899730"
     CDS             784462..785220
                     /locus_tag="DEHA2A09328g"
                     /note="similar to uniprot|Q12189 Saccharomyces cerevisiae
                     YOR095C RKI1 Ribose-5-phosphate ketol-isomerase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09328p"
                     /protein_id="XP_456735.2"
                     /db_xref="GeneID:2899730"
                     /db_xref="GOA:Q6BYI4"
                     /db_xref="InterPro:IPR004788"
                     /translation="MLKRIISARYIRNMSSGASLVEKAKKSAAYQAVDENFPEGAKVV
                     GVGSGSTVIYVAERISQLKNKESFVCVPTGFQSKQLIIDAGLRLGTIEQYPEVDIAFD
                     GADEVDTELNLIKGGGACLFQEKLVAAAASKFVIVADFRKRSPSKLGIQWRKGVPIEI
                     VPCAYAKVSKDLEAMGAKKVELRQGGSAKAGPVVTDNNNFLIDADFGEIEDPAKLHTD
                     IKQLVGVVETGLFVQMAYKTYFGEESGEVKCWSK"
     gene            complement(<785380..>785985)
                     /locus_tag="DEHA2A09350g"
                     /db_xref="GeneID:2899731"
     mRNA            complement(join(<785380..785892,785971..>785985))
                     /locus_tag="DEHA2A09350g"
                     /product="DEHA2A09350p"
                     /transcript_id="XM_456736.1"
                     /db_xref="GeneID:2899731"
     CDS             complement(join(785380..785892,785971..785985))
                     /locus_tag="DEHA2A09350g"
                     /note="similar to uniprot|P40994 Saccharomyces cerevisiae
                     YOR094W ARF3 or to YDL192W uniprot|P11076 Saccharomyces
                     cerevisiae YDL192W ARF1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09350p"
                     /protein_id="XP_456736.1"
                     /db_xref="GeneID:2899731"
                     /db_xref="GOA:Q6BYI3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI3"
                     /translation="MGLLVSKLFKNREMRILMLGLDNAGKTTILYKLKLGKASTTVPT
                     VGFNVETVKHKNVSFAVWDCGGQERIRPLWRHYFTGTNALIYVVDSSDHTRLEESKTE
                     LLRVISDKELSGCLLIVLANKQDVPGAIKPKELIDRFDLHNLPGQHTWSVIPTVAIDG
                     TGLIETLNWISKHDT"
     gene            complement(<786440..>788731)
                     /locus_tag="DEHA2A09372g"
                     /db_xref="GeneID:2899732"
     mRNA            complement(<786440..>788731)
                     /locus_tag="DEHA2A09372g"
                     /product="DEHA2A09372p"
                     /transcript_id="XM_456737.1"
                     /db_xref="GeneID:2899732"
     CDS             complement(786440..788731)
                     /locus_tag="DEHA2A09372g"
                     /note="highly similar to uniprot|P53131 Saccharomyces
                     cerevisiae YGL120C PRP43 RNA helicase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09372p"
                     /protein_id="XP_456737.1"
                     /db_xref="GeneID:2899732"
                     /db_xref="GOA:Q6BYI2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI2"
                     /translation="MGEDRSYKKQKVEDSKAEEVAEAAEESLRLHPHPRERTPLVHHD
                     DGEFSNLTRHTTTSLQASKLEDGPKNPFSGKQLSSKYFDILKVRRDLPVHAQREEFLK
                     MFQSTQIMVFVGETGSGKTTQIPQFVLYDDMPHLMGTQVACTQPRRVAAMSVAKRVAD
                     EMDVELGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMDDHDLTKYSCIILDEAHER
                     TLATDILMGLLKQVSVRRPDLKIIIMSATLDAEKFQNYFHNSPLLAVPGRTFPVEIYY
                     TPEFQRDYMDAAIRTVLQIHATEDEGDILLFLTGEEEIEDACRKISLETDELIRDQGC
                     GPCAVYPLYGSLPPHQQQKIFDPAPEPFRPGGRPGRKIIISTNIAETSLTIDGIVYVV
                     DPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELI
                     EQSHPEILRSSLASTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLQCLSDEG
                     DLTALGRMASQFPLDPMLAVMLIGSPAFKCSNEILSIVALLSVPNIFVRPASARKRAD
                     ECKLAFAHPDGDHLTLLNVYEAFNSDEAHNLGLHQWCRDNFLSYRSLLSARSVRSQLQ
                     RIMERYDLELVSTDFEDKSYWTNVRKALAAGFFMQVAKKKSGNKGYLTIKDNQDALIH
                     PTTVLASESEWVIYNEFVLTSKNYIRTVTSVKPDWLVELAPNYYNLEHFSKGDVKLSL
                     ERVIDRVQTMKKLEKKKSKKSKK"
     gene            <789881..>791548
                     /locus_tag="DEHA2A09394g"
                     /db_xref="GeneID:2899733"
     mRNA            <789881..>791548
                     /locus_tag="DEHA2A09394g"
                     /product="DEHA2A09394p"
                     /transcript_id="XM_456738.1"
                     /db_xref="GeneID:2899733"
     CDS             789881..791548
                     /locus_tag="DEHA2A09394g"
                     /note="similar to uniprot|P27697 Saccharomyces cerevisiae
                     YGL119W ABC1 Protein required for ubiquinone biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09394p"
                     /protein_id="XP_456738.2"
                     /db_xref="GeneID:2899733"
                     /db_xref="GOA:Q6BYI1"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BYI1"
                     /translation="MSVSKNIYELTAMANTMKKIAWDSVSVVERDATRVYEYSFLNKQ
                     LKKCSGSSMWSDAMATAEAARHGIRMGGAVNQRRMYSTNSFSHPSLTPEQNMPNETQR
                     KEIIGVKKPEEFQMSSSEVPSTRLARIFHYGSLAAGMGLGAATQGIKHYASGNKTSIS
                     MKSLILSPQNIERMAKKFSKMRGAALKIGQMMSFQDSSILPAEIQQILLRVQNSAHYM
                     PPGQLERVMVNDLGNNWRERLFTSFEDVPVAAASIGQVHNAVTEDLTPVVVKVQYPGV
                     VDSIDSDLNNLLTLLTASAILPAGLFLDKTIANARVELKWECDYIREAQNLIRFRDMI
                     KDDPVFEVPRVFHNLCGEHVLTMERMRGLEITKGNWDQNTRDWIATNIMRLCLLEIKH
                     FKFMQTDPNWANFLYNESTGKIELLDFGAAREFGDEFIENYILILKAAIKKDRDQIAH
                     YSKKLGYLTGLESPAMTEAHVDSILVLGEAFSPVDNKGKPFNFKDQTITDRVRGNVGI
                     MLSERLTPPPEETYSLHRKLSGVFLLCARLGATVPCEDLFKEIIGHD"
     gene            <791856..>794954
                     /locus_tag="DEHA2A09416g"
                     /db_xref="GeneID:8998058"
     mRNA            <791856..>794954
                     /locus_tag="DEHA2A09416g"
                     /product="DEHA2A09416p"
                     /transcript_id="XM_002769971.1"
                     /db_xref="GeneID:8998058"
     CDS             791856..794954
                     /locus_tag="DEHA2A09416g"
                     /note="similar to CA1713|IPF19743 Candida albicans
                     IPF19743"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09416p"
                     /protein_id="XP_002770017.1"
                     /db_xref="GeneID:8998058"
                     /db_xref="InterPro:IPR018820"
                     /db_xref="UniProtKB/TrEMBL:B5RST8"
                     /translation="METDDNIQSVNNKAPSSNRSLRHTNTTDDIKNLLSSPPERPKKF
                     NRQSSVILANTGERVHRTISLTNSSYESFDEDNLTERDSLLPQSNSNTSQRSISIYLN
                     WKYLRQVYHNDIFRSVLKCSVAYLIASMGVYYTPFNEFLGQTDSKHLVATVAVYFHPS
                     RSKGSMFQTLIFVVISLLFSFSVSFACRSIAGSFFKSGEDEISYSVDLIVSSISLGVI
                     AFMKQKVNKQTFNTACSLASISVVACIVKEGSLNAADIPIERLRSTAHVVVTGCVITV
                     AMCYLLWPVSAVDKLRNNLNDSYNIMSSLLSIIPNRILNGDKFTNQDAEYFNALKINI
                     AQLNSSFEESKFELKFKGREQELAIFAEIVNVTISLTRNLQALRSSTEMSWKLLHEEN
                     LEQNNESHSSTSSLKSYDNEYMRLSRSTEYLTHINTQGVSGDSSNIDYTAINSTQLFD
                     LFVYYLAPSMKSFIFTLKGVLSEIPFENKSSPNTFVNTTNYQNSLKSALELFHDKQTK
                     SFEKIYAQEIFKPPSDFFSKADQEEVTACCGNFSSLLKLFAEDLIEFLQLAEDYEKSR
                     KSSRTWHWLKFWRHHPEINASVINENANLEHSLNEALINFQNHLGSGNISHVSRSPRA
                     IERWSFSLWKALKVFRRIDVQFGIRVGLGAFFLSIFAYHPLTKHTFNLWRGEWALTIY
                     CIMMNKSLGGTTMTVKWRFIGTFLGAIAAYIIWILTDGNVYALSITGFLLSIPCFYII
                     IYWKKNNAFGRFILLTYNLTALYSYSMTQKDAEDGNEGGDEPIIGEIAFHRYVAVSVG
                     ILWALTMASCFLPNSARGRLKNGLAILWLRMGVIWDSDPLDYVYDSSAKGSCLIGLKD
                     QKGINDLLTECETLLKQAPIEFRLKGSFPRVTYEKLLKSTSTIIDAFQNMNHMVRVDP
                     KLSENEQYVLKYIAAERSELEDRIFLIFYMVASAMKLNFPLPVKPASMEHARDRMLYK
                     LSEIRSYNATESELALKNEDYFLLYSYTLVTSSISEELHKIVEIIKELLGELSEDMFQ
                     FV"
     gene            <795308..>796753
                     /locus_tag="DEHA2A09438g"
                     /db_xref="GeneID:2899724"
     mRNA            <795308..>796753
                     /locus_tag="DEHA2A09438g"
                     /product="DEHA2A09438p"
                     /transcript_id="XM_456740.1"
                     /db_xref="GeneID:2899724"
     CDS             795308..796753
                     /locus_tag="DEHA2A09438g"
                     /note="similar to uniprot|P32505 Saccharomyces cerevisiae
                     YGL122C NAB2 Nuclear polyadenylated RNA-binding protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09438p"
                     /protein_id="XP_456740.2"
                     /db_xref="GeneID:2899724"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH9"
                     /translation="MSGFDPEGPIGQQLKASLVVELSNKFNIADDAEDVSEFILVLIG
                     SNKTASEISSEVRELVDIPIDEAFVNTIFAEIQRLMTQGQGVQQQPASEQAQPPSQQP
                     IEQQQIPQQVPQQVPQQVPQPAQQLIQQPTEQPVQQSSEVDQLEHSMEDAQVQPQQHD
                     MLMNLPTGPKGLQNRNQHTNNKFNNRGGINKNTNNRNGLKKSFAMQNPGNFEKVLAMS
                     NSNVTNLKQFVQKPAKGRCRDFPYCNNKECQFSHPTKLCFAFPNCSNPPGTCNYLHPV
                     EDDELMAKLAKSKQEYMEKKKNTESAGTIGICKFGMLCSKDICPFGHPTPANKEAKVL
                     VLQWCPDGKTCQDVNCTKAHPSPNYQAPQVEMKPKPKPAQPELTLEQCKFGPSCTNLK
                     CPRRHATTPVVCREGANCVRIDCFFSHPIDEDCRFGINCTNKTCMFRHPEGRNLPNPS
                     NTWSKVPENATNERSFAVPEDQVMEQARQES"
     gene            complement(<797166..>797924)
                     /locus_tag="DEHA2A09460g"
                     /db_xref="GeneID:2899725"
     mRNA            complement(<797166..>797924)
                     /locus_tag="DEHA2A09460g"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_456741.1"
                     /db_xref="GeneID:2899725"
     CDS             complement(797166..797924)
                     /locus_tag="DEHA2A09460g"
                     /note="highly similar to uniprot|P25443 Saccharomyces
                     cerevisiae YGL123W RPS2 Protein component of the small
                     subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_456741.1"
                     /db_xref="GeneID:2899725"
                     /db_xref="GOA:Q6BYH8"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH8"
                     /translation="MSTEAAAPKRNFARSNRGGKPRRGGRRDEEKGWTPVTKLGRLVK
                     AGKITSVEEIYLHSLPVKEYQIIDQLLPELKDEVMKIRSVQKQTRAGQRTRMKAVVVI
                     GDSNGHVGLGIKTAKEVASAIKAAIIIAKLSIIPIRRGYWGTNLGAPHSLPTKVTGKC
                     GSVAVRLIPAPRGKGIVASPAVKKLMQLAGVEDVYTSSSGSTRTTENTLKAAFIAIGN
                     TYAFLTPNLWTEAPLAPSPLDVYAEEAAGSKRRY"
     gene            <798616..>799164
                     /locus_tag="DEHA2A09482g"
                     /db_xref="GeneID:2899726"
     mRNA            <798616..>799164
                     /locus_tag="DEHA2A09482g"
                     /product="DEHA2A09482p"
                     /transcript_id="XM_456742.1"
                     /db_xref="GeneID:2899726"
     CDS             798616..799164
                     /locus_tag="DEHA2A09482g"
                     /note="similar to CA1716|IPF17237 Candida albicans
                     IPF17237"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09482p"
                     /protein_id="XP_456742.1"
                     /db_xref="GeneID:2899726"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH7"
                     /translation="MSTYADAAASSGPIGAEKIPEPPKVKNTSNPNGNVETLDEDEFE
                     EFKKKTNAAVERGAKKVKDFSKEANENGEAYLNKFIASVKTGIDNVTKSVRDFTANFG
                     DNSTQLVAKASEEFKNPVVITQALVGISGLVAGYMTYLERHRIHSDNRVVLATHGAII
                     TGLIVADGYLFQKYYPQYKSKK"
     gene            <800593..>802065
                     /locus_tag="DEHA2A09504g"
                     /db_xref="GeneID:8998089"
     mRNA            <800593..>802065
                     /locus_tag="DEHA2A09504g"
                     /product="DEHA2A09504p"
                     /transcript_id="XM_002769972.1"
                     /db_xref="GeneID:8998089"
     CDS             800593..802065
                     /locus_tag="DEHA2A09504g"
                     /note="similar to CA2718|IPF7374 Candida albicans IPF7374"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09504p"
                     /protein_id="XP_002770018.1"
                     /db_xref="GeneID:8998089"
                     /db_xref="UniProtKB/TrEMBL:B5RST9"
                     /translation="MDFMIYGKMVEPEYTQYDDTRTSYEEPADFFEDSVMGIGSNSGT
                     MLTGHSNCGNTYNSNPWVTDVATSTQAQSGPYLSYPTNGGYGGSIYRCDNRMTQGSMD
                     LSGAIGNEVNGTYMDPTIELSGYNYNMDALPMPNHYTQNSLLPFNSTSSLNSMNSVNA
                     LNTYTSASELGAEGYSASGGSMAPGGSMTLGYPSPISHRQSPLQIQQQKARLKIKTEK
                     TDTKKRYRIIRGVSAGGCSTRPPKYLVDSNALYLPIELHINGALVEEICYPPWNASEK
                     EDRRRIIRIERVQNGHKLSANFSIVGGANENPITLPAPPDTDVIEVSCLECTTILSEA
                     DVQSASDDDSTIPINGVRDGKYNQYYITSVEVIEIVELLIGTQSMDPADRRKERGRIR
                     SNLVPFWSRKPISSRMQDIPSTHTSRSPNYLGKDTHLTNQDYRFELAKRIMAYEIRKP
                     RGFDKEVRILRWDKLIPALKRALQTYYTEIPGSDSSIDFS"
     gene            <804166..>807750
                     /locus_tag="DEHA2A09526g"
                     /db_xref="GeneID:2899390"
     mRNA            <804166..>807750
                     /locus_tag="DEHA2A09526g"
                     /product="DEHA2A09526p"
                     /transcript_id="XM_456745.1"
                     /db_xref="GeneID:2899390"
     CDS             804166..807750
                     /locus_tag="DEHA2A09526g"
                     /note="weakly similar to uniprot|Q5YCZ3 Candida albicans
                     BNI4"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09526p"
                     /protein_id="XP_456745.2"
                     /db_xref="GeneID:2899390"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH4"
                     /translation="MSGSGISNQDNFEDFLLSNQFYVGPSNSQNHITNLRKSVQIPNS
                     MSNTSIHAGLSNESVGANQQRTSIMKVSPSMKALESILSEKNNSAPAIVSERIVEEDE
                     DQGQFPPSSGLSANYTTEDPNRGSTYSVQTFETAHSENSFSDTINMNANESLHKSQKS
                     MSTIDDGYNTNDDTPVLVNPAQFQTFTQVNGSNKNSIHPIRVVHESSVEDLDGQSTDV
                     SNGTLDNKDIEQDDTLVGNEGVLKSQYEQQQQKFKQRQKELVEEQRIQRELQQKEAEI
                     QELKKQRDAQEQRKQKEFFELEQKKHEQQTITNPVSSLLLPETGKAVKKPAVKQQEKG
                     SSINTTTAYPEPLKRSPHTRSNSTFSLSFTKNKEQPPLPGTHKRSSTFSDLSAVSKGA
                     EKPSTAKRFSFKNLFKSRSKTTKNEDDDLVSKPRKLSSKSYSTPNIAGFNNEPNVIEG
                     AKKMTTTNKNRKSEKVVSGSYDKQSPLPQPPQEKPSHKPSMSSSASLLSVFKKDKTSE
                     ISSKSIKSENQEQVSKKAKPNQNDVEEEEEEEEEEEEEEEEVTPTTNFLNKNPSNSIP
                     NVNFIREVNDDDYNPNKNYPTPTITETNYDNNNIISNHNSQTLKSKEVEASNDELLIP
                     ESDTLLNNDSLFGSPFKVDYRPSTNTPKLETPHNKLTSLSKEEKSKAKPDVNDQLLGE
                     TLFPKSLSVQEVESIVSLERSRSMRSIKSNKRNSFINYDGSDENIIQYGGTRTNSPNL
                     DSTNMSRSNSILKNSNSKKNLNVENMNSINAQMLNDESMENYDDLIEFTDYIDLDNLD
                     FSISPKEIVEKSPVIMSSSPSLLSEKFDSFQQKNQQPLMNGYVDNKLSGSSDKEFDSS
                     SIQEIPPPVGYLRPSEAPPIILNTPPPSQDDDPEQHILLSQTDEEQAKVPVEEIESNE
                     PVQGPLTPNLEIINATQIPESPESINDSAEPTNLVEKSPILATSYQNSPMVNENGKNI
                     MNNRPISMSFRGLKGPSFGGKLAMHDLRSSDSHQSFNMSFGDEEVDEEENSHEARVSE
                     VGGGFGSSDEEDDDSFDRAEDKENEYSNPVIAHQQVSSKFGQENNFSPLAPPHPLPIF
                     THNKIPSISSNSSSPKSFSSMFSRKFKKSPTIQSSARAAAIKNEVRFSSRIILYDTYN
                     CDEYDRHPDNATCNQLTPALAQQIKDELNDFKSEMSIHEHSRCHTHFF"
     gene            complement(<807895..>808131)
                     /locus_tag="DEHA2A09548g"
                     /db_xref="GeneID:2899391"
     mRNA            complement(<807895..>808131)
                     /locus_tag="DEHA2A09548g"
                     /product="DEHA2A09548p"
                     /transcript_id="XM_456746.1"
                     /db_xref="GeneID:2899391"
     CDS             complement(807895..808131)
                     /locus_tag="DEHA2A09548g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09548p"
                     /protein_id="XP_456746.1"
                     /db_xref="GeneID:2899391"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH3"
                     /translation="MSEYPEYINGEPPVITLEEYDVAPWGKTTCVDSRPDGYVIVIME
                     KPEVVVARIDKSGDETLDKIFRSAKQTHAEQSAK"
     gene            <808318..>809214
                     /locus_tag="DEHA2A09570g"
                     /db_xref="GeneID:2899539"
     mRNA            <808318..>809214
                     /locus_tag="DEHA2A09570g"
                     /product="DEHA2A09570p"
                     /transcript_id="XM_456747.1"
                     /db_xref="GeneID:2899539"
     CDS             808318..809214
                     /locus_tag="DEHA2A09570g"
                     /note="similar to uniprot|P53859 Saccharomyces cerevisiae
                     YNL232W CSL4 Subunit of the exosome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09570p"
                     /protein_id="XP_456747.2"
                     /db_xref="GeneID:2899539"
                     /db_xref="GOA:Q6BYH2"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH2"
                     /translation="MPHEQKFAIPGQYIIPTHKVAAEKVVEKYVPGKGTTISSIDVEA
                     DQVKSIPVIVATIIGKIVIREIVVSDKEDEKDEADSKDSHIKIKNFVVNVIPKSNTYM
                     QYQEEVGEEAIPEVGNISINLPQEGDVVLARITRLNPRQAFCEILTVEGHGNVLNDSG
                     LGANGENAHRSIPAGGGSQSLSSHTTIASQASSINAVASDLGETFKGIIRTQDVRSTD
                     RDRVKIIECFKPGDIVRAVIISLGDGSNYYLSTAKNDLGVVFARSEGGAGGLMYAVDW
                     QNMICPETGVIEKRKCAKPFTS"
     gene            complement(<809310..>810356)
                     /locus_tag="DEHA2A09592g"
                     /db_xref="GeneID:2899540"
     mRNA            complement(<809310..>810356)
                     /locus_tag="DEHA2A09592g"
                     /product="DEHA2A09592p"
                     /transcript_id="XM_456748.1"
                     /db_xref="GeneID:2899540"
     CDS             complement(809310..810356)
                     /locus_tag="DEHA2A09592g"
                     /note="similar to uniprot|P53860 Saccharomyces cerevisiae
                     YNL231C PDR16 Phosphatidylinositol transfer protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09592p"
                     /protein_id="XP_456748.1"
                     /db_xref="GeneID:2899540"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH1"
                     /translation="MFSKLRGKDSKTETKKEQKVLGEKLYLPLTKASSKCTIPEAIGL
                     NGEEQEKYDKVLKYFQQEDFKVAVSEANQKDKDSSKYKELSESEKAWLTRECFLRYLR
                     ATKWHYEDTISRIELTLAWRREFGIAGCYDSENEVNGKLCSPENETGKEVILGYDNDT
                     RPCLYLKPGRQNTKTSLRQVQHMVYMLERVIDYMPSGQDSLALLIDFKASPLGTEGGK
                     IPPVGTGRQVLHILQTHYPERLGKALLTNIPWLGWTFLKIIHPFIDPLTREKLVFDQP
                     FPEYVPIEQLDKDFGGDLNFEYDHEKYWPEMIKIAESNKQKYMKRFENFGSKIGLSEY
                     DLRGESEELVYPVA"
     gene            <810632..>811879
                     /locus_tag="DEHA2A09614g"
                     /db_xref="GeneID:2899541"
     mRNA            <810632..>811879
                     /locus_tag="DEHA2A09614g"
                     /product="DEHA2A09614p"
                     /transcript_id="XM_456749.1"
                     /db_xref="GeneID:2899541"
     CDS             810632..811879
                     /locus_tag="DEHA2A09614g"
                     /note="weakly similar to CA1631|IPF19582 Candida albicans
                     IPF19582"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09614p"
                     /protein_id="XP_456749.2"
                     /db_xref="GeneID:2899541"
                     /db_xref="GOA:Q6BYH0"
                     /db_xref="InterPro:IPR010684"
                     /db_xref="UniProtKB/TrEMBL:Q6BYH0"
                     /translation="MASVDQSYNNPRNRKKVLSLVEIAINKCIQHVAKLEDVGATPFH
                     LLVPVLRRMNAKQLGQIEELSPQITPDSDELWTNLVSKEFPDRPILANSIRTSKVKSK
                     RANLVAPAGRTLMFCNMPMKSLYFQYSDERESFRQDSAERLRKITQRLKKEKSANSIV
                     PVPELLRDPTVRRRRFEGGSGYNRSEASYGPKNSILNKARKETRNRSLMFPNYAQKVK
                     KYDPYEAFKYKDTPSVQPGPPISHSLHQPRQQPRFPKSQQSAQPSTHPAAPRYAPRFN
                     HDRAEISPQLGRPPTIFNGQPIQHSTNMPRPIEPVPKFVSAANSNSSSPKPASPPSHS
                     SLSEPHSPPTSISSSSSPSPRAVSEAIRKRKAEPSIFLTGNRNKRPMRVPRAQMKGSA
                     PSNDSNTQPPNKKITLIKSSIFN"
     gene            complement(<811994..>812941)
                     /locus_tag="DEHA2A09636g"
                     /db_xref="GeneID:2899542"
     mRNA            complement(<811994..>812941)
                     /locus_tag="DEHA2A09636g"
                     /product="DEHA2A09636p"
                     /transcript_id="XM_456750.1"
                     /db_xref="GeneID:2899542"
     CDS             complement(811994..812941)
                     /locus_tag="DEHA2A09636g"
                     /note="similar to uniprot|P38786 Saccharomyces cerevisiae
                     YHR062C RPP1 Subunit of both RNase MRP"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09636p"
                     /protein_id="XP_456750.2"
                     /db_xref="GeneID:2899542"
                     /db_xref="GOA:Q6BYG9"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG9"
                     /translation="MLFDLNVPWPSNNYAATPTSQQITTLLNTITTLGTLGYTHIAIN
                     FTLSENVRFPSNQQDINPIQIKMIKDYFKDNFPRLKLFTRLTLVINDPSQCQGLSKVQ
                     NSFDLIAVQPTSEKGLQLATTNLDIDVISFNMASKLPFFLKHKTIGSALEKGIRFEIC
                     YSPMISGPAGYSIQTANDNMSLSKTALLVRKYFFSNVLQLIRASRSKGLIVSSGATQP
                     LQVRNSSDILILLKTVGLDNSRAKSCVTDNPEKVLVNGRLKIKSYKQTIVVGNDNDKS
                     DILYNNDEEDNVKKTDSAGYKKKLSDSSGGSLLKKQRVK"
     gene            <813131..>813979
                     /locus_tag="DEHA2A09658g"
                     /db_xref="GeneID:2899543"
     mRNA            <813131..>813979
                     /locus_tag="DEHA2A09658g"
                     /product="DEHA2A09658p"
                     /transcript_id="XM_456751.1"
                     /db_xref="GeneID:2899543"
     CDS             813131..813979
                     /locus_tag="DEHA2A09658g"
                     /note="similar to uniprot|P53899 Saccharomyces cerevisiae
                     YNL155W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09658p"
                     /protein_id="XP_456751.2"
                     /db_xref="GeneID:2899543"
                     /db_xref="GOA:Q6BYG8"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG8"
                     /translation="MSQAGVNKNLFVNETKTHPDQGIMNIGKQCHKCQQVDFLPFHCE
                     YCNFTYCSKHRNLESHQCPAKPQEKTRANQQYDATAASLFPDREKDKLKLENSINNAT
                     PKATNILGRNGAQGTVLAKFSKFLRLQKNKKKSDNKVMGIFKKKSVPQARSKVAEMAI
                     LRREAKGDTKVGDTDKIYLWCLYINPKQVSENAEEDIFSNIDVDMEKKAVWVSKQWSV
                     GRALDSIADNLNIVNINNRTRESDERLCICKVNDDDSPAMVETADRCSKALKNADVIY
                     LVRGSI"
     gene            <815000..>816397
                     /locus_tag="DEHA2A09680g"
                     /db_xref="GeneID:2899544"
     mRNA            <815000..>816397
                     /locus_tag="DEHA2A09680g"
                     /product="DEHA2A09680p"
                     /transcript_id="XM_456752.1"
                     /db_xref="GeneID:2899544"
     CDS             815000..816397
                     /locus_tag="DEHA2A09680g"
                     /note="similar to uniprot|P23292 Saccharomyces cerevisiae
                     YNL154C YCK2 membrane-bound casein kinase I or
                     uniprot|P23291 Saccharomyces cerevisiae YHR135C YCK1
                     membrane-bound casein kinase I"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09680p"
                     /protein_id="XP_456752.2"
                     /db_xref="GeneID:2899544"
                     /db_xref="GOA:Q6BYG7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG7"
                     /translation="MSNRAQLSNPAALAAAAASHNPSSSNSSNNSVVGLHYKIGKKIG
                     EGSFGVIFEGTNIINGVAVAIKFEPRKTEAPQLRDEYRTYKHLQGSEGIPSAYYFGQE
                     GLHNILVIDLLGPSLEDLFDWCGRRFSVKTVAQIAIQMLSLIEEVHRHDLIYRDIKPD
                     NFLIGRQGLVDENHVHLVDFGMAKQYRDPRTKQHIPYREKKSLSGTARYMSINTHLGR
                     EQSRRDDLEALGHVFFYFLRGQLPWQGLKAPTNKQKYEKIGDKKRTTPALQLCDGLPR
                     QFAEYLDSVRSLAFDAEPAYEEYRMLFLSILDDLGQACDEDFDWLHLNNGKGWDSSIN
                     KKPNLHGYGHPNPPNERDRRHRDQRRSRQHHASHHPQAPASQQAQPPSTQMTTAQLHQ
                     QKLQHLVNRPLPPIKQESQTGMNANAMDESALKAPQSKNYENTAANRQNQYDQQQMVD
                     DNEETKGFWSKLCCH"
     gene            complement(<817118..>817831)
                     /locus_tag="DEHA2A09702g"
                     /db_xref="GeneID:8998110"
     mRNA            complement(<817118..>817831)
                     /locus_tag="DEHA2A09702g"
                     /product="DEHA2A09702p"
                     /transcript_id="XM_002769973.1"
                     /db_xref="GeneID:8998110"
     CDS             complement(817118..817831)
                     /locus_tag="DEHA2A09702g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09702p"
                     /protein_id="XP_002770019.1"
                     /db_xref="GeneID:8998110"
                     /db_xref="UniProtKB/TrEMBL:B5RSU0"
                     /translation="MSIIEPFVLESSNGSITVDGINQLECFIPESHRFKEKYVKNTME
                     SSNLSIGEQIAYQWTKPETGGFYQNEEFGSLGMKYHLWIDERIEMDDDENFDKAELAE
                     LFTSNSAISSLSHTLFRQNKKIEPTEHNGITTSIIPAIFDCSSDDVDIKCLFFTRNNK
                     YDIQSMLKLQDWENILRITLSQLINDGYVGGKVTVLPSDKSFEISLKLGLALEPKVLE
                     EEYINSKSMKLRETILNEI"
     gene            <818366..>819319
                     /locus_tag="DEHA2A09724g"
                     /db_xref="GeneID:8998060"
     mRNA            <818366..>819319
                     /locus_tag="DEHA2A09724g"
                     /product="DEHA2A09724p"
                     /transcript_id="XM_002769974.1"
                     /db_xref="GeneID:8998060"
     CDS             818366..819319
                     /locus_tag="DEHA2A09724g"
                     /note="weakly similar to uniprot|O94628
                     Schizosaccharomyces pombe SPBC1347"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09724p"
                     /protein_id="XP_002770020.1"
                     /db_xref="GeneID:8998060"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B5RSU1"
                     /translation="MTEDQHKLAIEANIKVFDSKMAEDYDKRDAMQFLSIFFAKSLLE
                     FDVSSPRKTPEESNKLIGDPEQPYNGFSPDKSLPDPHTFGTQFPGSVFKPGMKMMDFA
                     CGTGILTQYFAPYLATNSDQTSDIIGVDINSTFLAKYNEKASHVNATYDGVAMTSYLC
                     DILDPTAQEVVSQFEGSMDLITCTLSYHHIDNYEKVTQKLSTFLRPGGWLFIVDFYNE
                     DVETSVSATKSASEAVRHMGGLKVDALNKTLGEYSNLANVSSAREARVYLWQEQPFIE
                     HHLPDEINEKLKNNQLRSKISNGTTVYLVETSLILAIGQKK"
     gene            <819766..>820494
                     /locus_tag="DEHA2A09746g"
                     /db_xref="GeneID:2899547"
     mRNA            <819766..>820494
                     /locus_tag="DEHA2A09746g"
                     /product="DEHA2A09746p"
                     /transcript_id="XM_456755.1"
                     /db_xref="GeneID:2899547"
     CDS             819766..820494
                     /locus_tag="DEHA2A09746g"
                     /note="similar to uniprot|P33296 Saccharomyces cerevisiae
                     YER100W UBC6 Ubiquitin-conjugating enzyme involved in
                     ER-associated protein degradation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09746p"
                     /protein_id="XP_456755.2"
                     /db_xref="GeneID:2899547"
                     /db_xref="GOA:Q6BYG4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /translation="MASRQSQKRLTKEYKAITLNPPPYVSAKPNDENILEWHYVITGP
                     PHTPFEEGQYHGILRFPSEYPFKPPSISMITPNGRFACNTRLCLSMSDYHPDTWNPAW
                     SVATILTGLLSFMTGDESTTGSITTSDNVKKRLARSSKEWNNAENQRFTKQFPDLVAQ
                     NKVDVAARNAREQAAATTDSTDPEKPFDVRENIDSLDPEDRARLLVEQDDHSTPSFGV
                     QRFTLVGVVVAAFIAAYFNFFSRT"
     gene            <821125..>823002
                     /locus_tag="DEHA2A09768g"
                     /db_xref="GeneID:2899548"
     mRNA            <821125..>823002
                     /locus_tag="DEHA2A09768g"
                     /product="DEHA2A09768p"
                     /transcript_id="XM_456756.1"
                     /db_xref="GeneID:2899548"
     CDS             821125..823002
                     /locus_tag="DEHA2A09768g"
                     /note="similar to uniprot|P34226 Saccharomyces cerevisiae
                     YBL061C SKT5 Activator of Chs3p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09768p"
                     /protein_id="XP_456756.2"
                     /db_xref="GeneID:2899548"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG3"
                     /translation="MSSHPYRQKAASTNAPYPVEDYGEPSPPREVGNNHSGHESSGSL
                     GQAPGSGYQTPVQEMDIPAPLGVLGGASNEADGAAGTKAPYPVYESSTPPPVFTQKEP
                     PLMSPNSNPLSTTSSVTNLNLNQNALDSQIFSKSENNLVASAPDFAKFGHNRSVSSTS
                     SFFHDRSDNASMVDFSQNIIQQYLGDNSSQLLPRIKTIELYRKNAKRSNDPSVLFQYA
                     QYMLQTALMLDSTDAGLSSTNTPQGQSIENSPKKGPLEKENNGSSLTLGSDIFKKSHN
                     KSRSAASLDFSGSDINLDDKKLKRALLKEALFYLKKLADKGYVDSQYLLADAYSSGAL
                     GKIENREAFVLFQSAAKHGHVESAYRTSYCYEEGLGTGRDARKAVDYLKMAASKNHPA
                     AMYKLGVYSFYGRMGLSSQVNTKKIGIKWLTRASNVANELIAAAPYELGKIYFNGFQD
                     IVIADKKYALELYAQAAALGHVQSAAILGQCYEFGDILPQDSNLSIHYYTTAALGGDP
                     ESMLAMCAWYLVGSDPYLPKDDTEAFEWAKRAAMCELPKAQFALANFYEKGIGCIKNV
                     HESQHWYQKAAENGDEKSLSRITNKELASSIEKKAKKRFPSSRAPASANGAQEKDCVI
                     M"
     gene            <823903..>824640
                     /locus_tag="DEHA2A09790g"
                     /db_xref="GeneID:2899549"
     mRNA            <823903..>824640
                     /locus_tag="DEHA2A09790g"
                     /product="DEHA2A09790p"
                     /transcript_id="XM_456757.1"
                     /db_xref="GeneID:2899549"
     CDS             823903..824640
                     /locus_tag="DEHA2A09790g"
                     /note="weakly similar to CA5650|IPF7109 Candida albicans
                     IPF7109"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09790p"
                     /protein_id="XP_456757.1"
                     /db_xref="GeneID:2899549"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG2"
                     /translation="MSANDFYSSGDQGSYEPRRDQQQGQQGQQGQQGQQGQQGEDGDR
                     GLISTLAGGSIGAFGGSKLGGNHSTLGGIGGAIAGAIGANKVEDRFENHGSSNNNHGH
                     SQQGGGLMSGLSSFLGGDKHEGRNDGYGGSQGGYGGNQGGYGGSHSGRHDGGRHEGGR
                     HEGGYGGGQGGFGSGNNGGNQGGYGGGQGGYSGGQGGYGGGQGGYGGGQGGYGGGQGG
                     YGGGQGGYGGGQGGYGGGQGGNQGGRW"
     gene            complement(<824797..>827577)
                     /locus_tag="DEHA2A09812g"
                     /db_xref="GeneID:8998068"
     mRNA            complement(<824797..>827577)
                     /locus_tag="DEHA2A09812g"
                     /product="DEHA2A09812p"
                     /transcript_id="XM_002769975.1"
                     /db_xref="GeneID:8998068"
     CDS             complement(824797..827577)
                     /locus_tag="DEHA2A09812g"
                     /note="weakly similar to uniprot|P53086 Saccharomyces
                     cerevisiae YGL216W KIP3 Kinesin-related motor protein
                     involved in mitotic spindle positioning"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09812p"
                     /protein_id="XP_002770021.1"
                     /db_xref="GeneID:8998068"
                     /db_xref="GOA:B5RSU2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:B5RSU2"
                     /translation="MNATGTVASSSGLNSSRESSITVAVRVRPFTPGEENNLIKLNNE
                     EFFLGDGSLSTNNAATDTPSKKSNLMPRGIRKIINVVDDRMLIFDPPETNPLIQMQRN
                     AFPNTKATSRIREHRFVFDKLFDIQATQEDVYNNTTRPLLDSVLDGFNATVFAYGATG
                     CGKTHTISGTPLDPGVIFLTMKELYEKIEGLADTKLFDVSMSFLEIYNETIRDLLNPE
                     TNFKRLVLREDANKKISVSNLSSHKPKSVQEVMDLILVGNQNRTSSPTEANATSSRSH
                     AVLQINVVQRNRTADISEEHTYATLSIIDLAGSERAAATKNRGARLNEGANINKSLLA
                     LGNCINALCDPRRRNHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSQHYDETLNTL
                     KYADRAKEIKTKLIRNQHNLDRHVGSYLKMITQQKQEIEDLRAREQKVVESTIAKQNT
                     LSQKCLNVTMDNISNLKASLSKQHQEKWKKYFFLAKRKLLLLQKLEMESLVKYLHKLS
                     KSGNINGFQNIVNLSEQLISKITTGISDLESQYSRPNEIDYIFNESTLQMLKKLKEQE
                     GWSDHNTVVFDSLVACLRDSLEREILFNSSILFDHLVHEIRGFDFFPKSFIDMLATYS
                     HSEKENMHEYTTASLSNAINGLTKTLEEILDGEYDTAIENVTSSFMQRKLKEQEMQAN
                     KVNNHSIDPSIVIPKPRDCKRGSNSPLKSSPPRDFKKSITKKNGSSISPAMLQKQGKK
                     VRWDVPNQDSTLAESDVSIDEQNTILKSDYEDDSPIGNNIIDKTNMIDDLDLKFDPTL
                     DSPPLAQLLKDSMNRSLMADLSKGRNKHRKFQPLTNRKLSTNENSEPLTKLPLLNKQA
                     STKITNSMQPTTPNEVPESSPNYLPGTQTNTKFKMNTLGAPSRVINRYNTYVEDDEDS
                     RDIESNGSEKVE"
     gene            <827864..>829213
                     /locus_tag="DEHA2A09834g"
                     /db_xref="GeneID:2899551"
     mRNA            <827864..>829213
                     /locus_tag="DEHA2A09834g"
                     /product="DEHA2A09834p"
                     /transcript_id="XM_456759.2"
                     /db_xref="GeneID:2899551"
     CDS             827864..829213
                     /locus_tag="DEHA2A09834g"
                     /note="similar to uniprot|P40501 Saccharomyces cerevisiae
                     YIL088C AVT7"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09834p"
                     /protein_id="XP_456759.2"
                     /db_xref="GeneID:2899551"
                     /db_xref="GOA:Q6BYG0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6BYG0"
                     /translation="MPTVDLHQGASMVSSAINLMKTIIGAGLLSMPYTYSTDGSIIGT
                     VIILLAALTSGYGLFLQGYVSKYAPLGHATFFNICSITYPSLSVVFDIAIAVQCFGCA
                     ISYLVLIGDLMPTIITSISFVSDEHYRTFWILVSTVICVPLSFMKNLSSLQYTSILGL
                     VAIFYMALLVITHFLIDDIPDSSKGEIKLFPPNILGMFSTFSIAVFAFTGHQNMFSII
                     NEAKDKSLKSITELINIAIIVSSVLFIVVGLAGYSTFGDKVNGNVILSYPNSWTTTLG
                     RLCIVFMVVFSFPLMLHPARISVNNIYHTVYSKIMEKEDHGDTDDETTALLDDASQEI
                     HESGSVSEDLSMKTTIVPFSRNVFLAITTILLITGYTFAITIKSFAFVLAIIGATGST
                     AISFILPGLFGYKLIGSEVDYPSKTDLLLKSCSLALVIWGFGVMFLCLYTTLFMDSY"
     gene            complement(<829411..>830565)
                     /locus_tag="DEHA2A09856g"
                     /db_xref="GeneID:2899552"
     mRNA            complement(<829411..>830565)
                     /locus_tag="DEHA2A09856g"
                     /product="DEHA2A09856p"
                     /transcript_id="XM_456760.1"
                     /db_xref="GeneID:2899552"
     CDS             complement(829411..830565)
                     /locus_tag="DEHA2A09856g"
                     /note="similar to CA5652|IPF19815 Candida albicans
                     IPF19815"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09856p"
                     /protein_id="XP_456760.2"
                     /db_xref="GeneID:2899552"
                     /db_xref="GOA:Q6BYF9"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF9"
                     /translation="MSSSSQTKPVDTSPIIKKHNEKYHNSYLAMVERNQIPLSRALLC
                     GIHLFNYIFPGGFASKFIRLQHRTGTSYSGSALYDIGIDDGYYIVHWVILLTFLRSFL
                     MQWCFEPFASYFCNIHSRKAKVRFSEQSWSFVYYSFSFTYGAYLYYNSSYWLNFDQIF
                     ANWPHYQLGSLFKKYYLISMGFWLQQIFVLNIEERRKDHFQMFSHHIITCLLLTGSYY
                     YYYNRIGHLILMIMDSVDIFLAAAKLLKYSGYNNACDYMFVFFMVSWVVLRHGLYNYL
                     FYQSWHNASSLMSNSECIPGQFQKRCWTPTILNSFFFLLGGLQVITMIWMYLISKVAY
                     KVISGKGAEDVRSDEDDSDYEEDSNIAPDGHHSSNKRRDYPNIGSDINIK"
     gene            complement(<830893..>831996)
                     /locus_tag="DEHA2A09878g"
                     /db_xref="GeneID:2899553"
     mRNA            complement(join(<830893..831752,831819..>831996))
                     /locus_tag="DEHA2A09878g"
                     /product="DEHA2A09878p"
                     /transcript_id="XM_456761.1"
                     /db_xref="GeneID:2899553"
     CDS             complement(join(830893..831752,831819..831996))
                     /locus_tag="DEHA2A09878g"
                     /note="similar to uniprot|P47821 Saccharomyces cerevisiae
                     YNL025C SSN8 Component of RNA polymerase II holoenzyme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09878p"
                     /protein_id="XP_456761.2"
                     /db_xref="GeneID:2899553"
                     /db_xref="GOA:Q6BYF8"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="InterPro:IPR028367"
                     /translation="MSADFWSSSQRNRWQLTRHSLLESRRKLLLLEKKMIQNGFIKDY
                     PNVEYDANTRIYLHNLLIKLGRRLNVRQIALATAEIYMSRFLIKVSLKEINVYLLVTT
                     CLYAACKIEECPQHIRLITSEARNLWPEYIPQDVTKLAEFEFYLIEEMDSFLVLHHPY
                     RSLLQIRDYLNENFALYGFSLSDDELQNSWSLINDSYITDLHLLLPPHIIAIATIYIT
                     IVLKKNISSLRLGANSMSNDTVGMDPHTKPNSNSIHAEDLMALATGGSAINDIGNPSS
                     GTNGFHDIELDENTIKINKFMTFLDHSHVNLNEVVEAIQDIITLYAIWNRYNEMSVKK
                     VLQDMLLNRSV"
     gene            complement(<832241..>833001)
                     /locus_tag="DEHA2A09900g"
                     /db_xref="GeneID:2899554"
     mRNA            complement(join(<832241..832461,832523..832722,
                     832775..832826,832908..832920,832978..>833001))
                     /locus_tag="DEHA2A09900g"
                     /product="DEHA2A09900p"
                     /transcript_id="XM_456762.1"
                     /db_xref="GeneID:2899554"
     CDS             complement(join(832241..832461,832523..832722,
                     832775..832826,832908..832920,832978..833001))
                     /locus_tag="DEHA2A09900g"
                     /note="similar to uniprot|P14832 Saccharomyces cerevisiae
                     YDR155C CPR1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09900p"
                     /protein_id="XP_456762.1"
                     /db_xref="GeneID:2899554"
                     /db_xref="GOA:Q6BYF7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF7"
                     /translation="MNPVVFLDVNKGDVPLGRIKLKLFASELPKTCENFRQFCTGEYR
                     ENNRPKGYKGCTFHRVVKGFMIQGGDFVRGNGLGSISIYGGNTFDDEGFPYDHKKYSV
                     SMANSGPNSNGCQFFICCKEVPHLDGKHVVFGEVVEGFDIVDQIEKTKVGVLDKPYPD
                     ITITNCGEM"
     gene            <833131..>834171
                     /locus_tag="DEHA2A09922g"
                     /db_xref="GeneID:2899555"
     mRNA            <833131..>834171
                     /locus_tag="DEHA2A09922g"
                     /product="DEHA2A09922p"
                     /transcript_id="XM_456763.1"
                     /db_xref="GeneID:2899555"
     CDS             833131..834171
                     /locus_tag="DEHA2A09922g"
                     /note="similar to uniprot|P40506 Saccharomyces cerevisiae
                     YIL083C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09922p"
                     /protein_id="XP_456763.2"
                     /db_xref="GeneID:2899555"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF6"
                     /translation="MTPKSPQQKKYHTSNPIAETAIDRTIPDLPIAQLSDEDKYFRTH
                     QAPPYLSEIEQQVTAFIEFHAANTGKRIALVTSGGTTVPLENNTVRFIDNFSAGTRGA
                     TSAEYFLENGYAVIFLHREFSLLPYSRHYSHTTNCFLDYMTEVNNKVEINPDFADEML
                     VVLRKYKEAKESQSLLLIPFTNVNQYLYTLKLMAILLQKIEDKALFYLAAAVSDFFLP
                     QSRMPQHKIQSQAAGKLIIDLEQVPKFLRRLVDNWAPSAMIVSFKLETDHSILIEKSK
                     GALERYQHQLVIGNLLQTRKKEVVFVHSDGSELWIKLTDKQKEDHMDIEGLIIPAVIK
                     EHSEWVVKHHSK"
     gene            complement(<834240..>835697)
                     /locus_tag="DEHA2A09944g"
                     /db_xref="GeneID:8998070"
     mRNA            complement(<834240..>835697)
                     /locus_tag="DEHA2A09944g"
                     /product="DEHA2A09944p"
                     /transcript_id="XM_002769976.1"
                     /db_xref="GeneID:8998070"
     CDS             complement(834240..835697)
                     /locus_tag="DEHA2A09944g"
                     /note="similar to CA5656|IPF14683 Candida albicans
                     IPF14683"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09944p"
                     /protein_id="XP_002770022.1"
                     /db_xref="GeneID:8998070"
                     /db_xref="GOA:B5RSU3"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:B5RSU3"
                     /translation="MSLEHDDQMIDRLSSNFQEVKSKEEKTLEELQHSKQELMTKQNK
                     EFLEELFKDNASTPINIKNIQVTNSQSFRNTFLQKQLQPLLSNNLTTLTKLTENIDQV
                     THNFTKLGLVENLLVSLNPIPKTYFNRGKPSIDLVPIFNIIPVKRFYAKTGTNIGNGE
                     GDGYIQFQIKNIFGGAENLTFDAITGTRTQSSYLLNYNQPIFNNANYIWENLAYLNVK
                     KLHWLNSDLDVKGITNKIYTQYKSPINHELILENCWRCLTNNQSKSLDVLNQSGNNFK
                     SSIMYNWRYETRNNMHLPTSGKFIRLGIEYSGLWSFNSSHFIKSVMESQFAYKFNKLH
                     SVILSCKSGLIFSTDNATPLLDRFYIGGPNDVRAFTLNGLGPKNYNSSIGGDVFLNGG
                     ISLISKFPRVSDDSNFKIHNFINFGKLLPLDKSKTSLETVKNLTTEFSVGYGFGVLYN
                     HPMARFELNFVLPIASHERDYIRKGLQYGIGISFL"
     gene            complement(<836219..>838000)
                     /locus_tag="DEHA2A09966g"
                     /db_xref="GeneID:2899558"
     mRNA            complement(<836219..>838000)
                     /locus_tag="DEHA2A09966g"
                     /product="DEHA2A09966p"
                     /transcript_id="XM_456764.1"
                     /db_xref="GeneID:2899558"
     CDS             complement(836219..838000)
                     /locus_tag="DEHA2A09966g"
                     /note="some similarities with CA5657|IPF14682 Candida
                     albicans IPF14682"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09966p"
                     /protein_id="XP_456764.2"
                     /db_xref="GeneID:2899558"
                     /db_xref="GOA:Q6BYF5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF5"
                     /translation="MSNEIKSEEDQLYDILNLSPPVDIKLNSPINMAGQGHYNPVGES
                     QYPKPENEDLFIKPVMGVPVNALPMQPAMQSGSQGTSHTNSNSSISAGKNQHNGEMYD
                     GMFNKNVNLNLGNNAGMSLNSNNLQQLNGELLSPPNMFGNSSHLHPQSPSVYSSHSLY
                     SDTSSNPGSPYIDAASHFSNAYSDMPQPPRQQVQYLDSNNQGHFNTFDTEIALGGSIS
                     STNLMGMSENHIQQPVPQFNYSVTQAYNGHPEQYNGNNNLASNNHNYNYQQNINSMNK
                     LTENNLINYNTMQEESQREVSISIEQAPEEVAAKTPSLFSNSSHNSSNNSPHKPNSGN
                     ELIPNYQLTPTSPGSVISDVSDQQSSLLNPDEFQTIKRGRKRNHVAKTSRSRSNSRSG
                     SKSLPQEEDMDDEGGSVVSKNGVVSSREKMLELASPNQSSKRTQKHPSVYACHLCDKR
                     FTRPYNLKSHLRTHTDERPFICNVCGKAFARQHDRKRHEDLHTGEKKFQCKGFLKDGT
                     PYGCGRKFARADALRRHFQTEAGKECIRLLVEEDEKDRGDGPPRDPGSIGEAGMSNEY
                     LSPTSALISSTTNSMHSIPQVAISPPD"
     gene            complement(<838758..>840005)
                     /locus_tag="DEHA2A09988g"
                     /db_xref="GeneID:2899559"
     mRNA            complement(<838758..>840005)
                     /locus_tag="DEHA2A09988g"
                     /product="DEHA2A09988p"
                     /transcript_id="XM_456765.1"
                     /db_xref="GeneID:2899559"
     CDS             complement(838758..840005)
                     /locus_tag="DEHA2A09988g"
                     /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
                     YML005W TRM12"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A09988p"
                     /protein_id="XP_456765.2"
                     /db_xref="GeneID:2899559"
                     /db_xref="GOA:Q6BYF4"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF4"
                     /translation="MMTRCIVVGIENSTHIKPVKVFLEELGLFNRNKKINRSGNLHQL
                     YTTCKKIEELEGIPRNDVEIGYYEKEESDKSTLEGVVRGFLTNMGFGGNVEKLLEHLP
                     KKWSVYPPMILLNSGTFDSDVWRGFFEDGGLKDEFFGYVLSSGVFPAGLTHIAVNKPI
                     IEQDIMRRPFNILPVYGDFGPEPTEEMFDSPSEQDFEQAFWCSAVQNGIYQTWAPRYT
                     MFSRGNIKEKKRVLEQCKDANKKCVFDLYAGIGYFTLSYLKNGATVFCWEINPWSIKG
                     LIKSVSKNGYSYKLIRRQESLDHASYNKYDKDGVSVYIFHESNEYAMDRYSQIGKTLP
                     LAHINLGLLPTSTPSWSITKALTRKSSTSTVIHVHENVHVEDFAQVGQKVADYFEGNV
                     VAINKVKTFAPDIWHVVIDVSLD"
     gene            <840463..>841854
                     /locus_tag="DEHA2A10010g"
                     /db_xref="GeneID:2899560"
     mRNA            <840463..>841854
                     /locus_tag="DEHA2A10010g"
                     /product="DEHA2A10010p"
                     /transcript_id="XM_456766.1"
                     /db_xref="GeneID:2899560"
     CDS             840463..841854
                     /locus_tag="DEHA2A10010g"
                     /note="similar to uniprot|P32588 Saccharomyces cerevisiae
                     YNL016W PUB1 Poly(A)+ RNA-binding protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10010p"
                     /protein_id="XP_456766.1"
                     /db_xref="GeneID:2899560"
                     /db_xref="GOA:Q6BYF3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF3"
                     /translation="MSDQPSTEPVKHTEAAEQPTVEPQAQESEEQEVSESPVPVSEEE
                     HSASEEQPNEQPNEQQQQQQPHAGQQAQQQKANEQAVDTNPASAVEGGREVSNKILYV
                     GGLHKSVSDEMLKDLFAVAGAIQSVKILNDKNRPGFNYAFIEFENTQSADMALHTLNG
                     RIINNSEIKINWAYQSSTISSLNPDEPTFNIFVGDLSPEVDDETLNKSFSKFPSLKQA
                     HVMWDMQTSRSRGYGFVSFGQQADAELALQTMNGEWISGRAIRCNWASHKQLNNNNNY
                     RNNNRHHQNNRQFRPFNNAIPQQLQNQNNGMPIGNGQFNPNQQGNMPPSQQQLHNVPQ
                     ANNSNNGNQANIPVMSPQSYDIVLRQTPSWQTTVYLGNIAHFTQQTDLIPLLQNFGFI
                     VDFKFHPERGCAFVKYDSHERAALAIVQLAGFTINGRPLKCGWGKDRPPMGQFQNFGR
                     GVPPPPMYNQGRP"
     gene            <842244..>844466
                     /locus_tag="DEHA2A10032g"
                     /db_xref="GeneID:2899590"
     mRNA            <842244..>844466
                     /locus_tag="DEHA2A10032g"
                     /product="DEHA2A10032p"
                     /transcript_id="XM_456767.1"
                     /db_xref="GeneID:2899590"
     CDS             842244..844466
                     /locus_tag="DEHA2A10032g"
                     /note="weakly similar to uniprot|P25037 Saccharomyces
                     cerevisiae YDL122W UBP1 Ubiquitin-specific protease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10032p"
                     /protein_id="XP_456767.2"
                     /db_xref="GeneID:2899590"
                     /db_xref="GOA:Q6BYF2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF2"
                     /translation="MTSYISKESIAFFVLIIIFVVPLLDQTLLDKVLPVTFFNNIIPG
                     GNINSISKFIKSNRLPLSTASTLVLLSIVLSVYYGRHPLSYSLPEFVNRAFSNMNSGY
                     RYMTSNKSRFGPSRQSRETRFAVKNGGELGGISNDGNTCFMNSVLQSLASSKHLLKFI
                     DSYLYSEIEISGEPTPTTVKSNTPKPDLVFTAALRRFLEGINGSYGSRGKEFSAKPLL
                     NKMPNGPKQNFFTGYNQEDAQEFYQLVMNLVETEYKKDSKSRQSSPEPDSSEKSPSDK
                     FVDSALVPNLISGCEELGRLGKVYVPASQVDPNLLEIDHKVYPLDLVTPVDGISVERI
                     GCLACGEVGGIRYSVNSGLSLNLPNKSSYSGYDLDSLMNDWIAPEIIEDVNCNRCGLV
                     QTKAFLLSKISEANNEKIIGQFQNRADEIEKELLQPHITDEVFEKLSIKQMIRKTKKS
                     KQISLSRPPPLLTIHINRSVFDPKTYMIVKNPSNVSFPSRLDLTSYVTEPKDINMDAR
                     LPFRKQDERTINIPLADINKPSNSSESESSNTVSMSDQDNFEDKELSQSDRYSNSTSD
                     SSENQDNCIALNPKLLYNLKAVISHFGTHNYGHYICYRRLRGSWWRISDESVYVVTEN
                     EVLNSQGTFMLFYEYNDGVNEILQHLDDDEEEDQESESAHGNSQCALDSESYEKNNTP
                     TKLEDDDYLNNRDDDDSQSSGLSDDGDIGLPNENLDSERNGNLSMDDYNVEEGRAFHI
                     "
     gene            <844650..>845618
                     /locus_tag="DEHA2A10054g"
                     /db_xref="GeneID:2899591"
     mRNA            <844650..>845618
                     /locus_tag="DEHA2A10054g"
                     /product="DEHA2A10054p"
                     /transcript_id="XM_456768.1"
                     /db_xref="GeneID:2899591"
     CDS             844650..845618
                     /locus_tag="DEHA2A10054g"
                     /note="similar to uniprot|P40493 Saccharomyces cerevisiae
                     YIL096C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10054p"
                     /protein_id="XP_456768.1"
                     /db_xref="GeneID:2899591"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:Q6BYF1"
                     /translation="MAKKLKGKLVNSKGLKGALARLTTKEEIIKKTEKSMEIQKDKQA
                     LKEKSIKSGKRNKKKAQNQQIQQKGLQPFNIDDKLLLVGEGDFSFAVSIIKENFIKPE
                     NLIATSFDSKDEIIQKYPTVEQNLNFLIDEGVQLLHSIDATDLVSSLKLNTTAKNKKK
                     AKARLFSDNRNLDYIMFNFPHTGKGIKDVDRNIIDHQKLVLNYFKSCRAVFNLVNNDM
                     ENDFAGYASSAVNENKGKILLTLFEGEPYTSWNIKILGRSEDYKVERSGKFSWQMFPD
                     YHHRRTNSVRDTTKPASERDARIYVFEQFTKKDDKRKKTDDSDSDN"
     gene            complement(<845724..>847259)
                     /locus_tag="DEHA2A10076g"
                     /db_xref="GeneID:2899592"
     mRNA            complement(<845724..>847259)
                     /locus_tag="DEHA2A10076g"
                     /product="DEHA2A10076p"
                     /transcript_id="XM_456769.1"
                     /db_xref="GeneID:2899592"
     CDS             complement(845724..847259)
                     /locus_tag="DEHA2A10076g"
                     /note="similar to uniprot|P40492 Saccharomyces cerevisiae
                     YIL097W FYV10"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10076p"
                     /protein_id="XP_456769.2"
                     /db_xref="GeneID:2899592"
                     /db_xref="GOA:Q6BYF0"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR024964"
                     /translation="MSEPTVNFHIQTRLTEFKIPTELIKKNFKAVQKQIEKQKKSIGE
                     DVAKVKKNNKLPTAMKIEMINKLIKSFEIFQKRLRTSINRDEVFRSRIIARLENLSEL
                     ANYTVKTNVVLESNASPIDSDDNRDESSVTPKSMEDEDRPLDLHNVNLINWYRDQTNL
                     LIIDYLIKSNTRSDQNIGLQLLKSISQTNPKFTKLIDYDLYDNFNKVFVSIIENHDLS
                     LVIAWFNENRSFLKKANSNLEFEINYCKFLSLIEEGDVNEAIKFSQVNLSPYGNKGNY
                     QSQEFMNHESNLNKLKEIGGLLVYMAINEKANAQIDKSIPFSSSLVINSPRFKEYKKL
                     LSNERWDSLSQCFIENFTKLYGISRNYPLFIYLSAGLSSLKTKSCYCNTENTIFKQYE
                     ESSESNKNIYKKDLAVLTDKKYRGPNKYYKLLNKINHCPVCSPELYKLSKNLPYAQLI
                     TSIFNNPFKLPNGNIYPFDKLLNPSEKYLSEKNTLLRMGKIKDPLTREIFLIDDCVRV
                     YPA"
     gene            complement(<847519..>849966)
                     /locus_tag="DEHA2A10098g"
                     /db_xref="GeneID:2899593"
     mRNA            complement(<847519..>849966)
                     /locus_tag="DEHA2A10098g"
                     /product="DEHA2A10098p"
                     /transcript_id="XM_456770.1"
                     /db_xref="GeneID:2899593"
     CDS             complement(847519..849966)
                     /locus_tag="DEHA2A10098g"
                     /note="some similarities with uniprot|P40009 Saccharomyces
                     cerevisiae YER005W YND1 Yeast Nucleoside Diphosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10098p"
                     /protein_id="XP_456770.2"
                     /db_xref="GeneID:2899593"
                     /db_xref="GOA:Q6BYE9"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE9"
                     /translation="MDFLEPRKQKKVITPGPIESKEGIPYDYIVVIDAGSKGSRVYVY
                     NWLNPVHILQNDIDLNDIADNRELKLVRRFFINSIGGRDNDEDSDSENEDNEENHNTD
                     KEKEKGKEKDKEKSKEKGKDRDKGKYKDKDNKTGKGGDQDKEKDKPKEPENENTRRLP
                     LVGAKKKWNKKIKPGISSFNSSPQKIGNHHLKHLLQLASIVVPKSQHSRTPIFLHSTG
                     GMRLLPPIEQQQILDNICKYITHNSDFFIPECSTHVNVIDGDVEGLYGWLSINYLIGA
                     LDNPQNHQHGKNHTTYGLLDMGGASTQVVFQPNFTEIEEHDKNLFKVKLVELPTPISG
                     EQKKEQTGKNEDSIGSFNTPSDLNFDIYSDSFLGFGMYQAHNRYLSFLTEKYTEEHEL
                     NKPAYYGRSHTPVPDPCLPKGYTTTSVINDDSVHFTGESDFNKCLTSIFPVLHNSTHN
                     AGSGKDENCKEFKDSDESSSCLLNDLIPAFDFDVNHFVGVSGYWDAITNLLSYEDKSA
                     RNLARSSDKKPGGKDAADTYDYKVIYNATSKLCSQSFSRLIELNNVRPEKNQMAEEEL
                     SDLCFKSSWILNFLHLGLGFPRFGIDKHATENSRFKSLELVERLGGSSFSWTLGRAIL
                     YANDEYVQAFNNFTADTIGLSEEDRITSKTNIPRSGFYHSASSSVFHFGAEQSGIFPR
                     PQFNPPVKDAKYTIFDYETDYQPEYKESKWDIEPHRWYGSLVFISLIGFILWLLMGRS
                     GRAALIDKTKNKLNSIFNLVKGRTGNSSYFRLNNDAGNEGDLELADFELNESSHNLHG
                     TSAEEADNQFKIDSDED"
     gene            complement(<851102..>851650)
                     /locus_tag="DEHA2A10120g"
                     /db_xref="GeneID:2899594"
     mRNA            complement(<851102..>851650)
                     /locus_tag="DEHA2A10120g"
                     /product="DEHA2A10120p"
                     /transcript_id="XM_456771.1"
                     /db_xref="GeneID:2899594"
     CDS             complement(851102..851650)
                     /locus_tag="DEHA2A10120g"
                     /note="similar to uniprot|P25378 Saccharomyces cerevisiae
                     YCR027C RHB1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10120p"
                     /protein_id="XP_456771.2"
                     /db_xref="GeneID:2899594"
                     /db_xref="GOA:Q6BYE8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE8"
                     /translation="MVKARKLAVVGSRSVGKSSMTVRYVEDHFVESYYPTIENQFSKT
                     INYKNQDYAIEILDTAGQDEFSIMNEKHLIGIHGYLLVYSVTSRQSFELIKVIRDKIL
                     NSIGTDQIPIVLIGNKSDLNYQRQVETEEGQALAKEFGYRFLETSVRDDVNIDTAFES
                     LIDEIEAIQNPTIKQDDKCTIM"
     gene            complement(<851981..>853456)
                     /locus_tag="DEHA2A10142g"
                     /db_xref="GeneID:8998030"
     mRNA            complement(<851981..>853456)
                     /locus_tag="DEHA2A10142g"
                     /product="DEHA2A10142p"
                     /transcript_id="XM_002769977.1"
                     /db_xref="GeneID:8998030"
     CDS             complement(851981..853456)
                     /locus_tag="DEHA2A10142g"
                     /note="similar to uniprot|P38355 Saccharomyces cerevisiae
                     YBR287W ZSP1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10142p"
                     /protein_id="XP_002770023.1"
                     /db_xref="GeneID:8998030"
                     /db_xref="GOA:B5RSU4"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:B5RSU4"
                     /translation="MPQKSLSYQSISYLTFEAILEVVIICFAGFVAAKSGILNTQAQK
                     VISQLNVDLFTPCLVFTKLAPSLSFEKMVDILIIPVFYAVSTGISYGCSQVVGWMLRL
                     NSPETDFITAMAVFGNSNSLPVSLTLSLASTLPNLLWDDIEGDTPDKVASRGILYLLI
                     FQQLGQVLRWSWGYNKLLRKRSQEELDSYSKLNHDDDQERDLDVGDEQRPLLSDPDMR
                     GAHFDTINGVDVDLNNSIAAKNDSKSLSYKPPRTDSSSSISSNGSQSLPEENVFVERI
                     SDDSDANSDQASTGIHKRRARIYQLWYALKRLPVIKEFLAFMNPPLYAMLISVVVACV
                     PALQREFFVDEESFIHNTLSQSIHSLGSVSIPLILIVLGSNLYPSNDMPPPSRHYKRI
                     VVGSLLSRMILPPFILLPIITLCVKFFKVSILDDPIFLIVAFILTISPPAIQLSQITQ
                     LNNIYQKEMSGVLFWGYVVLTLPTTIFIVVTSLEVLKWATT"
     gene            <854499..>856160
                     /locus_tag="DEHA2A10164g"
                     /db_xref="GeneID:2899596"
     mRNA            <854499..>856160
                     /locus_tag="DEHA2A10164g"
                     /product="DEHA2A10164p"
                     /transcript_id="XM_456773.1"
                     /db_xref="GeneID:2899596"
     CDS             854499..856160
                     /locus_tag="DEHA2A10164g"
                     /note="similar to CA3143|IPF8295 Candida albicans IPF8295"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10164p"
                     /protein_id="XP_456773.2"
                     /db_xref="GeneID:2899596"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE6"
                     /translation="MMGHTNTHSSTPSKRIEEAPLKWYNNRNHDDSENESLVNSSFDF
                     DMAGASTPLKMGKMPVGRGTGDISVSFSSPMKKLDNLHLESELDLDEGENHDELGNQT
                     VVGESDTDDEYGPVYGEDYEESSSGATGGTPSESNGHGRQPPRYVNRRKRHLDSPSDI
                     DMETPRQAQMTNTSVRSDMSICLNNSTNNTFKLSFSNSDSTPCPVQPRKKSKLKFKGS
                     PSQQQTPSQTKLTKVKHLLNFENSIKTSVSQNPIMNKLSAMTNHDNDAWTHDDEEDED
                     DEDDYLPRDSLISSPQQTSTLNTTVNSNQNIQSTPISQSTPANSRPPTPSHSPQVPIM
                     DEFGDSINGYKFVKPTRKPQHAYYNYQTPTNKILRSQELKTSYNRNEYDTHSAGNLNN
                     GKYKIVGDLPMSSAGLMDEAEVDLHVGDKRINDPYLQAVSETNSDQERISIRNLYFQS
                     FNSSDLSQLKLPLLTMFRANTMSTEEIVKLINDRQPISSFYEYIKSEDEDVLDLLKRE
                     RLRWHPDKWVSKLRSHLPKENLVINKQVIDSLSQSLNSIIENHKQ"
     gene            complement(<856258..>857052)
                     /locus_tag="DEHA2A10186g"
                     /db_xref="GeneID:2899597"
     mRNA            complement(<856258..>857052)
                     /locus_tag="DEHA2A10186g"
                     /product="DEHA2A10186p"
                     /transcript_id="XM_456774.1"
                     /db_xref="GeneID:2899597"
     CDS             complement(856258..857052)
                     /locus_tag="DEHA2A10186g"
                     /note="highly similar to uniprot|P32447 Saccharomyces
                     cerevisiae YJL115W ASF1 Nucleosome assembly factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10186p"
                     /protein_id="XP_456774.1"
                     /db_xref="GeneID:2899597"
                     /db_xref="GOA:Q6BYE5"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /translation="MSIVSLLGIEVLNNPAKFTDPYEFEITFECLEPLKEDLEWKLTY
                     VGSSRSLDHDQELDSILVGPVPVGINKFLFQADPPSPELIPASELVSVTVILLSCSYA
                     DREFVRVGYYVNNEYDSEELRENPPAKVQVEHVVRNILAEKPRVTRFNIVWDNEDGNA
                     DEYPPEQQVDEEEEEEEEEEEEEDDEEEEEEKDVEGEEGEEGEDAEEAAEVEENGSKE
                     ASKEEDIEEDIEEDIEEDIEEDIEIEDEEEAKNADQGETPIDKVQS"
     gene            <857237..>858118
                     /locus_tag="DEHA2A10208g"
                     /db_xref="GeneID:2899598"
     mRNA            <857237..>858118
                     /locus_tag="DEHA2A10208g"
                     /product="DEHA2A10208p"
                     /transcript_id="XM_456775.2"
                     /db_xref="GeneID:2899598"
     CDS             857237..858118
                     /locus_tag="DEHA2A10208g"
                     /note="weakly similar to CA3680|IPF8395 Candida albicans
                     IPF8395"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10208p"
                     /protein_id="XP_456775.2"
                     /db_xref="GeneID:2899598"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE4"
                     /translation="MSDIPGDGNKVMASDKNMAENQPKSVDENEEEEIHSKLDAKQAD
                     EEPNKQQTEEYNDNEDGREPAHENEDENFKAENDDSDPEIEQGHVDNDAQDPASNKDY
                     AKLFEKYQERFYKVYSVSQKLFQSEVSQRQALSFYQRRNNALIDLLDKFESKEPVSPT
                     TDQVLADSDKSRIENLITMNPRLKEVLAPLLAIDDSQQQFKETHKINLLINEAMPDLI
                     NDDMGNFELNPQDIEPWVRRHYPNLVISKYKPLTISGNKFKETVDTGSTTTTKRKRKS
                     SKDDENEEDPQSKKPKK"
     gene            complement(<858142..>861801)
                     /locus_tag="DEHA2A10230g"
                     /db_xref="GeneID:2899599"
     mRNA            complement(<858142..>861801)
                     /locus_tag="DEHA2A10230g"
                     /product="DEHA2A10230p"
                     /transcript_id="XM_456776.2"
                     /db_xref="GeneID:2899599"
     CDS             complement(858142..861801)
                     /locus_tag="DEHA2A10230g"
                     /note="similar to uniprot|P40061 Saccharomyces cerevisiae
                     YER093C TSC11 Binding Protein of TOR"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10230p"
                     /protein_id="XP_456776.2"
                     /db_xref="GeneID:2899599"
                     /db_xref="GOA:Q6BYE3"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE3"
                     /translation="MNNRINPYTPQDPHPSGSTTSLQDLNNSKQQSSRYNDPRFPREM
                     MRSSKSENDFMNRDNRDRSSTMNSIDSLNINSIENSKMYKVHVDQDDMNELINESPAN
                     IKSPTWLLSDILQSFSSIRDTDEYQIVSKGNDLVSILIKYPHLKNDIVLKSFLNKIQF
                     MLYHDVSEVRATGYRIMRYIISNYESLTMLIQSKILIFIIISLSTNSSLLEKEQALKL
                     IREFLNIPKGTDNLSIGVIKSLIAIIEISEPVANITDNFKKICIETICEIALLRPELI
                     FHSSGFKIIIETIVEDDSIELSGNCILVLMKVLDSENTRKFLRNGHDLNSLVSTFSSI
                     DSGEEDKNIPTFKLQKAAFSLSIILKNWNGLMSFSHNNFACLKDLILNLKKKGPKLRD
                     IIMDIILDMLRIEMLPWLKSSSIGDVIQCFNNYGHNSNYSFEYDEISPESFEFNLINH
                     YLGLIIAILINHGIIDLLIEVIEENSNEANTKKATKLVTHIYSMANNFLPNELLQSKL
                     ILPSLRNECLEHSSTFKIWQSTRRSNEVTQASGFDPSNSSSKKLKLYIKNVSIGSRYN
                     IDDTEFKNMVNNIRILTIKEYEDWNWNLLFSFIQGPLRNPKRFDEILEKNPKFLKRLM
                     SFYRPFKFRFCNMPITHKNFKMYINIGCQLLETYLTLNQGIKYLSSNKLLPQVSEIFA
                     QVDPYSGIVAKEPILSKKRLENTLSIGYVKFIGTLSANSYGLKMLEQWQFINLFHNII
                     EGSRNSESNNYLIINLLNSLDFTIDSQLRIVLSKAIGISNLKIRNFIIDNVIPKLIKI
                     KECEHFVIKLLVNQLYDLDQEISDKSIDLLYDCYLSNDINILNHIISLRPSIVILSKH
                     ASGKMLLMNFMKTSIGFKFLEDSGFIDAEFDKWINLIGFEYVKKIELLIQRRFFPYVS
                     SIAFDEKLPVHFFNYLLQTEEGLVYFQTLKQRNYLENLISNIEMISAKIAENNNDEIS
                     VDDGDEEEEDQSKLINKLKQNLWIIGSIASAKYGIQLLDTAYTNMDKSVVSMILNLFY
                     NSPSWQIRGISFYLIGSIASTIEGIEILDELNWYSVIDKYHNPMKLSYPKDLYTKDIF
                     NVEINNPYRDIKYYSLFSGGDENLETDRLFGDIDDDEFFDHEKIYEKILNLVKHSSSV
                     LNRIARKATKQLMFIKKNSPSVFENRNLFLKIIKLVDRGSYKFSIRKFIFELFLDTKV
                     LENLVKRDKKNINIK"
     gene            <862607..>863518
                     /locus_tag="DEHA2A10252g"
                     /db_xref="GeneID:2899600"
     mRNA            <862607..>863518
                     /locus_tag="DEHA2A10252g"
                     /product="DEHA2A10252p"
                     /transcript_id="XM_456777.1"
                     /db_xref="GeneID:2899600"
     CDS             862607..863518
                     /locus_tag="DEHA2A10252g"
                     /note="similar to uniprot|Q7S346 Neurospora crassa
                     NCU09169"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10252p"
                     /protein_id="XP_456777.2"
                     /db_xref="GeneID:2899600"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE2"
                     /translation="MSKLLVVFGATGQQGSSVVSYVKERMSDKFKIRAITRDPSKPEA
                     KTLQESGVEVVKADLGDKQSIKQAFKGADTIFAMTALNFGGQTELEQGKLIADAAVEE
                     KVPNIIWSTLVNANEISNGEFPHVVHFDEKAEVEKYIRSLPINSSFFSPGCFMQNFLG
                     MLKPQPVGDGKYSMFNVLRPGSEVPFFDTEDTGKFVGAILNEPEKFHGKILYAANGMY
                     SYETIAKIISKDTGKKVNYQQIPGNTFKEQIPEPIAEEITEMFQFFDKYNLYGPETRE
                     KVEWGMSQVSDKLSTFEGFFERNPLGL"
     gene            <864304..>865218
                     /locus_tag="DEHA2A10274g"
                     /db_xref="GeneID:2899601"
     mRNA            <864304..>865218
                     /locus_tag="DEHA2A10274g"
                     /product="DEHA2A10274p"
                     /transcript_id="XM_456778.1"
                     /db_xref="GeneID:2899601"
     CDS             864304..865218
                     /locus_tag="DEHA2A10274g"
                     /note="similar to uniprot|Q7S346 Neurospora crassa
                     NCU09169"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10274p"
                     /protein_id="XP_456778.2"
                     /db_xref="GeneID:2899601"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE1"
                     /translation="MSKILVVFGATGQQGSSVVSYVKERMSDRFKIRAITRDPYKPEA
                     KALEESGVEVVKADLGDKQSIKQAFKGADTIFAMTAVSFGGQTELEQGKIIADAAVEE
                     KVPNIIWSTLPSANEISNGEFTHVVHFDEKAEVEKYIRSLPINSSFFSPGCFMQNFAT
                     SLKPQPVGDGKYTMFNVMRPASEFPFFDTDDTGKFVGAILNEPEKFHGKILYAATDLY
                     SYEVIARIISKDTGKNVNYQQIPANAFREQIPKPIAEEITEMFQYVDKYNHYGSETRE
                     KVEWGKQQVSEKLTTLEEYFKRNPLGLE"
     gene            <869161..>870195
                     /locus_tag="DEHA2A10296g"
                     /db_xref="GeneID:2899605"
     mRNA            <869161..>870195
                     /locus_tag="DEHA2A10296g"
                     /product="DEHA2A10296p"
                     /transcript_id="XM_456779.1"
                     /db_xref="GeneID:2899605"
     CDS             869161..870195
                     /locus_tag="DEHA2A10296g"
                     /note="weakly similar to uniprot|P40463 Saccharomyces
                     cerevisiae YIL135C VHS2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10296p"
                     /protein_id="XP_456779.2"
                     /db_xref="GeneID:2899605"
                     /db_xref="UniProtKB/TrEMBL:Q6BYE0"
                     /translation="MASHNHNRNGLSLFSFKSGSNGSSKSSVKGGESTSPTNRSIENH
                     QLSSPVNSPMLMGDETSDVVSEANSDIFERSVQDSCTDLHSTHSQPKCNRCTTNRSRS
                     CTHNSSLSLQGGLKNEDFIPPAIDATTSILSDEDMNLDDVEMVYSNRRNSSVIGLNMA
                     LGRPFGSSRKSSTYSLQSSQPQAAQQTQSPISPPKLTSSKSSLSFYSYADMISNEEMQ
                     RRPSFKQSYSYSQNSFPLKKKSHVGSIPPPYKKSGQSLLSKELSAKNPSTTASPNQSF
                     SNQNFLISPESSDSEHENYFQGKRKSISSNISSNSKPNNLRFDNDNESLVSSSVGDCL
                     RQSTTEINGN"
     gene            complement(<870603..>871457)
                     /locus_tag="DEHA2A10318g"
                     /db_xref="GeneID:2899606"
     mRNA            complement(<870603..>871457)
                     /locus_tag="DEHA2A10318g"
                     /product="DEHA2A10318p"
                     /transcript_id="XM_456780.1"
                     /db_xref="GeneID:2899606"
     CDS             complement(870603..871457)
                     /locus_tag="DEHA2A10318g"
                     /note="highly similar to uniprot|P53941 Saccharomyces
                     cerevisiae YNL075W IMP4 Component of the SSU processome
                     required for pre-18S rRNA processing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10318p"
                     /protein_id="XP_456780.2"
                     /db_xref="GeneID:2899606"
                     /db_xref="GOA:Q6BYD9"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /translation="MIRKQARERREYLYRKSLELQESSLTEKRQQLKAALASGKPLSK
                     ELAEDKELQKDFIYDESEQTEIDDEYSALSGISEPKVLITTSRNPSVKLLQFSKEIKL
                     MFPNSIKLNRGNYVITDLVATCQRVQISDLIILHEHRGIPTSLTISHFPHGPSIIFTL
                     HNVKLRHDLPEIGNSSESYPHLVFENFTSELGKRVVKIMKHLFPPGVKKDSSRVITFI
                     NNDDFISVRHHMYVKTKDTVELSEVGPRFEMRLYELRLGLLDNKDSEVEWQLRRFIRT
                     GNRKNYLG"
     gene            complement(<871634..>874786)
                     /locus_tag="DEHA2A10340g"
                     /db_xref="GeneID:2899516"
     mRNA            complement(<871634..>874786)
                     /locus_tag="DEHA2A10340g"
                     /product="DEHA2A10340p"
                     /transcript_id="XM_456781.1"
                     /db_xref="GeneID:2899516"
     CDS             complement(871634..874786)
                     /locus_tag="DEHA2A10340g"
                     /note="similar to uniprot|Q9P851 Debaryomyces occidentalis
                     trk1 High-affinity potassium uptake transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10340p"
                     /protein_id="XP_456781.2"
                     /db_xref="GeneID:2899516"
                     /db_xref="GOA:Q6BYD8"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD8"
                     /translation="MNRVSKLWHSYKRHRVHGDTGLKIRNAIHRTTEKVYPYVKVVIP
                     NFRAAHYTYILFMTFLGSVIFYPIRNIRYIDALFFTGCASTQAGLNTVNLNRLALYQQ
                     ILIYIITTLTTPIFIHGSLLFIRLYWFERHFDNIKESSKLNNKMRRNATLAARTQSLD
                     PTRLNTEVNRGLGLNNPQSSGPEPVIDEVAFSNSSSTSPASKHSSPPQNPSINSNNVN
                     HISEPSDTDISSGVAPDSRNPINLSRPESPPRSLDGIRFGNLPQPSKIRQKEIEPSDM
                     YMSIAMLQDNHKSERKDNGDEDDVLIIKSPNEIEKDSQNPIFTKKSQIHFNVNDKPIR
                     KWKKKRRFSRGRQPWSKLKKTFSNSGVSPRKHVRSLSFTSLSNDDDDQSIDSETNNRT
                     TDTDADDDNAIIDDDDDDDEDDGDDDDEDDGDDEDEDDDDEDDEDDDQDDEEDEYNRQ
                     NRHDDNLDDIERAQSNLVIPSSDATGGKKFTKRSNTLDVTPGENHELSHSPTFEKMIK
                     SKMKKKKKPKQTKKQKLKYMKSPTVGLNSSLFSPNYNNGSDYDDSDDSDEDDDDEEED
                     GKSLSKVMSTNYLSWVPTVGRNSTFVHLSEEQKEELGGVEYRAIKLLIKIIVIYYIGF
                     HILAFTCLLPYILYQPVYKADVINVGITPTWWAFFTAQSAFNDLGHTLTPNSMQSFDK
                     SVYVMVIVAFFIVIGNTGFPVMLRFIIWVLFKLSKPMSLFNESLGFLLDHPRRCFTLL
                     FPSVPTWWLFIILVVLNAVDLILFIVLDLNNKYLESTPIGLRVMDGLFQAFSTRTAGF
                     AVVDLSELHPAVQVSYMLMMYISVLPLAISIRRTNVYEEQSLGVYLKDNNDDNDDAPD
                     DKTPRNFIGAHLRNQLSFDLWFIFLGLFIICIAEGPKLNKNNYRFSIFTILFEIISAY
                     GTVGLSLGYPGVDVSLSGEFTVLSKLVMIAMVIRGRHRGLPYALDRAIMLPDDNMQKR
                     DNLQENHAIRRHQTMETSNSLDDGNAFRRAFTRRASSFGFDNTNILGRRKSSVRSSKP
                     KPETPHYIVTTESHEMDDLA"
     gene            complement(<875412..>877055)
                     /locus_tag="DEHA2A10362g"
                     /db_xref="GeneID:2899607"
     mRNA            complement(<875412..>877055)
                     /locus_tag="DEHA2A10362g"
                     /product="DEHA2A10362p"
                     /transcript_id="XM_456782.1"
                     /db_xref="GeneID:2899607"
     CDS             complement(875412..877055)
                     /locus_tag="DEHA2A10362g"
                     /note="weakly similar to uniprot|P38125 Saccharomyces
                     cerevisiae YBR180W DTR1 Multidrug resistance dityrosine
                     transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10362p"
                     /protein_id="XP_456782.2"
                     /db_xref="GeneID:2899607"
                     /db_xref="GOA:Q6BYD7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD7"
                     /translation="MSSRSTSSLESAEESFHESQPNVFNETIPLELTSVTDEAVHRSI
                     SRIQSRRSSNSRLPGQDEDQRIEQHVSPYRDIEKALGDEKSNGSDIDATSKDTKTERF
                     SNRTKKICIFIAAVSGFLSPLSSLAFLPAIPEMAKEYNTTGEIINVSSAVYCVFMSLS
                     PCVFSPFSDIYGRRFSFLVCSCLFSVCSILVAVSPHLAMFFVFRSLTALVGTAFFSIG
                     AHIVGDLYIPTERGTYMSIIIMGAQFGTALGSVGGGIIVNFTSWRVIFFVLAGIGFVV
                     MAMAFVFLPETSLETKHQIVLREARKDNPNKKFVFITYNPLRIMTALKYPNLSIDGFI
                     TISVVFTMYSLLTPIRYVMDPRFDLTSPILSALFYLPPGLGYLVGSLFGGRWADYTVK
                     KYIKIKGRRVPEDRLRTILIPIGVVYPACMIIYGWSVEKEKGGIAVPVIFMFISGVAQ
                     TCIFPAANTYCVDSMPELGGDGIGSSYFSRYIAAAVASATCLRSIDNIGVGWSCTISA
                     FVLWVGAICGIVLIYFGESMRKKALIKYGLRTPESFNTN"
     gene            <880936..>887571
                     /locus_tag="DEHA2A10384g"
                     /db_xref="GeneID:2899610"
     mRNA            <880936..>887571
                     /locus_tag="DEHA2A10384g"
                     /product="DEHA2A10384p"
                     /transcript_id="XM_456785.2"
                     /db_xref="GeneID:2899610"
     CDS             880936..887571
                     /locus_tag="DEHA2A10384g"
                     /note="highly similar to uniprot|P07259 Saccharomyces
                     cerevisiae YJL130C URA2 Multifunctional carbamoylphosphate
                     synthetase-aspartate transcarbamylase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10384p"
                     /protein_id="XP_456785.1"
                     /db_xref="GeneID:2899610"
                     /db_xref="GOA:Q6BYD4"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD4"
                     /translation="MAQISNPITPPMKSTGDRMMTLETQDGIAMQGYSFGAPVAAAGE
                     VVFQTGMVGYPESITDPSYEGQILVITYPLVGNYGVPDRSLKDDDVPELPKYFESNKI
                     HIAGLVVAHYTEEYSHFLAKSSLGQWLQEQGIPAIYGVDTRSLTKRLREKGSTLGRLA
                     LQKASSKSSEIIETSKWEQHFEIPEWDDPNVKNLVAKVSTKEPVLYTPKNDVKVGKNG
                     KPLRILAVDVGMKYNQIRCFIRRGVELKVVPWDYDFSTEEYDGLFISNGPGDPSVMTS
                     TVSTLQKVLEAGKTPVFGICLGHQLLARATGASTLKLKFGNRGHNIPCTSTISGRCYI
                     TSQNHGYAVDTNTLSSGWKELFVNANDSSNEGIYHDSKPYFSVQFHPESTPGPRDTEF
                     LFDVFIQSVVDFNKSGVQKAVEFPGGLLEENRAAHPKVDAKKVLVLGSGGLSIGQAGE
                     FDYSGSQAIKALKEEGIYTVLINPNIATIQTSKGLADKVYFLPVTADFVRKVIKHERP
                     DGIYCTFGGQTALGVGIKLKDEFEGLGVKVLGTPIDTVITTEDRELFSQAMDEINEKC
                     AKSAAANNVSEAIDAANSIGYPLIIRAAYALGGLGSGFADNEQELVALCNKAFATSPQ
                     VLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDY
                     NMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLA
                     YTAAKLGLNIPLNEIKNSVTKSTSACFEPSLDYVVVKIPRWDLKKFTRVSALLSSSMK
                     SVGEVMSIGRTFEEAIQKAIRSTDYQNLGFNKTSALMSIDIDNELQTPSDQRLFAIAN
                     ALSDGYSVEKVWKLTNIDKWFLNKLDGLIKFGNLVTTYGVKENLPVTVLKQAKQLGFE
                     DRQIAKFLNSNEVAIRRLRKEAGVIPFVKQIDTVAAEFPAFTNYLYITYNADSSDVSF
                     DDHGVIVLGSGVYRIGSSVEFDWCAVRAIRTLRENGTKTIMINYNPETVSTDYDEADR
                     LYFETINLERVLDIYDLEQSSGVVISMGGQTSNNIALPLYRQNVKILGTSPEMIDSAE
                     NRYKFSRMLDRIGVDQPAWKELTSIDEAEDFAEKVTYPVLVRPSYVLSGAAMNTVYSR
                     DDLASYLSQAVDVSPDYPVVITKYIENAKEIEMDAVAKDGKMIMHVVSEHVENAGVHS
                     GDATLVVPPQDLDPETVGRIVEATAKIGKALDITGPYNIQFIAKDNDIKVIECNVRAS
                     RSFPFISKVVGTDLIEMATKAIMDMPFTPYPGEKLPEDYCAVKVPQFSFSRLAGADPV
                     LGVEMASTGEVATFGKNKYEAYLKSLISTGFKLPKKNILFSIGSYKEKQELLPSIRKL
                     HELGYKIFATAGTADFIKEHSIPVHYLEVLGEKEDQKSEYSLTQHLANNLIDMYVNLP
                     SSNRFRRPASYMSKGYESRRMAVDYSIPLVTNVKCAKLLVEALARNISLDVSEIDAQT
                     SHKTAVIPGLVNINSFVSSFDEFEATTRASLASGFTFNTFLPQTSDCSTISNIETLAD
                     AIESATNSAYTDFSLSIAASETNSEEAAYAAEDAGALFIPFNDFNKSKVSAISAHFAS
                     WPENKPIITDAKTTDLASVLLLASLHSRSIHITGVSSREDLGLIIMAKEKELQVTCDV
                     SVYALFLSQAEFPQLDFLPTKEDQNALWSGLKNIDCFSIGVLPYLVSKALNKKFCPGL
                     GTKETLPLLFNAVKEGRLTTQDIVERFHDNPVRIFNIPKQESSVEFDIDRLAASTNDS
                     EVLTIARANLQGAVNRVSFHNETVCLGGEILAVNALGHNGVEPRARFGSVTGIPSSPA
                     LSNKKARMSFNDGARRPSLLREQSSIPAEFEKLGAELVSQPPTSSVSGDNNALINYIR
                     KNNTFLRNSVLSVKDFTRSDLHSLFTVAQEMRLAVERQGVLDILKGRLLATMFYEPST
                     RTSASFDAAMQRLGGRVVSVASASSSVKKGETLQDTIRTLTCYADAVVLRHPSEESVD
                     IAAKYSPVPIINGGNGSKEHPTQALLDLFTIREELGTVNGITVTFMGDLKYGRPVHSL
                     CHLLRHYQVRIQLVAPKELAMPENIKKMLQDNGMLVVESEVLTPEIIAKSDVLYCTRV
                     QEERFEDKEQYSRLKDTYIVDNKILSYAKQHMCVMHPLPRTNEIREEVDFDQRAAYFR
                     QMRYGLFVRMALLAMVIGVDF"
     gene            complement(<887853..>889562)
                     /locus_tag="DEHA2A10406g"
                     /db_xref="GeneID:8998031"
     mRNA            complement(<887853..>889562)
                     /locus_tag="DEHA2A10406g"
                     /product="DEHA2A10406p"
                     /transcript_id="XM_002769978.1"
                     /db_xref="GeneID:8998031"
     CDS             complement(887853..889562)
                     /locus_tag="DEHA2A10406g"
                     /note="similar to uniprot|P35208 Saccharomyces cerevisiae
                     YJL127C SPT10"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10406p"
                     /protein_id="XP_002770024.1"
                     /db_xref="GeneID:8998031"
                     /db_xref="GOA:B5RSU5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B5RSU5"
                     /translation="MAEFDDVMQPPHFRPQLEYNPVTVIDRYTVLLKDGETTATIYPM
                     HTLNELPPGLLAFLCDEFNMEIERGDTFPFFDTLHIESFQNYWFGSFAAVMVLGDSPT
                     LEGSRQWEKECLGTFYIKPNYPGRCSHICTAGFLVNAGIRGKGIGRTLADCYLQWAPR
                     LGYTYSIFNLVFESNAAARKIWESLNFKRIGRVKSAGILKGHDTAVDAIVYGRELINN
                     SDPAIGAYRFDKIKFYLETGRYPAMADRQEKSRLRSSASHYRLENGKLMLKGRQVIAD
                     PVRQLQICTEVHMTNHGGINKTTAVVTEKYHWTRIKDTVATAIKNCPECRDPAKDPPL
                     LKRSTIPKKMATGNSIIRRNNKVLHSQPNNPNARNILKSRNSADDVDAMVAAAQLHNL
                     PGHHRHDATESLLTHDLSGLDDGIIAAVEAAQRSQQQGHPNHQHHPTYAAAAAAAVAG
                     DSNHYQHYQNEYTNHHEYHQDSNDNQGYNNGGNSKERNRNNNIPVDPEVSAFDHHVDS
                     AGEEIEIARALIQANEDVQEEGHHQDVDELQNQSSNNDNNEKNGDSKRADDETNMFSK
                     DNN"
     gene            complement(<889981..>890664)
                     /locus_tag="DEHA2A10428g"
                     /db_xref="GeneID:2899614"
     mRNA            complement(<889981..>890664)
                     /locus_tag="DEHA2A10428g"
                     /product="DEHA2A10428p"
                     /transcript_id="XM_456786.1"
                     /db_xref="GeneID:2899614"
     CDS             complement(889981..890664)
                     /locus_tag="DEHA2A10428g"
                     /note="similar to CA3375|IPF4684 Candida albicans IPF4684"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10428p"
                     /protein_id="XP_456786.2"
                     /db_xref="GeneID:2899614"
                     /db_xref="GOA:Q6BYD3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD3"
                     /translation="MTVDEETYKRLEDLPFASKDGKNTPKITEPITFSLAKDPTGKVT
                     LFPIHDASQVPKTLLKVIQHEINYVIEEGTTYPYHEIMDFDQFVSYWFSAFVAVLIEG
                     DHQSLSDAHFQDQPEDFWRTHFLGTFYVKPNYTGRCSHVCNAGFVVNHEKRGLGLGKE
                     LGAKYLVWGPQLGYVYSVFNLVFETNTASLRIWNSLGFDRIGYVKNVAVLKGHQSLVG
                     AYMYGKDLV"
     gene            <890914..>892000
                     /locus_tag="DEHA2A10450g"
                     /db_xref="GeneID:2899615"
     mRNA            join(<890914..890950,891018..>892000)
                     /locus_tag="DEHA2A10450g"
                     /product="DEHA2A10450p"
                     /transcript_id="XM_456787.1"
                     /db_xref="GeneID:2899615"
     CDS             join(890914..890950,891018..892000)
                     /locus_tag="DEHA2A10450g"
                     /note="similar to uniprot|P40505 Saccharomyces cerevisiae
                     YIL084C SDS3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10450p"
                     /protein_id="XP_456787.2"
                     /db_xref="GeneID:2899615"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD2"
                     /translation="MEDHKRNGIFNDSLSKRDKKRQQIGSRLGKLDVMFSSDRDNFYK
                     TSLHNLQNTLATLQQGANENYLDKKENLEEERDYELTRLRLWEEYQVKRIEEEYKEDL
                     IKAQENHDKMIKLIKEKLYDKLQKQIKQLKEDKLLLNLVNANSWSSNIANDSSTAALN
                     AVAANTLNLSDRRSLRKRELSSRLTAGEADDLSDGGVGSTTATGNVSTANGYISSSGK
                     RRRHYATRYSSNDEISSGITSTAASNKNSNGYGHNTLHNNAVGSGNESNLSDKDYDAL
                     NTLIMGNEDGGVSLVLLDNAQANSNKPNTRGLNKQFTGLQGLKPEELNDDLTLLRNAI
                     VKKEK"
     gene            complement(<892392..>894098)
                     /locus_tag="DEHA2A10472g"
                     /db_xref="GeneID:2899517"
     mRNA            complement(<892392..>894098)
                     /locus_tag="DEHA2A10472g"
                     /product="DEHA2A10472p"
                     /transcript_id="XM_456788.1"
                     /db_xref="GeneID:2899517"
     CDS             complement(892392..894098)
                     /locus_tag="DEHA2A10472g"
                     /note="similar to uniprot|P53838 Saccharomyces cerevisiae
                     YNL275W BOR1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10472p"
                     /protein_id="XP_456788.2"
                     /db_xref="GeneID:2899517"
                     /db_xref="GOA:Q6BYD1"
                     /db_xref="InterPro:IPR003020"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD1"
                     /translation="MKNRGLPNCIRYIGYGIFNDVRSRIPHYKSDIQDAWNYRIIPST
                     LFIFFANLLPAISFAQDMYDKTDQSYGVNETLMSSAIAGVVFGMFSGQPLCMVGVTGP
                     ITIFNYTVYELMKPRGTPFFPFMCWICLWSMVMHFIIAITNMVSYIKIITSYSADVFG
                     FFVCVVYLQKGVQILNNQFSVSLESGYCSVMISLLMVIFGVGCNVFGNNLHYFRGWFR
                     KIFSDYGMPLAVIFFTAFTYFGGNLSKTDLDKLPITEAFQPTYHGTDRSHGWFIHFWP
                     PDNIAVSDVFLAIPFAIDLTLLFYFDHNISSLMCQSKDFPLKKPSSFHWDFALLGLVT
                     GISGLIGLPAPNGLIPQAPLHTQSLVVHNYKTGEVISVVEQRVSNTIQGLLTFLMMSG
                     PFLVVLGLIPQAVLAGLFFIMGITGIHENAITNRLRYLFLNDDYVKNDPTCPLVFKEF
                     DKYRNKKWFYVYLVLLILGFGAEFAITLTKGTIGFPGVLLVLAICAKWVWPLIIPLEE
                     LQLLDSPVADEVTIKNLKIMDEIKLQENSSIQNKSDIEADVIGTQVKKSKLKLRNRNQ
                     NV"
     gene            <894941..>896713
                     /locus_tag="DEHA2A10494g"
                     /db_xref="GeneID:2899518"
     mRNA            <894941..>896713
                     /locus_tag="DEHA2A10494g"
                     /product="DEHA2A10494p"
                     /transcript_id="XM_456789.1"
                     /db_xref="GeneID:2899518"
     CDS             894941..896713
                     /locus_tag="DEHA2A10494g"
                     /note="similar to uniprot|P53966 Saccharomyces cerevisiae
                     YNL029C KTR5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10494p"
                     /protein_id="XP_456789.2"
                     /db_xref="GeneID:2899518"
                     /db_xref="GOA:Q6BYD0"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6BYD0"
                     /translation="MPAVKTNDQGSIKDSLEPHDTSDSDYDYSDDDDEYEVSFTEARL
                     RNIKSIVHTSRRIRLPKRSHRLWIMLLIIVLFIYSFTNMGFQGAKNNIQEDIGTFSDP
                     LDEAEGHFMSETRISSDIDSPFQIGCRVPDITQPRANAALVVLTRNSEVKKVIKSMKS
                     MERHFNQWFNYPWVFLNDEPFTDEFKNSVLKYTSSKVEFGTIPEKEWNFNEDIDKDEL
                     HEHIANQGDRRIMYGNSESYHKMCRFFSGYFYKHELVKKRDWYWRVEPDVEFFCDLTY
                     DPFIEMEKRNKKYGFNVLIGELYYTIPGLFKETRAFIRKNNVPLGNAWSLFITDYKYA
                     VGKNAAKYDGFKSKSDILREIEMNLTVKKFLSMKDKTDEQIPEYDSWLLDEVISKSKK
                     PALYEDRIDLEEYNMCHFWSNFEIARTDLFNSPRYEAYFDHLEKSGGFYKERWGDAPV
                     HSLAIGMLLDLKDIHYFRDVGYRHSGLSHCPGNSRRYQLKYEPSERYYQKDLSKDSAW
                     LSPDSPRSNGIGCRCRCPKTKEIEDSSSSCVRSWADITSNRYIPPEPVDVDFWEEEIK
                     NRLNKFLATGGILGQNNIAEKLLS"
     gene            complement(<896801..>897112)
                     /locus_tag="DEHA2A10516g"
                     /db_xref="GeneID:2899519"
     mRNA            complement(<896801..>897112)
                     /locus_tag="DEHA2A10516g"
                     /product="DEHA2A10516p"
                     /transcript_id="XM_456790.1"
                     /db_xref="GeneID:2899519"
     CDS             complement(896801..897112)
                     /locus_tag="DEHA2A10516g"
                     /note="highly similar to uniprot|P02309 Saccharomyces
                     cerevisiae YNL030W HHF2 histone H4 proteins and highly
                     similar to uniprot|P02309 Saccharomyces cerevisiae YBR009C
                     HHF1 histone H4 proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10516p"
                     /protein_id="XP_456790.1"
                     /db_xref="GeneID:2899519"
                     /db_xref="GOA:Q6BRZ4"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:Q6BRZ4"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRGVLKTFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <897665..>898075
                     /locus_tag="DEHA2A10538g"
                     /db_xref="GeneID:2899520"
     mRNA            <897665..>898075
                     /locus_tag="DEHA2A10538g"
                     /product="DEHA2A10538p"
                     /transcript_id="XM_456791.1"
                     /db_xref="GeneID:2899520"
     CDS             897665..898075
                     /locus_tag="DEHA2A10538g"
                     /note="highly similar to uniprot|P61830 Saccharomyces
                     cerevisiae YNL031C HHT2 histone H3 proteins and similar to
                     uniprot|P61830 Saccharomyces cerevisiae YBR010W HHT1
                     histone H3 proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10538p"
                     /protein_id="XP_456791.1"
                     /db_xref="GeneID:2899520"
                     /db_xref="GOA:Q6BRZ5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
     gene            <898310..>898798
                     /locus_tag="DEHA2A10560g"
                     /db_xref="GeneID:2899561"
     mRNA            <898310..>898798
                     /locus_tag="DEHA2A10560g"
                     /product="DEHA2A10560p"
                     /transcript_id="XM_456792.1"
                     /db_xref="GeneID:2899561"
     CDS             898310..898798
                     /locus_tag="DEHA2A10560g"
                     /note="weakly similar to uniprot|P40502 Saccharomyces
                     cerevisiae YIL087C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10560p"
                     /protein_id="XP_456792.1"
                     /db_xref="GeneID:2899561"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC7"
                     /translation="MARIDNYQQQVRRNEYSSMGEGHTLNIEGLTKSANELPNTPYPA
                     WFFSAVLLYKGVTTHKPIANSTGTSGGSAKFSQWLSLSKPSRLSCFTFGAAHLLGGWI
                     IYDGDLANGAGFNFAWSTLYLIVNGTSSVKSLTLGRLNPIGLSMLALGNVGMYGKKFF
                     WH"
     gene            complement(<898864..>899676)
                     /locus_tag="DEHA2A10582g"
                     /db_xref="GeneID:2899562"
     mRNA            complement(<898864..>899676)
                     /locus_tag="DEHA2A10582g"
                     /product="DEHA2A10582p"
                     /transcript_id="XM_456793.1"
                     /db_xref="GeneID:2899562"
     CDS             complement(898864..899676)
                     /locus_tag="DEHA2A10582g"
                     /note="similar to uniprot|P53965 Saccharomyces cerevisiae
                     YNL032W SIW14 Tyrosine phosphatase that plays a role in
                     actin filament organization and endocytosis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10582p"
                     /protein_id="XP_456793.1"
                     /db_xref="GeneID:2899562"
                     /db_xref="GOA:Q6BYC6"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC6"
                     /translation="MSEVLDDPFQMDEELPSYKENDSVHKDITPRYDDNEMMNDPSIM
                     NSDKRYIRSKLDQLKINEESTNNTGDDEPTYEEDIDDKFDGTFEPKETQESGDFADEI
                     PQLTPPENFAPVINKIYRSSFPQPSNFPFVKKLKLKSILCLIPEDYPEEHEQFLEKEN
                     IKLFQLGMSGNKEPFVKISHNLITEAIKIVLNPANQPILIHCNRGKHRTGCLVGVLRR
                     LQKWSLTIIFDEYRKFAAPKERPMDQQFIELYNEVELEEYAKENSLLPIPWD"
     gene            <899974..>900250
                     /locus_tag="DEHA2A10604g"
                     /db_xref="GeneID:2899563"
     mRNA            join(<899974..899976,900038..>900250)
                     /locus_tag="DEHA2A10604g"
                     /product="DEHA2A10604p"
                     /transcript_id="XM_456794.1"
                     /db_xref="GeneID:2899563"
     CDS             join(899974..899976,900038..900250)
                     /locus_tag="DEHA2A10604g"
                     /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
                     cerevisiae YNL024C-A"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10604p"
                     /protein_id="XP_456794.1"
                     /db_xref="GeneID:2899563"
                     /db_xref="GOA:Q6BYC5"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC5"
                     /translation="MSALFNFQSLLQVILLLICTCTYIHATWPVILDKNKTGALGVFW
                     KFARIGERLSPYVAIGCFAMAFNVLRS"
     gene            complement(<900306..>902465)
                     /locus_tag="DEHA2A10626g"
                     /db_xref="GeneID:2899564"
     mRNA            complement(<900306..>902465)
                     /locus_tag="DEHA2A10626g"
                     /product="DEHA2A10626p"
                     /transcript_id="XM_456795.1"
                     /db_xref="GeneID:2899564"
     CDS             complement(900306..902465)
                     /locus_tag="DEHA2A10626g"
                     /note="similar to uniprot|P40498 Saccharomyces cerevisiae
                     YIL091C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10626p"
                     /protein_id="XP_456795.2"
                     /db_xref="GeneID:2899564"
                     /db_xref="GOA:Q6BYC4"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /translation="MPAPYKRKKHSGKRPEDSHDAKRPKQKHGRQEMRTITRTARRVR
                     RDEEGEEDEQVEENVNEELESQDDDIEDGGDIDDDKGKAYDALLTLLSGDHQEDTKKN
                     TSVRAEPEQTQESESESDEDSGDDEIAGANVDDDKDVDEEGPEEDDGDDDQQDPFEVH
                     FNQVSDTFIEEQEKVLKDKPKWTFADKKSMEDAGYTYTFQVPPNPIKTGGKVKGQSVN
                     NYSIKQRLVSPFEKQHPESLNELEGVLLDSMVKYQDINYVYKTFDNESYKKLYVLHAL
                     NHIFKTRDRILKNNNKLHSYQESMKKGKTNIEEPELRDQGFTRPKVLILLPTRNACYE
                     IVELLIKLCGSEQQENRKKFNKQFSSKETPPDSKPEDFKHSFKGNNNDFFCIGVKFTR
                     KSLKLYSSFYSSDIIIASPIGLSMILENPDKKKRQYDFLSSIEVLVVDRANQIEMQNW
                     DHVNTVFKYLNKIPKDFHDADFSRIRMWSINDQANLLRQNLVFSEFSTPNINNIVSSK
                     SSNLSGKLRFKPVTTSKNCIMNSIGLKLKQIFQRFESNSPMTDPESRFKFFINSVLPS
                     LTRSTSYDDGLLIFIPSYYDYLRIKNYMKTSTKFTFASIDEYTSQSKLSRNRQQFASG
                     KIKIMLYTERLHHFRRFEINGVKNLLMYGLPSNPIFYKELVRFIGKSVFREIADLDLS
                     FIKILYSKWDAVALERIVGNERAPVLCNSVNEMYEFR"
     gene            <903096..>904592
                     /locus_tag="DEHA2A10648g"
                     /db_xref="GeneID:2899565"
     mRNA            <903096..>904592
                     /locus_tag="DEHA2A10648g"
                     /product="DEHA2A10648p"
                     /transcript_id="XM_456796.2"
                     /db_xref="GeneID:2899565"
     CDS             903096..904592
                     /locus_tag="DEHA2A10648g"
                     /note="weakly similar to uniprot|P40499 Saccharomyces
                     cerevisiae YIL090W ICE2 Integral ER membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10648p"
                     /protein_id="XP_456796.2"
                     /db_xref="GeneID:2899565"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC3"
                     /translation="MRESMNRIKVRTFRVLRAVLSTVYLALIILSIPLAFDVGGITCG
                     LAFSFTTFTLYFVLTTIRIVTRKSRYFGWVSLLYYLQHIIIPSLLTLFLSYYRTNQPT
                     TSTAYHPHEIWRYFIVNSTPIFTILEGFCSLLLIQAIGETVNWLTVYKSDSWLIVSLM
                     ASGSTITAALYFLYRIYVFPFTIDMISASLLGSLLTLTAGLGLFGIVSGKGSMIESAL
                     LFAYIVRCIYETFPILSEDASKTLTSIFTQTTFNLRNEIPKLPPQITNTVSQLLPFLA
                     SNLPGSFKAIWEFLIMSIHKLPLPLLLNLAYRIGVFYAATKIIPSLYHDASYPFNTPP
                     RTPSQNRSPRPSSTNIPGLSQSVSNSQTPPNSHHNRTHETSSEEVIDTTEIQPLSRSQ
                     SSFARNSFGKKREPRSTIIRLIYSYSPCIVIAVYTHLMMSYKGELGTELKIWGWWSPN
                     SDIQVIVHPWQFWNWVNMGTTLLLYTAELSGNDSNSGRTALTSHWKVE"
     gene            complement(<905778..>907037)
                     /locus_tag="DEHA2A10670g"
                     /db_xref="GeneID:2899566"
     mRNA            complement(<905778..>907037)
                     /locus_tag="DEHA2A10670g"
                     /product="DEHA2A10670p"
                     /transcript_id="XM_456797.1"
                     /db_xref="GeneID:2899566"
     CDS             complement(905778..907037)
                     /locus_tag="DEHA2A10670g"
                     /note="similar to CA2207|IPF12169 Candida albicans
                     IPF12169"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10670p"
                     /protein_id="XP_456797.2"
                     /db_xref="GeneID:2899566"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC2"
                     /translation="MVAEPVQATWKALNYYYNWTSDFVATQQDKVVNSEYFDKLPELN
                     PFSTSKPDPKIIARKPPSSIYTKLSDHVCRNKIQYVSVFSIGIGTGSYYYYNNIYKST
                     QQQKSIKFKRRVPKLANGARGDVVLIVGSPTEPLTRLIALDFEKRGFVVYLTILDEKD
                     FKYIESNQITEDINYLNLNESYSFEVQISKFRQSLEIPVVPFPGADSHYLRLTSVIFA
                     PSLYFPIGPIENITVASWNKMNERFSTYLKLFSSGLVNLIRSQQSKIILINANIISCL
                     DMPYHAPETIFSNSVRHLFTALSRELSQHNISVTQIRLGNLNISNQDGASESKIATIV
                     NSEIRSWNEDIKELYASNFSSSQYKANPIKSTGRGTSLRQLYHLMFDLIYAKGKNPPV
                     VYCGTGARIYDWVSKIIPESILAWFLT"
     gene            complement(907153..907224)
                     /locus_tag="DEHA2A10692r"
                     /db_xref="GeneID:8998043"
     tRNA            complement(907153..907224)
                     /locus_tag="DEHA2A10692r"
                     /product="tRNA-His"
                     /note="tRNA His (GTG) cove score=61.27"
                     /db_xref="GeneID:8998043"
     gene            complement(<907681..>908952)
                     /locus_tag="DEHA2A10714g"
                     /db_xref="GeneID:2899568"
     mRNA            complement(<907681..>908952)
                     /locus_tag="DEHA2A10714g"
                     /product="DEHA2A10714p"
                     /transcript_id="XM_456798.1"
                     /db_xref="GeneID:2899568"
     CDS             complement(907681..908952)
                     /locus_tag="DEHA2A10714g"
                     /note="similar to uniprot|P41816 Saccharomyces cerevisiae
                     YPL171C OYE3 NADPH oxidoreductase or uniprot|Q03558
                     Saccharomyces cerevisiae YHR179W OYE2 NADPH
                     oxidoreductase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10714p"
                     /protein_id="XP_456798.2"
                     /db_xref="GeneID:2899568"
                     /db_xref="GOA:Q6BYC1"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC1"
                     /translation="MSGVQVAALKDTDLFKSLKVGEHTLSNKVVYPPTTRMRALSDHT
                     PSDLELEYYEERSKYSGSLLIAEATFVSEQAGLNGTVPSTWNSEAAGYVPGIWNDKHA
                     QAWKKITDRVHENGSFMSSQFWFLGRVGDPQLLKDRGLDYVAPSAIYPDEDFKKKALA
                     AGNPIRALTEDEIHDLIYKTYPNAARKAIAAGFDYIELHAAHGYLLDQFLQPTSNQRT
                     DKYGGSIENRARVVLELVDHLTTVVGAKKLAIRISPWATFQGMKADQDSTHAVTTFSY
                     LLHELQKRADDGNELAYVSIVEPRVQGGDDVEKSQQVGDNTFVGQIWKGIILKSGNYT
                     YDAPDFKTLLHDISDNRTMVGFSRYYTSNPDLVKRLYEGWDLTPYDRSTFYGSSNWGY
                     NTFDNYNRKRQFTKDIESGKLPKAIEEIEVK"
     gene            complement(<909369..>910700)
                     /locus_tag="DEHA2A10736g"
                     /db_xref="GeneID:2899569"
     mRNA            complement(<909369..>910700)
                     /locus_tag="DEHA2A10736g"
                     /product="DEHA2A10736p"
                     /transcript_id="XM_456799.1"
                     /db_xref="GeneID:2899569"
     CDS             complement(909369..910700)
                     /locus_tag="DEHA2A10736g"
                     /note="weakly similar to uniprot|P06842 Saccharomyces
                     cerevisiae YFL026W STE2 Receptor for alpha-factor
                     pheromone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10736p"
                     /protein_id="XP_456799.2"
                     /db_xref="GeneID:2899569"
                     /db_xref="GOA:Q6BYC0"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:Q6BYC0"
                     /translation="MDISSYDNINPQKIPLNYTLPLGNADDVYVVTFGVLDEYVASSF
                     HYIVVYSVAIGACLTLSLALWASCQNKRTPIFVLNQLTMAIMMIESALYLAFFMGPLS
                     SLSFSFTGILIPNTYGSYRVTVAANVFQTILVACIEVSMTYQIFIIFRSPEVKRLGAA
                     LTIVAAAAGLTIVGFYINSTVSSARMFQDVFNHSTSTKRVGSWVTDIPFILFSASINL
                     MSCMLACKLFFAIKTRRYLGLKQFDSFHILFIMSTQTMFIPSILVLINYGVSEAKTNV
                     LSAVSVLLVVLSLPFSSMWASAANNNPTPTSSTLAFLNRSDSNNSDSSTIVGNRFSLF
                     PGKLSKSSTTDSSIEKTMKDLSHTTSNHQEDSPTTLTDFRLQNDQSFYFSNLSAPPSD
                     IEQIIYGVTNADPETSNKCLNYSSDRESIDRALDNASPDGFVAVTTHNVNQ"
     gene            <911301..>912392
                     /locus_tag="DEHA2A10758g"
                     /db_xref="GeneID:2899570"
     mRNA            <911301..>912392
                     /locus_tag="DEHA2A10758g"
                     /product="DEHA2A10758p"
                     /transcript_id="XM_456800.1"
                     /db_xref="GeneID:2899570"
     CDS             911301..912392
                     /locus_tag="DEHA2A10758g"
                     /note="similar to uniprot|Q04739 Saccharomyces cerevisiae
                     YER027C GAL83 One of three possible beta-subunits of the
                     Snf1 kinase complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10758p"
                     /protein_id="XP_456800.1"
                     /db_xref="GeneID:2899570"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB9"
                     /translation="MSNSPAPDMRDVSMVDVSNTSDSITNDQKPQDVENEPPARRKST
                     MILTEENEAQADMDQGVKAKNNDNDQMHIDQTGVGEAQNAPAAPQETMPDPNVTLPID
                     IRWTQGGEKVYITGSFTGWRKMIGLAKQPDNSFLITLGLPIGTHRFRFVIDNELRFSD
                     FLPTATDQMGNFVNYVEVTPEHVNSHLEKEQQKQLEEEELQQKQQAGRKSSVSSTRGR
                     SDSMWGLTNDDDDMGNGYSRYHDGDSADSGNNSQAFISDIPPIFTDPKVMEQYYIAID
                     KQAKNQNGQQQAWLHPPQLPPHLENVILNNFNSMDRDNNSGALPIPNHVVLNHLATTS
                     IKHNTLAVASIVRYKRKYVTQVLYAPLQQ"
     gene            complement(<915036..>916616)
                     /locus_tag="DEHA2A10780g"
                     /db_xref="GeneID:2899574"
     mRNA            complement(<915036..>916616)
                     /locus_tag="DEHA2A10780g"
                     /product="DEHA2A10780p"
                     /transcript_id="XM_456801.1"
                     /db_xref="GeneID:2899574"
     CDS             complement(915036..916616)
                     /locus_tag="DEHA2A10780g"
                     /note="highly similar to uniprot|P39076 Saccharomyces
                     cerevisiae YIL142W CCT2 Subunit beta of the cytosolic
                     chaperonin Cct ring complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10780p"
                     /protein_id="XP_456801.1"
                     /db_xref="GeneID:2899574"
                     /db_xref="GOA:Q6BYB8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB8"
                     /translation="MSVQILGDQATEERAENARMSSFVGAIAVGDLVKSTLGPKGMDK
                     LLQSSSNMDSAMITNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAE
                     LLKEAEKLIEKKIHPQTIIEGYRIACTTALEALSKAAVNNGSDQELFKKDLINIAKTT
                     LSSKILAQDKDHFSTLAVDAILRLNGSTNLNHIKVIKKVGGRLRDSFLDEGFILEKRF
                     GINQPKKITNANILIANSSMDTDKVKIFGAKFKVDSTSKLADLEKAEKAKMKAKVEKI
                     KKFNINCFINRQLIYDFPEQLFTDAKINSIEHADFDGVERLALVTGGDVVSTFDTPES
                     VTLGHCDTIEEILIGEDVMTKFSGVAAGEACTIVLRGSTEQGLDEAERSLHDALSVLS
                     QTTRETKTCLGGGCSEMIMSKAVEQAAANETGKKSLAIESFARALRQLPTILADNAGF
                     DSSELVSKLRSAIYNGMTTSGLDLNKGTIADMRETGVIESYKLKRAVVSSAAEASEVL
                     LRVDNIIRAKPRTADRNQ"
     gene            <917062..>918684
                     /locus_tag="DEHA2A10802g"
                     /db_xref="GeneID:2899575"
     mRNA            <917062..>918684
                     /locus_tag="DEHA2A10802g"
                     /product="DEHA2A10802p"
                     /transcript_id="XM_456802.1"
                     /db_xref="GeneID:2899575"
     CDS             917062..918684
                     /locus_tag="DEHA2A10802g"
                     /note="weakly similar to uniprot|P48233 Saccharomyces
                     cerevisiae YNL083W SAL1 Probable transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10802p"
                     /protein_id="XP_456802.2"
                     /db_xref="GeneID:2899575"
                     /db_xref="GOA:Q6BYB7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB7"
                     /translation="MSNFGRLNGSESQKGSIYEHGTDYEGIFRELDVNNSGQLTLDEF
                     RNISKVLRYPVGEGSEFIDKMFASIDKNDDKAIDLDDFRSYLIATDDQIIKGFKKIDR
                     NNDGKLNFEEFSNYMNETLNLNATREKMEIMFKKIAQKDTEYINFDEFRNFLLLVPRS
                     GGSRLKTAFMFLVNGLDISSDGDVNMNQSLLNGFGLFLAGGVAGVISRTCTAPFDRIK
                     TFLISRSDLSSLVIRSKAEISKAIADNASPRVIEEAKQNHRAVKNAAKQVTNPKKIRS
                     PLIQAARTLYLQGGLRAFFVGNGLNTVKIFPESAVKLGVFEATKRSLVTIEGVRDPSE
                     LSTISTYLAGGIGGVSGQLTSYPIDTLKFRLQCSNIKSDIRGNELLIRIAKELYQEGG
                     VRIYYRGVLAGLGGMFPFAALDLGTFTTIKNWLVKRESIKSGIKEEDVKLPNYVILAL
                     GAFSGSFGASAVYPVNVLRTRLQAQGTHAHPYTYNGFFDVLRKTLAREGVSGLYKGLV
                     PNLAKVAPAVSISYYIYERLKFTFKLEKTQPI"
     gene            <919035..>920678
                     /locus_tag="DEHA2A10824g"
                     /db_xref="GeneID:2899576"
     mRNA            <919035..>920678
                     /locus_tag="DEHA2A10824g"
                     /product="DEHA2A10824p"
                     /transcript_id="XM_456803.1"
                     /db_xref="GeneID:2899576"
     CDS             919035..920678
                     /locus_tag="DEHA2A10824g"
                     /note="weakly similar to uniprot|P48233 Saccharomyces
                     cerevisiae YNL083W SAL1 Probable transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10824p"
                     /protein_id="XP_456803.2"
                     /db_xref="GeneID:2899576"
                     /db_xref="GOA:Q6BYB6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB6"
                     /translation="MSTMASSTSTSKSGGDKEKGSNEGSSNNNDYHSLFKKLDINRSG
                     EITLQDFKKALKDLKHPLSESPEMIKKIFDSFDSNQDKVIDFNDFKLYLTTTDDQILK
                     GFNKIDQDNDGRLNKADFVHYLKKTLNLSPSDSKIDLIFKQIDYKNDGYVTYDEFRDF
                     LLLIPRLNGSRIKTAFHFIVEELDISSDGDVTLINQFLSGFGFFLAGGLSGVVSRTCT
                     APFDRIKVFLIARTDLTSTVLHSKSEIARQIANGASSHVIEEARQKVIAAEAAAAKQA
                     AEHPKKIRSPLIQAARTLWKQGGFRTFYVGNGLNVLKVFPESAMKFGSFEATKRFLSR
                     VEGVQDTSQLSKVSTYLAGGIGGVCGQFTVYPIDTLKFRLQCSDLESSVRGNDLLFQT
                     AKDLFKQGGLRIFYRGIFVGVSGIFPYAALDLGTFTTIKNWLVIRESKKKGIKEEDVK
                     LPNYMVLSLGALSGTFGATVVYPINLLRTRLQAQGTYAHPYTYNGFSDVLSKTIAREG
                     YPGLFKGLLPNLAKVAPAVSISYFMYENLKYFLRLDNSI"
     gene            complement(<920750..>921487)
                     /locus_tag="DEHA2A10846g"
                     /db_xref="GeneID:2899577"
     mRNA            complement(<920750..>921487)
                     /locus_tag="DEHA2A10846g"
                     /product="DEHA2A10846p"
                     /transcript_id="XM_456804.1"
                     /db_xref="GeneID:2899577"
     CDS             complement(920750..921487)
                     /locus_tag="DEHA2A10846g"
                     /note="similar to CA3178|IPF19974 Candida albicans
                     IPF19974"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10846p"
                     /protein_id="XP_456804.2"
                     /db_xref="GeneID:2899577"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB5"
                     /translation="MGLPLTLPYVILTLKEFIIVWLNQVLYYNEIYPLEIYDKLKSFD
                     TIVYQSRNPALNKYVEDLVNEFLQILVNGDGHDNGGKVNQILILLYDVKSNKTKKKYV
                     VKFNEMINLGASINDLNFLYSVHEKDSESLLEPVIEIPSFTWDEIYSQFKSILFSQIE
                     ELKVQKNGSENDDLFFKVIVDLEDSINLNVSINAETNSQHSNWVKTSVTSEDSKQRKT
                     KVVPIGEVSVGFICIDMYNEYTKRVNA"
     gene            <921599..>924478
                     /locus_tag="DEHA2A10868g"
                     /db_xref="GeneID:8998038"
     mRNA            <921599..>924478
                     /locus_tag="DEHA2A10868g"
                     /product="DEHA2A10868p"
                     /transcript_id="XM_002769979.1"
                     /db_xref="GeneID:8998038"
     CDS             921599..924478
                     /locus_tag="DEHA2A10868g"
                     /note="similar to uniprot|P14242 Saccharomyces cerevisiae
                     YNL082W PMS1 Required for mismatch repair in mitosis and
                     meiosis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10868p"
                     /protein_id="XP_002770025.1"
                     /db_xref="GeneID:8998038"
                     /db_xref="GOA:B5RSU6"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:B5RSU6"
                     /translation="MAIQNINAGDIQRITSGQVIIDLVSIVKELVENSIDASSSKIEV
                     LFKNSGLDSIEIIDDGIGIGEDDFTSVCLKHCTSKLSTFEQLSEVNTLGFRGEALSSL
                     CSVSNLRITTCTKENYPRATELKYNAMGVLINKKKVIGGIKGTSILVSSLFHNLPVRQ
                     KNLQKNLKREYNKAVSLLINYIIINPNIRFTVYNINPKTSKKNLIIGTKGTGSSTILD
                     NVVNIFGSNGAYGLIPIDLSVDDIDVKFRLNRGDFPTHKKLNVQFKGYISNSSFGLGR
                     SSGDRQYLFINGRPIIFKKFLKTINEVYKSFNHVQFPVVILNVIIDTEFLDINVTPDK
                     RVIMIQNEDLINDILRNEVTKFFDTQNTVIPKNKSSGISLSDEKSSVSSNSTQANKVT
                     EVVSNVNETSREAEVQKNLMVTRKREHNENETDEEAGEKKVQEENDEEEEEEEEEEVE
                     VEDVQETIDEEEEEAEAEAEEAEEEQEDEEEEENEKEIMNLDEEVDEINDDSNSSRNK
                     IIDNDLLVTRGTRTIGIGNNHKTQRTRDKLLSDLGVVEVGSSSTNNRRNRNNNIENEQ
                     SSDNEDVSQILNERGVEKQHNNSLEFNDSNIHESTRISLKRNRDEQLFVSESDDEPKN
                     GNKVLDLSSFKNNASEPKRLSQQIQPDVTDNLRISIGDREVEERPIKRTKTMVSRDEI
                     TFNEDPAVITKHTSKSYVHNLSTTLDVDLQHIYSELEKHEASGKSQEDSSRNIAIDNI
                     ESTKEAEEKLSYTISKSDFLEMRLIGQFNLGFILVTLNSSNNLFIIDQHASDEKYNFE
                     KLTEITTFQNQTLVIPKTIELNAIDEMIVMDNLSVFKQNGFVIQVEEDNPPGKRIKLI
                     SLPVSKNVLFDISDFHELIHLINTHNSTSNEGIKCSKIRSLLAMRACRSSIMIGQHLN
                     RKTMTKILTNLSKLDKPWNCPHGRPTMRHLTELQKWSSFKDDYQL"
     gene            <924949..>927691
                     /locus_tag="DEHA2A10890g"
                     /db_xref="GeneID:2899582"
     mRNA            join(<924949..925027,925083..>927691)
                     /locus_tag="DEHA2A10890g"
                     /product="DEHA2A10890p"
                     /transcript_id="XM_456806.1"
                     /db_xref="GeneID:2899582"
     CDS             join(924949..925027,925083..927691)
                     /locus_tag="DEHA2A10890g"
                     /note="similar to CA1121|IPF6730 Candida albicans IPF6730"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10890p"
                     /protein_id="XP_456806.2"
                     /db_xref="GeneID:2899582"
                     /db_xref="GOA:Q6BYB3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB3"
                     /translation="MSLARPGVYSRIKERKSRRTHKNSRDGCPNCKAKRIKCTEELPS
                     CHNCIKKNYRCGYIEFPEEKLELLRKKNEKKKEEHNFMKGLPSGGFDPSTPQPQILHP
                     NTSGNSVPNSTTSDAISSLPTSLSPNFRGRQQQQTPHNQSYPPQEGIYDQRNFNQDEV
                     IFKNEFYNNKDSLRMSLFKDTIFRLSKGETGFSVPNATDESIVKAFPSDYESQSMHVN
                     LEGDLNSEENFRMASGQAQISYLDEMGPNDALFNQRTPSDYQAPLSFDWENTPGKFTS
                     IGNEAQFKASNNLSGNKVNFNPLPNAIISRTTFPKLVQAKRLRNTYLERYLNDSNRNV
                     KSLVNLEFNSIFSPVWTNANADSFWVSVYNQAVVLEVYFSFFMDRSLNVLLKTCNVTL
                     NGEIFSNLSESPSYSSISASDTSLSSNASSDDGFFFTKKDLDILTQKSYRYYGALIKD
                     LRKSITDIHIEYPLKISLFSAWSIFFHTQATVETLCLMYNGTSSLLVKVFNDSTSIRD
                     ITPTIQVTLETLNGHASAALIPDYNFNIISDIYEDFKEFKTFFMDAQATYIKRYAEGN
                     SEDGRKMRLRSNLEKHDCLELESFLENLVTVIFPTINYINCYYRTNNNVKDTNSNNIY
                     FTSVRLIFDLLVSWFKNYPSDALSMSSSASPVKKTFYLFYSVIGRALTNIISPVRSVL
                     LVDPCNLFCPRVDFDPEIYKVEQINITTDEFHYLRTLSEKMLRTVSFFDYRVLFYSYF
                     LSTNTILNAEYVKPFNIPIQNDNDHYNDIVQLLPKKLDIQEDQIDNFSDITLNANHFP
                     IFDIFHANDEYRSILSHEKQNQQLRKQQLPNEFNYKTGLLTHDFNPSSLFNALKINQQ
                     SYWNSNQPTLEETRIRVQNFDYGRQAVANTVKNSLVSNT"
     gene            <928659..>931052
                     /locus_tag="DEHA2A10912g"
                     /db_xref="GeneID:2899583"
     mRNA            <928659..>931052
                     /locus_tag="DEHA2A10912g"
                     /product="DEHA2A10912p"
                     /transcript_id="XM_456807.1"
                     /db_xref="GeneID:2899583"
     CDS             928659..931052
                     /locus_tag="DEHA2A10912g"
                     /note="similar to CA0471|CaECM22 Candida albicans CaECM22"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10912p"
                     /protein_id="XP_456807.2"
                     /db_xref="GeneID:2899583"
                     /db_xref="GOA:Q6BYB2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB2"
                     /translation="MERTNYQLDTDASAPDINDIMKDGLNFKDDASAIGKIPGTKNKE
                     TEEKGDKGENETQGARRRKHKNSKNGCPNCKKRRVKCSETLPACSNCVRRKVRCGYLD
                     YTEEQLKDLTQSKFVLEQVDDLRGDQGKREDESRNSSLRSSETQYPSPSSLNALKTSN
                     SFPMGQGGAIDQISDTTYNHGFRWDDHLAGGYDMGVNNVLNFQGNLTFTEGDNLVSSS
                     EYPVIYPVYSIKNPNPHGSRIPGETDLHNMNPSFRPSRDVFNSGAFSSNKSPVSWNDS
                     VISPHTSDYFETSGSSIHSHEKALPGAIEKPTTFKRIDMPNINYNQLIHDLMLKFGPQ
                     LATGTCSLEDNRYLYSIWLHSFIHYSFTQKLMFGCMINFTTNYLISNCWMPQYISGGF
                     TALIDRTKVRNLLISSSIRHYAMAIKELRVYLNKDTDPLVCSSASFVLSLTSIYDPSA
                     TLRSMNCFRDGLFSILQHNVAYVTQNGEPLPFMLMMHLEVSKNIVRSVYLPAYNPTFL
                     HEYRSMLKSFGNLLSILGNSSTDAALDTNDIDTQKFIEAKFSDLIVFTNETIDTFLPT
                     INNNLGNLDIQQQALFDILHKWVRIFPAKCMFISNENDPVENILYFFYKCLKKALYAV
                     FPQVKYFFVREFDSPVTVDISVPEEDFEIYSKGIENPETCCYSLQSYNQVKDQLKVLS
                     SYSIRVNIFLQKRMEILNRTVIFDWSIKEAFPIDDIKCFRNSVTDIAKLRNDFKSSVQ
                     IHELPISSFATTFIKPEHYPRRYEYVINEMNNNEFREEVDLLTLTNNGLLVNDYEAQ"
     gene            <931250..>932488
                     /locus_tag="DEHA2A10934g"
                     /db_xref="GeneID:2899584"
     mRNA            <931250..>932488
                     /locus_tag="DEHA2A10934g"
                     /product="DEHA2A10934p"
                     /transcript_id="XM_456808.1"
                     /db_xref="GeneID:2899584"
     CDS             931250..932488
                     /locus_tag="DEHA2A10934g"
                     /note="weakly similar to uniprot|P53934 Saccharomyces
                     cerevisiae YNL092W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10934p"
                     /protein_id="XP_456808.2"
                     /db_xref="GeneID:2899584"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB1"
                     /translation="MNGQLEQEEDQNLEEYKALTSTLSSFYNFHKWEYEELIKPRNIK
                     QASLSEQELELIPWYPKHTSDLEMAIGINEEFTKSLAMNIAADWGVSSNAQEWAACSD
                     SDYDKVRSTLLQLSREWSTDGEKEREITFGRIIKELTDRFPNEKERQNIKILVPGCGL
                     GRLVLDLVKEGFWCQGNEFSYHMLLTSNFMLNHCKFANNYSILPFVHKQSHVIKRLNQ
                     LRPITIPDVNPTSIHELATKNPEIPYGDLMSMTAGSFVDLYGPPNLMYSETYSSDPVA
                     NQFRNENHERFDVLTTCFFLDTASNIIDYLKAIFHCLKPGGIWINFGPLLWHFEDDSQ
                     THFVTKQLSKGGALQSIPTIMKGLELTREDLIELVKKIGFIFEKHESDIETSYSSDIR
                     SLGTYVYKCESWVCRKPSSI"
     gene            <932750..>933415
                     /locus_tag="DEHA2A10956g"
                     /db_xref="GeneID:2899585"
     mRNA            <932750..>933415
                     /locus_tag="DEHA2A10956g"
                     /product="DEHA2A10956p"
                     /transcript_id="XM_456809.1"
                     /db_xref="GeneID:2899585"
     CDS             932750..933415
                     /locus_tag="DEHA2A10956g"
                     /note="similar to uniprot|P36017 Saccharomyces cerevisiae
                     YOR089C VPS21 Rab5-like GTPase involved in vacuolar
                     protein sorting and endocytosis post vesicle
                     internalization"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10956p"
                     /protein_id="XP_456809.2"
                     /db_xref="GeneID:2899585"
                     /db_xref="GOA:Q6BYB0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BYB0"
                     /translation="MSFPNPATSVKLVLLGEAAVGKSSLVLRFVSNDFQENKEPTIGA
                     AFLTQKCTIGDRTIKYEIWDTAGQERFQSLAPMYYRNAQAALVVYDITKPASFIKARH
                     WVKELHEQASKDITIALVGNKYDLAENDNENEESLRKVSIEEGKNLAEEEGLLFFETS
                     AKSSYNVNDVFVGIGSKIPDTSANSGTASGLNVNGQSNNEGRIDLSAGSNNNRGGADA
                     CAC"
     gene            <933639..>934577
                     /locus_tag="DEHA2A10978g"
                     /db_xref="GeneID:2899586"
     mRNA            <933639..>934577
                     /locus_tag="DEHA2A10978g"
                     /product="DEHA2A10978p"
                     /transcript_id="XM_456810.2"
                     /db_xref="GeneID:2899586"
     CDS             933639..934577
                     /locus_tag="DEHA2A10978g"
                     /note="similar to CA3427|IPF11865 Candida albicans
                     IPF11865"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A10978p"
                     /protein_id="XP_456810.2"
                     /db_xref="GeneID:2899586"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA9"
                     /translation="MLKSFSRTMTVLKVAYIPEHFSTPLFFAQQENYYASKNLEIEFT
                     PVPEGTGRLIALLNSNEVDIAIGLTEGFVADIAKGNETYKVAGTYVESPLCWAISTGY
                     NREDITKSEDLAGKKIGVSRIGSGSYIMSFVLGLQLKFPSPFFSDHPTCSNFKNLRES
                     VSHTYEDESKFSDAFMWEHFTSKKYYDNKEIKKIGEIYTPWPSWVVAVRENVLKNNYE
                     DIKNFTACVNEGVKHFLENPDKATSYISTNLDYSEEDAKAWLKTVKFNESLGQSEIDW
                     ESVVNNTSKVLKTAGVLTDSDQLIQDRLEKGVIKNL"
     gene            <935081..>936016
                     /locus_tag="DEHA2A11000g"
                     /db_xref="GeneID:2899587"
     mRNA            <935081..>936016
                     /locus_tag="DEHA2A11000g"
                     /product="DEHA2A11000p"
                     /transcript_id="XM_456811.2"
                     /db_xref="GeneID:2899587"
     CDS             935081..936016
                     /locus_tag="DEHA2A11000g"
                     /note="weakly similar to uniprot|P25044 Saccharomyces
                     cerevisiae YDL230W PTP1 Phosphotyrosine-specific protein
                     phosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11000p"
                     /protein_id="XP_456811.2"
                     /db_xref="GeneID:2899587"
                     /db_xref="GOA:Q6BYA8"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA8"
                     /translation="MVSPSFLKLPIPDQKVNFTTHNAVESERIREALNSPDKSDWSIS
                     DAVSRKSVQRNRYSNVFPWNKSRVKLPVEQGHSDYINASYISMGNKVRYIAAQGPLEA
                     TIHHFWSMCYNESEKQKNDTVIIAMVTPLTEGGMKKCSQYWPTKTNPVLNVTTLLQGD
                     GIEIPGLTVHFVSETYIEKGDYLLTEMELRSKTQVKKVYHFYYYKWADARVPPSVSPL
                     ISLSQEIRALKKSVTNEPVPIVHCSAGVGRTGTFIALDQLFNELSPDILDPANDQFDP
                     IEAIVTQLRSERMMMVQTVYQYCFLYDTMREVYAK"
     gene            <936265..>937428
                     /locus_tag="DEHA2A11022g"
                     /db_xref="GeneID:2899588"
     mRNA            <936265..>937428
                     /locus_tag="DEHA2A11022g"
                     /product="DEHA2A11022p"
                     /transcript_id="XM_456812.1"
                     /db_xref="GeneID:2899588"
     CDS             936265..937428
                     /locus_tag="DEHA2A11022g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11022p"
                     /protein_id="XP_456812.2"
                     /db_xref="GeneID:2899588"
                     /db_xref="GOA:Q6BYA7"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA7"
                     /translation="MSLQPTPNGSSDRIYCPESTSTLASAENESRSINRMSSSSIVGS
                     QECYSESYVDADDEWIFSSLYLYNTLWIEYSEIKNSYIYGKSPGDSSLISIDKLQEKT
                     DHNDPSKQVRVRICSKQIIQFLSELNKNYEAEIFFEQSHSFNDNRAWVMCKKLCVDEW
                     MVSLAPIKNKSMKQILATMARLHFESALYIDFFVSTSRVMQMKSYICKNAPNLSCLYE
                     STFNGDVIRIHPNYSSNSKLPTENDTFESISELLDVMDSNYNDIIIHNPLYEFPSCPR
                     SIVSLTTTLRKKIKVCEIPQPTDIIRKVLSLKKHEVSFLMGFQGTRINSIRKSSACVV
                     KVLPYSTTMDATFIPLKNTPQDLVICGTPANVQYSINLIQNYLMDYRDSNSCP"
     gene            <937770..>939611
                     /locus_tag="DEHA2A11044g"
                     /db_xref="GeneID:2899589"
     mRNA            <937770..>939611
                     /locus_tag="DEHA2A11044g"
                     /product="DEHA2A11044p"
                     /transcript_id="XM_456813.1"
                     /db_xref="GeneID:2899589"
     CDS             937770..939611
                     /locus_tag="DEHA2A11044g"
                     /note="highly similar to uniprot|P40150 Saccharomyces
                     cerevisiae YNL209W SSB2 Ribosome-associated molecular
                     chaperone or uniprot|P11484 Saccharomyces cerevisiae
                     YDL229W SSB1 Ribosome-associated molecular chaperone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11044p"
                     /protein_id="XP_456813.1"
                     /db_xref="GeneID:2899589"
                     /db_xref="GOA:Q6BYA6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA6"
                     /translation="MADGVFPGAIGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFV
                     AFTNEERLIGDAAKNQAALNPKNTVFDAKRLIGRAYDDESVQKDLKTWPFKVIDANGN
                     PQIEVEYLEETKSFSPQEISAMVLTKMKEVAEAKIGKTVEKAVVTVPAYFNDAQRQAT
                     KDAGAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNITGG
                     VFTVKATAGDTHLGGQDFDTNLLDFFKADFKKKTGLDISGDARALRRLRTACERAKRT
                     LSSVTQTTVEVDSLFDGEDFSANLTRARFEDINSALFKSTLDPVEQVMKDAKISKSSV
                     DEVVLVGGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDDT
                     KDLLLLDVIPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGE
                     RVNCTENTLLGEFDLKNIPPMQAGEPVLESIFEVDANGILKVTALEKSTGRSANITIS
                     NSIGRLSSDEIEKMIEDAEKFKSSDDAFAKRHEQKQKLEAYVASVESTVTDPVLSAKL
                     KKSAKDKIEVALSDALAALELEESSADDYRKAELALKRAVTKGMSTR"
     gene            complement(<939773..>941056)
                     /locus_tag="DEHA2A11066g"
                     /db_xref="GeneID:2899521"
     mRNA            complement(<939773..>941056)
                     /locus_tag="DEHA2A11066g"
                     /product="DEHA2A11066p"
                     /transcript_id="XM_456814.1"
                     /db_xref="GeneID:2899521"
     CDS             complement(939773..941056)
                     /locus_tag="DEHA2A11066g"
                     /note="similar to uniprot|P40160 Saccharomyces cerevisiae
                     YNL207W RIO2 Protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11066p"
                     /protein_id="XP_456814.2"
                     /db_xref="GeneID:2899521"
                     /db_xref="GOA:Q6BYA5"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA5"
                     /translation="MKLDTSHMRYLTAEDFKVLQAIEQGSRNHELVPTQMIHSIGGLK
                     SPSGTNRAIGDLAKLKLVARLRNAKYDGFRLTYNGFDYLALKSMLNKNTLYSVGSIIG
                     VGKESDIYSVSDPNGQQKVLKIHRLGRTSFTTVKNNRDYLRNRQTSNWMYLSHLAAHK
                     EYEFMVILYNNGFSVPEPFDYSRHTVMMEWIKGIPMKHLRIHDNFKKLYCELMNFIVK
                     LANHGLIHCDFNEFNIIIRDKEDVPKHEFDFVVIDFPQCVSIDHTDAKVYFDRDVASI
                     RSFFSKKFRYDPEHDPTMFDTEGYGDGYKYAYPNFKRDVSRVKSLDVEVQASGYARKR
                     TGNREDKDLEAAVSGMRVNVEDDEEDDRSEIDSDYEHDEEEEEEEDEEDSIDEYDSEE
                     EFKDDQEENEQIIEALSSGLKQLKMDKLGNYILEE"
     gene            <941229..>942731
                     /locus_tag="DEHA2A11088g"
                     /db_xref="GeneID:2899522"
     mRNA            <941229..>942731
                     /locus_tag="DEHA2A11088g"
                     /product="DEHA2A11088p"
                     /transcript_id="XM_456815.1"
                     /db_xref="GeneID:2899522"
     CDS             941229..942731
                     /locus_tag="DEHA2A11088g"
                     /note="weakly similar to CA3536|IPF5414 Candida albicans
                     IPF5414"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11088p"
                     /protein_id="XP_456815.2"
                     /db_xref="GeneID:2899522"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA4"
                     /translation="MLRSRNRNKKSKRYGSKTNRLLLKKAKKDESWTSKSPFGKDLSK
                     IGIKNDLFKDSSSSTTYPWTRLAPLSDYNLIEVPRSRKGIPSLKSICSKKIAENADSL
                     ESSFLDTASWMVWRTVWEEILSLNNDSPRVFNLFAGKFFLSDGFKCHKLSLPLDVNLG
                     SSKWEKLLKARNEGISSVIIPRTRNHRIENLFSNINVLEIVKFIHRLSYRPWVLLDVS
                     LMTQKYDREDHLKLFNITNLIALDLSNSQIVDDLFLYNMSVSISKDGKLSKLTILKIN
                     NCPKVTSKGLQYLLCLSNDADARCSLSYIESDVKISSSNFAAKLQNIKSESPDFIDGT
                     RWFVLDDGSESKFIRKLPLALKLHCLYKNYSNRITKDPIVTDFPSYTTNSMSYLFSVR
                     NSIVLDIMVHENTFTSAENDFEKLEEVWATRIHFRNSRAQSKIYCYVIDNKYEFSGQM
                     ANIERHEENKKDDSVMFRASEKKLPSKYIAKPKRRRPVARKVDANSFFDM"
     gene            complement(<942868..>945663)
                     /locus_tag="DEHA2A11110g"
                     /db_xref="GeneID:2899523"
     mRNA            complement(<942868..>945663)
                     /locus_tag="DEHA2A11110g"
                     /product="DEHA2A11110p"
                     /transcript_id="XM_456816.1"
                     /db_xref="GeneID:2899523"
     CDS             complement(942868..945663)
                     /locus_tag="DEHA2A11110g"
                     /note="weakly similar to uniprot|P53550 Saccharomyces
                     cerevisiae YNL118C DCP2 Protein required for the decapping
                     of mRNAs"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11110p"
                     /protein_id="XP_456816.2"
                     /db_xref="GeneID:2899523"
                     /db_xref="GOA:Q6BYA3"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA3"
                     /translation="MSIQLTDGLANQSVDLVLEDLLVRFLVNVPDEDLSSIERVFFQI
                     EEAQWFYTDFVRQLNPLLPSMKMKSFATKLLKKCPLIWKWGDPADAISRFGKYKSTIP
                     VRGVALFNKDLTKVVLVKGTESNAWSFPRGKISKDETDIDCAVREAEEETGFNARDLV
                     NENDVIERTIKGKNYKIYLVKNVPEDYNFEPLARNEISKIQWHDMKSIQKKSRSNPNN
                     FFIVSAILKPMLGWINKNKGVLNEEELMLQAEIKLKSLLGISQPKLENLDAGRELLNI
                     LQGVIPRDSQVGNNTQAMPAAYDQIIQMNLPQHLHKQFPFFNNQPIQPQPYPIPNQPF
                     FVPQMPPNAFAPMNMSPVRSQPAHYQPMPPQAPHIPREQDSLSNDYINQQPNPSSLQK
                     PTSIANRRPSGVNSKEFLSILNKPRNKEDENTKLSDESRSNDHVNNRSKAQHLLSLFN
                     KDKKTASDDAKFTEGMQSDARGKSKNGSSNGYDHDFVSPHEASNELEESLIGSDDKTN
                     RKEAGKKLTLLKRPTDAGSELMSSNSSASADILRMLGSAPKAEPKKETEDVKQNQSNE
                     ILGLLKGDKKEPEQNPNNRATAKELLGLINQKSTDNRKVEDQTQSFNTQPEPEINTSP
                     EEEDFDDFEDFEDFENLDEYLSRHGPVSNVTSHNFDIASDDEDIYETPQNSSINAINE
                     IQDTHAEKPVPDSKKNKIRLLKPGESLNDIIGKPDRALQQSVDSTAVSKIQDTTQKKD
                     NVNDGRSLLDILNGGKNQNKKEVNQGPPKDYNYSPNSMDFGSVYGPPPTNNQPSPGYF
                     SPNSAAERTAFSPFENSNSGFPINSQTDSPSTVQSHNNSNPASASLLSLLGKKPPAQS
                     SYEPSPKTQSPQPASALTLDEIEGAQLGHMLPQPVAPPQTHSYTSEDASSPKSRPAEG
                     QASSARTLLDLLKGGRS"
     gene            <945898..>946758
                     /locus_tag="DEHA2A11132g"
                     /db_xref="GeneID:2899524"
     mRNA            <945898..>946758
                     /locus_tag="DEHA2A11132g"
                     /product="DEHA2A11132p"
                     /transcript_id="XM_456817.1"
                     /db_xref="GeneID:2899524"
     CDS             945898..946758
                     /locus_tag="DEHA2A11132g"
                     /note="weakly similar to uniprot|P18496 Saccharomyces
                     cerevisiae YLR393W ATP10 Mitochondrial inner membrane
                     protein required for assembly of the F0 sector of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11132p"
                     /protein_id="XP_456817.2"
                     /db_xref="GeneID:2899524"
                     /db_xref="GOA:Q6BYA2"
                     /db_xref="InterPro:IPR007849"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA2"
                     /translation="MIKIQTRTFSQVSRLLNVKAPRFTQTLKEASKPALTKSHSITRP
                     FGLDSGVMINQTNHGSGGSIQDKIFGSEAKERRQKQLDYEIAHSPFYESKSFTNTNGK
                     IFTPPVSFFKREKSKYFPNFGGATVDGRDQTLFGLLEGKVSIVRLYSTVSGEKCSETY
                     FNVEGKKYLTSGYGAFEAEHPMSQIIDINIPQNWLKGLLVKLSSGSIKRSLPQQRQSK
                     YFIVSDKLFSFDIKQKLMCDNTCSGYIYVLDHQGRIRWATSGYADPAELSLMWKCVRG
                     LEKELKSLSV"
     gene            <947827..>948177
                     /locus_tag="DEHA2A11154g"
                     /db_xref="GeneID:2899525"
     mRNA            <947827..>948177
                     /locus_tag="DEHA2A11154g"
                     /product="DEHA2A11154p"
                     /transcript_id="XM_456818.1"
                     /db_xref="GeneID:2899525"
     CDS             947827..948177
                     /locus_tag="DEHA2A11154g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11154p"
                     /protein_id="XP_456818.1"
                     /db_xref="GeneID:2899525"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA1"
                     /translation="MKFLSVATLVTIALAVFVEAENFDDKREDLKDDHDDEVENLSKD
                     YYPNKVCDRYCNQVYSYGKKYEHSKNWKKYLCSRDFHRDLDRCKYGCRKNYYHNHWSK
                     YIDPYYKKNCGRYI"
     gene            <949444..>949677
                     /locus_tag="DEHA2A11176g"
                     /db_xref="GeneID:8998050"
     mRNA            <949444..>949677
                     /locus_tag="DEHA2A11176g"
                     /product="DEHA2A11176p"
                     /transcript_id="XM_002769980.1"
                     /db_xref="GeneID:8998050"
     CDS             949444..949677
                     /locus_tag="DEHA2A11176g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11176p"
                     /protein_id="XP_002770026.1"
                     /db_xref="GeneID:8998050"
                     /db_xref="UniProtKB/TrEMBL:B5RSU7"
                     /translation="MTVMITKMITKTMMTTTATQKNGSPNDATEYVTKLSRWVKSVKN
                     RGILNMSSLKAIPEGTCKDYGCENNYKKNWGKY"
     gene            <950502..>950858
                     /locus_tag="DEHA2A11198g"
                     /db_xref="GeneID:2899526"
     mRNA            <950502..>950858
                     /locus_tag="DEHA2A11198g"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_456819.1"
                     /db_xref="GeneID:2899526"
     CDS             950502..950858
                     /locus_tag="DEHA2A11198g"
                     /note="highly similar to uniprot|P38701 Saccharomyces
                     cerevisiae YHL015W RPS20 Protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_456819.1"
                     /db_xref="GeneID:2899526"
                     /db_xref="GOA:Q6BYA0"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:Q6BYA0"
                     /translation="MSAPINKEKVQDQEQEILKIRITLTSTKVKQLENVSANIIRNAV
                     QNKIVKKGPVRMPTKVLKITTRKSPNGEGSKTWDTYEMRIHKRVIDLQAEASIVKKIT
                     QITIEPGVDVEVTIAA"
     gene            <951379..>953154
                     /locus_tag="DEHA2A11220g"
                     /db_xref="GeneID:2899527"
     mRNA            <951379..>953154
                     /locus_tag="DEHA2A11220g"
                     /product="DEHA2A11220p"
                     /transcript_id="XM_456820.1"
                     /db_xref="GeneID:2899527"
     CDS             951379..953154
                     /locus_tag="DEHA2A11220g"
                     /note="similar to uniprot|Q12511 Saccharomyces cerevisiae
                     YOR090C PTC5 Mitochondrially localized type 2C protein
                     phosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11220p"
                     /protein_id="XP_456820.1"
                     /db_xref="GeneID:2899527"
                     /db_xref="GOA:Q6BY99"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6BY99"
                     /translation="MVFILAVRPRLLYIANRQIQSNKRLISSSTQKLLQSSNTLSNAS
                     KVNRQVTEKTNKFFKKRHVALVSGIIIIGSYISFNQSNYYNLDTVPPIGGGGRSGISP
                     KLFPPSNTTVIGDDSRYFSTSTNSMHQKNSIGNQQQKQGVFLLNDEQVSERLRQFEES
                     YSVNRGKGVTRYDICQLPSNSPIEDDRAEEIVQVPILQDNNIKTSTDWMFFGVFDGHG
                     GWTTSSKLRDQLISYIVHELGTIFKPTNEDNLRYVPNGATIDQAIKNGFLKLDHEVVN
                     KNMEKLLNDNNKAKAAELLMPALSGSCALLSFYDTNSKLLKVAVTGDSRALLGSFKDN
                     HWTVRQLSIDQTGSNPTEVARIISEHPDEPNVVRNGRVLGTLEPTRAFGDCRYKLPAS
                     IQERIYKQFFGRRLPNNLKSPPYVTAEPVITTTKINPENNDFLVMASDGLYEMLSNEE
                     IIGLVVKWMEKERMVKPQKSFWNYFGSTENKLPEISDITNDKSSKQPFRKNKQSSGYG
                     GFLLDDRNVSTHLIRNALSNGGSREQTSMLISIPNPVSRRYRDDLTVTVVFFGKDLRG
                     ENEAGKLEINADATAGGIDSAKPKL"
     gene            <953371..>957102
                     /locus_tag="DEHA2A11242g"
                     /db_xref="GeneID:2899528"
     mRNA            <953371..>957102
                     /locus_tag="DEHA2A11242g"
                     /product="DEHA2A11242p"
                     /transcript_id="XM_456821.1"
                     /db_xref="GeneID:2899528"
     CDS             953371..957102
                     /locus_tag="DEHA2A11242g"
                     /note="similar to uniprot|P35207 Saccharomyces cerevisiae
                     YLR398C SKI2 antiviral protein and putative helicase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11242p"
                     /protein_id="XP_456821.2"
                     /db_xref="GeneID:2899528"
                     /db_xref="GOA:Q6BY98"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BY98"
                     /translation="MVETTDIKAGETILDTCNNVRDPLTKTKFLEPEVSREDTNKEIS
                     DELLTPSNQLSWDLLDLVQSLPEVNQNKLYDGLLNIPSPISRTSFRFKRSGIAGTVDG
                     YKEELRLSDLDNANSSNSLSVNRKFTSKSDALRGKSTFLPFQPGGLLDKKSMINAAKD
                     ESAFLHRNEMGLFDIPQGLSRGLNISDSTVSDDNIVNLEQSKEPQDSQPEESTLEDKN
                     FIESSNLSDQGSKSDNRLPFESEDIDGIIPSDYASMKQSMDEAPEHKKSWAHVVDLDH
                     KLENFKEVIPNMAREWPFELDTFQQEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMA
                     TRNMTKAIYTSPIKALSNQKFRDFKETFKDIDVGLITGDVQINPEANCLIMTTEILRS
                     MLYRGADLIRDVEFVIFDEVHYVNDIDRGVVWEEVIIMLPDHVKYILLSATVPNTYEF
                     ANWVGRTKQKDIYVISTPKRPVPLEIFIWAKDHLFKAIDANRKFSDIEFKKHKEILEK
                     GNKKEPPHVTMGAGSRGGRGGTARGGNRGGGQVANRGRGNFSGGRGGLTRDGPNKNTW
                     VSLVQYMKQHNLLPAVIFVFSKKKCEEFADTLSNVDFCNAREKSEVHMFIDRAVSRLK
                     KEDRELPQIIKIRDLLSRGIAVHHGGLLPIVKECIEILFARSLVKVLFATETFAMGLN
                     LPTRTVVFNTYRKHDGRGFRNLLPGEFTQMSGRAGRRGLDDTGTVIVMSFNEPLSPTD
                     FKDVTLGTPTKLSSQFRLTYNMILNLLRIEALRVEEMIKHSFSENSTQTLLPEHEVTV
                     KRLSEELNETKVEDCSICNLKNIEETYNLLTDYENLYGQIVEEIQKSPIVRNTLMRVG
                     RLLCFRDKNDTLRLGFFIRSNVSDNALLVLTFDLGEEYERDSATYKLPWIPHSYYLSH
                     FMKKMVYSGSLRIESVPYNNIGFIGRYFLKANIKSILQNDSKVIAEAVEQIQILLKFQ
                     NKWDEVGFYQATQLSLHELLEKKMPILERLNELESFECKNFKVHYQQMHRQDEIKSEI
                     TTLQRLISDENLELLPDYEQRLNVLQSLGFIDKNQNVVLKGRVACEVNSGWELIITEL
                     VLDNFLGDFEPEEIVALLSCFVYEGKTNEEEEPPITPRLEKGKTRILAIAEKLMKVYA
                     EHQVLLTSEEEEFLERKRFALVNVVYEWARGLSFNEIMQMSVEAEGTIVRVITRLDEI
                     CREVKSAALIVGDSTLHSKMSEAQEKIKRDIVFCASLYL"
     gene            complement(<957213..>958154)
                     /locus_tag="DEHA2A11264g"
                     /db_xref="GeneID:2899529"
     mRNA            complement(<957213..>958154)
                     /locus_tag="DEHA2A11264g"
                     /product="DEHA2A11264p"
                     /transcript_id="XM_456822.1"
                     /db_xref="GeneID:2899529"
     CDS             complement(957213..958154)
                     /locus_tag="DEHA2A11264g"
                     /note="some similarities with CA5107|IPF1358 Candida
                     albicans IPF1358"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11264p"
                     /protein_id="XP_456822.2"
                     /db_xref="GeneID:2899529"
                     /db_xref="UniProtKB/TrEMBL:Q6BY97"
                     /translation="MLSKTNRGIQLRIRSASKALLSYTNNGAKRNVVDSALISSRDLY
                     KENPQINSHKKIPYQGVRPSFYRRAATDFDSEYLDRKGLGNNRILEVLDSDEDFESKI
                     SPRAEHIQQFVGEEFPLSLNEKLSILCGLSNFSLVLEQRGKYDATSFDKTPSNVSSQG
                     LFPEVRTGEEYTTEKLRSIGKTIFDLHLGLSTVFTDEKYLSLPSESLEQTMNLFNDEE
                     KIIPLFMKRNYIYDCILPYQGTTRRGVIHSSEKYTEKKKKIQDVTSIGSFYTMIGLLS
                     VKFNMEDMLDKVVYGKIINGQAGLVTLATETLTKLRT"
     gene            <958405..>960783
                     /locus_tag="DEHA2A11286g"
                     /db_xref="GeneID:2899530"
     mRNA            <958405..>960783
                     /locus_tag="DEHA2A11286g"
                     /product="DEHA2A11286p"
                     /transcript_id="XM_456823.1"
                     /db_xref="GeneID:2899530"
     CDS             958405..960783
                     /locus_tag="DEHA2A11286g"
                     /note="similar to uniprot|P32794 Saccharomyces cerevisiae
                     YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11286p"
                     /protein_id="XP_456823.2"
                     /db_xref="GeneID:2899530"
                     /db_xref="GOA:Q6BY96"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BY96"
                     /translation="MSSKTSSSASKKKATSTPASESSTKKVKIPKNYIVRPSPNNSAR
                     SSNKVFINSEILQALEISNGSIVYISKVSGGEAGVLGTIHSDNDIIDKNVIGISSSLR
                     CLGGLLLGDRIQIDKYLSQPEYATSVDLRIENDQNESIKIEGKVSKALEKLFNEIGIV
                     FPGLKLTKVSIPNNEGGNEEEDIKMSCTIKVIDVSGKESLEDSLNKLSINEEKESEIC
                     NSSTVSPAYIFSKGKTQINTSVIREPLRSKFPQLPQPVGYSQVGGLSRPIALLQSTIE
                     LPLHNPTLFSDFGISPPRGILLHGPPGTGKTMLLRCVANETNAHVLTVNGPSIVSKYL
                     GETENAIRDIFEEARKFQPSIIFLDEIDSLAPNRNSDDSGETESRVVATLLTMMDGMG
                     DTGRIVVVGATNRPNSIDPALRRPGRFDQEVEIGIPDVEARGDILIKQFDKMDKSKFD
                     LTKEEINSIASKTHGYVGADLTALCRESVMKAINRSLKASIPQREIKLELRDVEEALP
                     EIRPSAMREIFLEMPKVYWSDIGGQEELKQKLTEVVQLPLEAADTFNKLGVSAPKGVL
                     LYGPPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERTIREIFRKARAASPSI
                     IFFDEIDAISGDRESSGTSASQNVLTSLLNEIDGVEELKGVVIVGATNRPTEIDPALL
                     RPGRLDRHIYVSPPDYDARLQILTKGCSKFNLDGREVNLSTLADLTNGCSGAEVALLC
                     HEAGLSAVMEDKQATCVEQRHFDHALKGISKGITQDMLDYYKTFSSRSGLSI"
     gene            complement(<960836..>961813)
                     /locus_tag="DEHA2A11308g"
                     /db_xref="GeneID:2899531"
     mRNA            complement(<960836..>961813)
                     /locus_tag="DEHA2A11308g"
                     /product="DEHA2A11308p"
                     /transcript_id="XM_456824.1"
                     /db_xref="GeneID:2899531"
     CDS             complement(960836..961813)
                     /locus_tag="DEHA2A11308g"
                     /note="weakly similar to uniprot|Q07418 Saccharomyces
                     cerevisiae YDL065C PEX19 Chaperone and import receptor for
                     newly-synthesized class I peroxisomal membrane proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11308p"
                     /protein_id="XP_456824.1"
                     /db_xref="GeneID:2899531"
                     /db_xref="GOA:Q6BY95"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:Q6BY95"
                     /translation="MSLSSENKDSVKSNEKRDQSTGQAKQAVPTSTNAGDEDDLDDLD
                     DLLDDFADDVLNKPPGSAVGTETQEKEEVKTSADEPLNDEFKTRIEDLVKDLNIEDPE
                     TKVQFEQLVKQFDEDHKEEAAAASQPQNFDNVMKETMERLKKSGDTIDEQIKNDQSSG
                     KPEDMLTQLLAGLGGPGAGGDGDLDMSKLLVDMLEQLSSREVLCEPIKDLHSKFPDYL
                     KEKKGKISEEEHANYTKQYEISGEILAIFEATDYDDEDKEKREKVNSLLESLQELGQP
                     PTELVGDSGDFPGFGGMGGGALGGNGLDFNDKDLPPDLEKGLEEGCKQT"
     gene            complement(<961941..>962126)
                     /locus_tag="DEHA2A11330g"
                     /db_xref="GeneID:2899532"
     mRNA            complement(<961941..>962126)
                     /locus_tag="DEHA2A11330g"
                     /product="DEHA2A11330p"
                     /transcript_id="XM_456825.1"
                     /db_xref="GeneID:2899532"
     CDS             complement(961941..962126)
                     /locus_tag="DEHA2A11330g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11330p"
                     /protein_id="XP_456825.1"
                     /db_xref="GeneID:2899532"
                     /db_xref="UniProtKB/TrEMBL:Q6BY94"
                     /translation="MVTTRRLTVRHTPYCFHEKYKINTTGSADFQRTNKENIFQNLPF
                     GSNEWLYKSSAIFKRVI"
     gene            <962390..>962866
                     /locus_tag="DEHA2A11352g"
                     /db_xref="GeneID:2899533"
     mRNA            <962390..>962866
                     /locus_tag="DEHA2A11352g"
                     /product="DEHA2A11352p"
                     /transcript_id="XM_456826.1"
                     /db_xref="GeneID:2899533"
     CDS             962390..962866
                     /locus_tag="DEHA2A11352g"
                     /note="highly similar to uniprot|P50623 Saccharomyces
                     cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
                     in the Smt3p conjugation pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11352p"
                     /protein_id="XP_456826.1"
                     /db_xref="GeneID:2899533"
                     /db_xref="GOA:Q6BY93"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:Q6BY93"
                     /translation="MSLCKTRLQEERKQWRKDHPFGFYAKPSKAADGSLDLTQWTAGI
                     PGRSNTLWQGATYPITISFPEEYPSKPPKIKFPTGFYHPNVYPSGTICLSILNEEQDW
                     RPAITIKQVVMGIQELLDSPNPDSPAQEPAWKAFSKDLATYEKKVKEQAKRYATAS"
     gene            complement(<963118..>964503)
                     /locus_tag="DEHA2A11374g"
                     /db_xref="GeneID:2899534"
     mRNA            complement(<963118..>964503)
                     /locus_tag="DEHA2A11374g"
                     /product="DEHA2A11374p"
                     /transcript_id="XM_456827.1"
                     /db_xref="GeneID:2899534"
     CDS             complement(963118..964503)
                     /locus_tag="DEHA2A11374g"
                     /note="similar to uniprot|P32604 Saccharomyces cerevisiae
                     YJL155C FBP26 Fructose-2 6-bisphosphatase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11374p"
                     /protein_id="XP_456827.1"
                     /db_xref="GeneID:2899534"
                     /db_xref="GOA:Q6BY92"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BY92"
                     /translation="MPVYSISHVENVRVCVVMVGLPARGKSLIAQKIVRYLSWLSIKS
                     KCFNVGTYRRKLVPCESTTAEFFDPHNEKGLKYREEALNSAMKDMMNWFTEDNGVVGI
                     LDATNSTRARRDKILKLCRENYIEPMFLESWCDDKDLVLQNIADVKTTSTDYVNKDED
                     YATKDFLQRIKYYEDIYETMDRDTDSDLTFIKLVNVNSQVILNKIESYLESRIVYYVM
                     NLHIKPRCIWLSRHGESEFNLTGQIGGDANLSERGRRYAKKLPELVLKSFGEENKHTN
                     LTVWTSTLQRTQQTASFLPYKKKLQWKALDELDAGECDGMTYEEIEQKFPEDFKARDD
                     NKYEYRYRGGESYRDIVIRLEPIIMELERQENILIITHQAVLRCLYAYFMNVPQEESP
                     WMSIPLHTLIKIEPGAYQTLVSRIKADIPAVSTYKEKGTSQLGELATGSTIKSRDLIK
                     DSECVRNSMQQ"
     gene            <964783..>967359
                     /locus_tag="DEHA2A11396g"
                     /db_xref="GeneID:2899535"
     mRNA            <964783..>967359
                     /locus_tag="DEHA2A11396g"
                     /product="DEHA2A11396p"
                     /transcript_id="XM_456828.2"
                     /db_xref="GeneID:2899535"
     CDS             964783..967359
                     /locus_tag="DEHA2A11396g"
                     /note="weakly similar to uniprot|P47002 Saccharomyces
                     cerevisiae YJL156C SSY5 Component of the SPS plasma
                     membrane amino acid sensor system"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11396p"
                     /protein_id="XP_456828.2"
                     /db_xref="GeneID:2899535"
                     /db_xref="GOA:Q6BY91"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="UniProtKB/TrEMBL:Q6BY91"
                     /translation="MKCRVMSLTQNITKFSIKGSKFIIDRQIYVKTIKMPMKNLLNRT
                     TKSEYKERDTPDAEERAVLDIKPVTSSTMSTSTEESQDSIHQLRPMFSSPLAKAEDET
                     KSNSQKFNFMHDTNLNLNPSISNTNSAPSVMTKDSEYMVNSMYSDSKKTYSTKQSSYL
                     TQNSQKKTGASSAARNLEYGQPLQILNIAEESSENPDIKGTVVDKLHELYEDVLFIMN
                     QYNNSSINLSTTVINTIDCFKKFVSFAESFGSDSESWDITTFNNGDMRRIMKIYLHFY
                     DNLLASDVYIKLKLLLVKNFNDFATTLNSRDKPANKPMQNMVKPQNYAIGIDPDKSLP
                     NEDLIEKIMKKIASTSISVKEQNGSFIAPIARGISNDLNILCLYFGYPNPTDSHSKLI
                     QSLHGLYDDIHVVVMKNQIELASIMAESASIPFPNYNASESVLPSTQVENVVRKFKLP
                     FRNPTDSSRPPISLSLSVENASRLSGTMGGYIYPQIDLEKQPHLESYTNSKFAISCGH
                     VCLDNNDEDVNYPHVSAPSAVLISLYKKALWTQYQKFSQQGNNVSTMEERIAYGSVLK
                     NLDKVFPLKKVKVPYSSKREGHEIRNLPEHRFGQIIWGERTLINSKGSDKASQDVENK
                     LSDLAIIKVNKNLKCDQNFLGDDIAFNEYDPALMFDNLYVRKVINLERESKELNINEV
                     DSVASANSNYSGLSIFKYGSTTKFTRGNLNGIKLVYWLDGAIHSSEFVINSVESNTAF
                     AAGGDSGSWILTKLEDCTSESNSKGLGVLGMLHSYDGEHKQFGLFTPMCEILERLETV
                     TNIKWGVVGVPQKDERISGHEVYSGSSATDSDSDNSDSVDDTEYESGAEELEGACPPE
                     ID"
     gene            complement(<967633..>968373)
                     /locus_tag="DEHA2A11418g"
                     /db_xref="GeneID:2899536"
     mRNA            complement(<967633..>968373)
                     /locus_tag="DEHA2A11418g"
                     /product="DEHA2A11418p"
                     /transcript_id="XM_456829.1"
                     /db_xref="GeneID:2899536"
     CDS             complement(967633..968373)
                     /locus_tag="DEHA2A11418g"
                     /note="some similarities with CA2885|IPF7204 Candida
                     albicans IPF7204"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11418p"
                     /protein_id="XP_456829.2"
                     /db_xref="GeneID:2899536"
                     /db_xref="UniProtKB/TrEMBL:Q6BY90"
                     /translation="MRISTILSIVALAAATSAAPADPVAPGEPTPGAPDVSGTITLDD
                     PIPPTGTITLDDPTSELPSGTITSDDPIPPTGTITLDDPTSELPSGTITIDDPTSSGT
                     IPSVSITVNATLPTLSVSSFPTPNPPPTFYPNTTTTVTGSVTVTDFVTFCPYPTTVTV
                     TTCRSNVCLPHTVTVPEATTLTVTGSCLVPTTYTTETCHECTKTQEPTTTPGPSSVSS
                     IPTVSEGSAPKNIAGVLAGIVAIAAVLF"
     gene            complement(<969302..>971260)
                     /locus_tag="DEHA2A11440g"
                     /db_xref="GeneID:8998029"
     mRNA            complement(<969302..>971260)
                     /locus_tag="DEHA2A11440g"
                     /product="DEHA2A11440p"
                     /transcript_id="XM_002769981.1"
                     /db_xref="GeneID:8998029"
     CDS             complement(969302..971260)
                     /locus_tag="DEHA2A11440g"
                     /note="similar to uniprot|Q07395 Saccharomyces cerevisiae
                     YDL063C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11440p"
                     /protein_id="XP_002770027.1"
                     /db_xref="GeneID:8998029"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B5RSU8"
                     /translation="MGKLKRGRKNQKARVNPIANNSKKNFDKQEIKDENTRNSKILPL
                     INNLKSSVPNDKTMALGAITVLCEDERMRKLLLKEKLVSIIMEQCLNDSNDEIVVESF
                     GLLRNIGIEEGYEVTKFYWRSNIWTAIEAALKKIETSFKFLEESKSLPLAATEDDEKK
                     AQGKKTSDKSKEQLLFDFTENILSLIVVMASGSEDLYDNVFQKIDPVLKLVVDLINWN
                     IPTMKTTVKLFNSLLDFIYEFASESTEFVQNLHENSQFDLHRLIEYLASPAQSKNTLG
                     KVYIEGIKFHLYEALNQADNKDAASTEILNNLISCITTINLDNLKKNLSVIDNAKEPI
                     QKKAPEEIKDIDQQIGGDTPETAQAKVDVQTLEIAIDLITSIWEYIAFNEANPQDPVT
                     LSTDLVQVILQLAYPSLIELLKFEMQNKEALELLDKIIVCLNNMCWLFLSSENIPVEW
                     YSDALQLWDLIVNISSNKDNLLIQKDCLSICWGITKTLGGEIKSKVNYSMIESLISRC
                     DDLTKHNPTEDNATSLEFFLCAVGFLGSLAPVIDNTEVTSHISQFLLSSTELFATNQT
                     DEPKANEIPIECLNLIYQIFGDMSYSYDYEIYVKNNYHEKLQALEPSIKSMYKKIDKN
                     RYPHLKIRAEETWATLGRFIQYKQSERD"
     gene            complement(<971472..>971814)
                     /locus_tag="DEHA2A11462g"
                     /db_xref="GeneID:2899538"
     mRNA            complement(join(<971472..971667,971723..>971814))
                     /locus_tag="DEHA2A11462g"
                     /product="DEHA2A11462p"
                     /transcript_id="XM_456831.1"
                     /db_xref="GeneID:2899538"
     CDS             complement(join(971472..971667,971723..971814))
                     /locus_tag="DEHA2A11462g"
                     /note="some similarities with uniprot|Q06011 Saccharomyces
                     cerevisiae YLR390W ECM19"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11462p"
                     /protein_id="XP_456831.1"
                     /db_xref="GeneID:2899538"
                     /db_xref="UniProtKB/TrEMBL:Q6BY88"
                     /translation="MSSAGGKAITICLVAGLSWYTGVKFWQPLIIERLQQDGNLRDDV
                     YIRDTSDQPKSWSDLKEKVKTTLHPNNPSIGKEELIKEFNKEKQETIDSSK"
     gene            complement(<972813..>973169)
                     /locus_tag="DEHA2A11484g"
                     /db_xref="GeneID:2899446"
     mRNA            complement(<972813..>973169)
                     /locus_tag="DEHA2A11484g"
                     /product="DEHA2A11484p"
                     /transcript_id="XM_456832.1"
                     /db_xref="GeneID:2899446"
     CDS             complement(972813..973169)
                     /locus_tag="DEHA2A11484g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11484p"
                     /protein_id="XP_456832.1"
                     /db_xref="GeneID:2899446"
                     /db_xref="UniProtKB/TrEMBL:Q6BY87"
                     /translation="MSILIYIFNQNQKIIGADKEENDFLNNGIEYVLVDKIENIKKDM
                     RTQNKKEYVEDYGIITKNNECRIQNRNRDFNDHTILENEYLVSLLQNISIEHLDIDTM
                     IDDHMLEHNEETCTIN"
     gene            complement(<973962..>974132)
                     /locus_tag="DEHA2A11506g"
                     /db_xref="GeneID:2899447"
     mRNA            complement(<973962..>974132)
                     /locus_tag="DEHA2A11506g"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_456833.1"
                     /db_xref="GeneID:2899447"
     CDS             complement(973962..974132)
                     /locus_tag="DEHA2A11506g"
                     /note="highly similar to uniprot|P41058 Saccharomyces
                     cerevisiae YDL061C RPS29B Protein component of the small
                     (40S) ribosomal subunit or uniprot|P41057 Saccharomyces
                     cerevisiae YLR388W RPS29A Protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_456833.1"
                     /db_xref="GeneID:2899447"
                     /db_xref="GOA:Q6BY86"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /translation="MAHESVWFSHPRNFGKGSRQCRVCSSHSGLIRKYDLNICRQCFR
                     ERASDIGFNKFR"
     gene            <974890..>977229
                     /locus_tag="DEHA2A11528g"
                     /db_xref="GeneID:2899448"
     mRNA            <974890..>977229
                     /locus_tag="DEHA2A11528g"
                     /product="DEHA2A11528p"
                     /transcript_id="XM_456834.1"
                     /db_xref="GeneID:2899448"
     CDS             974890..977229
                     /locus_tag="DEHA2A11528g"
                     /note="similar to uniprot|Q07381 Saccharomyces cerevisiae
                     YDL060W TSR1 Protein required for processing of 20S
                     pre-rRNA in the cytoplasm"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11528p"
                     /protein_id="XP_456834.2"
                     /db_xref="GeneID:2899448"
                     /db_xref="GOA:Q6BY85"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="UniProtKB/TrEMBL:Q6BY85"
                     /translation="MAKGGHSHRSTLKNDHKPFKSKHASKGQLKNQYKGKVEKTGAGN
                     GKANKVMSKTERKNAARQMKENKIHETKVIRKLFDGSQGAEKIVTVISLTKDISTQDI
                     VSRLVNNVKEESDEEFVVGLPSVSSAKINRFKTNLKFIVPDQNNLLSILDAAKISDYV
                     VFGISANEEVDKEYGEQILRALIAQGIASVIGVLPNVVSAYPKKNLQLDIRRSLFSFF
                     THFFPNEEKLYALEYDTECLNCIRTICQRFPKSVTWRDSRPYLLADKTSWMASENDAS
                     MGHIVVEGTVRGVGFNANRLVHIPGFGDFQVDRIEKLFKSRVNKKSEMDIDTEENDVF
                     LPNENRETLEELNPEEIDMEGEEWDDEDEFGVRMEGKHYFEDGKDGGYSSRSKLPRGT
                     SEYQGRWLLDDVLENASDLESEDEDIDVDIEQNNDDEMQMEDAQSEYAPTEAGDNQSE
                     MFVDLPPEEEERQLHEFRESVKEDLEFPDELELDPSESAKERLASYRGIKSLGNCDWD
                     YDEEDVEAPSIWKRLLRISNFKATRNKVCKDVIKDVQLNIGNKARIFIKAPSYVMEKV
                     NCEQQPFVVYGLLEHEHKLAVVNFSFESWEDYDEPIPNKDTLIVQYGPRRQVIQPLFN
                     QGSNNANNVHKSENYAHQGKLSIATCVAPVLFSNAPVIFFRQATDGSLQLVGQGTFLN
                     CDHTRIVAERAVLTGHPVKIHKRVVTIRYMFFNPEDINWFKAIPLFTKTGRSGFIKES
                     LGTHGYFKATFDGKLDASDTIAMSMYKRVWPEISTGWTD"
     gene            <977419..>978732
                     /locus_tag="DEHA2A11550g"
                     /db_xref="GeneID:2899449"
     mRNA            <977419..>978732
                     /locus_tag="DEHA2A11550g"
                     /product="DEHA2A11550p"
                     /transcript_id="XM_456835.2"
                     /db_xref="GeneID:2899449"
     CDS             977419..978732
                     /locus_tag="DEHA2A11550g"
                     /note="similar to uniprot|Q06709 Saccharomyces cerevisiae
                     YLR387C REH1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11550p"
                     /protein_id="XP_456835.1"
                     /db_xref="GeneID:2899449"
                     /db_xref="GOA:Q6BY84"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BY84"
                     /translation="MTSFMPHGSNPLTSSFTCNTCDIRFVTADLQRQHMKTDWHRYNL
                     KRRVAQLPSISSEMFAEKVLSQQNQSDEDEEDEFGFHINHRKSSKGSKQLTKKFLKKQ
                     AKFNELRKAREEDKESHVRAVSPASISSEFSQFSLGDSENLSVNNDTDTGSELNYTDT
                     SEFTDLDITADDEEYSDSDMESNEELDVTPITYCFFCGVNNKEIETNVKHMFNSHGLY
                     IPERSFLVDLEGLLAFLSEIFTADLECLVCGFLGKNLESIRQHLRSKGHCRIPYESKE
                     EKAIIAEFYDFYVDESNTKSKTNKKVTFTESSDSDDGVLVDVPSSSLDLDDSQANIND
                     NYSVVHVDKSGVELTLPTGSRIGHRSMARYYRQNIAVPRDLAESEKTVAVVDRRFAPG
                     LSYHDVSKQEKETRRLAQHSKNDYIRKSKSYRMNYQPHYRDELLQ"
     gene            <979250..>981022
                     /locus_tag="DEHA2A11572g"
                     /db_xref="GeneID:2899450"
     mRNA            <979250..>981022
                     /locus_tag="DEHA2A11572g"
                     /product="DEHA2A11572p"
                     /transcript_id="XM_456836.1"
                     /db_xref="GeneID:2899450"
     CDS             979250..981022
                     /locus_tag="DEHA2A11572g"
                     /note="weakly similar to uniprot|P25491 Saccharomyces
                     cerevisiae YNL064C YDJ1 mitochondrial and ER import
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11572p"
                     /protein_id="XP_456836.2"
                     /db_xref="GeneID:2899450"
                     /db_xref="GOA:Q6BY83"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6BY83"
                     /translation="MVLETHLYDILLVSPDASTEEISKGYRKVALKCHPDKTNHDPEL
                     TEQFKEVTRAYEILKNEKARDVYNHYGEAGLNGSCETKRGNSGVKKYNDSYNVRTATD
                     VFSNVFSDINSMFNRDPLGGGFDSFSSFPMNMNMNMNPNMNMNMNFNIGSSRGDFRKH
                     VQPAPNGNKNKMVRGHDIHHTCKVGLEDLYVGKIVKFQLPKNSRCYTCIGLGGMNPKS
                     CRVCQGNGQVFETLYNQFSQFQELRSCRQCSGTGIYIAPKDRCCECDNGYVKEKKIIK
                     INILPGFKNGDKVILQGEGDEGRNIIPGDVVIHLEEMPHPYLTRRFNDLYMDYDIDLR
                     TALLGGPIILNDFLKKDQDLKININVHGNEDLNKGAGDNIQEGEIVGTINSGIPKIVK
                     NLGMPINDLDIKGIFYQSTEAIDETCDMFDLKEYGKGDLFIRFNVIMPTVSDFKDDKS
                     LFTLANILPTTIPQVSKTGPKKTLEAHLSNIPNFDGDSCPGPTNPVYSSGSSEDSLDY
                     KHGHKKLKKSNYGYTVDDLSNSEYDYDDINVEDDNVDGNETEEEQFYANEWNKEKDGR
                     GKKRKKDDDLMDGSNSMHDSGIQC"
     gene            <981296..>984394
                     /locus_tag="DEHA2A11594g"
                     /db_xref="GeneID:2899451"
     mRNA            <981296..>984394
                     /locus_tag="DEHA2A11594g"
                     /product="DEHA2A11594p"
                     /transcript_id="XM_456837.1"
                     /db_xref="GeneID:2899451"
     CDS             981296..984394
                     /locus_tag="DEHA2A11594g"
                     /note="weakly similar to uniprot|Q06708 Saccharomyces
                     cerevisiae YLR386W VAC14 Activator of Fab1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11594p"
                     /protein_id="XP_456837.2"
                     /db_xref="GeneID:2899451"
                     /db_xref="GOA:Q6BY82"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021841"
                     /db_xref="InterPro:IPR026825"
                     /db_xref="UniProtKB/TrEMBL:Q6BY82"
                     /translation="MEEGNVLDSSIIKDLSNNIYEKRKATSFQIESLTKSALARNDSQ
                     IIFKIIAELTELTNDGTNSAKMGAITALGSVSVALGSFAIAYFLEEIIKPIFATFRDT
                     DARVRYYACESLYNIAKIARGEILLYFNEVFDILCILVTDTESSVKNAADILDRLIKD
                     IVSAKSTNYVSILHQDNIIESGQSNDISSHIIDPTGVAIQVNQVQDTHKAFSLPKFIP
                     TLLERMYTIDPFAKKFLISWLELFDDIPALELITFLPNFLEPLIKFLMNTAPSDVRIE
                     TQNLLNVFLKEIKAINRVKIEAKRKALEKEIAKKKADKKLKDTQENTNDSITADDESQ
                     DESSGIQREGAQDDAQDENKDDSYTTDQASIQSNSTTIIRQRKDDESEHLQELNELSE
                     LSDSQFLSGQDIFIDYSKIIDILLSFLRFPLSNSSNKNDYKINDISNETHEIYSEVQF
                     TVLKWLQEILVISPTSIAKFLPDCVSINMKNISIADDNKDSDLRNQFLKFNLSLQNFL
                     VNLNESGSKGEVREKKIPKKDAKNKDEKRKSESKEITEYKKKKDESTEEDGDSEYDNI
                     DENLINGLNKDVYDEFFEAYLGPTLKSIMTECLTCVNELSRITSLDWLIFLYSLNPSS
                     FFKPSFKGSDDKDDKTFDMSALLHSSIDASNEVVLKVLQLSSKISETDQEFFKNFMIE
                     LMRFFEDEVQESATTSKQNQIHGPTASPLTRSKIEFIIRKLCVTLTSEKIFKTLSEVV
                     VSHEEQNLDFMNMMIVMLNNILLTTQELAGFRKKLKNIDVYKVDDWSLFATLFQSWCH
                     NAPSALSLCLLTSNYELAYLIIKSFSESEVSFQLLTQLDILVQLLESPIFLKLRLQLL
                     EPEKHPYLYKTLYGLLMILPQSSTFTTLKKRISLVSGVNSLNTPSGSSGPITTPVATP
                     GATTTSSSVGNQLSIKRKRIHEMLDKFTKVQEKHEEFQMTKKLNEATLALNTDNPTNK
                     PYSKSNGLDSYTSNTNRILSHDSTVSDKKDYFSHDHSVQAGSDPKTQKRSSSKRFGLH
                     RF"
     gene            <984548..>985924
                     /locus_tag="DEHA2A11616g"
                     /db_xref="GeneID:2899452"
     mRNA            <984548..>985924
                     /locus_tag="DEHA2A11616g"
                     /product="DEHA2A11616p"
                     /transcript_id="XM_456838.1"
                     /db_xref="GeneID:2899452"
     CDS             984548..985924
                     /locus_tag="DEHA2A11616g"
                     /note="similar to CA5118|IPF1321 Candida albicans IPF1321"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11616p"
                     /protein_id="XP_456838.2"
                     /db_xref="GeneID:2899452"
                     /db_xref="UniProtKB/TrEMBL:Q6BY81"
                     /translation="MSTSDLKSTILQESTRAQNVHHAAEALRIATQSTHHQVHNQQHV
                     QQIDKEQGNNIHEFSEYDLKSRDSKYKRWSPKMDQFLIKLLSDVVHSYPKGAEAEMTK
                     KAWAYVTGQLRAANPETVYSTYTKYSCQQHLFNVNHHRFKIWYILMLHSKNNQTTDGY
                     SYRWNPDGGRFQIIDNTNGGIIQDERQVKSLLYSDSMSLPSLSSFNKGNLIVTDFFLT
                     DHLGYMSTYHNEVLPLLIRLDNRYADGLGDLYHEIPKFEYRDSNKEYFKPLVQAKSIK
                     LGTNDASKTKKRTHSESNQSHNSQGDVPLFTNSLSSMQHDPEVGDEDTVDPALKRSRN
                     INTPETNSNATTTEFENALATAAIAAINTPSVTNGRDIQPIYIKDRKWFNRLVSLNES
                     GLITPNEVLVVCEGVRDGKIPLFMLNILDQSYYPTRSAEDITPDETPDEEAAKKIREF
                     MLPMTFNS"
     gene            complement(<985988..>988087)
                     /locus_tag="DEHA2A11638g"
                     /db_xref="GeneID:8998035"
     mRNA            complement(<985988..>988087)
                     /locus_tag="DEHA2A11638g"
                     /product="DEHA2A11638p"
                     /transcript_id="XM_002769982.1"
                     /db_xref="GeneID:8998035"
     CDS             complement(985988..988087)
                     /locus_tag="DEHA2A11638g"
                     /note="weakly similar to CA5117|IPF1323 Candida albicans
                     IPF1323"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11638p"
                     /protein_id="XP_002770028.1"
                     /db_xref="GeneID:8998035"
                     /db_xref="UniProtKB/TrEMBL:B5RSU9"
                     /translation="MAGMTENLSLELREGEPFRNGDSLMEFEKMQYHNSNSEEAKRSN
                     PFDVLYEPHKVHSPSHYNTPLSQSFRYLEMEHNNVINRDQGVNDTSYNNIVTVIDSTD
                     SVNRTGSMISRSATLRNRNRIKTRSKMVRKNDIDSDPEKAKRKSKLAFLFPVRRERSL
                     KQKPKYVPLNRSPKFTNAQEFQQFFDKSNAANVLAEMLPPKMNHFKYKRLFLPDSKLI
                     TSNAYYQITRNNSFIINPKTQASKMIISSPIKDTFTKNGVKNEPDLDQHLPPDFGSEA
                     YNKYRISVFSNKLSTIPTFYQLFPEEAKLGMLNASELEQINKKLLFEVLLRRTVAAKI
                     GYRLKHNGYFNRKSNNNASSNGDSSSESHSGPSSDNERFDNQNLPKLSKSHTNSSSYD
                     ESINTDELLKQNASLYSGVLPSPQISYSSRIELDCLVSEISDSPNFLPLHKSIDKNNY
                     SSSSVYSTPKTNKFLNNGKFTPMAYFESPESLYIATFRKQINNEGNPSTRRSFPTSTN
                     PHQTILPESHSKFLQPMTQPNEPEVNFLGSPNNSLKSKPKHKSQTSSNTSILQDLEDL
                     SSELSSFAIGHEDMVQNFQYSARDKSLNIPLQKHHNLIQSIEESKDSVGLRSTNSTHP
                     IRSESPVADIKSMRASISIIGTLSDSSSNSSSNKKVSLRDAINAHNLNSIKANISTVA
                     LKSISSNKGAKLNNPTI"
     gene            <988776..>989516
                     /locus_tag="DEHA2A11660g"
                     /db_xref="GeneID:2899453"
     mRNA            join(<988776..988793,989049..>989516)
                     /locus_tag="DEHA2A11660g"
                     /product="DEHA2A11660p"
                     /transcript_id="XM_456839.1"
                     /db_xref="GeneID:2899453"
     CDS             join(988776..988793,989049..989516)
                     /locus_tag="DEHA2A11660g"
                     /note="similar to uniprot|P40414 Saccharomyces cerevisiae
                     YIL138C TPM2 Tropomyosin isoform 2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11660p"
                     /protein_id="XP_456839.1"
                     /db_xref="GeneID:2899453"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:Q6BY80"
                     /translation="MDKLKEKINNLKLDAEKWQEKSDEYSDRVKELEQENLDKDNQIQ
                     SLTRKNQVLEEQVEKLETDLTEIKQTADESHSLKTSNENYTKKHQVLEEELEEADKNL
                     KETTEKLRETDIKAEQLERKVASLESEKEEWENKFEQLTEQHNAAKAELEEISQQLEA
                     I"
     gene            <989886..>990977
                     /locus_tag="DEHA2A11682g"
                     /db_xref="GeneID:2899454"
     mRNA            <989886..>990977
                     /locus_tag="DEHA2A11682g"
                     /product="DEHA2A11682p"
                     /transcript_id="XM_456840.1"
                     /db_xref="GeneID:2899454"
     CDS             989886..990977
                     /locus_tag="DEHA2A11682g"
                     /note="weakly similar to uniprot|P53938 Saccharomyces
                     cerevisiae YNL080C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11682p"
                     /protein_id="XP_456840.2"
                     /db_xref="GeneID:2899454"
                     /db_xref="GOA:Q6BY79"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:Q6BY79"
                     /translation="MALMESIRKRFSHRLESHQIDEDYTTPSRSSSSVRDSTQPNNIP
                     NTINPNANNVDRSTNSFVYNVVDPYDPSEMVPSYETSQLLYEQQQRAPDRNGSIPNSS
                     NISRTISRTNSFATITPLTQNQGPNANQSSNNGSHKNNTKNSLKMLGLKFLNARQHFM
                     LACCRDISLIPCLIGLIQSWNRVFLNSGSMHNFVDDNLSLVAQETGNETLYLSMTSAR
                     LSEHFLTGVWCIVAGYLSFSVLDGLMIRWIVTYSTLAAIVRMLSMSTIMITIEQYLLS
                     TFTADGYKYGLHIWILISCCLTLLYIGQNFVTSNLDLKGNTRARFFDFYNIAVFAVVP
                     VGLASFITMIGLLRSLLILRLDIDQNGLP"
     gene            <991251..>991736
                     /locus_tag="DEHA2A11704g"
                     /db_xref="GeneID:2899455"
     mRNA            join(<991251..991301,991422..>991736)
                     /locus_tag="DEHA2A11704g"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_456841.1"
                     /db_xref="GeneID:2899455"
     CDS             join(991251..991301,991422..991736)
                     /locus_tag="DEHA2A11704g"
                     /note="similar to uniprot|P53937 Saccharomyces cerevisiae
                     YNL081C SWS2 Putative mitochondrial ribosomal protein of
                     the small subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_456841.1"
                     /db_xref="GeneID:2899455"
                     /db_xref="GOA:Q6BY78"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q6BY78"
                     /translation="MGVHIFGKSIKHNALVKIGLAKKIFGVGYNTAERICAKVGIYPK
                     MRMNQLTEPQIMAINKELSDLTIEGHLKQKILDDIKLKRSIGSIAGSRHAAGLPVRGQ
                     RTRNNSQTANRLNRLERHV"
     gene            complement(991986..992058)
                     /locus_tag="DEHA2A11726r"
                     /db_xref="GeneID:8998037"
     tRNA            complement(991986..992058)
                     /locus_tag="DEHA2A11726r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (CGC) cove score=76.18"
                     /db_xref="GeneID:8998037"
     gene            complement(992132..992203)
                     /locus_tag="DEHA2A11748r"
                     /db_xref="GeneID:8998040"
     tRNA            complement(992132..992203)
                     /locus_tag="DEHA2A11748r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (TCC) cove score=66.01"
                     /db_xref="GeneID:8998040"
     gene            complement(992451..992522)
                     /locus_tag="DEHA2A11770r"
                     /db_xref="GeneID:8998039"
     tRNA            complement(992451..992522)
                     /locus_tag="DEHA2A11770r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (TCC) cove score=66.01"
                     /db_xref="GeneID:8998039"
     gene            <992838..>994022
                     /locus_tag="DEHA2A11792g"
                     /db_xref="GeneID:2899459"
     mRNA            <992838..>994022
                     /locus_tag="DEHA2A11792g"
                     /product="DEHA2A11792p"
                     /transcript_id="XM_456842.2"
                     /db_xref="GeneID:2899459"
     CDS             992838..994022
                     /locus_tag="DEHA2A11792g"
                     /note="similar to uniprot|P39013 Saccharomyces cerevisiae
                     YNL084C END3 EH domain-containing protein involved in
                     endocytosis and actin cytoskeletal organization and cell
                     wall morphogenesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11792p"
                     /protein_id="XP_456842.2"
                     /db_xref="GeneID:2899459"
                     /db_xref="GOA:Q6BY77"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /translation="MMPRLEDWEIKKYWEIFQGLNPVDNKITGDKASTVLKNSRLKDD
                     QLSQIWDLSDIDSDGKLDFEEFCITMRLIFDLVNGNQQSLPSELPSWLVPASKAHLIQ
                     ANMAVTTGSNNYQTNNNTITDDDDEDESLSDDFDWYISPTDKSIYETIYDSNSDSYGR
                     VKFDSLTGLYQTLSKVPRSDISSAWNLVNPKSFEAIDKDQVLVFLHILNQRENGKRIP
                     RYVPASLRATFSKDTPSYDLNQAPSKPINSAPVNNKNSFANSYLNKIGHANNATNEKG
                     TDFSATEGTDWEEVRLRRELANLEDLLSKASQKDHTSNKSDDSESAMIKYEYEQLLKY
                     KTNILSELESGSNHNNSKDLGDAKNDIELIENQVTILEEFLNERQNELNKTNEEIRAL
                     RT"
     gene            complement(<994146..>995000)
                     /locus_tag="DEHA2A11814g"
                     /db_xref="GeneID:2899460"
     mRNA            complement(<994146..>995000)
                     /locus_tag="DEHA2A11814g"
                     /product="DEHA2A11814p"
                     /transcript_id="XM_456843.1"
                     /db_xref="GeneID:2899460"
     CDS             complement(994146..995000)
                     /locus_tag="DEHA2A11814g"
                     /note="highly similar to uniprot|Q9UUU0 Yarrowia
                     lipolytica YALI0F02123g nugm NUGM protein precursor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11814p"
                     /protein_id="XP_456843.1"
                     /db_xref="GeneID:2899460"
                     /db_xref="GOA:Q6BY76"
                     /db_xref="InterPro:IPR001268"
                     /db_xref="InterPro:IPR010218"
                     /db_xref="InterPro:IPR020396"
                     /db_xref="UniProtKB/TrEMBL:Q6BY76"
                     /translation="MISSRSVLRKIGQANLRTVSLNSTRLFSSTLIRQNENEELVDLN
                     KLPRKDPGVPIVPLVNPVDYYKDQSEELHKFGKYIMGCLPKFIQQFSVWKDELVIYVA
                     PSALRPTMMFLKNHTAAQFKAVMDVTAADYPSRTNRFDVVYNMLSVRHNSRIRVKTYA
                     SEVSPVPSIVPLFQGTNWFERETYDLFGIFFEDHPDLRRIMTDYGFEGHPLRKDFPTT
                     GYTEVRYDEEKKRVVYEPLELSQAFRNFAVGSSVWEPVGDGKDFTPESFKLPTPEPEP
                     TKDDDDKK"
     gene            <995443..>998022
                     /locus_tag="DEHA2A11836g"
                     /db_xref="GeneID:2899461"
     mRNA            <995443..>998022
                     /locus_tag="DEHA2A11836g"
                     /product="DEHA2A11836p"
                     /transcript_id="XM_456844.1"
                     /db_xref="GeneID:2899461"
     CDS             995443..998022
                     /locus_tag="DEHA2A11836g"
                     /note="weakly similar to CA2799|IPF19769 Candida albicans
                     IPF19769"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11836p"
                     /protein_id="XP_456844.2"
                     /db_xref="GeneID:2899461"
                     /db_xref="GOA:Q6BY75"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6BY75"
                     /translation="MSSTTPKTKRKRRRYSCGPCKTLKIKCNLQTPCQACKKVGRDDK
                     CHEDPPRPPSSEEISISTRRKTLTKRKKQLIGVSEEEDPLSAKHAERDGLEDSFGKSL
                     HKMPVSDTNCSESPSATPGPNNITAESLGNANFEGIAQNVNYSVLPRAMCHSTIDDTK
                     DHGLENSYVSNASVPGSFASMSSTSLSDNQGTTSRNVSLSSSLLSHSLGGDLEDIRLN
                     PDVNNYEYRNSIQHQIMNERYLVVTQAAEQPLNTHNFYLSQPNMTIASPNQDQSNPRF
                     YSNASSIEAEDIQSKQVMFTFNNTDLNIFKTFLPAFSILEEFLHHYILSSNYTYYNIL
                     DIGEIFSVFKGFFNSISNLSSTDTIKIDKNSLKCISHFYGIMSIGYLLSGWENEVLVN
                     LDKQTVIQGWINISSMIRRIIVDSTKVSDILFSIEWYLIIRDFFTYNNLVLDDYSSFI
                     SVVELLKSNKWILDTIKKDTKKISTQADKDVVRVIKYWIYLRIVDLEVPYIMLKGTFI
                     DSTEFENSVVPDKQTFDFLFKDLTNISDPLSNISFDVMKLYFNRTQHTASLKSFLRSY
                     LEFFCDVSSLALDELKDFKKKSLEQNFEQTDSHLRSLVKIQLCQQAAIRWLSFMSIEF
                     THYFPSLRFASYLTSILNLFNHFNCLDSIIKRQTKNQMSLVDILLQTYNYGCFSIFVR
                     CLVYQGIFIVTLKNFKNSTNSILNFREIFDIARRRFHDTFTVFWNSNQVHNKLYPNLP
                     LFRNSFDLCHQMCRMVDNDTQFNSLDDFITHLTSELPLYDYLTQNYFASPDDLRLYLK
                     ILWQLLTHINTDQSTKLIISESLFLNMDLLNSRLDDPTGLTITSEVVDDFAKLVIEPN
                     IHE"
     gene            <998520..>1000220
                     /locus_tag="DEHA2A11858g"
                     /db_xref="GeneID:2899462"
     mRNA            <998520..>1000220
                     /locus_tag="DEHA2A11858g"
                     /product="DEHA2A11858p"
                     /transcript_id="XM_456845.1"
                     /db_xref="GeneID:2899462"
     CDS             998520..1000220
                     /locus_tag="DEHA2A11858g"
                     /note="similar to uniprot|P32329 Saccharomyces cerevisiae
                     YLR120C YPS1 Aspartic protease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11858p"
                     /protein_id="XP_456845.2"
                     /db_xref="GeneID:2899462"
                     /db_xref="GOA:Q6BY74"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6BY74"
                     /translation="MKVSTLLGPIALAAFAVGENPSIFKIDFNVLRGNSKRDLSFEGE
                     RPNFVKRDGSAEMELQNERTFYLANLKVGSNKDEVGVLVDTGSSDLWMMSHDLSCEAP
                     SGSSKRDVIVDSKFPKVKADGGKDKMVDNKNEGHAKHVSKSSEDVVTKSADGNNKAFW
                     DFGGSDSTTMVTVSPEGTGSGGGGSGSSSKSAGGATTNTCTSYGSFKTEGSDTFNRNS
                     SAEAFSISYADGTDANGIWGTDDVRFGDITVKDLSFAIANETSSNVGVLGIGLSGLET
                     TYSNSYGGNYQYENLPLKLKSQGTIEKAAYSVYLGEKDAKAGSILFGAVDSAKYTGDL
                     QTVQIVNTMKSYGYSEAIKLEIIVSGLTFNDSGSEIDLTSSDHTAVLDTGSTYSYFPS
                     SLLKVVGETLNGQYSSSLGAYIVDCVDDDSYYFTIDFSGAKIQVPLSNLVTQYSSNRC
                     FLSILPQTGADYILFGDNVLRSAYLVYDLEDFEISLAQVKYTSDEDISTISSSVPNAK
                     NAPGYSSTAISTSTDETGSITTSNYGSDKKSGASINKLSMIKLYGLIIGMGLLVGVSV
                     "
     gene            <1000519..>1002242
                     /locus_tag="DEHA2A11880g"
                     /db_xref="GeneID:2899463"
     mRNA            join(<1000519..1000529,1000589..>1002242)
                     /locus_tag="DEHA2A11880g"
                     /product="DEHA2A11880p"
                     /transcript_id="XM_456846.1"
                     /db_xref="GeneID:2899463"
     CDS             join(1000519..1000529,1000589..1002242)
                     /locus_tag="DEHA2A11880g"
                     /note="similar to CA3814|IPF4023 Candida albicans IPF4023"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11880p"
                     /protein_id="XP_456846.2"
                     /db_xref="GeneID:2899463"
                     /db_xref="GOA:Q6BY73"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6BY73"
                     /translation="MNNSSDNDESRDNREQVREAAGQEGAADINTADINTADINTAAN
                     TVADHGDRNINDNPSGSNANTSIQGPESSNENDNDNRNEMNIFDRFMDTILGANRNRV
                     QSPIAIPIVSSAGGDATAVASTTTDASNPTGDADSGPDSTNANALSTSTDSNGGAIII
                     TVNYVFSDENNPQNPNRSGSLVMTLPNNSSNRDPRIIQEFIRLATQMAYSTIVNLNKE
                     KGITIDKFNSFDIKTLEELKETSRECSICFEDYLAFSNNGKKRSVVDGSRSQEDTSAK
                     KRKLNNKNAESTSNDSSSSSTTSTSSSSDPNTSRPKYLSEFTGTFEHLPVQMPCGHIF
                     GKSCLFEWLKNHSSCPLCRNSVSEPSTDGTSTNDTNGNVQDNPNITLVHRPALLDIFN
                     SFSRDRESNSPVRRILRSGNGLGENNSPHTHMHTHSFPSQSVDSQDEAQEGESGNQTG
                     VFSHLLNYLRRSQSSESSEPLFPTGVSSRRTTNGVETRSTDRIDSEDNVLEFMNLRSL
                     VDDNRSNNSVNNNATESNNNGDNDNDNADGNNNNASNNDNENESTT"
     gene            complement(<1002342..>1003499)
                     /locus_tag="DEHA2A11902g"
                     /db_xref="GeneID:2899464"
     mRNA            complement(<1002342..>1003499)
                     /locus_tag="DEHA2A11902g"
                     /product="DEHA2A11902p"
                     /transcript_id="XM_456847.1"
                     /db_xref="GeneID:2899464"
     CDS             complement(1002342..1003499)
                     /locus_tag="DEHA2A11902g"
                     /note="similar to uniprot|P47103 Saccharomyces cerevisiae
                     YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11902p"
                     /protein_id="XP_456847.2"
                     /db_xref="GeneID:2899464"
                     /db_xref="GOA:Q6BY72"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6BY72"
                     /translation="MKVELLRPCSYIDISIGGSKTGRIVVELFDDLAPKTSENFIKLC
                     NGSQITKEGSPLTFKGNYFHRVIKNFVIQAGDIENGSSIKDYPNSNVGKGGISIYNNE
                     AFEDENLSEPLDDPFKLCSANDGTSNANKSQFFITTYPQPHLTGKHTVFGRVIHGKSV
                     VREIERVNTDSQNIPTREDIVLIEDCGDWTENMEIPVYNACYDQIGGDIYEEYPDDDE
                     NIDKDSSESVYVASTKIKESGTILFKKGMKLEAFLKYKKCLRYIMEYIPDEDQEPDWY
                     KKYLDIKKKIYLNLSMVCLGLKNFIKAADYSSYLLDMDNLTAQEKAKGHYRKGCALFE
                     LRKYNDALTEFKDAKLLVPEDPAIGPQLDRCESLIESKKQNEKAKYSKFFS"
     gene            <1003620..>1004786
                     /locus_tag="DEHA2A11924g"
                     /db_xref="GeneID:2899465"
     mRNA            <1003620..>1004786
                     /locus_tag="DEHA2A11924g"
                     /product="DEHA2A11924p"
                     /transcript_id="XM_456848.1"
                     /db_xref="GeneID:2899465"
     CDS             1003620..1004786
                     /locus_tag="DEHA2A11924g"
                     /note="similar to CA3816|IPF4017 Candida albicans IPF4017"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11924p"
                     /protein_id="XP_456848.1"
                     /db_xref="GeneID:2899465"
                     /db_xref="GOA:Q6BY71"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:Q6BY71"
                     /translation="MLRQKILRRPRFTSAKCWYSTGSNNYDLQLHSAREDINSLLEVH
                     DRSSYILAQYIPEPARDAFLAIRAFNLEINKINDGGNNTNSVSSKASNQLSGSMGIST
                     TDIKFKFWSDLLSRVFTDPSSEKNLGEPIAILVRDALRNDLNLDLSYFHQFLQTRKHF
                     LQTKSFQTVNDICSYGEGTYSQLNYLTQGLLLSPSISPSAISLLEHSTSLQSKVSDIA
                     AHIGQATAIGSMILGLKYYSSTRNQVTLPIDLMTKFDLSQESVLRLTQGHLKDEKDIS
                     DVREKLKNITYETAVIANDHILSARDKLDKSREEILSIVKSHPNDQVLQKHQKRWRKN
                     IPDVVFTPFMVAIPTTLYLQKLEKYDFDIFHPKLQQQEWRLAWTSFRNYYQRRI"
     gene            <1005255..>1009931
                     /locus_tag="DEHA2A11946g"
                     /db_xref="GeneID:2899466"
     mRNA            <1005255..>1009931
                     /locus_tag="DEHA2A11946g"
                     /product="DEHA2A11946p"
                     /transcript_id="XM_456849.1"
                     /db_xref="GeneID:2899466"
     CDS             1005255..1009931
                     /locus_tag="DEHA2A11946g"
                     /note="similar to uniprot|P39993 Saccharomyces cerevisiae
                     YEL022W GEA2 Guanine nucleotide exchange factor for ADP
                     ribosylation factors"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11946p"
                     /protein_id="XP_456849.2"
                     /db_xref="GeneID:2899466"
                     /db_xref="GOA:Q6BY70"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q6BY70"
                     /translation="MMHEFSKSPTPSIPLGYKQPGISLHPSTSTVSNVAIDPITLMIN
                     DCMTISSAMRKMTRWSQSGVAAILGAGDIFGENDSITNLGLSTNMANNGSSRSTGIND
                     NPLLSSFLQLRSMLTDAKDLYEIDSLTLLQPFLLVIKSSSTSGNITSLALNSISKFIS
                     YEIISFKSKNLQSSLIQIISALTHCRFEAADQSSDDAVLLKVLRLMEDILESPLSKLL
                     PNEVISEVVQTCLSLACNKKRSEVLRKAAEMAMTSITSHIFRQLKDIEPETVGIDDLQ
                     TNFSKTQLPEDLIGGTETTTSILKEEEEEVTNRNIEDKKTEDGQLDENTVEENDQPVE
                     NPREISNSENPKEALDTEEPFGIICINEFLGILISMISPSNQYQHMESTRVFALSLMN
                     TAIEVSGHDIPKHPSLMSLVSDPVSKHVVQIMTTTDSPALLQASLQLFSTIAIVLGRQ
                     LKSQIELTLLLLFNSISPDSVEKNDTINGNETSVATRISGSKEMLIESLSLLWTRSPV
                     FFTHLFIDYDCNFDRTDLSRKFLEFLCKLSLPESAVLTTDNVPPICLEGILTFIGGIN
                     DRIKSLPIDKELSDLQLHSLILDKYKKTTFISCTDILNNKPKAGIKELAEKGFINDEN
                     DADELAHFFFSKSGRLNKKVLGEYLAKPSNIEILRKFINMFEFTGLRVDEALRVLLKS
                     FRLPGESQQIERVVELFAERYVHCQENVVSDSEEEAVKPDRDAVFVLSYSVIMLNTDL
                     HNPKVRHQMDLDAYKRNLRGVYNGKDFPSWYLSKIYHSIKEREIIMPEEHHGTDKWFD
                     DAWHNLISSEAVNIDKDETLEFDNVQLCQFDKVLFEGSVDRIIDTLISVFKEASDDQI
                     ITRLMSSVDKCANICLYYNLSSSIDKLVGLLAELTTLTSEIHHVPSADDNVREEIPIT
                     QIKVEKKDEAITVSEMAVWFGRDFKAQISTVVLFRLIKKTDFKVTESWNKIINIILTL
                     FENCLINPNFFTEFQKKIKLNPLAKVKPRYIINRIKPLKDSGIFSTFSSFLKGYSDDP
                     PEPTDQEVESTLSTIDCVKSLNIPSIFEHISKGPKDNLKLFIELLLDSIPTFKEETKR
                     YFEIENLFLFEIMVCFCLLLDDTSITNSTLDKITYFGGLKDLSRKGNLRVCAYKLLLI
                     RHSDGSHESTLTECIKELSEFDKELISKHGAQLAQPLISLVDDESWFCKKLVNNEEYW
                     KALRIFGSIPIYSSDVLRFVDGIILNSPMEVSPLNYMPLLGLLDEISSLGAAGSQWEQ
                     ETEQLAVSGQKQEDDNSYYRDLVEISKKSISLTAELNSISKRPEFNQKDLSYSLIQAL
                     AHQCFNPCREVRTYAINTLQSTVLSSEINDKFTPAGIFEYGLFPLLSELSKNEVLQTD
                     PNGFARTQTEALSLVSKVFLKYESQFDSEGTDKIWLGILEYFIVFNSLGEKFNMNENL
                     IKESGGELLKNMILVLQNNGILTDSKTELWKTSWEKIEQVYPNLKDELALENSSKVEE
                     GSSVNDDKLNKEQDIEQNQEASKEQNEKQNEVSQKESKKESIEESNEDPKEELKVPEE
                     ERHERR"
     gene            <1010134..>1010937
                     /locus_tag="DEHA2A11968g"
                     /db_xref="GeneID:2899491"
     mRNA            <1010134..>1010937
                     /locus_tag="DEHA2A11968g"
                     /product="DEHA2A11968p"
                     /transcript_id="XM_456850.1"
                     /db_xref="GeneID:2899491"
     CDS             1010134..1010937
                     /locus_tag="DEHA2A11968g"
                     /note="uniprot|Q6BY69 Debaryomyces hansenii DEHA0A12419g
                     URA3 Orotidine 5'-phosphate decarboxylase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11968p"
                     /protein_id="XP_456850.1"
                     /db_xref="GeneID:2899491"
                     /db_xref="GOA:Q6BY69"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /translation="MVKTQTYTERASAHPSPVAQRLFKLMDNKKTNLCASVDVKSTEE
                     FLTLIEKLGPYICLVKTHIDIIDDFSYEGTVVPLLALAKKHNFMIFEDRKFADIGNTV
                     KSQYSGGVYKIAQWSDITNAHGITGSGIVKGLKEAAQESSKEPRGLLMLAELSSKGSL
                     AYGEYTEKTIEIAKSDKEFVIGFIAQRDMGGTDEGFDWIVMTPGVGLDDKGDGLGQQY
                     RTVDQVVTTGTDIIIVGRGLFGQGRDPTVEGKRYRDAGWNAYLKKTGSL"
     gene            complement(<1011001..>1012335)
                     /locus_tag="DEHA2A11990g"
                     /db_xref="GeneID:2899492"
     mRNA            complement(<1011001..>1012335)
                     /locus_tag="DEHA2A11990g"
                     /product="DEHA2A11990p"
                     /transcript_id="XM_456851.1"
                     /db_xref="GeneID:2899492"
     CDS             complement(1011001..1012335)
                     /locus_tag="DEHA2A11990g"
                     /note="similar to CA2800|IPF11366 Candida albicans
                     IPF11366"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A11990p"
                     /protein_id="XP_456851.2"
                     /db_xref="GeneID:2899492"
                     /db_xref="GOA:Q6BY68"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BY68"
                     /translation="MDKDYSSSSSERDFPILSTSSVHNDDMHVGVINSSLEMESLNNY
                     NNQPQSTKNSNQAVTLSTAGIRAIIYQLQALYLRTPVKLFRPSRFDYMAYVRAVANKH
                     DEIYLKPYRVRTHSSVGMLVNVLRKEGWRFIPDQVLPPLIANSATGLILYGTYLSSLD
                     QFDKRHEEEKKQNQRSNYYYSPVDTWRAGLIAGAAQSLAAAPVDAIYTRSSAAEMLNG
                     THQNLWVYGLSKLKEVGLVGVFAGYGFSLIKDSVGFAFYFSVFEIVKTQGYNLTYSTL
                     LAYKRARLSITKKLAKLGVHEEIQQSDEQVLKLEKNRSIKILKSSFILLAGASAAFTL
                     LAVQYPIAKVQKIHLSRLEALDVYNASKSTAYRPFIKLYYNSYIDTYNQVLKIKAKSK
                     ATWFQLSYKGFIRNALTTIPATSVGLLVFEIMRTKLSDTLDEEVFGTGALDP"
     gene            complement(<1012602..>1013537)
                     /locus_tag="DEHA2A12012g"
                     /db_xref="GeneID:2899493"
     mRNA            complement(<1012602..>1013537)
                     /locus_tag="DEHA2A12012g"
                     /product="DEHA2A12012p"
                     /transcript_id="XM_456852.1"
                     /db_xref="GeneID:2899493"
     CDS             complement(1012602..1013537)
                     /locus_tag="DEHA2A12012g"
                     /note="similar to uniprot|P40335 Saccharomyces cerevisiae
                     YJL053W PEP8 Vacuolar protein sorting protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12012p"
                     /protein_id="XP_456852.2"
                     /db_xref="GeneID:2899493"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:Q6BY67"
                     /translation="MSMFFKAPLDIEIRLDNEDTRKHVDVKTPQGRLEKLPIYKDGES
                     VKGTVTIRTREGRKVEHLGVRVQLLGSIETNTDSVVSDDFLSMATELAAPSQLMHPET
                     YPFEFKNVEKQYESYRGKNARLHYYVKVTVSRKSATEITREKELWVYQITAPANQSTS
                     EQGTDARNSQIAQPTTVKMDVGIEDCLHIEFEYSKSRFSLKDVIVGRIYFLLVRLKIK
                     HMELSLIRRETVGAPPNQITDSTTVVRFEIMDGAPVKGETIPIRLFLGGFDLTPTYKD
                     VNKKFSCRTYLSLVLIDEDARRYFKQSEIILYRDS"
     gene            <1014919..>1018851
                     /locus_tag="DEHA2A12034g"
                     /db_xref="GeneID:2899494"
     mRNA            <1014919..>1018851
                     /locus_tag="DEHA2A12034g"
                     /product="DEHA2A12034p"
                     /transcript_id="XM_456853.1"
                     /db_xref="GeneID:2899494"
     CDS             1014919..1018851
                     /locus_tag="DEHA2A12034g"
                     /note="similar to uniprot|P04821 Saccharomyces cerevisiae
                     YLR310C CDC25 Membrane bound guanine nucleotide exchange
                     factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12034p"
                     /protein_id="XP_456853.2"
                     /db_xref="GeneID:2899494"
                     /db_xref="GOA:Q6BY66"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6BY66"
                     /translation="MSKYLEEIAPDAIAPHDTKEELDEPLKHLDTVIALYDFPGTQPS
                     HLPLNLGDTIYVLTKSDSGWWDGVIIYSNNEYGRGWFPHNYVRLINYVQPVLNKLKSN
                     KEIDSLTAANTAANVLIPSFTNLLQKNLGESERNSPANSTRKNSVVSFASSETSIPSD
                     QKAQSILGSGASNHIPSVSDTLNSVELNHEVVFTDVEEAEHILESYRDEHRRNVMWLP
                     RYTTGGDVVYYCHELDLYCQTIPLTTFRSDIDTCSDAAIPPRDAIYDATILKRDSEFS
                     PINEMSDAILTKTDSNSSSSKDFDPLKRESNASSLNSQSTSASAYHHFSQPLFCMDDL
                     FYYQPSDLGSWSELRGKFQYFLNLSYKALKDYDKQLFSTHFSRLNKIISFVVSATRLV
                     QEDFVGTKYEKSIRRKLKRILSSYSQIYSNGLLHLSVMYYDKNVPESRLFSFNLSKFK
                     ARAASTAQDSPTSSISTIKQDPEDHYFDSNKSSKKLSRSDSSFISYLQQIEFEIDNLK
                     YDMNALIKVFRKLSIGKRIKKSDYDGSDPSGDEGEDRYDILPQVYPRFIADEFNGGNW
                     CNPFFESKNTVLNASGDELKNRYHSKIIIDRDAFETIRSYTEEMVKLSEETFEYIDPK
                     IQHLYYNLILKNERNTQILRLIYKYLYFASSMVDMIESFDFTVFCLIHRYASSEDDAD
                     KVMSEFKASQLESESEITSNLTFDYPVVLEFFQLKQQFHDIISRIVMATQSLTLEDPD
                     VFKGIKQEDPLYYDRDILKDPNEKAAMLLSNILMEQNNNVKGKSISLNCDSLMYTYLT
                     DGFRLFESLLPIIQSLIEERESILNYATRVMHNDLNVQLLLMERNNTVLSEKSDEGHA
                     YYAGKKQSDAPWYLEGDDEYDLLLDIKGNIKGGTKQALIAHLTHHDYFDSNFNSAFLL
                     TFATIMPIGEFVDLLINRFNLEAPEGLSYEEYNTWISKKQSPIRLRVMNVIKLLIERY
                     WANSYYDETVLSKLLSFAQGPQIKLFSVSKVLQSHLQSLLNHEKVCFEQEPSIPTSKP
                     PPPLIKGYPMKKTKLLDIDYIELARQLTIKEFKLYSKITKFECLTKVWGNKSGLHEDI
                     SSITNFIRTSNQLTYFVAYMILRKQEVKKRVHLITYFVQVAEKCKQYNNFSSMTAIIS
                     ALYSSPIHRLSRTWKHVPIEALTNLRNMNKLMNSSRNFNEYRDVLKFVGSEPCVPFFG
                     VYLSDLTFVYHGNPDYLMNRSRMINFAKRAKTCEIVTGIDRFKSTAYNLQEVAEVQEY
                     LLSWFDKCPTIEEQYQLSLNLEPRINVHGNNAARNQKYSSGTFSFGKH"
     gene            <1019057..>1022458
                     /locus_tag="DEHA2A12056g"
                     /db_xref="GeneID:2899495"
     mRNA            <1019057..>1022458
                     /locus_tag="DEHA2A12056g"
                     /product="DEHA2A12056p"
                     /transcript_id="XM_456854.1"
                     /db_xref="GeneID:2899495"
     CDS             1019057..1022458
                     /locus_tag="DEHA2A12056g"
                     /note="weakly similar to uniprot|Q06704 Saccharomyces
                     cerevisiae YLR309C IMH1 Protein involved in vesicular
                     transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12056p"
                     /protein_id="XP_456854.2"
                     /db_xref="GeneID:2899495"
                     /db_xref="GOA:Q6BY65"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:Q6BY65"
                     /translation="MFTKLKNFSEDVAKSFNDVNHDGTNGTVHTPNRLKNPINELKNE
                     SKVLNTKTPDASDLTQPEDEPISKSSSPSLTENKAELMKSKTIDLAELPPSIRSKMKK
                     FAKYEEKYPILLEAFKTEKRKAELIVSFEKVLQENTPISSISDAGLLVEYLNGVNEKT
                     AMLNEEMRKYAKENSSLNEKLKDVEARLKEALAKDKESEGEGVTKDSISSQESNDELD
                     KLRNTISDLKGKLEKKQAEDKTVEEKGGENKKEEKTDDRQTKQSEEVDGYKKDIESYK
                     KEIESVKDKLVKSESSSRNIKDELSAAIERSNSLEKDLKKLNDMSKNDNETIGLKTKL
                     EEYKKQLAELVDVNSALETEIENKNKELKNFNDISGTMQNDLGNANKSIENLKSEAQE
                     LNERASDLLNQLDEKNKIIKELEQGQLNSGQPIEATTPDTPSSNNKKNKKKNKKGGKK
                     NSTTDNQIIVNKESEQGLSAKPEDIQNKYDELKKENERIQSCLKEIDSSKQEISDELK
                     RTKEKYDKLVEEHDDLITNHNKVKSDLKLKIEDVDHLRDSLKTIGDDLVQARDEIKEL
                     KAKSKSVKLNNDECLKKELTEMQAKFKELNESKEDIEKSKQELLKSIEDNKSSNSSNE
                     KLLSTVRGEKQKLENSFRELTKDLEASKEKNSDLEKEIEKHLKSIEDNDLSQSSNKAD
                     HDALNEKHSALKSKFEETNKQFEIAKQEKDDLNKRIKELSEFKSNDTSLKLEIASLKT
                     SISHKDQLIENFKKKIDELNKSNEELSGSISKLNASNNELQNSNKDLVSEKNTLVTKQ
                     ELSFEKNNSLNNELLKLQSEKQKLSTELETMKDKHDSLVKDKTSSSNSIQTFRQQYEE
                     LSMKSKESLLRIDNLEDELNESRTMLQERTRESSTIRRMLVDAEEQLKLKNHDFKCEL
                     TKISKEKSEVENNCQALIKKKQREIDEFKSITDNYLLKIQDLENKCNELKQQYEELQS
                     EKSKNKNTISDKDENFEETQQTIETLRRSLQASSKKVKDFENLNNILKRLNEESNLKF
                     ERLSKNYKILTQQYKQIKSSNDSPIESHAQSSESLTKSPSTSSRHSVDDSSSESSNQT
                     NVAYLKNVLLGFFEHKDQRDQLLPVVKTLFNLSSDDEKKFLLALK"
     gene            <1022581..>1023423
                     /locus_tag="DEHA2A12078g"
                     /db_xref="GeneID:2899496"
     mRNA            <1022581..>1023423
                     /locus_tag="DEHA2A12078g"
                     /product="DEHA2A12078p"
                     /transcript_id="XM_456855.1"
                     /db_xref="GeneID:2899496"
     CDS             1022581..1023423
                     /locus_tag="DEHA2A12078g"
                     /note="similar to uniprot|P53177 Saccharomyces cerevisiae
                     YGL050W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12078p"
                     /protein_id="XP_456855.1"
                     /db_xref="GeneID:2899496"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:Q6BY64"
                     /translation="MQDPFDQKKKSILAEIGATDEITPDASPKGTIDEFCIPIIHLIN
                     SNKDMVTTSSCSGRVSVFLEGMKNIDQDDIKIGAKGNYGRWIFVTHDPKDLPDWSSSV
                     NFKYITDGSSYGSTDVNARYILYKFEPLILHVKCRDLEMANNLYSVAMSCGFRESGIG
                     TNNIVGIRISIKLDVPIGFLNETNQELTSFVSEDYLRIITKLSEDRFKENFKKLDALY
                     KAIESLNTLKSPISKVETKEERKSRKMKEGLARREEVRALKEQKKKEKLSSEQQEKHH
                     EQKQ"
     gene            <1023622..>1025310
                     /locus_tag="DEHA2A12100g"
                     /db_xref="GeneID:2899497"
     mRNA            <1023622..>1025310
                     /locus_tag="DEHA2A12100g"
                     /product="DEHA2A12100p"
                     /transcript_id="XM_456856.1"
                     /db_xref="GeneID:2899497"
     CDS             1023622..1025310
                     /locus_tag="DEHA2A12100g"
                     /note="highly similar to uniprot|P04802 Saccharomyces
                     cerevisiae YLL018C DPS1 Cytoplasmic aspartyl-tRNA
                     synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12100p"
                     /protein_id="XP_456856.1"
                     /db_xref="GeneID:2899497"
                     /db_xref="GOA:Q6BY63"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6BY63"
                     /translation="MSEATEKLEKLNIEESKATEVPSVEAGADVPLGEDGQPLSKKAL
                     KKLEKEKEKARKKAEREEQLAKEKAEREAKAANDPAKENYGKLPMINSSYKTGTTRVN
                     IKDLSAANDGEEVVFRARAHTSRQQGATMAFITLRQQDNLIQALIKANGESISKQMVK
                     WVGSINLESIVVVHGVVRKVEEEIKSATVQDAEVHVTKIYTIVETPEQLPVLIEDATR
                     SEAEAEAAGLPVVNLDTRLDARVIDLRTPTNQAIFKIQAAVCQLFREFLSTKGFTEIH
                     TPKIIAAPSEGGSNVFEISYFKGKAYLAQSPQLYKQQLIAADFEKVYEVAPVFRAENS
                     NTHRHMTEFTGLDLEMAFEEHYDEVIDVLSDLFVFIFTELKNRYSKEIATVRKQYPVE
                     EFKLPEDGKMVRLHFKEGIAMLREAGKEVDDFEDLSTENEKLLGKLVREKYNTDFYIL
                     DKFPLAIRPFYTMPDSEDPRYSNSYDFFMRGEEILSGAQRIHDPVLLKERMNAHEIDP
                     SVPGLDDYVDAFTYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPRRLRP"
     gene            <1025660..>1026700
                     /locus_tag="DEHA2A12122g"
                     /db_xref="GeneID:2899498"
     mRNA            <1025660..>1026700
                     /locus_tag="DEHA2A12122g"
                     /product="DEHA2A12122p"
                     /transcript_id="XM_456857.1"
                     /db_xref="GeneID:2899498"
     CDS             1025660..1026700
                     /locus_tag="DEHA2A12122g"
                     /note="highly similar to uniprot|P53290 Saccharomyces
                     cerevisiae YGR163W GTR2 Cytoplasmic GTP binding protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12122p"
                     /protein_id="XP_456857.2"
                     /db_xref="GeneID:2899498"
                     /db_xref="GOA:Q6BY62"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BY62"
                     /translation="MEATILPNPKDSNATILLMGLRRGGKSSICKVVFHNMQPLDTLY
                     LESTSKPTTEQFSSLIDLSVMELPGQLNYFEPNYDSERLFSSVGALVYVIDSQDEYLN
                     ALTNLSIIIEYAYKVNPKINIEVLIHKIDGLSEDYRIDAQRDIMQRIGDELLDLGLEG
                     VQVSFYLTSIFDHSIYEAFSRIVQKLINELPSLENMLDNLVQHSSIDKIFIFDVNSKI
                     YVATDSSPVDIQTYEVCAEFIDITIDLDDLYIENENSMNDSETVIKKQELKSISHLSN
                     GSLLYLKQMIRGLALVALVRHDENNSDLSLDSLMTIIDYNVSNFKKSLMKMWENSKLV
                     EQPNTQNSELMN"
     gene            complement(<1027158..>1027994)
                     /locus_tag="DEHA2A12144g"
                     /db_xref="GeneID:2899499"
     mRNA            complement(<1027158..>1027994)
                     /locus_tag="DEHA2A12144g"
                     /product="DEHA2A12144p"
                     /transcript_id="XM_456858.1"
                     /db_xref="GeneID:2899499"
     CDS             complement(1027158..1027994)
                     /locus_tag="DEHA2A12144g"
                     /note="highly similar to uniprot|P50167 Pichia stipitis
                     ARDH D- arabinitol 2-dehydrogenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12144p"
                     /protein_id="XP_456858.1"
                     /db_xref="GeneID:2899499"
                     /db_xref="GOA:Q6BY61"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6BY61"
                     /translation="MDYSYDNVVPSFRLDGRLAILTGGSGGLAAVVSRALLAQGAQIA
                     LLDMNLERTKAAAKELETWGQESLKGAHESPVGAVSAWSCNIGDFEQVEECFKNINEH
                     HDMVADLLINTAGYCENFPAEEYPSANAEGILKVNGLGAFYVSQAFARPLISSNKKGS
                     IILVGSMSGTIVNDPQPQCMYNMSKAGVIHLTRSLACEWAKFNIRVNTLSPGYILTPL
                     TRNVISGHSDMKEAWESKVPMKRMAEPKEFVGSILYLASESASSYTTGHNLVVDGGYE
                     CW"
     gene            complement(<1029657..>1031780)
                     /locus_tag="DEHA2A12166g"
                     /db_xref="GeneID:2899500"
     mRNA            complement(<1029657..>1031780)
                     /locus_tag="DEHA2A12166g"
                     /product="DEHA2A12166p"
                     /transcript_id="XM_456859.1"
                     /db_xref="GeneID:2899500"
     CDS             complement(1029657..1031780)
                     /locus_tag="DEHA2A12166g"
                     /note="similar to CA4635|IPF1524 Candida albicans IPF1524"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12166p"
                     /protein_id="XP_456859.2"
                     /db_xref="GeneID:2899500"
                     /db_xref="GOA:Q6BY60"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BY60"
                     /translation="MTSSSDLTNKDSSFLQEDSNYDEPNKQDRLESKSINSLASSLNS
                     SREGSPLREPIVYDNDVHDSNSRIRRRSSVGSKSDRGRSHSFITLGTDYLHGSRHSMG
                     SQHSLSRYSTSYCVKEIYGDMPEEDIMIQRTATKSTILNSLSKRVENANIEAERGENL
                     DKESKVEEDVSEEDRLYQEVPDIPVPTTKFGGEFSSIDPELVTWEGTDDPEYPRNWPV
                     RSKILQTAIVSIYTLVPPMSSSVCSPAMPDIAESLGMNSQFLQSFSVSIMVLAWALGP
                     IIIAPLSESDKIGRRWVLNISVWISFIFNLACAFAKTTTQLCVFRFLGGLGGAAPLNV
                     GAGTIADLWDDRGRQFAMAAYSISPSLGPVISPIMSGFIVENTHWKWVFIVLAILNGV
                     VAAVGTLLFKETYSPKLLSLKAKRLREETGNSHLHTIFEIANGETTSEKVMSTVTRPL
                     QLLFSHPMCFGLGSFMAFIYGFMYLMVVTFPSVFERNYGFSVGISGLMFLPMGIGYVV
                     GIAFWTWLIDYFYIKLTEKNNGVSKPEYRLPCLCFAGIGIPIGLVWYGWSAEKKIHWI
                     MPAIGSAIFAFSYIPVFQTIQNYLIDMNTRLSASSIASCSIYRSVFGFALPLAANPMY
                     EKLNYGWGNTMCAFIAFALGIPFPIFCLIYGERLRDWANRRLDKKQAARDARNLKRLQ
                     QQNEMEFAKMDKSQLVTDSSFSKTD"
     gene            complement(<1032049..>1032387)
                     /locus_tag="DEHA2A12188g"
                     /db_xref="GeneID:2899501"
     mRNA            complement(<1032049..>1032387)
                     /locus_tag="DEHA2A12188g"
                     /product="DEHA2A12188p"
                     /transcript_id="XM_456860.1"
                     /db_xref="GeneID:2899501"
     CDS             complement(1032049..1032387)
                     /locus_tag="DEHA2A12188g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12188p"
                     /protein_id="XP_456860.2"
                     /db_xref="GeneID:2899501"
                     /db_xref="UniProtKB/TrEMBL:Q6BY59"
                     /translation="MLHEYLTSTFVSCYIPQLESGGIAMRNRDLIRGDAADQLCEDNG
                     VSSKSSRIRSVLFARLIPHKIGTGWSILYLLRCALLIFVGRCMISVRWVKHFDRREGI
                     FRRTGPRLKN"
     gene            <1032671..>1033675
                     /locus_tag="DEHA2A12210g"
                     /db_xref="GeneID:2899502"
     mRNA            join(<1032671..1032681,1032772..>1033675)
                     /locus_tag="DEHA2A12210g"
                     /product="DEHA2A12210p"
                     /transcript_id="XM_456861.1"
                     /db_xref="GeneID:2899502"
     CDS             join(1032671..1032681,1032772..1033675)
                     /locus_tag="DEHA2A12210g"
                     /note="similar to uniprot|P53045 Saccharomyces cerevisiae
                     YGR060W ERG25 C-4 methyl sterol oxidase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12210p"
                     /protein_id="XP_456861.2"
                     /db_xref="GeneID:2899502"
                     /db_xref="GOA:Q6BY58"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6BY58"
                     /translation="MSSSVFHDYSGFSNATTFGEVYNNFNQIDSLNWMEKLWGSYYYY
                     MGNDLFATGLLFFTLHEAMYFGRCIPWMIIDRIPYFNKYKIQDAKIPSNKEQWECLKS
                     VLTSHFLVEAFPIWFFHPLCQQIGISFEIPFPDISSMLIQLAVFFVCEDAWHYWFHRA
                     LHHGVFYKYIHKQHHRYAAPFGLTAEYAHPIEVMLLGFGTVGIPIVWCLITKNLHLFT
                     VCIWITLRLFQAVDSHSGYEFPWSLHHFVPFWAGADHHDEHHHFFIGSYSSSFRWWDF
                     VLDTEAGPKGKSSREQKMKTKAESKKQL"
     gene            complement(<1033831..>1034217)
                     /locus_tag="DEHA2A12232g"
                     /db_xref="GeneID:2899503"
     mRNA            complement(<1033831..>1034217)
                     /locus_tag="DEHA2A12232g"
                     /product="DEHA2A12232p"
                     /transcript_id="XM_456862.1"
                     /db_xref="GeneID:2899503"
     CDS             complement(1033831..1034217)
                     /locus_tag="DEHA2A12232g"
                     /note="weakly similar to uniprot|P40540 Saccharomyces
                     cerevisiae YIL027C KRE27"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12232p"
                     /protein_id="XP_456862.1"
                     /db_xref="GeneID:2899503"
                     /db_xref="InterPro:IPR018937"
                     /db_xref="UniProtKB/TrEMBL:Q6BY57"
                     /translation="MIQSSVLYLLGSLLFIHAAYSSFEFHQLLKTHIEYDYLPLPTEI
                     TVEVILALVTFIIGSIISVENGPKLSIDNKLIQQDDKYLKKIEMRKAMREFEKVGISG
                     FEEYDSRVDFIDIKQKRKEYSDWLNK"
     gene            <1034993..>1036630
                     /locus_tag="DEHA2A12254g"
                     /db_xref="GeneID:8998052"
     mRNA            <1034993..>1036630
                     /locus_tag="DEHA2A12254g"
                     /product="DEHA2A12254p"
                     /transcript_id="XM_002769983.1"
                     /db_xref="GeneID:8998052"
     CDS             1034993..1036630
                     /locus_tag="DEHA2A12254g"
                     /note="similar to uniprot|P08019 Saccharomyces cerevisiae
                     YIL099W SGA1 Intracellular sporulation-specific
                     glucoamylase involved in glycogen degradation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12254p"
                     /protein_id="XP_002770029.1"
                     /db_xref="GeneID:8998052"
                     /db_xref="GOA:B5RSV0"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:B5RSV0"
                     /translation="MMKLNLIISMLIANFAVSYGLYVPGYDLHYLNTGVAEAVQKVLS
                     LNLFPNYDDKVDSSDTTEQSEYEKWLVTQGNTSFQGILNNIGGISEFLEGTEVSEGAV
                     IASPSKNKPNYFYQWVRDAALTIRSLVHYLEDNNTNNQKICSIIEKYIENNYYLQRLP
                     NNSGRFDDNTRSGLGEPKFMPDCTAFDEHWGRPQNDGPGLRISTIVSYLNLIEKYRLS
                     LSNKFLKDERFIYDEIIKPDLFYIVKNWKKESFDIWEEVNSIHFFTSMSQLRAVIDGL
                     KLAKKYEVDKQFVDQLYESITNLKSFIEVDARFAIPSSLYIIETPGLFSSGKRSGLDA
                     AALLASIHSHDLEVDEYSDVPFDVNDYHILNTINAMASDMRFRYPINRDRIGKPSLGV
                     ALGRYPEDIYDGVGSSEGNPWFIATASAAEVIFKTVYKLSDSQQDLLINKYNQEFFKS
                     FINFEADDLEEFVIPCNSIRYNNALLNLFDFGDSFLKIIKDHVDGNGHMSEQFNKYTG
                     YMQGAMDLTWSYSAFWNALRWRNKTLEVISNHNNNHN"
     gene            complement(<1036688..>1039003)
                     /locus_tag="DEHA2A12276g"
                     /db_xref="GeneID:2899505"
     mRNA            complement(<1036688..>1039003)
                     /locus_tag="DEHA2A12276g"
                     /product="DEHA2A12276p"
                     /transcript_id="XM_456864.1"
                     /db_xref="GeneID:2899505"
     CDS             complement(1036688..1039003)
                     /locus_tag="DEHA2A12276g"
                     /note="similar to CA2797|IPF8404 Candida albicans IPF8404"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12276p"
                     /protein_id="XP_456864.2"
                     /db_xref="GeneID:2899505"
                     /db_xref="GOA:Q6BY55"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BY55"
                     /translation="MTNEDDLAVYDEPRSARQEEFDSLNTSVKLERLNTLIQRSQVYS
                     QIMAENILQNTMDKKQARGIAADTSENHPSKRRKGVKRQTKTPKHDVVSMLSAPSAEM
                     STHKQPRLFSGGTLKDYQLDGMEWLITLFENGLNGILADEMGLGKTIQCIAFLTFLME
                     NGINGPFLIVVPLSTISNWCNEVKRFAPSLKMLKYIGSKQERSDLAISSDYNIVLTSY
                     EISIRDFSKLNRINWKYLIVDEGHRLKNMNCTLIKFLKKLNVNNKLLITGTPLQNNLD
                     ELWSLLNFILPDIFHDLDLFQQWFNFDELTNFQQQNTGNDDETNRLIEMNIQESLVKN
                     LHTILKPFILRRLKKDVIRNLPPKKEYIIHISLSTLQKKLYNDALNNNLLFGLLEVYL
                     KEYIHYNHGDLFDASEITKLMEKKLAVIPAEKRSKLGSFKEADSDDEFDYIEEHIDNS
                     KPELDEKQIAKLPKKKRKEYIFDNLYYKCLKRLKHLSLQNLIIQLRNICNSPYIFYEP
                     FEPYSNKDAQFMDLLLRNSSKFKVLQQLLDELLSKNHKVLIFSQFTKVLDLINDWLVY
                     ENVEICRLDGSMNQSDREEEITEFNAKNSKQQVFLLSTRAGGLGINLTASDTVIIFDN
                     DWNPQIDLQAIDRVHRIGQTKPVKIYRFLIKNSIEEILISKSYSKRFLEKIIIQMGEF
                     KFNKFQKVINEKNLNFKNLVNLSKSFRINGEVKENQSGDNDYDVDERANENKLTDDEM
                     TELLDRSSECYRTEKNFENVSVFETINNMDK"
     gene            <1039435..>1042515
                     /locus_tag="DEHA2A12298g"
                     /db_xref="GeneID:2899506"
     mRNA            <1039435..>1042515
                     /locus_tag="DEHA2A12298g"
                     /product="DEHA2A12298p"
                     /transcript_id="XM_456865.1"
                     /db_xref="GeneID:2899506"
     CDS             1039435..1042515
                     /locus_tag="DEHA2A12298g"
                     /note="some similarities with uniprot|Q12139 Saccharomyces
                     cerevisiae YPR022C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2A12298p"
                     /protein_id="XP_456865.2"
                     /db_xref="GeneID:2899506"
                     /db_xref="GOA:Q6BY54"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BY54"
                     /translation="MSTTNIATSTKPQLFICPSCSKSFTRKDYLYRHEKNHSQVKPFK
                     CDQCNLSFTRSDLLTKHYKSKSHQRVKNELNSCSGKSIVGNSSNSNPKQAPYKVEKRS
                     SRSVDSSTSSIMNDTLLNQHAPSLNQFNKEREMKEFKRLGIPDFLNRHFNDEKIPAPP
                     PQPSIILPAIPSNCNDNSSIASANMFMNRSQEKGKAVDSNTHTSAKEQQNPNSHYLNS
                     HNDSAPTPNTSMPGRNDISGGGSEMDSNAPPGIIDNDLLWLFNDITPVDNLFWLFSDI
                     SPSDNSGTGSGSGSGNKLANSNDWNPTTSSLAEAHSNTNISKSLNNHDDIASFMYQNL
                     YNESTNTKINNNKINMNESTRSRIIHTLSSVNQLNKVSLKRFEEYLDLYWFNFAQTFP
                     IIHQATFDPNTMNIYLLISIIVIGMAHSLDKLEYETSIAINKKLRRIIYDVIEDNTEL
                     PLPLMQALMLHNFSAKNFGDTQLSKIAQIDHGSNIMYLKFSGFLNNLTEPIVYKQKNA
                     SLTELTEQWQNWIQYESCKRSVFFEFICDTQHATFSKIRSLSAFDIKLELPCSDEVWN
                     CADSLRFFEEYQKQPKGLCARPRLDISSKYVYSKELEYLYNNDSNDEIKNDNVYGYGS
                     DNTNFNRTFEFSNNENYLTDSFNIKAPKDTADLSNASDTSRSQQSIKKENKWPTFLWG
                     LKSMMTTYKANQKEYPLDCYSLFSRYIILHGLLRVCWDMRGQSLLDLGFISKKKLGEF
                     FKKLENAFLNWKRYFDLHVKLYEKQIESDEDVYVKHSPNKHLILSLNNYGPTNASWAN
                     ISFYYTGLFCLYADIPSVTMFAAEYKNFHYVTKTVYKGIKEMEYERNKLIIEQWARSI
                     YGKFALVEACKFLRLVYGNEETINTFSHIPQAAYLAALIIWCYEIKRDCRNVEMNRER
                     NDEVERDKIKLDASKYFDLLGNIHYELSRSDAREYFSMILDLKNDLNDDYLDEQNNNQ
                     DFIGRNDYEEFKERQMNTIGVVCYVLHLLRNCKWVYSIDLVQQLEHVIITYEKI"
     gene            complement(<1042691..>1043161)
                     /locus_tag="DEHA2A12320g"
                     /db_xref="GeneID:2899507"
     mRNA            complement(<1042691..>1043161)
                     /locus_tag="DEHA2A12320g"
                     /product="DEHA2A12320p"
                     /transcript_id="XM_456866.1"
                     /db_xref="GeneID:2899507"
     CDS             complement(1042691..1043161)
                     /locus_tag="DEHA2A12320g"