GenomeNet

Database: RefSeq
Entry: NC_006048
LinkDB: NC_006048
Original site: NC_006048 
LOCUS       NC_006048            2305761 bp    DNA     linear   CON 20-APR-2018
DEFINITION  Debaryomyces hansenii CBS767 chromosome F complete sequence.
ACCESSION   NC_006048
VERSION     NC_006048.2
DBLINK      BioProject: PRJNA12410
            BioSample: SAMEA3138183
            Assembly: GCF_000006445.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Debaryomyces hansenii CBS767
  ORGANISM  Debaryomyces hansenii CBS767
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Debaryomyces.
REFERENCE   1  (bases 1 to 2305761)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 2305761)
  AUTHORS   Casaregola,S., Val,M.E., Neuveglise,C., Talla,E., Martin,T.,
            Durrens,P., Barbe,V., Bleykasten,C., Bon,E., Despons,L.,
            Fritsch,E., Groppi,A., Iragne,F., Jauniaux,N., Leh,V., de
            Montigny,J., Pottier,S., Straub,M.L., Wirth,B., Wincker,P.,
            Sherman,D.J., Gaillardin,C. and Souciet,J.L.
  TITLE     The second release of the complete genome of Debaryomyces hansenii
            type strain CBS767
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 2305761)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 2305761)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382138.
            On Apr 13, 2010 this sequence version replaced NC_006048.1.
            This is an updated version of the complete genome sequence. The
            Debaryomyces hansenii sequence is made of 7 chromosomes (A to G).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2305761
                     /organism="Debaryomyces hansenii CBS767"
                     /mol_type="genomic DNA"
                     /strain="CBS767"
                     /type_material="culture from type material of Debaryomyces
                     hansenii"
                     /db_xref="taxon:284592"
                     /chromosome="F"
     gene            complement(<807..>4961)
                     /locus_tag="DEHA2F00110g"
                     /db_xref="GeneID:8999086"
     mRNA            complement(<807..>4961)
                     /locus_tag="DEHA2F00110g"
                     /product="DEHA2F00110p"
                     /transcript_id="XM_002770672.1"
                     /db_xref="GeneID:8999086"
     CDS             complement(807..4961)
                     /locus_tag="DEHA2F00110g"
                     /note="some similarities with CA1884|IPF5486 Candida
                     albicans IPF5486 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00110p"
                     /protein_id="XP_002770718.1"
                     /db_xref="GeneID:8999086"
                     /db_xref="UniProtKB/TrEMBL:B5RU73"
                     /translation="MSVLDDANFPSMEKFFERYGDDGVQEPRDEHYMSHEEYEETYAA
                     QFSYEFGSTKDTKLRDVSETPINYDVSDYYFDPQLGLGIHKEIGLVVVFHRDPRKNYI
                     IRSLLFERYAQAIMCKMTSFRGALQLSRAKDELSSKLVLSCEMGEPGLEHARGKLSPQ
                     CMPLQAVPIHFGFGCGCGIIRRRYGELSRHSCIQRDSIRPMAFQKFPQRYGLRPANFE
                     VYCPTDDGYVEARARDGPASSSSSSSSSSLSGTATTVQNHSRTTTVPDSQHHPLVKKI
                     LQEVDREIVDIQVKGMKEANFVSKIAQLLVGAMTLFSANINHVNLAGLEVVRLFKGAA
                     NNTGGASNNFNRRPSTYFRAVQTYSTCVQYSKYMAELVYMVLMYGPKPAASLALTEML
                     DKYRDDEVVLEVNSRDYHNLTGYSQFITAEERTRILDQTFTESSLRDIDQLVHWIMDH
                     CIRKEFDENLSVAGDEQRQQQQQQPDIDIESDAIAAGILDEDGDDNNETPEVYLEAMN
                     TTMSSSQQQTAAESLASLYYPVYGVNNNAEEEEEQNTSNENAFVVYLGYLGAKYPTKQ
                     YCRSLSGICYVAKTCVLLDIIKRARTRRVSLRDAEDPSVVDTGSYRILAQVRTHYTYL
                     GLSLARSEGNLFRLNFSTGDIFNSDNVVVGHTNMISKIFGRLYDLAQETIQDLSNGEE
                     LDYSVDNARLSDGMVSFTECVRVPSYSRYKHRLLSIHNNNIDSFRKAHTNLSLILITL
                     LHISCLPARSTEIDRLSVEGTSKEYRGVYFLGPTFGFCYNYNKSANSKDPIIREIGPE
                     LSSLFLWYVLVFRRMYVESSRVESSEKLYQFDAMSPDKIRRGVSYWFTYGMDNQREYK
                     FCEVRQILKRCIEFHYTKSVTADLDMYRSVYETIARTSGHSVATSTEHYGTIANYPPS
                     VNAADVLRSRHLGQVWHRSGLRRKFIGFEGEVVEPEGEPGDVDEVVASDVSIDPASPV
                     NEEIEEVEPLRDDIGGNPVYEDDEVEEVEPLRDDIGGNPVYADDEVDSISDMLMEIPR
                     IDYNRAVGSDPTPVPPLEPSAVPPSEPPAPDAPPVSVSWNDSSLSPNHASSPYVHQLP
                     GYRPPFSPPYHAPIAPYHAPASSGFALPPQDAYLGAPLYDAHVSREVLSGARKRHSRE
                     KKERKERKMERKRKEKERISKREEDIRKREEKIRKREEKEKIRKREKREKRERKRAEE
                     KREKESAALASPVTPVRTLKVKDVHLYSSATSGRLFRSESPSGPSGPSSPRAMPSGPP
                     TPNSSARRVHPLIYQSSTQSSAVPGSSHPTRVQKQSKQPKQPPSARSLGSPPSFPETP
                     RRSLLSPQHLRQRITESLQASPLGRFFAPSDSPKSVARKGPKIPKNDPVVDDSDYSES
                     DYSDED"
     gene            complement(<5249..>6253)
                     /locus_tag="DEHA2F00132g"
                     /db_xref="GeneID:2903925"
     mRNA            complement(<5249..>6253)
                     /locus_tag="DEHA2F00132g"
                     /product="DEHA2F00132p"
                     /transcript_id="XM_460367.1"
                     /db_xref="GeneID:2903925"
     CDS             complement(5249..6253)
                     /locus_tag="DEHA2F00132g"
                     /note="similar to CA3328|IPF10564 Candida albicans
                     IPF10564 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00132p"
                     /protein_id="XP_460367.2"
                     /db_xref="GeneID:2903925"
                     /db_xref="GOA:Q6BN53"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6BN53"
                     /translation="MSSLVANHSKSINAKDISFTNILVVGGSYAGISFLKGIVNQVRK
                     ENKRKLDSKLNNKKLLITMVEPRCGLLNIIGLPRSILDVEFAKSQFLSFRKINLMFDN
                     IYNKYGCYMNNQKPVDSFKHQESSLTLNHIQGKVIHLDNKSAEYVLDENGPKKKIYFD
                     YVVLATGRDRNSPITPKANTGPMFVKEMSDFNKTIEKYNIISIIGGGAVGVEIAANIK
                     KYFPKKNVNIIHPHYSLPPEPLSCEFKDSAYRSLVDAGINVILGTRILRECDNGNLET
                     NNGEIITSEFNFWSYIVNTGTLFGVSCRVSRVYGFMGVYCRFGKCLGCRKSWIWLSLD
                     "
     gene            <6898..>10197
                     /locus_tag="DEHA2F00154g"
                     /db_xref="GeneID:2903926"
     mRNA            <6898..>10197
                     /locus_tag="DEHA2F00154g"
                     /product="DEHA2F00154p"
                     /transcript_id="XM_460368.2"
                     /db_xref="GeneID:2903926"
     CDS             6898..10197
                     /locus_tag="DEHA2F00154g"
                     /note="similar to uniprot|P33302 Saccharomyces cerevisiae
                     YOR153W PDR5 Short-lived membrane ABC (ATP-binding
                     cassette) transporter actively exports various drugs
                     expression regulated by Pdr1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00154p"
                     /protein_id="XP_460368.2"
                     /db_xref="GeneID:2903926"
                     /db_xref="GOA:Q6BN52"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BN52"
                     /translation="MGWDCPKRQTTADFLTSLTNPAERVPRPGYEDKLPYTPVEFEEY
                     WKKSPQYKKLIEDIEEYLKQKEGSDRDLYHQAHVARQSNHISQKSSFTVSFFMQTRYI
                     MSRNILRTKGDPSIALQSIALQVVMGLIIGSTYYNLETTTGSLFYREAVLFFAILFNS
                     FSSILEIMSLFEARPIVEKHKQYALYRPSADALAGIITELPTKFFMSMGFNFFVYFLS
                     NMRRDAGRFFFYWLMNALCTLVMSHFFRSLGAVSTSFPGAMTPATVVLLAMVIFSGYC
                     IPPPNMLGWSRWIGYINPVSYVFEALMINEFNDREFTCSAFVPAGPSYMDISSDQSIC
                     SVTGSRPGLSFVNGSDHIAVTYEYYNSHKWGCFGIIVGFIVFFLVLYVILSEFNKGSM
                     QKGEVTLFLKSSLKEHKKQAAKGAATTKDIENSNISNEKISHKDQLDANKEENNNNNN
                     ALPSSKDIFHWRDLTYQVKIKSEDRVILNHVDGWVKPGQLTALMGSSGAGKTTLLNCL
                     SERVTSGIISDGTRMINGQELGSSFQRSIGYVQQQDLHLPTSTVREALRFSAQLRQPN
                     SVSIQEKNEYVEYIIHLLDMNLYADALVGVAGEGLNVEQRKRLTIGVELVAKPKLLIF
                     LDEPTSGLDSQTAWSICKLMRKLADHGQAILCTIHQPSAILLQEFDRLLFLQKGGKTV
                     YFGDLGENCHTLIDYFEKYGAHHCPEEANPSEWMLEVVGAAPGSHANQDYHEVWKNSA
                     EYQMVKDHLTEMETELVKIPRDESQEAKRSFAAPIWKQYLIVTKRIFEQNWRSPSYIY
                     SKLILVISSSLFNGFAFFKADRSLQGLQNQMISIIQFLVPFMTLVQQMMPYYIKQRDI
                     YEVREAPSKTFSWFAFITAQITSEIPYQVVIGTLGFFCWYYPVGLYDNAVPTDSVDSR
                     GVLMWLYITAFYVYTSTMGQLCISFIEVPENAANLAVNLFTVCLIFCGVLAPYDFLPG
                     FWTFMYRCSPMTYFVQGMGSTGLSNVEAVCSESELLRFEPRSGQTCGSYMADYIKQTG
                     GYLVDGNATSKCEYCTTKSTNDYLASVDSLFSERWRNWGIVICFIAFNIIFTVFFYWI
                     ARVPKSNRQKK"
     gene            <14009..>14590
                     /locus_tag="DEHA2F00176g"
                     /db_xref="GeneID:2903934"
     mRNA            <14009..>14590
                     /locus_tag="DEHA2F00176g"
                     /product="DEHA2F00176p"
                     /transcript_id="XM_460369.1"
                     /db_xref="GeneID:2903934"
     CDS             14009..14590
                     /locus_tag="DEHA2F00176g"
                     /note="similar to uniprot|Q6F9D3 Acinetobacter sp
                     ACIAD2568"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00176p"
                     /protein_id="XP_460369.1"
                     /db_xref="GeneID:2903934"
                     /db_xref="GOA:Q6BN51"
                     /db_xref="InterPro:IPR000566"
                     /db_xref="InterPro:IPR002446"
                     /db_xref="InterPro:IPR011038"
                     /db_xref="InterPro:IPR012674"
                     /db_xref="InterPro:IPR022271"
                     /db_xref="InterPro:IPR022272"
                     /db_xref="UniProtKB/TrEMBL:Q6BN51"
                     /translation="MLNNFRIFDSSWSKRVLVALLIASILLIPVHTKKEEMPVVEKIE
                     LDKYLGKWYEIARKPFLFQKKCYSNVSAKYSLNDNANINVDNSCYSKDGKLRQAIGEA
                     FTQNPPFNSKLKVSFLPKAIRFLPIGRGDYWILKIDDNYQTVLVGGPSRKYMWILSRS
                     QNHDEIVVQDYLDYAKEIGFDVSDIIMTKQTNE"
     gene            <16091..>17515
                     /locus_tag="DEHA2F00198g"
                     /db_xref="GeneID:8998848"
     mRNA            <16091..>17515
                     /locus_tag="DEHA2F00198g"
                     /product="DEHA2F00198p"
                     /transcript_id="XM_002770673.1"
                     /db_xref="GeneID:8998848"
     CDS             16091..17515
                     /locus_tag="DEHA2F00198g"
                     /note="weakly similar to uniprot|P53388 Saccharomyces
                     cerevisiae YPL265W DIP5 Dicarboxylic amino acid permease
                     mediates high-affinity and high-capacity transport of
                     L-glutamate and L-aspartate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00198p"
                     /protein_id="XP_002770719.1"
                     /db_xref="GeneID:8998848"
                     /db_xref="GOA:B5RU74"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B5RU74"
                     /translation="MRWIGVYGSIFPNELSATGVVMTYWTDKSPSIFINTFSVIVIAV
                     NCYNVACFGEVEFWFEMSKLSLVIALVLSGIILDLGGIKDQERLGFRYWIYPRPFAAY
                     FATGSLVRFIDFWKAITTVVYSFGGVQTMFIVFAGEALYPRRTTYRAAKRIFFRAFIM
                     YSSPVFVLTLIVPYNNPSIASSTGSAAGSPFVAMKRVGVKGFPHIINGVVLTSALSAQ
                     NNAIGEGSRYLYVLAAKGQALQSFLKVNKNKLPYVATIAIGMFLPLAYMSVSSGADNV
                     LGWFTSLISAYLLLKWITIAVNHILLSRAMRNKSILEIYYLIDSKSQVSHLSSPFFWS
                     VIFLLTSDFANFLHGNFVISSFISAYLIIPISLVLYFGYKFIKKMKIKNSSKIKLKQL
                     FQHVVNNPEPPFPKKRPWEYIAAIWDRSLCYLEVGDGRVSNLSTIILDVLLNLYLKHV
                     IILFIASLYIQILRYKLIHYQIQI"
     gene            <18642..>19418
                     /locus_tag="DEHA2F00220g"
                     /db_xref="GeneID:2903936"
     mRNA            <18642..>19418
                     /locus_tag="DEHA2F00220g"
                     /product="DEHA2F00220p"
                     /transcript_id="XM_460371.1"
                     /db_xref="GeneID:2903936"
     CDS             18642..19418
                     /locus_tag="DEHA2F00220g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00220p"
                     /protein_id="XP_460371.2"
                     /db_xref="GeneID:2903936"
                     /db_xref="InterPro:IPR022167"
                     /db_xref="UniProtKB/TrEMBL:Q6BN49"
                     /translation="MYFSGVDIDIITYYDPENRCITISIDLFIRVLNNYEQNTRVFLD
                     THLLKIRGNEDEQERRAEKLVSKGNASVDLGNMPFIPIVVYTSRALITAEFREMSSDD
                     FKEAYLGPLDSVIRESCIRSLPLVRQYKYPSGDAMRMEQTIQEYFNEIAIPIRQLYRD
                     VGDVNNYFGSPSIVRPALDQRRIIQPDIIHMRSESDSDMQYPEIVFGIGDYKTGVYKM
                     MEGFEEFKTAISNRRRLRSHSIGKFFPDREWSPRVLLRWF"
     gene            <19523..>19849
                     /locus_tag="DEHA2F00242g"
                     /db_xref="GeneID:8998849"
     mRNA            <19523..>19849
                     /locus_tag="DEHA2F00242g"
                     /product="DEHA2F00242p"
                     /transcript_id="XM_002770674.1"
                     /db_xref="GeneID:8998849"
     CDS             19523..19849
                     /locus_tag="DEHA2F00242g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00242p"
                     /protein_id="XP_002770720.1"
                     /db_xref="GeneID:8998849"
                     /db_xref="InterPro:IPR022167"
                     /db_xref="UniProtKB/TrEMBL:W0TYS9"
                     /translation="MIIDYHIIHDPETVEDGITLRSAIAGFFYKSVGDAADTKARLME
                     IFSVASSTDVKSIKESDPFFNVHPRDPSGSSGKLDRPGFSGNLDSVKENDSSDNFDAI
                     DGNTYC"
     gene            complement(<23680..>25641)
                     /locus_tag="DEHA2F00264g"
                     /db_xref="GeneID:2903943"
     mRNA            complement(<23680..>25641)
                     /locus_tag="DEHA2F00264g"
                     /product="DEHA2F00264p"
                     /transcript_id="XM_460372.1"
                     /db_xref="GeneID:2903943"
     CDS             complement(23680..25641)
                     /locus_tag="DEHA2F00264g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00264p"
                     /protein_id="XP_460372.1"
                     /db_xref="GeneID:2903943"
                     /db_xref="GOA:Q6BN48"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BN48"
                     /translation="MNNNTFPNSIRRYILEGGGEDKDMDIDVDADIDLFEITKFNYRT
                     LFDKSTHQNISHTEMVYKFFGIENISDVDLEPQSQKWYFKNHPDEWRELFIFLCVMPF
                     TEYEFQGKDGKLLNPDSLRAIGSSHGTDNVLIETFSELEFKSFNKIIPEGRLAFNLEN
                     ILKTEIFSSNFNQDEPKRILTKLLGVCFKEDYMLVTDISSTDEDTYKENFKKYLFNPI
                     CEYVAALLYFEINVRTKNTAGRTGVNTKVPHQSNDIFHSHPDVVAYDKWKHRRSLAIV
                     EVKKLPILKGEKVVDFTEPRMVSFMIQVVAEMFSDHTNKGMLTDSYTTILIEIDIERS
                     MEIVHQKLTGPGNCKFIALNYRILDCQSSGLTLRGGLISFIYEAFSANEYQLNDVKRG
                     LDAIYDYVRKSDEEYLTYLDGLGEKADQIYKNNYSAFMRKLHVIEPKITLGEFKRIDV
                     QSGVTFNSQLFKVNSKDVKMYLKEDFDETVELVVKVFDPAKAKRDHSKYVIKKHDMFD
                     NCRRAYLCEKRAYERLLPNFKFNSVYIAQEPVYGRFFIGNHYHALGPFIVLKYLAKET
                     LPRDEETYEKAKEQLNIIHLYNIIHGDISPRNILYSQGKVYFIDFGYSEYTEDKLGSN
                     PVSANPERIKSEHQQLCGIFGQPTPNEYE"
     gene            complement(<27509..>27799)
                     /locus_tag="DEHA2F00286g"
                     /db_xref="GeneID:2903855"
     mRNA            complement(<27509..>27799)
                     /locus_tag="DEHA2F00286g"
                     /product="DEHA2F00286p"
                     /transcript_id="XM_460374.1"
                     /db_xref="GeneID:2903855"
     CDS             complement(27509..27799)
                     /locus_tag="DEHA2F00286g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00286p"
                     /protein_id="XP_460374.2"
                     /db_xref="GeneID:2903855"
                     /db_xref="UniProtKB/TrEMBL:Q6BN46"
                     /translation="MSAMKILKPKYLYQTRVLYAKLAGRFCTFAKYSRNATIEEVIHR
                     PKPLSVAQAMHVMMQTYVLVARDPTPSLRTVHHRFSMAIPGFKTIPCNWVEA"
     gene            <27919..>29847
                     /locus_tag="DEHA2F00308g"
                     /db_xref="GeneID:8998851"
     mRNA            <27919..>29847
                     /locus_tag="DEHA2F00308g"
                     /product="DEHA2F00308p"
                     /transcript_id="XM_002770675.1"
                     /db_xref="GeneID:8998851"
     CDS             27919..29847
                     /locus_tag="DEHA2F00308g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00308p"
                     /protein_id="XP_002770721.1"
                     /db_xref="GeneID:8998851"
                     /db_xref="GOA:B5RU75"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022167"
                     /db_xref="UniProtKB/TrEMBL:B5RU75"
                     /translation="MPRMYFSGVDSDTITIDDPSNRCITINPELFIRVLNNRELNTRV
                     FLDTHLLKIGGNEDGQERRAEKLVSKGNASVGLGNMPSIPIVVYTSRALITAEFREMS
                     SDDFKETYLAPLDNALRESSIRSRPLAQEYKYPRGDAMHIEQAIQEYFDREIARTIDH
                     LYRDIGDITNHFCSPSFVKSPLDGKRAVQPDIIHMLTKSDLNTQYPEIVFGIGDYKTG
                     VYKMTQGFEEFKTAISNRRRLRSHSIGNFFPDREWSPRVLFALVLSKYIYQAFLCGTD
                     RILISDHQTFSGFFKYEIVDGEMIIDYHIIHDPETVEDGITLRSAIAGFFYKSVGDAA
                     DTKARLMKSFDIANNTGIKKLEESDPFFNVRPRDPSGSSGKLARREFSGNLDSVKEND
                     ASDNFDAIDGNTYCRVIYDSAEFYPDLKLPSPVFVKLYYYSSRLWEENSLMCLEIPEK
                     EGYYGMFFNELLINERIAKSEFASNFPKLLVSGYWNGLSDHPMHIFEYLGKEVPEEKW
                     NNKEVYEVIKSRLEELHSIGISHNDIRLANIHVSVSGKISLIDFGLSDYTNNEEHKKN
                     DFETLDYILRANGSNENYKHANRVNGEAISADRADEDDKYGNDSNSSSEEVFDEGSSG
                     TFGTQITIEDIASKSSQR"
     gene            <33041..>34786
                     /locus_tag="DEHA2F00330g"
                     /db_xref="GeneID:2903858"
     mRNA            <33041..>34786
                     /locus_tag="DEHA2F00330g"
                     /product="DEHA2F00330p"
                     /transcript_id="XM_460375.1"
                     /db_xref="GeneID:2903858"
     CDS             33041..34786
                     /locus_tag="DEHA2F00330g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00330p"
                     /protein_id="XP_460375.2"
                     /db_xref="GeneID:2903858"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BN45"
                     /translation="MKKVPKRKEVNSKRQFSTVITSIGIPLIFVPLRSITTTIGSPLL
                     QEDTKVVNAWNHDTIAGHSISLFDFLLSSKRVDLVKADACNDEKELERSIINAIDHLP
                     KNIISKNREGRKYSIAKASRVSGILLDDVNLEVNTTSLRNVLYVAEASISREIKHTKF
                     VNLPESISGKFSEYLFNHYRVVSCGNQKFEDSKISILRVCLPLIIGNITVLKCVLVLS
                     FYDLLNGDSPELLEKENEMHALHVQVLEELKDRLNYYSSVCCDHSLLCVLLLLTIELI
                     NGANGPLWRKLQKLSLSMIALRGGVKRISSNITGLCLLKLLTMSLSTGISIQSLDSNN
                     GDALSFKDFSSSMSTNNQFQFFDNFNYKSSLTLNELKEVIEIYGHISSLQSLMSVSLD
                     ANRNKHFWTPEHFMKYKSVSSANLIRVLQNAEKLEKHISIRCKETHLNNTSRCHEIQM
                     TFALNVSKLYIYQMVYHQASGSPKTILLVKELLIKAESVFDVFKSIHEHEVNSMTVMI
                     LPLFCLGVDLISKDVRDWYIDKLNQLLVKTKRKMIKTSIELLQKVWNLNRDGTLFLDW
                     ISLSAANCSYISLTC"
     gene            complement(<34941..>36455)
                     /locus_tag="DEHA2F00352g"
                     /db_xref="GeneID:2903859"
     mRNA            complement(<34941..>36455)
                     /locus_tag="DEHA2F00352g"
                     /product="DEHA2F00352p"
                     /transcript_id="XM_460376.1"
                     /db_xref="GeneID:2903859"
     CDS             complement(34941..36455)
                     /locus_tag="DEHA2F00352g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00352p"
                     /protein_id="XP_460376.2"
                     /db_xref="GeneID:2903859"
                     /db_xref="GOA:Q6BN44"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BN44"
                     /translation="MSMDTTEKLNTYVQVTHFSSKEELKNIDEAFKFSLETECMDLDP
                     SKEKKLVKKIDMFILPIMCILMSCQLMDKSTNSYASIVGLRTDLNMTSQEYSWVGSSF
                     YLGYLFSEYPANMLLQRFPLSKTLALAVVCWGIIICCHGACQSSASFLLCRTLLGIFE
                     AFMDPAYMLMTSQWYRKEEQYIRCGIWLGLQGFGTMLGSGLAYGVYKHETLFHFAPWR
                     LLFVVTGVITIVFGLVSFIHVPDIPTKAWFLNEEEKKYAVERIRKNKTGFGSKVYKPT
                     QFKEALTDPCIYLFFFYMCGYGITNGSIGNFGSILLNEEFEFPTGQALLLNMVGSGVD
                     IVFPLFFAYVNKILIPSRLATSFLINSIIYIGICLIAFAPQKGAKLTGYFVSFLTTAS
                     WACMSSVVSSNVAGHTKKITANTTFLIGFCVGNIIGPQAFIGSEAPIYITAKRVMAGT
                     YVLTVVSAGSLLVIYYLRNKKKDQLQGTSNSEDNAHLSFGDLTDQENPSFRYVL"
     gene            <36777..>38237
                     /locus_tag="DEHA2F00374g"
                     /db_xref="GeneID:2903860"
     mRNA            <36777..>38237
                     /locus_tag="DEHA2F00374g"
                     /product="DEHA2F00374p"
                     /transcript_id="XM_460377.1"
                     /db_xref="GeneID:2903860"
     CDS             36777..38237
                     /locus_tag="DEHA2F00374g"
                     /note="weakly similar to uniprot|P78573 Aspergillus
                     fumigatus Fructosyl amine: oxygen oxidoreductase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00374p"
                     /protein_id="XP_460377.1"
                     /db_xref="GeneID:2903860"
                     /db_xref="GOA:Q6BN43"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6BN43"
                     /translation="MTLNKDSKIILVGAGVFGLSNALHLAKSGYKNVTVFDRLDFGAN
                     HYTLLEGADTASADINKIFRAQYAEKKHYQELAFRAFEIWQEWDRKIQLLPESEVKEF
                     TGLRLLDLCGMLRLDDQVGWEELASRDNFAREGLGPLRFDINDKNDLKRAKAQGYGPK
                     VQFALDLQSKIPDLEGVFDSTSGMLYASRCLQYAAYLCKSMGVRFIMGGDKGTFKEYV
                     MISNKIVGGIVTRDGKKHEAELVVINCGPWSTSLVPELDGINEGTGGNILICKIPDSR
                     KDLKVKYSSKNFPIIGWKSGHSREHDYLAGMFIFPVIEPEGILKIIVRQTKYTNPEKL
                     ANGRVVSIPKTSNSNPPFEALPRHIVYQVREWLQTFFPDLIDLKWESRILWYTDTINN
                     DYIYDYVPNKKGLFVACGGSGHAFKMLPVLGQFLVDKIEGRENFYTKLFAWRNAKDYE
                     KDPNGLREGLNGARVYKRQLMSSPEDYIFNKMAPHL"
     gene            <38847..>40187
                     /locus_tag="DEHA2F00396g"
                     /db_xref="GeneID:2903861"
     mRNA            <38847..>40187
                     /locus_tag="DEHA2F00396g"
                     /product="DEHA2F00396p"
                     /transcript_id="XM_460378.1"
                     /db_xref="GeneID:2903861"
     CDS             38847..40187
                     /locus_tag="DEHA2F00396g"
                     /note="similar to uniprot|Q7S638 Neurospora crassa
                     NCU04771"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00396p"
                     /protein_id="XP_460378.1"
                     /db_xref="GeneID:2903861"
                     /db_xref="GOA:Q6BN42"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6BN42"
                     /translation="MESTKDIIIVGAGIFGLSTAIALAERYANRTIHVVDRFEPPVPD
                     GSSVDTTRCIRFDYKDETYCRLAHESMNLIKADPMISKLFHQQGMTFVYDGNHDTWED
                     IFLSSKSSAEKVNEREEGKMDYYDSAEDVFRSIHNRSPNSVETTELGGPKKWNKGYTN
                     RVNGFIDARASIKVYYERARNFPNVNFRFQEVEKIDYFKNTKKVKGVLLKNGDKISAD
                     LVIVAAGAWSCKLVNLDNISKSSAIEVVWFKVTPSMEKEWKQMSITTNLSTGINIFPP
                     YNGEIKVLRRSAGYKNTVAIESPSPFSRVKQEISVPRTIIDSPKDWIPEEAEIEIRGN
                     LKEIMPSLCELPFDRTKLCWLTQTTTSNFIIDYYPEAENVLVATGGSAHAWKFVPIIG
                     DKVVDFIEGRLETELIRKWSWKEKLTSTVENENAPRMKGDPKEMKECIRNVYDL"
     gene            <42433..>42792
                     /locus_tag="DEHA2F00418g"
                     /db_xref="GeneID:2903862"
     mRNA            <42433..>42792
                     /locus_tag="DEHA2F00418g"
                     /product="DEHA2F00418p"
                     /transcript_id="XM_460379.1"
                     /db_xref="GeneID:2903862"
     CDS             42433..42792
                     /locus_tag="DEHA2F00418g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00418p"
                     /protein_id="XP_460379.2"
                     /db_xref="GeneID:2903862"
                     /db_xref="UniProtKB/TrEMBL:Q6BN41"
                     /translation="MWFGSAENLLLPSVTDLQNDGLIYFEQENVVASIVALASVIGSG
                     RLLSPENNGQISGRSFLCSKLFNDGSGCINVEVSVTAQLLPDVSDAEFSIGSDQTIYL
                     SSVTSRLSFLTGGLLEN"
     gene            <42796..>43008
                     /locus_tag="DEHA2F00440g"
                     /db_xref="GeneID:2903863"
     mRNA            <42796..>43008
                     /locus_tag="DEHA2F00440g"
                     /product="DEHA2F00440p"
                     /transcript_id="XM_460380.1"
                     /db_xref="GeneID:2903863"
     CDS             42796..43008
                     /locus_tag="DEHA2F00440g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00440p"
                     /protein_id="XP_460380.2"
                     /db_xref="GeneID:2903863"
                     /db_xref="UniProtKB/TrEMBL:Q6BN40"
                     /translation="MLVLVAGFGNGSRIIIDFTFIRYLYDGDTESLREAFLGSTNVVF
                     EIELGYSSDQFNDNVVIVALQDFFSI"
     gene            <43589..>45070
                     /locus_tag="DEHA2F00462g"
                     /db_xref="GeneID:2903864"
     mRNA            <43589..>45070
                     /locus_tag="DEHA2F00462g"
                     /product="DEHA2F00462p"
                     /transcript_id="XM_460381.2"
                     /db_xref="GeneID:2903864"
     CDS             43589..45070
                     /locus_tag="DEHA2F00462g"
                     /note="similar to uniprot|P11491 Saccharomyces cerevisiae
                     YDR481c PHO8 alkaline phosphatase a glycoprotein localized
                     to the vacuole"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00462p"
                     /protein_id="XP_460381.2"
                     /db_xref="GeneID:2903864"
                     /db_xref="GOA:Q6BN39"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR018299"
                     /db_xref="UniProtKB/TrEMBL:Q6BN39"
                     /translation="MKISNFATYIATLSMFFTANAAPVEPNKKQNIILMVSDGMGVAT
                     LDLARQYNAVVNGLELPSLLNLDDYLIGSLRTRSNSSFITDSAAAGTALACGKKSYNK
                     AIGVDPDRNPIGNVGEALKIEGYTVGIVVTTKITDATPGVFYAHSDSRSYEDLIAEQL
                     VGEHPLGRIPDLVMGGGRTYFYPNTSEGGSRADSRNLIEEIQNNGTWSYAGNRQEFDE
                     LDGGNNVTLPLLGLFADKDIPYKIDRNESVYPSLNEQVQVALTALTEATKDSEKGFFL
                     MIEGSRIDHAGHANDAAASVRETIEYDSAWKEVLDFADASEVETLVVSISDHETGGIS
                     LNAEKAEDYQPLINATHSGEYLSKEINNFSDIDDDALFTKFIKSEIIEKGLGIYNYTN
                     EEIERVKNTKNNEEPEYTEVLANLTSSRAKIRFSSYEHTAVDVGVYAHSNSDRLQYKV
                     LDRINGLAGAHENTDYPKFLQGIVGFDMDDVTELIQDIQHTLD"
     gene            <47628..>49208
                     /locus_tag="DEHA2F00528g"
                     /db_xref="GeneID:2903867"
     mRNA            <47628..>49208
                     /locus_tag="DEHA2F00528g"
                     /product="DEHA2F00528p"
                     /transcript_id="XM_460382.1"
                     /db_xref="GeneID:2903867"
     CDS             47628..49208
                     /locus_tag="DEHA2F00528g"
                     /note="weakly similar to uniprot|P39709 Saccharomyces
                     cerevisiae YAL067C SEO1 Putative permease member of the
                     allantoate transporter subfamily of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00528p"
                     /protein_id="XP_460382.2"
                     /db_xref="GeneID:2903867"
                     /db_xref="GOA:Q6BN38"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BN38"
                     /translation="MSVENNFQSNVEKVKVDSEISSKQGGLGYENAILDTSSDISENR
                     AGNVDAEERRIVKHWYDGFVRLFLWYPSYLDGKEKKLLLKLDFCILTYVCCSYFTKSL
                     DKSNITNAYVSGMRNDIEFTGDDLSYAKSLYSAGYIVSMCFGMLFVTRPWARYMLPTL
                     ELIWGVLTFCGAAVRNSSDMFALRFLIGLAEGPIFCTVVHILGSWYKRDEIYRRVMVF
                     SISSSLGGMFSGYLQSAAYETLSGKGGLAGWKWGFIIDGIFTVPIALFGFFIFPGAPY
                     QVKKLWWLSAEDLTLAKERTQTSGIATPGALNFSLVKRVFLRWHVHYFTAFWVFLNVL
                     ALPDGTAFPLWLSANSPERFSISQVNNYPTIQSAVGIIAQFLLAGLADTFSIYPFLTI
                     TQCLFIISYSSLAAWNIPDGWRWVCFLIIGFDGVNQAIISGWANRSCRHDNEERAFVL
                     GFSDAVSQAINVWTNIVFYPTSDAPKFRKGFIVSLVGAIVMLFLPILGYMGDRFDRKQ
                     LENSHESDGVESRVEEIK"
     gene            <50934..>52661
                     /locus_tag="DEHA2F00550g"
                     /db_xref="GeneID:2903868"
     mRNA            <50934..>52661
                     /locus_tag="DEHA2F00550g"
                     /product="DEHA2F00550p"
                     /transcript_id="XM_460383.1"
                     /db_xref="GeneID:2903868"
     CDS             50934..52661
                     /locus_tag="DEHA2F00550g"
                     /note="weakly similar to uniprot|P38767 Saccharomyces
                     cerevisiae YHR032w and similar to CA4294|CaERC1 Candida
                     albicans CaERC1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00550p"
                     /protein_id="XP_460383.2"
                     /db_xref="GeneID:2903868"
                     /db_xref="GOA:Q6BN37"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6BN37"
                     /translation="MSNERMDKYILSNTDGQSSYGSSVNNGLSIPSDIDRFDSSNQGD
                     FSGDERGIRCSSVNDTSPLLKASYDSHSKSVAQELIEQERGFLKYHNRIPNKGNENQA
                     IKRFEETISSKKITDTTALIELKSLFVASVPLSMTFLLQCSFSTVSVFTAGHLGSVEL
                     ASVSIGSMTASISGYAIIQGISSALDTLCPQAFGAKEYYLVGTYLQKCVAMNFTIMVP
                     ILFIWTFFGYEVITGFLPDNDTAKYAAVYLRYTAPGIPAYILFECGKKFLEAQGIYHI
                     STIVLLFAAPSNLVMNLLFVKTFGYIGIPMAISINYWLMTFGLFVSIVYFIKPHSTPS
                     GKHPLTCWNGLHIKQAFQSWNEIVYLAVPGLVMLEAKFFALETLTLIASYLGTLSLAA
                     QSVGTAIASLSYQVSIAIGIASSTRIANFLGAGSNSAAKKTTQVSLCFVLVFSIINVL
                     FLYCFQTRIAPLFTKDEKVIKIVESIMWLIALLQICDAINAGSAGCLRGQGQTKIGGI
                     VSLLSYYLIGIPLSIYITVYSKFKGTIDGLWIGNCAALIIIGVVQSYYALFADFIRLC
                     TDAQKRASN"
     gene            complement(<53845..>55479)
                     /locus_tag="DEHA2F00572g"
                     /db_xref="GeneID:2903869"
     mRNA            complement(<53845..>55479)
                     /locus_tag="DEHA2F00572g"
                     /product="DEHA2F00572p"
                     /transcript_id="XM_460384.2"
                     /db_xref="GeneID:2903869"
     CDS             complement(53845..55479)
                     /locus_tag="DEHA2F00572g"
                     /note="similar to uniprot|P39932 Saccharomyces cerevisiae
                     YDR536w STL1 Glycerol proton symporter of the plasma
                     membrane subject to glucose-induced inactivation strongly
                     but transiently induced when cells are subjected to
                     osmotic shock"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00572p"
                     /protein_id="XP_460384.2"
                     /db_xref="GeneID:2903869"
                     /db_xref="GOA:Q6BN36"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BN36"
                     /translation="MGLRGRALRVAITFTAVSGFSFFGYDQGLMSGIITGDQFNKEFP
                     PTAGKSHDAVVNQGGVVSCYEIGCFFGALFALFQGDKYGRRPMLIIGSLLIILGTVIS
                     VASFGPHWGLGQFIIGRVITGLGNGMDTATIPVWQSEISRAENRGKLVNLEGSMIAIG
                     TFVAYWVVFGLSYVDTSVQWRFPVAFQAIFGIVLFGAIINMPESPRWLIAHDKKDEAN
                     YVLAALSDVDITDDIVIAESGVITDGVNRFSRSEVGFKELFSGGRSQHFSRMIIGAST
                     QFFQQFTGCNASIYYSTVLFENLGMGEDFEKLPLIMGGVFATVYALATIPSFFLIDRL
                     GRRALFLIGATGQAIAFTITFACLIPDDGQNKETAKGAAVGIFLFIAFFAFTLLPLPW
                     IYPPEINPLRTRTVASAISTCTNWLSNFTVVMFTPLFMNESQFGCYLFFAIFNYILIP
                     TTIWFYPETAGRSLEEIDIIFAKAYVDKRPPWRVAATMPRLSLQEQDEEAIKLGLFDE
                     FEKEGFEHSENLSSHSSRKTPEDRSHDESLVRPEGV"
     gene            complement(<56616..>57611)
                     /locus_tag="DEHA2F00594g"
                     /db_xref="GeneID:8998853"
     mRNA            complement(<56616..>57611)
                     /locus_tag="DEHA2F00594g"
                     /product="DEHA2F00594p"
                     /transcript_id="XM_002770676.1"
                     /db_xref="GeneID:8998853"
     CDS             complement(56616..57611)
                     /locus_tag="DEHA2F00594g"
                     /note="weakly similar to uniprot|Q7S675 Neurospora crassa
                     NCU07100 Hypothetical protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00594p"
                     /protein_id="XP_002770722.1"
                     /db_xref="GeneID:8998853"
                     /db_xref="GOA:B5RU76"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:B5RU76"
                     /translation="MGHACGHNLIATGAIAAAIASSEAMRKFNFAGTIKLFGTPAEEG
                     GDGKGKMLKAGAYNDVDVSLMHHGNSESPGQAFVRTAASFRFNIEYFGKSAHAGACPW
                     QGVNALDAASIFMHSSSLLRQQFEATDRIHFVVTDGGAAANIIPDYTRIKGIIRAINR
                     GKMAELKEKLVGCIKAGALGSGCAYKINYENEYNDMVSNIPLTDSFREFFNGFCDNDN
                     EPKLKDLDHERILVSSASTDQGNVSWEIPSLHSFFCIKADKEPHTIEFCEAAGKKSSH
                     DSCLKSAKCMSLTGLKVLYDEEFYTKIYSSWKADVESLKPKSVDLNALDNEFTYS"
     gene            <59465..>59632
                     /locus_tag="DEHA2F00616g"
                     /db_xref="GeneID:8998854"
     mRNA            <59465..>59632
                     /locus_tag="DEHA2F00616g"
                     /product="DEHA2F00616p"
                     /transcript_id="XM_002770677.1"
                     /db_xref="GeneID:8998854"
     CDS             59465..59632
                     /locus_tag="DEHA2F00616g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00616p"
                     /protein_id="XP_002770723.1"
                     /db_xref="GeneID:8998854"
                     /db_xref="UniProtKB/TrEMBL:B5RU77"
                     /translation="MVHLSTVDSDNESIASEISDSASVSTQYTSTLASPESKLHKHLS
                     IEEVEDEECLY"
     gene            <60636..>62249
                     /locus_tag="DEHA2F00638g"
                     /db_xref="GeneID:2903872"
     mRNA            <60636..>62249
                     /locus_tag="DEHA2F00638g"
                     /product="DEHA2F00638p"
                     /transcript_id="XM_460387.1"
                     /db_xref="GeneID:2903872"
     CDS             60636..62249
                     /locus_tag="DEHA2F00638g"
                     /note="weakly similar to uniprot|P32467 Saccharomyces
                     cerevisiae YHR092C HXT4 High-affinity glucose transporter
                     of the major facilitator superfamily expression is induced
                     by low levels of glucose and repressed by high levels of
                     glucose and similar to CA0480|IPF8610 Candida albicans
                     IPF8610"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00638p"
                     /protein_id="XP_460387.2"
                     /db_xref="GeneID:2903872"
                     /db_xref="GOA:Q6BN33"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BN33"
                     /translation="MLIKIYNPFKKEEDRPTPSSVYNWRIYFVGLISSFAALEIGYDS
                     GFIGGTLALNSFRKEFGFDRMSESHSSFIISNIVSLFHAGCFFGSILSYPITFYKGRK
                     VVLISSALFMALGAVLMLISNKDRGLGPIYAGRILAGIGVGQSTSIVPTFLSEISPPP
                     IRGRVSAMYEIGWRTGDLIGFWVSYAVDENMSTGYVQWILPFAIQIIPAALYLALVWW
                     VKESPRWLFSVGKDSEAIENSKFYRKLDDGNDYLLSEISSIKESVNEAKKKVGTGIAG
                     PFLILLREPKLQKRLLVTASLYVFQNLLGVQSINYYSPIIFGKIGVDGTNATLFSTGM
                     FGVVKYIATIIWLMFIVEQIGRRNTLLYVSPICAVCFFYIGAYLKVEGGAAAGRAALG
                     LMYVWCFFFIIGWSGTPYIVGAEVFDNSLRASFQAINSMFLWLSVFFMTRFTTDMIEG
                     MDYGIFFFFASMALISIPWVYFLLPETKGIPLENMEELFDYPAPRAHILVFNSLKCGS
                     DILQDKADESSLTSNGNLKQETIHVEKVV"
     gene            complement(<62898..>64151)
                     /locus_tag="DEHA2F00660g"
                     /db_xref="GeneID:2903873"
     mRNA            complement(<62898..>64151)
                     /locus_tag="DEHA2F00660g"
                     /product="DEHA2F00660p"
                     /transcript_id="XM_460388.1"
                     /db_xref="GeneID:2903873"
     CDS             complement(62898..64151)
                     /locus_tag="DEHA2F00660g"
                     /note="some similarities with uniprot|P08678 Saccharomyces
                     cerevisiae YJL005W CYR1 Adenylate cyclase required for
                     cAMP production and cAMP-dependent protein kinase
                     signaling"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00660p"
                     /protein_id="XP_460388.2"
                     /db_xref="GeneID:2903873"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q6BN32"
                     /translation="MNILFRLPIELMGETLSHLSPDELTYKFDLEGLIYDTTFNSYSK
                     VRQMAFFVKYKGKHVTISNTNINDTHQLSNFQLQYLNITQMVIKPKVISFVLFDCNNR
                     SSYNFISFMLSHHFKLLKSFTNKFSFQLSIHDDNLIDINLLNGILYHFSYNNYIVNWF
                     SIHYKTVKQITGVQQTSFEENSHDLNHGSIENLKLHLFNSSRLMEHFMYFRNHNCLCG
                     NLKTLDLSYNNINDENLAKLYFPDSIQDLNLSNNNLHTISNNFNINNLANLRNLNLSN
                     NNLIRISISINISFNLEVLVLSGNNLNNCNFLCKPFFQNLSKLNISRNLISNLINLPT
                     SLERLDLSGNYLSSFFNEQTSNVFPASLVELNLSWCKILFKARLNVIEAKRTLHIENL
                     HKLKSLILSGNYYYNIDSEILQVCK"
     gene            <65202..>66521
                     /locus_tag="DEHA2F00682g"
                     /db_xref="GeneID:2903875"
     mRNA            <65202..>66521
                     /locus_tag="DEHA2F00682g"
                     /product="DEHA2F00682p"
                     /transcript_id="XM_460390.1"
                     /db_xref="GeneID:2903875"
     CDS             65202..66521
                     /locus_tag="DEHA2F00682g"
                     /note="weakly similar to uniprot|P07991 Saccharomyces
                     cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse)
                     catalyzes the second step of arginine degradation
                     expression is dually-regulated by allophanate induction
                     and a specific arginine induction process"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00682p"
                     /protein_id="XP_460390.1"
                     /db_xref="GeneID:2903875"
                     /db_xref="GOA:Q6BN30"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BN30"
                     /translation="MSLYSSIDEKEFWLKSKSLLPYGGVFTPAIITKAKGVYIYTHDG
                     KRILDFTSGQMSCLLGHGHPEISKTITEHAFNLDHLFSGMICPPVVNLAHMLTGILPD
                     GLDKAMFLSTGGEANEAAIKLAKICTGNFEVVGLSLSWHGMTGASNATTYQSGRSGQG
                     PMIPGNLVLPAPNGYRSIFRKPDGSYDWETELDYGWSLIDSASVGSLAAVIVEPILSS
                     GGMLVLPDGYLRAMKKHCEKRGMLLIVDEAQTALGRCGSMFAFGDSGVIPDILSLSKT
                     LGNGIPLSAIVTSEQLSERGNKKGFLFYTTHVNDPLPAAVGLKVLEVIIRDNLVDKAR
                     IMGNIFKSELDKFKQEYNFIGDIRGKGLMVGIEIVKNRQTKESDPDLAKVLADKMMEL
                     GLSANLIAVASFGGIFRIAPPITITEEELRHGLSIMNDAFRAIRNQL"
     repeat_region   complement(67161..67306)
                     /note="solo LTR of Debaryomyces hansenii Tdh2
                     retrotransposon"
                     /rpt_type=long_terminal_repeat
     gene            complement(<67391..>68701)
                     /locus_tag="DEHA2F00726g"
                     /db_xref="GeneID:2903876"
     mRNA            complement(<67391..>68701)
                     /locus_tag="DEHA2F00726g"
                     /product="DEHA2F00726p"
                     /transcript_id="XM_460391.1"
                     /db_xref="GeneID:2903876"
     CDS             complement(67391..68701)
                     /locus_tag="DEHA2F00726g"
                     /note="similar to uniprot|Q96W94 Saccharomyces kluyveri
                     PYD3 Beta-alanine synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00726p"
                     /protein_id="XP_460391.2"
                     /db_xref="GeneID:2903876"
                     /db_xref="GOA:Q6BN29"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q6BN29"
                     /translation="MTYETLIIKKDRLINTIHETASKFGAKGVWGPGLTQTGVCRLAL
                     SDEDKNVRDWFVKETQFLGCEVKVDAIGNIFAIYPGKNPGPPTGIGSHLDTQPNGGRY
                     DGIYGVLSGLEVLRTLKENGIIPNYPIALVNWTNEEGARFPRSLIASSLWAEIVSEEE
                     ALGLESISDKVPVSIGDELKRIGYNGPIMSSYKSNPLAAHFELHIEQGPILENENKKI
                     GIVTGVQAYTWYTVTVRGKSSHAGTTPMNTRSDAMQIASKLILKGIDIAQKHDGLATI
                     GTIDLEPASINVIPDTVRFSFDARHVNDDKLTELMDNVKLEFKSIAEKGNCSKYSQSL
                     EVEFDHIYTSGAVSFDETNIDTVKKSALELFSTDDVKEIVSGAGHDSCATSIRVPTSM
                     IFIPSKNGISHNPEEYSSPEEIDNGFRVLLNTILRYDELRRKNP"
     gene            <69404..>70984
                     /locus_tag="DEHA2F00748g"
                     /db_xref="GeneID:2903877"
     mRNA            <69404..>70984
                     /locus_tag="DEHA2F00748g"
                     /product="DEHA2F00748p"
                     /transcript_id="XM_460392.1"
                     /db_xref="GeneID:2903877"
     CDS             69404..70984
                     /locus_tag="DEHA2F00748g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00748p"
                     /protein_id="XP_460392.1"
                     /db_xref="GeneID:2903877"
                     /db_xref="GOA:Q6BN28"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BN28"
                     /translation="MSLYEEKNSVETNLHQYRLSKDPEKSIHPIISVKSTIREDVENG
                     AIGLDLYEQAQELSKDEIESEYLKIRRKIDRRLLPILCITYTLQFLDKLSLNYASAYS
                     LKEDLGLTGQRYSWVAAIFNFGYLFWALPSNYIIQRAPVAKYTGVMLFVWAIILIAHI
                     GCQNYGGMLVVRFILGMFEAGISPACMTICSMFYTREEQPFRMCTFLSCNGIATIVGA
                     LLGYGLGHSTNASIKSWKLIFLVIGLLNLVWSVVFIWLCPDSPATATFINEREKAIVV
                     DKISKNNMGIKDKKIRRYQIIEAVSDPAVWLISFIGLSCGIVNGGVSNFSSALMKGYG
                     FSGLNATALQLPTGAIEFVVVFIAGIIAISVKNTRCIIFVLLCVPGLAGLIGIHLINL
                     DHKWALVGCTWLQFIIGGPVILSWIFLTGNIGGHTKKTISNGFWFTLYAAGNIIGANI
                     FYANEAPKYTSAIVGLITCYSGMMVIGIGYRFLLIHRNKKRTYEQGEYNDEIAKQAVI
                     DGFNDLTDFENRGFRYAI"
     gene            <72231..>73133
                     /locus_tag="DEHA2F00770g"
                     /db_xref="GeneID:2903878"
     mRNA            <72231..>73133
                     /locus_tag="DEHA2F00770g"
                     /product="DEHA2F00770p"
                     /transcript_id="XM_460393.2"
                     /db_xref="GeneID:2903878"
     CDS             72231..73133
                     /locus_tag="DEHA2F00770g"
                     /note="weakly similar to uniprot|Q03529 Saccharomyces
                     cerevisiae YMR272C SCS7 Required for the hydroxylation of
                     the very long chain fatty acid (VLCFA) located in the
                     endoplasmic reticulum"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00770p"
                     /protein_id="XP_460393.2"
                     /db_xref="GeneID:2903878"
                     /db_xref="GOA:Q6BN27"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6BN27"
                     /translation="MFVGILVNASEQERLDDGDEDLASSFRNELPTFDLMTKDTDAKK
                     DFERYRFLDIAEPLMPQIMSAHWTKDFYLDQVHRPRHCSKGARVYPNSIVDILCSRVP
                     WWAILIYSPIGIASFIVGKRSLAELGASNDIYKWLLIGCLFWTFAEYILHRFIFHMDR
                     YLPDYNQTLFALHFAIHGVHHFLPMDPERIAAPPPMVLLLNFLLWYVSYATMGPAYGN
                     IFYAGGFASFLWYEEFHISLHTNPEFYQFWTGWWSHHTEMKRYHLQHHYKNYDWGYGV
                     TSKLWDFPFGTVLDSADANQVHSK"
     gene            <74487..>76001
                     /locus_tag="DEHA2F00792g"
                     /db_xref="GeneID:2903880"
     mRNA            <74487..>76001
                     /locus_tag="DEHA2F00792g"
                     /product="DEHA2F00792p"
                     /transcript_id="XM_460395.1"
                     /db_xref="GeneID:2903880"
     CDS             74487..76001
                     /locus_tag="DEHA2F00792g"
                     /note="similar to uniprot|P46367 Saccharomyces cerevisiae
                     YOR374W ALD4 Mitochondrial aldehyde dehydrogenase that
                     utilizes NADP+ or NAD+ equally as coenzymes"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00792p"
                     /protein_id="XP_460395.2"
                     /db_xref="GeneID:2903880"
                     /db_xref="GOA:Q6BN25"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6BN25"
                     /translation="MVSTNLPLEIPITLPNGIKYTQPTGLFINNEFVRSKQGNKFEVL
                     SPSTEEVVTSVYEAREDDVDIAVQHASRAFEESSWAKADPCQRGAALYKLANLIEENF
                     ETIASIEAMDNGKAIGNAKGDVTLAISVLRSTAGFSDKMLGSVIESGDSHFNFTRREP
                     LGVCGQIIPWNFPLLMFTWKIAPALVTGNCVVIKSSETTPLSALYVSNLIKEANLFPP
                     GVLNVISGFGKYTGNAITEHPLIKKVAFTGSTATGKTIMRKCAESNLKKVTLELGGKS
                     PHIIFNDADMDTTLKSVVTGIFYNSGEVCSAGSRLYIQEGIYDAFVEKFVQTTKSDVK
                     VGDPFLPDTIQGAQNSVDQLDKILKYIQIGTDEGAKILAGGERLQGKGYFIKPTIFGD
                     VKEDMRIVQEEIFGPVITISKFKTTDDVVRMANNTDYGLAAGIQTSNVNRAIDVSRRL
                     KAGTVWVNTYNDFHPMVPFGGYNSSGMGREMGVEVLQNYTQTKAVRMSIIKPKD"
     gene            complement(<76156..>77049)
                     /locus_tag="DEHA2F00814g"
                     /db_xref="GeneID:2903881"
     mRNA            complement(<76156..>77049)
                     /locus_tag="DEHA2F00814g"
                     /product="DEHA2F00814p"
                     /transcript_id="XM_460396.1"
                     /db_xref="GeneID:2903881"
     CDS             complement(76156..77049)
                     /locus_tag="DEHA2F00814g"
                     /note="some similarities with CA3202|IPF3444.5f Candida
                     albicans IPF3444.5f unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00814p"
                     /protein_id="XP_460396.2"
                     /db_xref="GeneID:2903881"
                     /db_xref="UniProtKB/TrEMBL:Q6BN24"
                     /translation="MDGTRLDIVKEILSGNGISLKEEKGNIEDSAKIQTTYIRRLEND
                     IHLVSSFINQANVSIEKLILKTKNTSHEDSISLKKDIIALSDTYGRLPYLSDKSDVIG
                     IASASSIIDSLIQQQTEASIHLNKKNEIDSYEITSKQALVEEYKRLLQLIDQKHITEQ
                     EKLEEIDQKTSAMESDPISKGSQIGALNIKLDEARQSENLLSTYLKRIIIKYLALSDW
                     ESQQVITEEKLQENVNVCIELIDKLVVSSINSTAWVEIDPNEIESKFINHLLMNNTII
                     SRDDSTKEKLFLSLRTFGSEF"
     gene            <77245..>77517
                     /locus_tag="DEHA2F00836g"
                     /db_xref="GeneID:2903792"
     mRNA            <77245..>77517
                     /locus_tag="DEHA2F00836g"
                     /product="DEHA2F00836p"
                     /transcript_id="XM_460397.1"
                     /db_xref="GeneID:2903792"
     CDS             77245..77517
                     /locus_tag="DEHA2F00836g"
                     /note="similar to uniprot|P57744 Saccharomyces cerevisiae
                     YJR135W-A TIM8 Mitochondrial intermembrane space protein
                     mediating import and insertion of polytopic inner membrane
                     proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00836p"
                     /protein_id="XP_460397.1"
                     /db_xref="GeneID:2903792"
                     /db_xref="GOA:Q6BN23"
                     /db_xref="InterPro:IPR004217"
                     /translation="MSQISQTALASLDESSRKDIMQFIESENSKSKVQMSIHNFTDMC
                     FKKCNANKPITSGTLDSSEEQCLTNCLNRFLDTNIKVVQALQGAQK"
     gene            complement(<77631..>79349)
                     /locus_tag="DEHA2F00858g"
                     /db_xref="GeneID:2903793"
     mRNA            complement(<77631..>79349)
                     /locus_tag="DEHA2F00858g"
                     /product="DEHA2F00858p"
                     /transcript_id="XM_460398.1"
                     /db_xref="GeneID:2903793"
     CDS             complement(77631..79349)
                     /locus_tag="DEHA2F00858g"
                     /note="some similarities with CA3204|IPF3446 Candida
                     albicans IPF3446 Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00858p"
                     /protein_id="XP_460398.2"
                     /db_xref="GeneID:2903793"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR018870"
                     /db_xref="UniProtKB/TrEMBL:Q6BN22"
                     /translation="MSDSWLDNLDNLSGILDEGSIGENRLSSVQMDLIYINTIKPYNL
                     TSKMLSDQILHKKQSVKNTAFFVLEAAIFKESMETEKQQDFVELCSKVTSSLDIPNQN
                     WNWIVPANSHKSENYFYYRLRLLCALIYKACIKDSSVTDQSLILNLLAPLSYHMHPKL
                     PWTSELNSKTIENFIADNNKVRDMIHSVIPLYIDKKLKPELLNLSSTKGQYIRNSLSN
                     PKTTPAGYAIGNSGSTRLLQGGLRPKLGYGGTRTEVIAEDQRQAWKSSTKVKSISMIW
                     FVIYTITSNEHLNQFWPLITSFILNLIDDHDPLMKAQSCELLNYFMLMIDHSKDYKQH
                     ILLKTGLVDLLIESCKTCLTYLPNLTPSDQSFYLLSIAYPTVVKLCVLNCKKEANFLS
                     LVELINGNILSSATHIHNSNGPNSNYPLLSLLFNQLDIIIKYYLKTNVLICLSRLNFT
                     INQVMSNPDIFEEGIEGVNCIKSALNVQSSILQSFKSLNDREGLKLILNYKYDFLAVW
                     TILQKRLKHNLVEHSNVDVSGLCDLNCKLLIQLSKNCQAIEFENLQTDLKQILKANPD
                     VNFPLE"
     gene            <79499..>80539
                     /locus_tag="DEHA2F00880g"
                     /db_xref="GeneID:2903794"
     mRNA            <79499..>80539
                     /locus_tag="DEHA2F00880g"
                     /product="DEHA2F00880p"
                     /transcript_id="XM_460399.1"
                     /db_xref="GeneID:2903794"
     CDS             79499..80539
                     /locus_tag="DEHA2F00880g"
                     /note="similar to CA3205|IPF3448 Candida albicans IPF3448
                     Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00880p"
                     /protein_id="XP_460399.2"
                     /db_xref="GeneID:2903794"
                     /db_xref="GOA:Q6BN21"
                     /db_xref="InterPro:IPR007342"
                     /db_xref="UniProtKB/TrEMBL:Q6BN21"
                     /translation="MKQHKHYLSRCQFAITTKLRRNFVSIPLVISEEIQQTLNDKQKP
                     IVSLESTIITHGLPYPDNLSMATEVERIIRANGAVPATCAFIEGIPYVGLTSHQLEYL
                     SEQASKKEINKVSRRDIGYTMANKVNGGTTIASTMILSHLAGIKVFATGGLGGVHKDG
                     HLTMDVSADLTELGRTPVSVVCAGPKSILDIGLTMEYLETQGVFVGTYNDNNRTRIEI
                     PGFYCRDSGIQSPYSFNSFVQAASIIHSQNNLMSLKSGNVFCIPPPEDSALPSELINN
                     IIEKANEEAKEKGIRGKNLTPFLLSKIANDTKGKSVECNINFVYNNAVSATKIAKELL
                     LLENNSEPNVCY"
     gene            <80773..>81987
                     /locus_tag="DEHA2F00902g"
                     /db_xref="GeneID:2903795"
     mRNA            <80773..>81987
                     /locus_tag="DEHA2F00902g"
                     /product="DEHA2F00902p"
                     /transcript_id="XM_460400.1"
                     /db_xref="GeneID:2903795"
     CDS             80773..81987
                     /locus_tag="DEHA2F00902g"
                     /note="similar to CA3206|IPF3454 Candida albicans IPF3454
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00902p"
                     /protein_id="XP_460400.2"
                     /db_xref="GeneID:2903795"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6BN20"
                     /translation="MNDSNPGQTRSSMGGVGYNVSLACKYGLESPSCSSENIDRSSYR
                     FVSVVANDFAGRSLLKHLDSNKVDTSGIKIIKDSKNSTAQYSSIHNTNGELLVACADM
                     AIIEEDFITEHTVTQLARAKPDCIVLDCNISSSAMSNILQYIRNNLEKTKVIIEPTSA
                     PKAARLSHVNSKNLKVFPNNIISLVSPTVAELNTFHSSFSNRELFDDYDEWFPLLDTL
                     GVDSLFREKLNKQAQQYEVLREGLKRGFLQQSFQLLPYLPNILLKLGPSGLLYIGLST
                     SIGDYSSIPTTSDYCPEFTITTNGKEFIDSDGKSKKMGIVIQYFPIPEVNKNLKVKNV
                     TGAGDSLLGYLTARLSLSSKNIVGKAWLEPEINRIEDEWFKWESIYKAQISSGLSLQS
                     NEAISPEIAKIK"
     gene            <82068..>82961
                     /locus_tag="DEHA2F00924g"
                     /db_xref="GeneID:2903796"
     mRNA            <82068..>82961
                     /locus_tag="DEHA2F00924g"
                     /product="DEHA2F00924p"
                     /transcript_id="XM_460401.1"
                     /db_xref="GeneID:2903796"
     CDS             82068..82961
                     /locus_tag="DEHA2F00924g"
                     /note="weakly similar to uniprot|P38884 Saccharomyces
                     cerevisiae YHR198C FMP22 The authentic non-tagged protein
                     was localized to the mitochondria and similar to
                     CA3207|IPF3456 Candida albicans IPF3456 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00924p"
                     /protein_id="XP_460401.1"
                     /db_xref="GeneID:2903796"
                     /db_xref="GOA:Q6BN19"
                     /db_xref="InterPro:IPR016087"
                     /translation="MFRSGFIHNTRFNFSKVTTKRLFSSSARPIHSLRIKSLTLGVCG
                     FSAITGLALYNHRLIELDNKKQDISPNISIAVDSSISPFPTALISANQTNLNTDFQLL
                     GYGVRSVTFVNFKVYGIGLYIANDDVNKTKKILSPNYLSTFGTENHSLRELLSDPEFS
                     AQLISKLLEENVRFAVRISPVRNTDFNHLKDGLIKSILAHPESKENKEIVSNGLEELR
                     NVFSGYRGSVPKNHVLWLEILKQGSLSISYENPVKNELTSMGQVKEPIISKLLFLQYL
                     SGKKPLSEPLRKSCNDGFIGL"
     gene            <83456..>85450
                     /locus_tag="DEHA2F00946g"
                     /db_xref="GeneID:2903802"
     mRNA            <83456..>85450
                     /locus_tag="DEHA2F00946g"
                     /product="DEHA2F00946p"
                     /transcript_id="XM_460402.1"
                     /db_xref="GeneID:2903802"
     CDS             83456..85450
                     /locus_tag="DEHA2F00946g"
                     /note="weakly similar to uniprot|Q7Z7X5 Pichia angusta
                     MPP1 ZnII/2cys6 transcription factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00946p"
                     /protein_id="XP_460402.2"
                     /db_xref="GeneID:2903802"
                     /db_xref="GOA:Q6BN18"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6BN18"
                     /translation="MVRSKNGCISCRRKKKKCDEAQPICTLCSKTNSVCEYPVSHGMF
                     LQKNNKGIPDYQGTKRVKIRDKEPEDSFEDTSSEEHSLNDAYQPHKIVHLNSIAMEKS
                     TLPSYPLGSLSPELLKDGHGLDMNDLVETAPKDVDDPMLIQTNKKSPEYQELYDTFRD
                     FMFLNAASQGPQSPVQMPLGLKDVDIVNHFKSFLDYNTEVSLNEMQEILPQVVSGNSL
                     LSFASVSPKIAGSSTEITSLKDTSSTREFSSTKPQTTNEQIRDEQPDPVVDEIKLNHR
                     DFELFTNFVEEIAGWLDMFDHKKHFTTIFVTLSKKSLPLYYSILAISSRHLDETKKLQ
                     KKNDHLTYHLYQRSLYYLVPMVQGNSNIEVVASCIILCVFEMMNPSPSNWRKHLKGGA
                     TLLMAANIHGFSDSMEKSLFWCFSRMDICNALINDEPTLIPLRKWGDLSFIEDGDDDD
                     DDDLIIAARYKEKFLSFSSQNSDMYSNYIVFLAARTVNLISDGNDFSSKTINSVNFET
                     SFDALYQELLEWYINRPVTMKPIICHSDDEEFPRLLFSNGPGISGNQMYHMVMILMNS
                     NKPRASKKCKSGGIDNVYKNHLSNVWHAKRIVGISLVNKNDHGCLSNALQPVYFAGKV
                     LTSKREHQIILDLLRNIEEITGLNCEWRIKDLETIWKDYF"
     gene            complement(<85718..>87829)
                     /locus_tag="DEHA2F00968g"
                     /db_xref="GeneID:2903803"
     mRNA            complement(<85718..>87829)
                     /locus_tag="DEHA2F00968g"
                     /product="DEHA2F00968p"
                     /transcript_id="XM_460403.1"
                     /db_xref="GeneID:2903803"
     CDS             complement(85718..87829)
                     /locus_tag="DEHA2F00968g"
                     /note="similar to uniprot|P23254 Saccharomyces cerevisiae
                     YPR074C TKL1 Transketolase 1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00968p"
                     /protein_id="XP_460403.2"
                     /db_xref="GeneID:2903803"
                     /db_xref="GOA:Q6BN17"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6BN17"
                     /translation="MNQIEDLSLKTIRCLVSDLVQQYNGGHPGGAMGMAAIGIALWKY
                     ILKYNPKNANWFNRDRFVLSNGHTCLFQYVFLHLVGYESFTMNQLKKYHAPEVSQCAG
                     HPEIEFEGIEVTTGPLGQGIANAVGLAIASKNLAANYNKPDLDLVDNKIYCMVGDACI
                     QEGVGLEAISLAGHLGLDNLIVIYDNNQITCDGSVDLANSEDINAKFMAQKWHVLTVD
                     DGSFDLRSILAAIEQAKSVKGSPILINIRTIIGVDTNVANNAKAHGAAYGVEEGRRLK
                     ALYGFDPDQFIEVPKLVYDFFREGNEGAISKGVFHQEQWEKKLEAYSKKYPQLYEEVV
                     SRINGKLPTDWKESLPHSLPTDATASRKASGLVFTPLAAKYPQFLVGTADLSPSVNLL
                     WPHKKDFQNPEIKTDCGINGDYSGRYLHYGIREHAMCAISNGISAYSKGAFIPITSSF
                     FMFYLYSAPAVRMGALQNLQVIHVATHDSIGTGEDGPTHQPIALASFYRSLPNCLYVR
                     PADNEEVAGAWELAIETTNKPTIISLSRQNLKQYPGITDRNKVKFGAYVLKEFDSSSD
                     SQKLQIISVGAESQFAIDAAEILIESNINVKIISFPCQRLFECQSTEYKRSVLDPQIV
                     TVAIEAYASNGWERYANAGFHLNEFGISLPGKNAYEHFGFNGAYIASKIQKYLDDLQK
                     DDIMKFEYQELNITKNHHSSS"
     gene            <88583..>89458
                     /locus_tag="DEHA2F00990g"
                     /db_xref="GeneID:2903804"
     mRNA            <88583..>89458
                     /locus_tag="DEHA2F00990g"
                     /product="DEHA2F00990p"
                     /transcript_id="XM_460404.1"
                     /db_xref="GeneID:2903804"
     CDS             88583..89458
                     /locus_tag="DEHA2F00990g"
                     /note="weakly similar to uniprot|P32573 Saccharomyces
                     cerevisiae YNL202W SPS19 late sporulation specific gene
                     which may function during spore wall formation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F00990p"
                     /protein_id="XP_460404.2"
                     /db_xref="GeneID:2903804"
                     /db_xref="GOA:Q6BN16"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6BN16"
                     /translation="MTVKAFDDNVSDTHYLLDTPRSLPTRDPQLNNHVIDLFNLKGKV
                     AVVTGGGQGIGYAICEAYAQAGAEVAIWDISDTSTVATKLEKLYGVKSRSYVCDVTDS
                     KRVEQTVNNIVEDFGDIDIFVANAGINIPVGTIINEENSNDKNWLKVMDINLNGVYYC
                     AKNVGKVFSRKPEGRKGSMIITGSMSGHIINTPVHQAAYNASKASVIHFAKSLAIEFV
                     DFARVNSISPGYVNSGINDHLPSNTRKRWWSTIPMGREGLPRELVGAYLYLASDASTY
                     TTAADIIVDGGWCAV"
     gene            complement(<89714..>91198)
                     /locus_tag="DEHA2F01012g"
                     /db_xref="GeneID:2903805"
     mRNA            complement(<89714..>91198)
                     /locus_tag="DEHA2F01012g"
                     /product="DEHA2F01012p"
                     /transcript_id="XM_460405.2"
                     /db_xref="GeneID:2903805"
     CDS             complement(89714..91198)
                     /locus_tag="DEHA2F01012g"
                     /note="similar to uniprot|P39932 Saccharomyces cerevisiae
                     YDR536W STL1 Glycerol proton symporter of the plasma
                     membrane subject to glucose-induced inactivation strongly
                     but transiently induced when cells are subjected to
                     osmotic shock"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01012p"
                     /protein_id="XP_460405.2"
                     /db_xref="GeneID:2903805"
                     /db_xref="GOA:Q6BN15"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6BN15"
                     /translation="MVAFVASIAFMLFGYDQGVMSSLLTLPSFLETFPEINVFENKSN
                     STLQGLVVAIYEIGCMCGALFAMVYGDNFGRRKMIWIGAATMTVGAVLQCSAFGLPHL
                     IVGRIVTGIGNGFSTATIPMWLSECAKPERRGALNMISAALNIFGVALSYWVDFGFYF
                     VKGSASWRFPIAFQIVFALFMMSVIFLMPESPRWLVKKNRIEEAKEVFAVFAEVETNH
                     TFVLAKIKEIKDLSMKEDAEFSLKRLISFGPNKHFHRTMLAAFCQIMQQICGINLITY
                     YAGTIYEDYLNMDPIPARILAACNGTEYFLAACLSYFLIERVGRRNLMLICAAGQSAT
                     MAILCGSGWAADNGDTKAAISAAVFLFVFNSFFAVGWLGVSWLYPAEIAPLEIRAAVN
                     GLSTACNWAFTFLIVMITPICFAHIGAYTYAIFACVNFAMVPAVYIFYPETSGRSLED
                     IDIIFEHSNPKTPWDVISLSRNYKKLDYKESDLYERKVLVESIE"
     gene            <91694..>93517
                     /locus_tag="DEHA2F01034g"
                     /db_xref="GeneID:2903806"
     mRNA            <91694..>93517
                     /locus_tag="DEHA2F01034g"
                     /product="DEHA2F01034p"
                     /transcript_id="XM_460406.1"
                     /db_xref="GeneID:2903806"
     CDS             91694..93517
                     /locus_tag="DEHA2F01034g"
                     /note="similar to uniprot|P43550 Saccharomyces cerevisiae
                     YFL053W DAK2 Dihydroxyacetone kinase required for
                     detoxification of dihydroxyacetone (DHA)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01034p"
                     /protein_id="XP_460406.1"
                     /db_xref="GeneID:2903806"
                     /db_xref="GOA:Q6BN14"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:Q6BN14"
                     /translation="MSLAKHWGYSKDLVLENLKGLAAANPKISLIPAEKTVVYNDSLQ
                     SKGNKNINRIMVISGGGSGHEPLHAGFVGVNALDAAVSGSIFASPSAKQIFAAIKSIS
                     SKQNNSKGTLVIVKNYTGDVLHFGLAVERAKAHGYKIDMIIVGDDAAVGRSKGGMVGR
                     RALAATALVHKIVGSAASEIEDLSRLKILGDSVANNTVTIGATLDHCSVPGRDIANFE
                     PIGQNDAEIGLGIHNETSVKKVNPVPMIDSLVQDLLEFLLNENDKDRYFVPFDLSNDE
                     TVLLVNNLGGTSTLEMYAITNCVIETLYQQYSLRPKKVIVGEFATSLNAPGFSITLLN
                     VSCASKQSQISISHIMSYLDLPTDAPGWKAHPCGFGLERDINIETSINGIDSFVKSQL
                     KLSREQQTDFRSSLVNGLEKLLDKEPSITFYDTVAGDGDCGETLASGANGILESLRNN
                     EICFEDPVYSISQIANIVEDKMGGTSGGLYSIFLTSLIKHLQDCTTLNLCEMFASSLH
                     NALYQGLYKYTRARVGGRTLIDALEPFVNTFNDTLNFSKAAQAAIDGSESTRKLAAKF
                     GRASYVNEQEFKQFDEEGGLPDPGAIGLATLIAGFAGVDYN"
     gene            complement(<95058..>96146)
                     /locus_tag="DEHA2F01056g"
                     /db_xref="GeneID:2903808"
     mRNA            complement(<95058..>96146)
                     /locus_tag="DEHA2F01056g"
                     /product="DEHA2F01056p"
                     /transcript_id="XM_460408.1"
                     /db_xref="GeneID:2903808"
     CDS             complement(95058..96146)
                     /locus_tag="DEHA2F01056g"
                     /note="highly similar to uniprot|P41940 Saccharomyces
                     cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase
                     (mannose-1-phosphate guanyltransferase) synthesizes
                     GDP-mannose from GTP and mannose-1-phosphate in cell wall
                     biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01056p"
                     /protein_id="XP_460408.1"
                     /db_xref="GeneID:2903808"
                     /db_xref="GOA:Q6BN12"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /translation="MKGLILVGGYGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAKA
                     GVTDIVLAVNYRPEVMVSTLKKYEAEYGVTITFSVEEEPLGTAGPLKLAEKVLKKDDT
                     PIFVLNSDVICDYPFQELADFHKTSGGKATIVATKVDEPSKYGVIVHDRDTPNLIDRF
                     VEKPVEFVGNRINAGLYILNPSVIDLIEMKPTSIEKETFPILVENKELYSFDLEGYWM
                     DVGQPKDFLSGTVLYLTALSKKEPKKLCNEKFIHGGNVLVDPSAKIHPSALIGPNVVI
                     GPNVVVGEGARIQRSVLLSNSEVKDHAWVKSTIVGWNSRIGKWARTDGITVLGDDVEI
                     KNEVYVNGAKVLPHKSISSNVEHEAIIM"
     gene            complement(<97098..>98558)
                     /locus_tag="DEHA2F01078g"
                     /db_xref="GeneID:2903809"
     mRNA            complement(<97098..>98558)
                     /locus_tag="DEHA2F01078g"
                     /product="DEHA2F01078p"
                     /transcript_id="XM_460409.1"
                     /db_xref="GeneID:2903809"
     CDS             complement(97098..98558)
                     /locus_tag="DEHA2F01078g"
                     /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
                     YDL054C MCH1 Protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01078p"
                     /protein_id="XP_460409.2"
                     /db_xref="GeneID:2903809"
                     /db_xref="GOA:Q6BN11"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /translation="MLKHKTFINRISHSIKHYLSFHVSIANLKKISFFISLFSCLTSG
                     SIMLFSLFSSSLHELYGINYLHINFIASLSAIGMYLCLPVLGYLADCYGPSLLSLISI
                     WFFVPSYFVNSQVIKSLEYNNVMKIHLYAFGICFFFIGLATSSLYFSSLLTCAKIYPE
                     HKGLAISLPVTCYGLSTLLGSQLMKLSYFKQYNGFLNLHKVFNFFGVLYLVMGILNFV
                     SSSVVSMESEIIFTNEDEMEEADEESPLMTSRSRHSHHSCEDDDNLIPERSIIEPLKH
                     QERFINFLKDKSAWLLLASLILNIGPMESFQNNLGSIIINSNSESNLSDQVSIMAASS
                     TVTRLAMGGLSDYLSSSKRKFPICRVNLLIINLAIGIVGQFMVTRSTRFSIVSILNGS
                     SYGGLFTIYPTIVASIWGIDMMGSTWGSFMIAPAIGSIGFSIFYGNEVDNKCGVDYSS
                     CLQHYFNLTAVGLSVSLILIIIVWKGIWAKRGYRVF"
     gene            complement(<98790..>99815)
                     /locus_tag="DEHA2F01100g"
                     /db_xref="GeneID:2903810"
     mRNA            complement(<98790..>99815)
                     /locus_tag="DEHA2F01100g"
                     /product="DEHA2F01100p"
                     /transcript_id="XM_460410.2"
                     /db_xref="GeneID:2903810"
     CDS             complement(98790..99815)
                     /locus_tag="DEHA2F01100g"
                     /note="highly similar to uniprot|P09201 Saccharomyces
                     cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
                     regulatory enzyme in the gluconeogenesis pathway required
                     for glucose metabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01100p"
                     /protein_id="XP_460410.2"
                     /db_xref="GeneID:2903810"
                     /db_xref="GOA:Q6BN10"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:Q6BN10"
                     /translation="MSTQHNSVSEQMNVDTDIITLTRFILQEQQKEAPNATGELSLLL
                     NSLQFAFKFIAHNIRRAELVNLIGISGSANSTGDVQKKLDVIGDEIFINAMKSSNNVK
                     VLVSEEQEDLIVFEGGGRYAVCTDPIDGSSNIDAGVSVGTIFGIYRLKEDSQGSIKDV
                     LRKGTEMVAAGYTMYGASAHLMLTTGQGVNGFTLDTQLGEFILTQPHLTIPKTRAIYS
                     VNEGNSHYWADSAKQYIADLKKPQEDGKPYSARYIGSMVADIHRTILYGGIFAYPADS
                     KSKNGKLRILYECFPMAMLMEQAGGAAINDKGERILEILPKGIHDKSGIWLGSTGEVD
                     RYLTYLK"
     gene            complement(<100203..>100700)
                     /locus_tag="DEHA2F01122g"
                     /db_xref="GeneID:2903811"
     mRNA            complement(<100203..>100700)
                     /locus_tag="DEHA2F01122g"
                     /product="DEHA2F01122p"
                     /transcript_id="XM_460411.1"
                     /db_xref="GeneID:2903811"
     CDS             complement(100203..100700)
                     /locus_tag="DEHA2F01122g"
                     /note="weakly similar to uniprot|Q9P8Q5 Candida albicans
                     IPF3432 Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01122p"
                     /protein_id="XP_460411.2"
                     /db_xref="GeneID:2903811"
                     /db_xref="UniProtKB/TrEMBL:Q6BN09"
                     /translation="MSGGWAEKLTNASASNSSNVSNVSSKPVTTSPSSTSAAIKSKKP
                     HPVNADSLQPNTFNGKEILHYLSTSYNTHLQHAKEDKEGENIKVYRSLESSSQWKTKP
                     SSTKIAASSANTAGPNSKSKYNSKNVIRNQRDSTGKTNGNIDLLFELNRSIYQQQQHQ
                     SAHKK"
     gene            <100920..>102359
                     /locus_tag="DEHA2F01144g"
                     /db_xref="GeneID:2903812"
     mRNA            <100920..>102359
                     /locus_tag="DEHA2F01144g"
                     /product="DEHA2F01144p"
                     /transcript_id="XM_460412.1"
                     /db_xref="GeneID:2903812"
     CDS             100920..102359
                     /locus_tag="DEHA2F01144g"
                     /note="highly similar to uniprot|P32915 Saccharomyces
                     cerevisiae YLR378C SEC61 Essential subunit of Sec61
                     complex (Sec61p Sbh1p and Sss1p)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01144p"
                     /protein_id="XP_460412.1"
                     /db_xref="GeneID:2903812"
                     /db_xref="GOA:Q6BN08"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /translation="MSGFRVLDLVKPFTPFMPEVIAPERKVAFQQRLMWTGVTLLIFL
                     VMSEIPLYGIASSDGSDPLYWLRMMLASNRGTLMELGISPIVSAGMVFQLLQGTKLIT
                     VDMSNKNDRDQFQTAQKLFAILLAVGQATVYVLTGMYGPPSSLGTGVCLLLVLQLVFA
                     GIVVILLDELLQKGYGLGSGISLFTATNVCEQVFWKAFAPTTSNIGKGTEFEGAVVAL
                     FHLLGSRKDKKRALLEAFYRSHLPNMFQLIATVFVFLLVVYLQGFRIELPIKSTRQRG
                     PYGLYPIRLFYTSNIPIMLQSALSSNIFIISQMLFVRWPNNIFVKILGSWDTRQGAAQ
                     LYAVSGLAYYIQPPLSFTEALLDPIKTIIYIIFVLGSCAVFSTTWIEISGASPRDVAK
                     QFKEQGLVIAGHRDTSAYRELKKIIPTAAAFGGATIGALSVFCDLMGTLGSGTSILLS
                     VTTIYGYYELAMKEGGFGKSVVSSFSDGI"
     gene            <103410..>105980
                     /locus_tag="DEHA2F01166g"
                     /db_xref="GeneID:2903813"
     mRNA            <103410..>105980
                     /locus_tag="DEHA2F01166g"
                     /product="DEHA2F01166p"
                     /transcript_id="XM_460413.1"
                     /db_xref="GeneID:2903813"
     CDS             103410..105980
                     /locus_tag="DEHA2F01166g"
                     /note="weakly similar to uniprot|Q76I27 Pichia pastoris
                     PNO1 PNO1 protein and similar to CA4175|IPF4425.repeat2
                     Candida albicans IPF4425.repeat2 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01166p"
                     /protein_id="XP_460413.2"
                     /db_xref="GeneID:2903813"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:Q6BN07"
                     /translation="MPQPISGSNIGIGAKSRTLFRKVGNAKTIKFIIVLIAIVNILYI
                     STLLVDERTSSTLTSKIKNHASYVLDNFYESDEEEAEDGTVFTDIPEANTVYSNNQNG
                     QGSESIHKYDKTLYNIPNRPYDQLSTSDKILFKLNEITSDSEKYWLGHTELTDYELEI
                     QVDDFVKSAWKEKQTIFYDPRFTLAIYINEIKNQYLKKNPDNEKHKSHEIVVPFAWSD
                     WVDLTMLNEELSKPESQRKNCEYMKATHHIPAKDADYCINNVAITNADLKEMNLPSTK
                     FVPGFAVKKSPTNKASNEVRMLEGKSHLLTYAPNPLAIIFLTNDGVYEAQIEGKQRIV
                     DSNLFEDFLTSTKNKDPKIIMNPVKEFNDLLARVKPNPLDPEDDEFGMVAKIKDKNPE
                     KTKEVYLPQKAFNYQQDKIDVQLEEYETKMKTLHDLTTNELIFDHHTINKLKLTRNEK
                     IYYEGLKYANKFELAKEPTYFRMARLNFQTEENDHDAGWHYEWRFFNGALRYLKKGWN
                     EEELLIREKVLLDRILRNWFKFANEKGIISWIAHGPLLSWYWDGLLFPFDEDIDIQMP
                     AEELTRFSKLYNQTLVVEDISEGFGKYFIDCSTFIHHRGKSYKENHIDARFIDIDTGS
                     YIDITGLGISKEEAPDKYKDIVNQAAIFNQPKPVYNCRNLHFYSYDEISPLRYTMIGG
                     VPCYIPNKVEDILKDEYTKGMSVYDFEGFYFIDPLNLWIHQQKLKFLFDQSHAHLFND
                     KEEVTNREEFTNLVKGMNEEQILSLLEHNEDILLEYYLTKDVTDLHKQELTYMFNMPD
                     GENTKIGNINGQKQQSEISENLEYHKLTSRFKFQKPFRRPLFNYEKIDKPKHAKPSTA
                     "
     gene            <106989..>109346
                     /locus_tag="DEHA2F01188g"
                     /db_xref="GeneID:2903814"
     mRNA            <106989..>109346
                     /locus_tag="DEHA2F01188g"
                     /product="DEHA2F01188p"
                     /transcript_id="XM_460414.1"
                     /db_xref="GeneID:2903814"
     CDS             106989..109346
                     /locus_tag="DEHA2F01188g"
                     /note="weakly similar to uniprot|Q76I27 Pichia pastoris
                     PNO1 PNO1 protein and similar to CA4176|IPF4425.repeat1
                     Candida albicans IPF4425.repeat1 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01188p"
                     /protein_id="XP_460414.2"
                     /db_xref="GeneID:2903814"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:Q6BN06"
                     /translation="MINTKFVKITFLIVLFINILFFTKYYSKQEAKLHEQAIQHVASI
                     NYHTDDEVKVPDDKVYSELEAKEKISHLLEQVKNDKEKYWLANTEISEPDLTINMKEF
                     LTPDEGESNFANKPTLFYDPRFTLSVYLNEIKNQLQTKNPKNEKTKDHLVTVPFAWSD
                     WVDLTMLNEELNKEESERLDCGWLQSEINKPTKYPNFCKNTRDLTSEELREIGLPSKA
                     FLPGFAVKSSPMNKAPPKQVMMQGKAHLLAYQENPLSIIFLTKNGTYEAQVSGKKRLV
                     HTEMFEHFLERKHINANHIDDMEDQTITLNPIDEFGDLQSAIKPRPLDMNDDMYRMFS
                     ITRQKDKNASREIYLDTEAFNYNQEQVDAQIEEYESRLNILDDLMTNELRYDPRQIET
                     NILNRHEMNHYEGLKYSNSISAQDEPTYYKLATLKKDKENRDAGWHYEWRFFNGALRY
                     LKEGYTMRQLEIREQIILDRLLRNWFRFAEEKGIISWIAHGPLLSWYWDGLMFPFDID
                     IDIQMPSAELNRLSQNYNMTLVVEDVSEGYGKYLIDCATFLHHRDRAAKDNVIDARFI
                     DIDSGTYIDITGLGKNNEKPPAEYDTYIRSRQSKGEEVQLYMDRRKHWLNFEKINPLR
                     YSMISGVPAYVPNDIMVMLNYEYDKGTTSYHYDGYYYVPQVRLWLKEEQLTFLFEESA
                     YKDGDKINPDKLTGLIKKMNIDHKVRLLESSDDILIEYYLTQKYTSYHEIEKKFMLNP
                     SLQHSILDLKEKTEYHQLTSKFHMDKPLRKSLFDYEYLERVKHSE"
     gene            <109654..>110481
                     /locus_tag="DEHA2F01210g"
                     /db_xref="GeneID:2903815"
     mRNA            <109654..>110481
                     /locus_tag="DEHA2F01210g"
                     /product="DEHA2F01210p"
                     /transcript_id="XM_460415.1"
                     /db_xref="GeneID:2903815"
     CDS             109654..110481
                     /locus_tag="DEHA2F01210g"
                     /note="similar to uniprot|P32787 Saccharomyces cerevisiae
                     YJR144W MGM101 Protein involved in mitochondrial genome
                     maintenance"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01210p"
                     /protein_id="XP_460415.2"
                     /db_xref="GeneID:2903815"
                     /db_xref="GOA:Q6BN05"
                     /db_xref="InterPro:IPR009446"
                     /translation="MIRGTSLSTSSRSIKVFIFNARYSSNYVKAPIKKMSYNSAFQKS
                     YYSNPASKNGMTNNSATTSSPKPISNNESESSSSSSTIKSFSDSPAIASSPEVGSPIN
                     WSDSFHGLGTAPFPKEVSDILLASIDNDDIEIKPDGLLYLPEIKYRRILNRAFGPGGW
                     GLAPRTESLITPKQISREYALICHGRLVSVARGEQDYFGGDEKITTALEGCKSNALMR
                     CCKDLGIASELWDPSFIRKWKKDFCDEIFAEHVTTKKKKKLWKLKKNKTLDYPYKKI"
     gene            complement(<110699..>111298)
                     /locus_tag="DEHA2F01232g"
                     /db_xref="GeneID:2903816"
     mRNA            complement(<110699..>111298)
                     /locus_tag="DEHA2F01232g"
                     /product="DEHA2F01232p"
                     /transcript_id="XM_460416.1"
                     /db_xref="GeneID:2903816"
     CDS             complement(110699..111298)
                     /locus_tag="DEHA2F01232g"
                     /note="similar to CA4178|IPF4421 Candida albicans IPF4421
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01232p"
                     /protein_id="XP_460416.1"
                     /db_xref="GeneID:2903816"
                     /db_xref="UniProtKB/TrEMBL:Q6BN04"
                     /translation="MSEQSDAEQRIVPDSRFKWPRPFGNLTSASAYPPWKPVDTKKET
                     SQIFRFTFYTTVGAYAWLYLWKRTTFKIGLPMTVVTFATVATASKGMITNLREKNDGW
                     NTFWGVGLGNLACLTAGFKNMPVKHKVLTGISGAAIAAVLDHWSWSQSASFAGRDTKH
                     VMANTDEELPKQQFWDVWRRRPLSQTVEEMGSGRGIFKA"
     gene            <111567..>112103
                     /locus_tag="DEHA2F01254g"
                     /db_xref="GeneID:2903817"
     mRNA            <111567..>112103
                     /locus_tag="DEHA2F01254g"
                     /product="DEHA2F01254p"
                     /transcript_id="XM_460417.1"
                     /db_xref="GeneID:2903817"
     CDS             111567..112103
                     /locus_tag="DEHA2F01254g"
                     /note="weakly similar to uniprot|P35180 Saccharomyces
                     cerevisiae YGR082W TOM20 Translocase of Outer
                     Mitochondrial membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01254p"
                     /protein_id="XP_460417.1"
                     /db_xref="GeneID:2903817"
                     /db_xref="GOA:Q6BN03"
                     /db_xref="InterPro:IPR002056"
                     /db_xref="InterPro:IPR023392"
                     /db_xref="UniProtKB/TrEMBL:Q6BN03"
                     /translation="MSKALTFTAVAGSALVAYAVYFDYKRRSSPDFRKTLKKKSVKQQ
                     KLAAKEHENTKKSKLDAIKKALTADLEANPVPTDLSEKENFFMQQVALGEQLATVPDK
                     KIEAALCFYKALAVYPNPTDILGIYQRSVPEEVYEIVVMMIAVQPPAAVTNILGAGGA
                     AGAGAGEPEIKPSEEDLD"
     gene            <112580..>114040
                     /locus_tag="DEHA2F01276g"
                     /db_xref="GeneID:2903818"
     mRNA            <112580..>114040
                     /locus_tag="DEHA2F01276g"
                     /product="DEHA2F01276p"
                     /transcript_id="XM_460418.2"
                     /db_xref="GeneID:2903818"
     CDS             112580..114040
                     /locus_tag="DEHA2F01276g"
                     /note="similar to uniprot|P23776 Saccharomyces cerevisiae
                     YLR300W EXG1 Major exo-1 3-beta-glucanase of the cell wall
                     involved in cell wall beta-glucan assembly"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01276p"
                     /protein_id="XP_460418.2"
                     /db_xref="GeneID:2903818"
                     /db_xref="GOA:Q6BN02"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q6BN02"
                     /translation="MTCIYSLLLTFWFAQLTLGLNSTSPSGNSSSLIQSQYNSRNFHY
                     KGVALGGWLILEPYITPSLFLEFNKTSGKDSDIPIDEHAYCKKLGYKEAKNRLTKHWD
                     TFYNESDFAQIKEYGLNMVRIPIGYWAFEKLENDSYVPGAEKYLDQAIEWAYKYNLKV
                     WVDLHGLPGSQNGFDNSGLRSLDYPGWFNRTEHVDLSHRVLNKIYSKYGGHNMSTEYK
                     DTILGIEVVNEPLGPKLSMKKVKKFYEDSYGNARKIQAVNNTIVFHDAFQSMGYWNKF
                     LSYSGNKTNSTIDNYNILVDHHHYEVFSSGALNSTIDGHLSSIKSLSSSIKDENKHHP
                     AVVGEWSAALTDCTPWLNGVGIGTRFEGTSPYTNDKIGTCDDINTWGKWSKEQKKNYR
                     KFVEMQLDQYSSKMNGWIFWCFKTETSIEWDFKRLVHFDLMPQPLDDRKYIVNGTDTD
                     EGDDKKSIASTTRHRNIWLLLVTFGLQLVNVLSDQY"
     gene            <114400..>115482
                     /locus_tag="DEHA2F01298g"
                     /db_xref="GeneID:2903819"
     mRNA            <114400..>115482
                     /locus_tag="DEHA2F01298g"
                     /product="DEHA2F01298p"
                     /transcript_id="XM_460419.1"
                     /db_xref="GeneID:2903819"
     CDS             114400..115482
                     /locus_tag="DEHA2F01298g"
                     /note="similar to uniprot|P31116 Saccharomyces cerevisiae
                     YJR139C HOM6 Homoserine dehydrogenase (L-homoserine:NADP
                     oxidoreductase) dimeric enzyme that catalyzes the third
                     step in the common pathway for methionine and threonine
                     biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01298p"
                     /protein_id="XP_460419.1"
                     /db_xref="GeneID:2903819"
                     /db_xref="GOA:Q6BN01"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:Q6BN01"
                     /translation="MVKSVNVAIIGSGVVGSAFVNQLKNLKTAINFNVVYFARSSKEA
                     LFSSDYKPVDLASYKNASAQAVLSLDELTKFLKGASKPTILIDNTSNSTIADYYPTFV
                     KEGISIATPNKKAFSSDLSVWNEIFKNSEAPSGGLVYHEATVGAGLPIIGPLRDLITT
                     GDKVEKIEGIFSGTLSYIFNEFSTTDPSTKVKFSDVVKVAKDLGYTEPDPRDDLNGLD
                     VARKVTILARISGFDVESPTSFPVESLIPKELESVQTADEFLSKLPDFDADIQKVKEE
                     ALAENKVLRFVGQVDFKANKVSVEIGKYGFDHPFASLKGSDNVVSIKTERYSNPLIIQ
                     GAGAGAEVTAHGVLADAIKIAERIAI"
     gene            complement(<115548..>120230)
                     /locus_tag="DEHA2F01320g"
                     /db_xref="GeneID:2903820"
     mRNA            complement(<115548..>120230)
                     /locus_tag="DEHA2F01320g"
                     /product="DEHA2F01320p"
                     /transcript_id="XM_460420.1"
                     /db_xref="GeneID:2903820"
     CDS             complement(115548..120230)
                     /locus_tag="DEHA2F01320g"
                     /note="similar to uniprot|Q75DV2 Ashbya gossypii ABL079C
                     ABL079Cp"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01320p"
                     /protein_id="XP_460420.2"
                     /db_xref="GeneID:2903820"
                     /db_xref="GOA:Q6BN00"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /translation="MHDARIFNSSSNKTMNQNDEAGKSKIKPLRTNQRRVIGASKSSS
                     HMGSHVGTTLIIGKNSHSTSHGVRNNSPENTIVIGRRNFSDGQIEYTKPASHSNKFKK
                     DSILRDPNIDSNVEASKKLSEQIQLTVWFHEPRTSTEDVIIDASVIPGLKEGDICELV
                     PLNTFKPHKKPKRLIFIIKNQSLLSKSSSLHTSNNNNNAGATTSTLSANNNNTTKTKT
                     NFQISLISNPLQNLMDLPPRSLVQLKTILDVESIEADTIEIFIKDINLSRDLMWTFSS
                     SLVGTCVYSEKRLTFLSNRTGVVKKIYKNGNELFSALICEKTKVVFRSKSAKLVFLVQ
                     LSREMWHFEETGEIMFHKLVNTLFPKIFKKWRDKNTHHAITIVLFTSVDLTNIPWTSL
                     GQGERPNNRRDYFRVVVDQVSIFHWDRIMANLRLEFANFKRDIMLNCQPENNGKFTMA
                     GQSLPSVKGNVLEAINVGIHLVNDRFKNTDLKHSLNHFILVTPGTGLFDVDYSLMHET
                     SKKMLSIDCALDIVCLSQPPLHIVPLFRYRDPSKDGQISHCVPHWCDISFYKDSTANS
                     TQWIPHCKIYELQMMGVMENEINDVKIERYRVPNEAKSMVEAMDKYDSDVFKPVNKDS
                     DSKVTRELSSSPEQSTINSKTGTPKENSKPLSLIWNNRTSLLPNSSTARIDVSTTNSS
                     VLGTVANSGKDVSALSSLYTLNKTSADKSVVHAPSIRADSRKGVKENVSRDRKEFNEI
                     TRTKLRPRLQKTEEFYKSDDSVSNTSKSRDILDSKSRNKQSSTKVEEEFETLTNLLWT
                     EIRNPSKESHSDMLSFLRLSRWNDIFPSNIKRRLVKWRSFESPAALPVTTSIFPSTKQ
                     LETDYSFQIYSVFLNSENDLEIESTHDLMREMIQLRLLLGFQICYSDQVKKFESSRKP
                     GGNAESLIKYFPKGSCYGSRIYMSLDDEIHRISCDYNGNLYVQMYRKIEELKHSRLLG
                     SKDYRQQSYVPLIRTRYVDEYAPAKFDFINTKPLKYNWNQFDQLIAGYDDAIPPEKRQ
                     FHKMKFVVLPANIPKNAYFISNENLTDEEIRVEGLRKLIGLIERGKFVKSDDKESKRK
                     EEILPEISFYTGNLYEFLSDQAETYDATGNEPSNSLMLGENMRFTKSIKLSQLAQELQ
                     SPTGVRLVDRTWHFKRHLHCFLGNELVSWFIECFEDIDNRNDATSYGQSLMDRGMIKH
                     VESRHGFLDGYYFYTFEGEYIDKNYKPERLNSGWFNRKKNSSEKGSAVTSPTYTRNNS
                     DTESAKSPVFPVQDNLDLRKITSNSIGQHMYDSETSSMAGSSTKTKQKKKFILSRSVK
                     FNADPLKKSFRPEIVTVHYDRVHNPEHCYHIRLQWLNTTKKFIDDAILNWSRLCERHG
                     LKLVETPWLELCTIPQVNPFHSFVDLKLVINPWTDPEFSDPNILKDNKFYYHLYLMKK
                     SDFLLDNRSTVFFSKDHIEISYSWGKPIFQYAQYIHKTGAYIVELRDNGDLFLAPNNI
                     HITRLNTSLSSVPEQDYLKSYKMDSQKVMLKFRSACTNEKILRGIFKEAKENWREKCS
                     EVVLPAIN"
     gene            complement(<120362..>121066)
                     /locus_tag="DEHA2F01342g"
                     /db_xref="GeneID:2903821"
     mRNA            complement(<120362..>121066)
                     /locus_tag="DEHA2F01342g"
                     /product="DEHA2F01342p"
                     /transcript_id="XM_460421.1"
                     /db_xref="GeneID:2903821"
     CDS             complement(120362..121066)
                     /locus_tag="DEHA2F01342g"
                     /note="similar to uniprot|Q03144 Saccharomyces cerevisiae
                     YMR095c SNO1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01342p"
                     /protein_id="XP_460421.2"
                     /db_xref="GeneID:2903821"
                     /db_xref="GOA:Q6BMZ9"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ9"
                     /translation="MTITKKLTVGVLALQGAFIEHIKHFEGATKNGYSDFEFDFIEVR
                     TEEQLDRCHGLVIPGGESTSISLIAQRTDLLGPLMHYVKSERPIWGTCAGLIFLSTQV
                     ENGRPGQQLLGGMNIQVKRNAFGRQLQSFQSDLDFSSFIPSVSDFPTIFIRAPVITSV
                     LSDINGSENVDNEIIHSKNDYENKAPVQILHQLDNGLIVAVRQGTKLGTSFHPELSDD
                     YRFHKWFIDEFITKAV"
     gene            <121660..>122544
                     /locus_tag="DEHA2F01364g"
                     /db_xref="GeneID:2903822"
     mRNA            <121660..>122544
                     /locus_tag="DEHA2F01364g"
                     /product="DEHA2F01364p"
                     /transcript_id="XM_460422.1"
                     /db_xref="GeneID:2903822"
     CDS             121660..122544
                     /locus_tag="DEHA2F01364g"
                     /note="highly similar to uniprot|Q03148 Saccharomyces
                     cerevisiae YMR096W SNZ1 Protein involved in vitamin B6
                     biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01364p"
                     /protein_id="XP_460422.1"
                     /db_xref="GeneID:2903822"
                     /db_xref="GOA:Q6BMZ8"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ8"
                     /translation="MTQEFKVKAGLAQMLKGGVIMDVVTPEQAKIAEKAGACAVMALE
                     RIPADMRASGQVCRMSDPKMIKEIMATVSIPVMAKCRIGHFVEAQILEALEVDYIDES
                     EVLTPADKLYHIKKDQFKVPFVCGARNLGEALRRVSEGAAMLRTKGEAGTGDISEAVS
                     HINLIKQQIDHALSLKSEAEVAAYAEELRVPLITLQELIANKGKFPVVNFAAGGVATP
                     ADAALCMQLGCDGVFVGSGIFKSKNPELLAKAIVNAVTHYDDPKKVMEYSTDLGELMF
                     GVSVDSLKASEKVSTRGW"
     gene            complement(<122661..>123251)
                     /locus_tag="DEHA2F01386g"
                     /db_xref="GeneID:2903823"
     mRNA            complement(<122661..>123251)
                     /locus_tag="DEHA2F01386g"
                     /product="DEHA2F01386p"
                     /transcript_id="XM_460423.1"
                     /db_xref="GeneID:2903823"
     CDS             complement(122661..123251)
                     /locus_tag="DEHA2F01386g"
                     /note="similar to CA0416|IPF17492 Candida albicans
                     IPF17492 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01386p"
                     /protein_id="XP_460423.1"
                     /db_xref="GeneID:2903823"
                     /db_xref="GOA:Q6BMZ7"
                     /db_xref="InterPro:IPR024359"
                     /translation="MPQAQIRKTQRNPKLWIAALVAASIVTISYKVYSSYIAEENIED
                     KKTEGDGGVEEKLRIAKRYTKKSIALTLSHSVLSSQLPLNEILLNSENVTFILPPNLS
                     MDDLVCNIGNADEVERYNLPKTLLNNYKLLHCSNIDGYFNILKNLKPDTLLVCSEDLG
                     IANNVPRDLHRFVKEIINIDQNKDDIYKKLSSIFIK"
     gene            complement(<123638..>127951)
                     /locus_tag="DEHA2F01408g"
                     /db_xref="GeneID:8998856"
     mRNA            complement(<123638..>127951)
                     /locus_tag="DEHA2F01408g"
                     /product="DEHA2F01408p"
                     /transcript_id="XM_002770678.1"
                     /db_xref="GeneID:8998856"
     CDS             complement(123638..127951)
                     /locus_tag="DEHA2F01408g"
                     /note="some similarities with uniprot|P07866 Saccharomyces
                     cerevisiae YAL024C LTE1 Putative GDP/GTP exchange factor
                     required for mitotic exit at low temperatures"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01408p"
                     /protein_id="XP_002770724.1"
                     /db_xref="GeneID:8998856"
                     /db_xref="GOA:B5RU78"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:B5RU78"
                     /translation="MPMENSILETSDDGSGMMDNRDQRSINEENVFYEANTEENKEMD
                     IQEVEPGMIHPEFMYNEHDESIFDDENVFPSLNPKADDIVKFDHNNPELINHGTLKAL
                     IVQLTSPEIIDYNLICDFFLTYRIFVDSEKVMNMLLIRLIWSLQYINSNNEASVKIGK
                     LVLLRTFVVLRHWMLNYFVDDFDSNNHLCDIFTYNMNQITNESNLVTDDMFFEQKVLK
                     DLKIHWISLLNEFWNVDIDLGIISDDVLQYKLPMIFEISNVKKLSKSNTEMSIHTNAS
                     YRRSAMLSLYDPKIQHKCLIFGTNGNDENPQLSVNNLLLHHRSSRLSVNTKLQELKDK
                     KLKDVTVERKPLSSNTKHNHMNLQDSSLGLKKTSQNKQQIPEETQHGMVTPIKNKENI
                     NSNYKLSPIKMENIGFSTNGNVKLPSSKVSSILPPTPAKKMDYVIKQSNVDDPFHKPN
                     HYIKDGKSTDDASNDFGRKKSLKKFVDGWKKSFNHSSSNAPHQSHTKDNSQGSKDMNN
                     LIKDAMNVMSENDEENIGDRVDILCARAVDELEYLIRCYVGNDSPCTIIEGDIDGIDE
                     HNKTDPIDEFVEVTVDDYREDNKVDLYDDESIDIMASPAKKARVKSTTHSSPVQGKIE
                     NIEDNEDSSAIDINDLSELNLKKIDNLINTDELTNGEQCHDKENYNQRSRTPVDQIFG
                     RSFDASNQSSFQRPASINWNDEGNLDLEYSENKTTGSVDDFDDEPKSPITQDQSFGLG
                     SQLPPDPQYLFNNQFNKSFESSISTPSNITQYNAEVADLGIALSPQSIKKNSVRRISF
                     NEANLTKNNSNRKRMSTLSKNSSGSIFRKDSRNSAKSYVSYDSAFSISNGSVSYKNKE
                     PDNGELRKKMAHADLRTIAGINDQRPALDSRISMESMSMSSYLSRSSSLRKSVRFSTL
                     CALTELPFGEYNASSTSADRRVPSTRKEIRQSDISDSSFFSVAARSKTNSVMVCNEQN
                     TQNSHNSSNNSVAIPGISNFVLKELADIPDESYQLHSPLDHALYKLEGKKSNSSDSKH
                     EIKHEELPRGASNVEQQANESNITPDNTQDILNEINNANTQDIDDYPSDIVDMTQERP
                     LTPVKNIMVVRSPQKKTARGSLKKNESVFFVSNGPSPRQFPSPKTILNGYYISTDILS
                     IEKVMEADSHISFLLSYDSKSLADHFTIIEKDILQEIDWKELIELKWNKELVPVNSWL
                     EIIVNDDYFHKNRGVNLVIARFNLMVNWIISEILMSKTQLERISIISRLIHIAHNCYV
                     LQNFSTLMQIILGLMSEKVSKLKETWKNLPPGDILILKNLEELSSPLKNFVNIRLCIN
                     RIKPSNGCIPFVGLYLSDLIFNAERPAFIKTQIPHAAKNNDTTGGDSTLNTQNIAAKM
                     INFSRFRTSVHIVKSLSQCIEWSSNYDLSIQKDLLSKCLYIKSLDEEEMNFCLSNIVD
                     P"
     gene            complement(<128421..>129048)
                     /locus_tag="DEHA2F01430g"
                     /db_xref="GeneID:2903828"
     mRNA            complement(join(<128421..128984,129046..>129048))
                     /locus_tag="DEHA2F01430g"
                     /product="DEHA2F01430p"
                     /transcript_id="XM_460425.2"
                     /db_xref="GeneID:2903828"
     CDS             complement(join(128421..128984,129046..129048))
                     /locus_tag="DEHA2F01430g"
                     /note="similar to uniprot|P53251 Saccharomyces cerevisiae
                     YGR081c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01430p"
                     /protein_id="XP_460425.2"
                     /db_xref="GeneID:2903828"
                     /db_xref="GOA:Q6BMZ5"
                     /translation="MAVKKRTTLRDKHAKSNTKSNLSGKIAELKEENNGQESDYHENP
                     FLKLSKVTKKDKQLNKSQNFSQKFDSSTLNTSSNISKSALRRRKRNARNELKPKMDEL
                     LQNLPETTNVIDPSAAAHKPNDHKSTKFIKSTKASANLPNATKQTGHAKIMTQESKNF
                     TNVLKNPQFRSSPFSALKDAIAQNIQNQ"
     gene            complement(<129333..>130829)
                     /locus_tag="DEHA2F01452g"
                     /db_xref="GeneID:2903829"
     mRNA            complement(<129333..>130829)
                     /locus_tag="DEHA2F01452g"
                     /product="DEHA2F01452p"
                     /transcript_id="XM_460426.1"
                     /db_xref="GeneID:2903829"
     CDS             complement(129333..130829)
                     /locus_tag="DEHA2F01452g"
                     /note="similar to uniprot|P23776 Saccharomyces cerevisiae
                     YLR300W EXG1 Major exo-1 3-beta-glucanase of the cell wall
                     involved in cell wall beta-glucan assembly"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01452p"
                     /protein_id="XP_460426.2"
                     /db_xref="GeneID:2903829"
                     /db_xref="GOA:Q6BMZ4"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ4"
                     /translation="MFRSIKIIILLLNGLTTVLGQFQGTYDLDSDYSHVRKEPKIRTK
                     NGSKYQLDYCQKTFGVSLGGWLVLEPWIVPSLFEEVYEKMGEMPVDEYTYTKLLGKRE
                     AEKALEEHWSSFYTEDDFQDIVDHGINLVRIPIGYWAFGLLADDPYVQGQEYYLDQAI
                     EWADKYDLQVQIDIHGMPGSQNGFDNSGKRTDPTWLNGGENMDLTYDVMDYFFNKYGG
                     EEYEDIVTSIEVVNEPFAFILDKDDLREFYEYAYQCARDNSVKANLYFHDGFLPIGSW
                     DRFMNDSSVYPNITIDHHLYEIFSEHQIALNIDQHIKNVEDQGAAMALQPHHRIVGEF
                     SGAFTDCTKYINGVGIGARYDGTFSNTKPVGSCKNHSDFDSWSEEFKNNTKEFIKAQF
                     ETFEKNGDGWIFWCFKTEDSIEWDFKRLASLDMLPESFLNRKKCHNLKTTQRLNDTEK
                     NETTIEKTSDGSSSIDSTILKFHQSFQLPKIIYIGVISSILLILAAIP"
     gene            <131151..>135242
                     /locus_tag="DEHA2F01474g"
                     /db_xref="GeneID:2903830"
     mRNA            <131151..>135242
                     /locus_tag="DEHA2F01474g"
                     /product="DEHA2F01474p"
                     /transcript_id="XM_460427.2"
                     /db_xref="GeneID:2903830"
     CDS             131151..135242
                     /locus_tag="DEHA2F01474g"
                     /note="some similarities with uniprot|P39521 Saccharomyces
                     cerevisiae YPR104C FHL1 and similar to CA0765|IPF9040.3eoc
                     Candida albicans IPF9040.3eoc"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01474p"
                     /protein_id="XP_460427.2"
                     /db_xref="GeneID:2903830"
                     /db_xref="GOA:Q6BMZ3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ3"
                     /translation="MMSSLSLGDDSLTSSKKEQDSLEDKNLKGNLGKQEDNNKIGGVD
                     IEREADAQSLDLDDEINSILNDNEENHKAHRKQGAETKNDEDIATQMSLPDLQDLDIG
                     PLDKIQNPMNKIVLDFDDTSKTVSNSQSPNPVDEETYDRYKNSTSQVDIRRNSSLVPI
                     TSEAALGSSNHEDDKDSSKISAYARLDFENFTFFVQTLQVILGRKSNDELLQSSHHAV
                     DVHLSSTKAISRRHAKIFYNFGTQRFELSVLGRNGAFVDDAFTEKGITVPLADGTKIQ
                     IGDIPFAFVLPSIDSNTNDNSAGTAKQFNPSDAINLRSNLYKVSESPSKNDQKPKQSK
                     EADKPREESKSNISQSPSNSNSDNSSHTSRRTSQSKSNTSRRLSGARKKSVTNDEIDD
                     ILNELETNSINAIDEEESELLDSEIQSILNDPDSHGQDEEMDLDEENLLKLTQFNEAS
                     NEEDEIDKLVQQHNLEQGVTWDEDELDREDENDDDMHDIDLDLSVLDQEIATLAPLID
                     AHHQDLMKEKEEKRKQLEQEKRKKESQQLRKMAGKKLPFNKPKVKPSTGSVSQPPTRS
                     TPLMGKPAVPRMGRPASIQPPASRLYGRQAPINGLSKAQLVDNRLTTMSSPLAGLPTH
                     LVAQGSANSGLPLKIAQGTHHSMAHLVNSQMSKPLMPPKPPAPKLDVQLQTITSSTSS
                     TIRIPIRAITIDSKVELPPVCVPKNLTEQKDTPKVPKRRKDINQIKKAAKSIYTIDEI
                     PEHYRIKPTLSYPLMITNVLKSKGGDIGLTLSEINESIKEIYPYYKYCPDGWQASVSH
                     NVTLNKIFKRISKKEYDANWTWGIDDAYIAEREKVKQKQQEMAAAKAKAAAIKAEELK
                     QKQRLEAQQGTTHNIVGRNFASPYGLSPLNAGLRMPQSQFISQLQQKQMGSANTNGQK
                     PKTIAELASEIRRDGLIGSKAPLYFKPQSTLQVNSSGELVKRNDIPATVSSPAASTVS
                     QQPQVTTNTIKAQLAANRSQSPSSLSPTSQGTHTSSEAKPKMNQDTKKSLAYLQKELF
                     TLYKARKLSYNTATTTEVITKALATTIAQVNIIGVKAGCGDNALSFLVEKAPQQVSKI
                     LDIALTKSIKEKQGTLSSRPASRGNTPGPTSHSLASSPEKQISSMVNTPQLAGSPKPS
                     SSAASPIEKLGEQLTTSSHKSESVAYSNSKENTPNASGELANDMPKPNQSSGIKSESP
                     SASPSLTRPPVYKSGLSKPPTFFGKSESSSPSQSAFASASYSSGAGLPKPQSFSKPSA
                     LSNPPRFLSNKPARPSFHGNKDETAVPRPPSFTSGSFPSTKGQNNSTTATNSPNIRET
                     PTGDSVAEQATVANAPGTKRSASDEGNVEEKLEDNSRKIIKIE"
     gene            <135638..>136486
                     /locus_tag="DEHA2F01496g"
                     /db_xref="GeneID:2903831"
     mRNA            <135638..>136486
                     /locus_tag="DEHA2F01496g"
                     /product="DEHA2F01496p"
                     /transcript_id="XM_460428.1"
                     /db_xref="GeneID:2903831"
     CDS             135638..136486
                     /locus_tag="DEHA2F01496g"
                     /note="highly similar to uniprot|P30656 Saccharomyces
                     cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
                     responsible for the chymotryptic activity of the
                     proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01496p"
                     /protein_id="XP_460428.1"
                     /db_xref="GeneID:2903831"
                     /db_xref="GOA:Q6BMZ2"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ2"
                     /translation="MNAIAQKFTHSNTNSVLKEINEAKSEFAENAQLDLAPSIQLPPI
                     SQPTDFLRAHTDDASNPDCKIKIAHGTTTMAFRFQGGIVVAVDSRATQGNWIASQTVN
                     KVIRINPDLLGTMAGGAADCQYWETWLGTQCRLHELREKERISVAAASKILSNLVYEY
                     KGMGLSMGTMICGYTKKEGPTIYYVDSDGSRLKGEMFCVGSGQTFAYGVLDSEYRWDL
                     SVEEALYLGKRSILAATHRDAYSGGSVNLYHVTEAGWVYHGNHNVGDIFWDIKEKEKS
                     FNNVDG"
     gene            <137005..>137862
                     /locus_tag="DEHA2F01518g"
                     /db_xref="GeneID:2903832"
     mRNA            join(<137005..137007,137341..>137862)
                     /locus_tag="DEHA2F01518g"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_460429.2"
                     /db_xref="GeneID:2903832"
     CDS             join(137005..137007,137341..137862)
                     /locus_tag="DEHA2F01518g"
                     /note="highly similar to uniprot|P0C0W9 Saccharomyces
                     cerevisiae YPR102C RPL11A Protein component of the large
                     (60S) ribosomal subunit and highly similar to
                     uniprot|Q3E757 Saccharomyces cerevisiae YGR085C RPL11B
                     Protein component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_460429.2"
                     /db_xref="GeneID:2903832"
                     /db_xref="GOA:Q6BMZ1"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ1"
                     /translation="MSAKAQNPMREMHIEKLVLNICVGESGDRLTRASKVLEQLSGQT
                     PVQSKARYTVRTFGIRRNEKISVHVTIRGPKAEEILERGLKVKEYQLRNKNFSATGNF
                     GFGVDEHIDLGIKYDPGIGIYGMDFYVVLGRAGARVTRRKRCRGTIGNNHKTNKEDSI
                     QWFKQRYDADVLNK"
     gene            <138362..>138874
                     /locus_tag="DEHA2F01540g"
                     /db_xref="GeneID:2903833"
     mRNA            <138362..>138874
                     /locus_tag="DEHA2F01540g"
                     /product="DEHA2F01540p"
                     /transcript_id="XM_460430.1"
                     /db_xref="GeneID:2903833"
     CDS             138362..138874
                     /locus_tag="DEHA2F01540g"
                     /note="similar to CA0422|IPF9046 Candida albicans IPF9046
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01540p"
                     /protein_id="XP_460430.1"
                     /db_xref="GeneID:2903833"
                     /db_xref="GOA:Q6BMZ0"
                     /db_xref="InterPro:IPR008409"
                     /db_xref="UniProtKB/TrEMBL:Q6BMZ0"
                     /translation="MLPLRDNPEKHLPRPLLMQEIERYEQEQDDEDIDENNARIIQDG
                     IDMSKYSEFTSANKSGGEDIRYDNLYATLSYSSLQNRNLSLLSQNEEQLEGLHEHHLN
                     DLATIEEEYRQDLSKKRQRIEELNVYRKRRQVVDFKPVNDYLNDRWKDGLKSVVELGI
                     EAKRMDMDMH"
     gene            complement(<139137..>139496)
                     /locus_tag="DEHA2F01562g"
                     /db_xref="GeneID:2903834"
     mRNA            complement(<139137..>139496)
                     /locus_tag="DEHA2F01562g"
                     /product="DEHA2F01562p"
                     /transcript_id="XM_460431.1"
                     /db_xref="GeneID:2903834"
     CDS             complement(139137..139496)
                     /locus_tag="DEHA2F01562g"
                     /note="similar to uniprot|Q06835 Saccharomyces cerevisiae
                     YPR094w RDS3 Well-conserved 12-kDa protein with five CxxC
                     zinc fingers that has been implicated in the activation of
                     certain drug transport genes and in the pre-mRNA splicing
                     pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01562p"
                     /protein_id="XP_460431.2"
                     /db_xref="GeneID:2903834"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="InterPro:IPR029037"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY9"
                     /translation="MSRHQYDLIQCMKQPGTHMGMLCQSCDGKCPICDSFVKPTTKVR
                     ICDECSFGHLGNKCILCGNNLGVNKELGSAAYYCLECVRLEKDREGCPRIVNVGSSKA
                     DMIQNKKKANATGGLLQ"
     gene            <139662..>141353
                     /locus_tag="DEHA2F01584g"
                     /db_xref="GeneID:2903835"
     mRNA            <139662..>141353
                     /locus_tag="DEHA2F01584g"
                     /product="DEHA2F01584p"
                     /transcript_id="XM_460432.1"
                     /db_xref="GeneID:2903835"
     CDS             139662..141353
                     /locus_tag="DEHA2F01584g"
                     /note="weakly similar to uniprot|Q06834 Saccharomyces
                     cerevisiae YPR093C ASR1 Protein involved in a putative
                     alcohol-responsive signaling pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01584p"
                     /protein_id="XP_460432.2"
                     /db_xref="GeneID:2903835"
                     /db_xref="GOA:Q6BMY8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY8"
                     /translation="MSLAIKEEECTICLEVITFASTIGTIKNCHHYYHEDCILQWSSH
                     SNSCPTCRKLFYKIDVSRHDEPNKIRKSISIRDKLLPNDAIDQIPQEYIIPMNSPSTD
                     RENSHSTLDQITEHYSSNNKLCSICSSSDYRSSLSRNLIYCNNCPSAFHLNCLGVNAY
                     EEFDDLTWCCPMCDSLQDLSAMPTYQSGVSNRSRSSRGAGNIRPRANRIRTPRTTTST
                     SSLNSHITDAIFRNASVPINVVPRVDNLNVTSERISRENSKRRPGLIIHNENGELDDD
                     FLYDNSNPEDETNIRAENNRVYSPPIINGGVILRKELKEKQKLSKEEARSWDVFDEAR
                     KCKVDSESSNAVKSIAQKTEEPRARRRRKKLSDLPHPNPNPELIEGTSANLQNVSEKK
                     QEKTRISSLISQLRSQQTGCKYERNVITTSTTPEISTGISLNPTESISGDSGASSDSE
                     TKSQRKKACIDKPTSMELSLEQKVEIQKHIRNNLRPLYRPGDSNPSCSPMIRSEEIYI
                     EINKSASRKIYAHILSLITSETDESKCIEYFNDDETKLKSIVEKFVRDELRYYKW"
     gene            complement(<141436..>142521)
                     /locus_tag="DEHA2F01606g"
                     /db_xref="GeneID:2903836"
     mRNA            complement(<141436..>142521)
                     /locus_tag="DEHA2F01606g"
                     /product="DEHA2F01606p"
                     /transcript_id="XM_460433.1"
                     /db_xref="GeneID:2903836"
     CDS             complement(141436..142521)
                     /locus_tag="DEHA2F01606g"
                     /note="similar to uniprot|P53250 Saccharomyces cerevisiae
                     YGR080W TWF1 Twinfilin A member of a conserved family of
                     actin monomer sequestering proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01606p"
                     /protein_id="XP_460433.2"
                     /db_xref="GeneID:2903836"
                     /db_xref="GOA:Q6BMY7"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR028458"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY7"
                     /translation="MSTQSGIVSSEELLDAFKNFKSGALVIKVSSDNTQLIVDEEFQS
                     TETDTSKILIELNKYVSGIYPHPVYTIFSLSSPSNSNADYAFISFIPDVAPIREKMLY
                     ASTKNTLLTQLGSNNFSKSRTFAWTELDELSFDNFKRSSEVQEDGPLTHEEKTLKEVN
                     SLQGLSLAESSARRNNDTAYKKKLASMHESSSSNGGVLMFSVDSKLESEFRALSQNHD
                     NGKLIIFGINLENEGMELISETTGVNSSSLVSNLNSAIETRSVHPLFALYNYSTNRFA
                     FIYSCPSGSKVKDRMVYASNKQGLINHLRGITDSDELSIDKILEIGDLDELEVKELES
                     SQNEDKDKASNTRNGLKFTKPKGPRRR"
     gene            <142885..>144138
                     /locus_tag="DEHA2F01628g"
                     /db_xref="GeneID:2903837"
     mRNA            <142885..>144138
                     /locus_tag="DEHA2F01628g"
                     /product="DEHA2F01628p"
                     /transcript_id="XM_460434.1"
                     /db_xref="GeneID:2903837"
     CDS             142885..144138
                     /locus_tag="DEHA2F01628g"
                     /note="some similarities with CA0418|IPF9051.5eoc Candida
                     albicans IPF9051.5eoc unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01628p"
                     /protein_id="XP_460434.2"
                     /db_xref="GeneID:2903837"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY6"
                     /translation="MNFLSLFGTSANKTAKVPNFEQGENHDSVDLQVKSLLYVFKRLR
                     LNKLSSFLGKDGTTYSFKYVDGDKQLNSDSGVHNYFQKLDAMYNVKKFKQVMINDEYR
                     VMIDFTKNKFRSFCILSEYPSKGTLSSQGIGNGEFPNFKDYKDRDVKHFRFSIIPLQD
                     TSIAFIANTLSTSDIYVEHHNKIDFNCRYQYAMDSINKVLDMERSMSDIDSSISITDA
                     EKASIIQYYLKRVAFFIQLNRIYVEYLKHHATKGSPTKVSAPISPSKSVSSLSQSYGS
                     SNSKLTNSMSNLSLAPSPPKLSPRKSMADLNKSRSPSPTRTLKSKPSVARMRMDELFN
                     NPISTTPTKAPKLTNKAIDSSKSDTSSTTFNDDIAIISSKKLPEVATEIKLDVWEKCK
                     LAVKDKLEQERKKLSSISSNNSLHE"
     gene            <144436..>145056
                     /locus_tag="DEHA2F01650g"
                     /db_xref="GeneID:2903838"
     mRNA            <144436..>145056
                     /locus_tag="DEHA2F01650g"
                     /product="DEHA2F01650p"
                     /transcript_id="XM_460435.1"
                     /db_xref="GeneID:2903838"
     CDS             144436..145056
                     /locus_tag="DEHA2F01650g"
                     /note="some similarities with uniprot|Q7SBV1 Neurospora
                     crassa NCU07858 Hypothetical protein and similar to
                     CA0620|IPF17998 Candida albicans IPF17998 unknown
                     function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01650p"
                     /protein_id="XP_460435.1"
                     /db_xref="GeneID:2903838"
                     /db_xref="InterPro:IPR007523"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY5"
                     /translation="MISRNILRQSCHRTQSRYFASSALMSNLFGGKKVINQTQLNAPT
                     GKGESTTNPADMIKRNDILMFSQKPINYIETVKSNGFHLANNLLITSPDKEGNIIGTL
                     LLESETFEINMSKPNKGFDLINGFIIDFHEDVLQIFNKIHPKPEICVIGLGCKSRMLS
                     DSTKKYFSNLGIQVDHSDSNNAAQMFDLLATERPNVIAALLLPPNI"
     gene            complement(<145270..>147450)
                     /locus_tag="DEHA2F01672g"
                     /db_xref="GeneID:2903839"
     mRNA            complement(<145270..>147450)
                     /locus_tag="DEHA2F01672g"
                     /product="DEHA2F01672p"
                     /transcript_id="XM_460436.1"
                     /db_xref="GeneID:2903839"
     CDS             complement(145270..147450)
                     /locus_tag="DEHA2F01672g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019C MUC1 GPI-anchored cell surface
                     glycoprotein required for diploid pseudohyphal formation
                     and haploid invasive growth transcriptionally regulated by
                     the MAPK pathway (via Ste12p and Tec1p) and the cAMP
                     pathway (via Flo8p) and similar to CA0621|IPF17999 Candida
                     albicans IPF17999 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01672p"
                     /protein_id="XP_460436.2"
                     /db_xref="GeneID:2903839"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY4"
                     /translation="MSNDFLQSSPSRHMIDPAIYNSFPDMQEDRNTSNSHTGNGNTSQ
                     HQQPQQSQQQLSAGPPSAQKNHNQLPSNLTGWTPLISKTIFNDQLISYNSTPSGKFFN
                     GVLSGHVNNEIDYAQGLNLTPFLTHNLNIPNSNSHMNGISNITPFHDKTLHLTDFFMD
                     SPIKQTPIKNIDTITPSKFKIGSERKFLKQSVFQDPKSASKRSITQIDTPPRQPHKVS
                     ILNKHEARYEKNNIIDDKVQSKDEDEDDQGDEENEKKSDGISINKSKLYGQNLLTPSK
                     TVLKDISNINKNQGKSTPMPKDSKKTKESFETPSKQIPDSSPSTVIMSSAVNSPPSKP
                     LTTNDIDSSKNVTVKYSTTTQNLPPSPTPKKEIANNSDNVDVLKPTMGVFSEKKSKPL
                     KTKPAVFKNLSSDSTGASSSMNTKTKSNSKTQMQAGMNKFQIVFTDVHTLMNKKNKSK
                     KLNNAPKPKLKRSQSANRSKDQSFHINDNTKPRSLTRSATAPDSNQQSYQTTHRTGSS
                     HDHNVSMNTSSKEVSLISGNSNSMNTSNLNMSSTDHSSFELGGLSSTPNGKYFLDKMF
                     DKPSPQSQQNLNANQYYSMHQHSLSNMPPPNPNNSRPPPTVAQHNLSHAQQQQQHPMM
                     MMMMMMSTPQHQNVVNYGSNVYNPNNEISPTSDNQFASNSNISNFSYQPYPKSGTPSQ
                     SMMGPMVANQKESSQYSQLIPVSTSDEDEDILLKREEDEEEDNV"
     gene            complement(<148453..>149385)
                     /locus_tag="DEHA2F01694g"
                     /db_xref="GeneID:2903840"
     mRNA            complement(<148453..>149385)
                     /locus_tag="DEHA2F01694g"
                     /product="DEHA2F01694p"
                     /transcript_id="XM_460437.1"
                     /db_xref="GeneID:2903840"
     CDS             complement(148453..149385)
                     /locus_tag="DEHA2F01694g"
                     /note="highly similar to uniprot|P53252 Saccharomyces
                     cerevisiae YGR086C PIL1 Long chain base-responsive
                     inhibitor of protein kinases Phk1p and Phk2p acts along
                     with Lsp1p to down-regulate heat stress resistance via
                     regulation of the Pkc1p and Ypk1p pathways"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01694p"
                     /protein_id="XP_460437.1"
                     /db_xref="GeneID:2903840"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY3"
                     /translation="MHRTYSLRSSRAPTAAQLQSPPPPTSSTKQKFFGKGSLSHTFRK
                     QAAGSMGPELSRKLAVLVKMEKNLMRSIEITSRERKDVAKQLSIWGEANDEDVSDITD
                     KLGVLIYEVGELEDQFIDRYDQYRITIKSIRDIEGSVQPSRDRKQKITDQIAYLKYKD
                     PQSPKINVLEQELVRAEAESLVAEAQLSNITREKLKTAFNYQFDSTREHAEKIALIAG
                     YGKALLELLDESPVTPGETRPAYDGYEASKQIIIDAENALASWTFDSAVVRPTLSLAT
                     HEHDDEYDVDELAEDARNMQVTEKEWEDENRVTA"
     gene            <150565..>151131
                     /locus_tag="DEHA2F01716g"
                     /db_xref="GeneID:2903841"
     mRNA            <150565..>151131
                     /locus_tag="DEHA2F01716g"
                     /product="DEHA2F01716p"
                     /transcript_id="XM_460438.1"
                     /db_xref="GeneID:2903841"
     CDS             150565..151131
                     /locus_tag="DEHA2F01716g"
                     /note="similar to uniprot|Q88KQ7 Pseudomonas putida
                     Hydrolase isochorismatase family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01716p"
                     /protein_id="XP_460438.1"
                     /db_xref="GeneID:2903841"
                     /db_xref="GOA:Q6BMY2"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY2"
                     /translation="MTKQAFIIIDLQNDYYKDGKFPLVGIEEATENAATLLKEVRKLK
                     DEYLIIHVRHEFPVDPKDAPFFGKGTEGSQINEAVKNEPNELVITKDEPNAFVRTNLQ
                     QVLEDNKISELIIVGAMSHLCVQGTSRAASEKGYKVTVIQDAIATRDLEFGGVNVPAK
                     QVAATVLVTLAFGYAKVITTKEQLQLLN"
     gene            <152133..>152822
                     /locus_tag="DEHA2F01738g"
                     /db_xref="GeneID:2903842"
     mRNA            <152133..>152822
                     /locus_tag="DEHA2F01738g"
                     /product="DEHA2F01738p"
                     /transcript_id="XM_460439.1"
                     /db_xref="GeneID:2903842"
     CDS             152133..152822
                     /locus_tag="DEHA2F01738g"
                     /note="weakly similar to uniprot|Q06563 Saccharomyces
                     cerevisiae YLR251w SYM1 Protein and similar to
                     CA3605|IPF3865 Candida albicans IPF3865 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01738p"
                     /protein_id="XP_460439.2"
                     /db_xref="GeneID:2903842"
                     /db_xref="GOA:Q6BMY1"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:Q6BMY1"
                     /translation="MSFFDKYNRLLKTHPFRVNMVTTGLLFGVGDGVAQKLFPSNHDH
                     LDEEKPKYNVYRTMRAMIYGSCFFAPCGVLWYGKRLPLIKNPFVSVKNRETWSKNRVH
                     LYDTLYRVAIDQIFIPGLFWIPMYNIVMSTLSGYENPLEVAFHKLQHNWWNVLTTNWM
                     VWPGFQLISFFYIPVHLRIVAANICSVGWNCFLSYLYNGKAHGDHQKEEILDHLVDPD
                     EEIEETTMVVY"
     gene            <153307..>153927
                     /locus_tag="DEHA2F01760g"
                     /db_xref="GeneID:2903848"
     mRNA            <153307..>153927
                     /locus_tag="DEHA2F01760g"
                     /product="DEHA2F01760p"
                     /transcript_id="XM_460440.1"
                     /db_xref="GeneID:2903848"
     CDS             153307..153927
                     /locus_tag="DEHA2F01760g"
                     /note="similar to uniprot|Q06563 Saccharomyces cerevisiae
                     YLR251w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01760p"
                     /protein_id="XP_460440.1"
                     /db_xref="GeneID:2903848"
                     /db_xref="GOA:Q6BMY0"
                     /db_xref="InterPro:IPR007248"
                     /translation="MASIYQKYSQLIAKRPLITNIITTGFLFGSGDYLAQTLYPSSSK
                     YDYKRTLRATFYGSIIFAPIGDKWYRLLHKINFPFPKTKVSPTVSKVLNTLTKVGVDQ
                     LVFAPFIGIPLYYSVMSVLEFHDNPLQVAREKLHAHWFNTLKTNWVVWPTFQLFNFAL
                     IPVQFRLLVVNIFSIGWNCYLSSVLNHKHDFLIENITDVDKDEILI"
     gene            <154574..>156829
                     /locus_tag="DEHA2F01782g"
                     /db_xref="GeneID:8998857"
     mRNA            <154574..>156829
                     /locus_tag="DEHA2F01782g"
                     /product="DEHA2F01782p"
                     /transcript_id="XM_002770679.1"
                     /db_xref="GeneID:8998857"
     CDS             154574..156829
                     /locus_tag="DEHA2F01782g"
                     /note="similar to uniprot|P38903 Saccharomyces cerevisiae
                     YOR014w RTS1 B-type regulatory subunit of protein
                     phosphatase 2A (PP2A)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01782p"
                     /protein_id="XP_002770725.1"
                     /db_xref="GeneID:8998857"
                     /db_xref="GOA:B5RU79"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B5RU79"
                     /translation="MMKGFKNRLSRNKGQSTGKKGEKKLDKDKDSKSDSSSRKASSSS
                     SIASKLSGSGSNAKSSSPSISRHNSGNSIKSSSSGGSATAMGQTSHSPQSPNQSQQDS
                     PRILINDSENNDSPTMVTTAGSNTQPVTPTPTSPTTVTNTSPNASNSPFDQVQIKPGH
                     VPHSQTGSAIHPHGYPLNTNISSPTRDNFDIDLIVTPKRHSSSRFEPSTSDRYQEIVK
                     LPNFDEILPEEQISLFIQKIDQCNIMFDFSDPTYDGRGKEIKRITLQELIHFISNNRF
                     TYTDEMYKHVVGMFKKNLFRPIPPPVNPIGDIYDPDEDEPVSELAWPHMQAIYEFFLR
                     FIESPDFTHQIAKQYIDHEFILKILELFDSEDPRERDCLKTTLHRIYGKFLSLRSFIR
                     KSINNVFLQFVYETERFNGIGELLEILGSIINGFALPLKDEHKIFLVRILIPLHKVKS
                     LSLYHPQLAYCIVQFLEKDPMLTEDVIMGLLRFWPKINSPKEVMFLNEIEDIFEVMEP
                     NEFLKIQIPLFAQLSKCISSPHFQVSEKVLCYWTNEYFLTLITENAEVVLPIIFASLY
                     ELTNATQPGITNGTVQQRLLENPESPTDANGNLIDRGLILNDLNNHSIDHNTNVNDSL
                     NPNMHDITDEEYYDSFSSPQQVQGDLDEFGTPNQIPPHNSATSNWNRSIHSLAFGALK
                     VFMDHNPILYDHCTMLYHQSLEEQRAREVARKDGWKKVEEYVNSLRLQQSSSALSGKN
                     SNDNGASVASH"
     gene            <157882..>159664
                     /locus_tag="DEHA2F01804g"
                     /db_xref="GeneID:2903945"
     mRNA            join(<157882..158332,158550..>159664)
                     /locus_tag="DEHA2F01804g"
                     /product="DEHA2F01804p"
                     /transcript_id="XM_460442.1"
                     /db_xref="GeneID:2903945"
     CDS             join(157882..158332,158550..159664)
                     /locus_tag="DEHA2F01804g"
                     /note="highly similar to uniprot|P50094 Saccharomyces
                     cerevisiae YML056C IMD4 Inosine monophosphate
                     dehydrogenase catalyzes the first step of GMP biosynthesis
                     member of a four-gene family in S. cerevisiae
                     constitutively expressed"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01804p"
                     /protein_id="XP_460442.1"
                     /db_xref="GeneID:2903945"
                     /db_xref="GOA:Q6BMX8"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX8"
                     /translation="MVLDASSATSHLQSYSKKDGLDVKTLIDSANFGGLTYNDFLVLP
                     GLIDFPSSKVGLDTKLTKKISLRSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNCSP
                     DEQAEMVRKVKKYENGFINDPFVISPNETVGDVRNMKAELGFTSFPVTENGKIGGKLV
                     GIVTSRDVQFHDNNDSKVSEIMTTELITGEKGIDLSEGNELLRSSKKGKLPIVDASGN
                     LVSLISLTDLQKNQSYPLASKSFDSKQLLCGAAIGTVPNDRERLEKLVAAGLDVVVVD
                     SSNGSSIFQLDMLKWIKSKFPELQVIAGNVVTREQAALLIEAGADGLRIGMGSGSICI
                     TQEVMACGRPQGTAVYNVTEFANQFGVPCIADGGIGNIGHITKALALGASCVMMGGLL
                     AGTSETPGSYFYSDGKRLKSYRGMGSVDAMQQTSTTANASTSRYFSESDKVFVAQGVS
                     GAVVDKGSITKFVPYLYNGLQHSLQDIGTPSLDELRTRVDNGEVRFEFRTASAQFEGG
                     VHGLHSYEKRLHN"
     gene            <159815..>160360
                     /locus_tag="DEHA2F01826g"
                     /db_xref="GeneID:2903946"
     mRNA            <159815..>160360
                     /locus_tag="DEHA2F01826g"
                     /product="DEHA2F01826p"
                     /transcript_id="XM_460443.1"
                     /db_xref="GeneID:2903946"
     CDS             159815..160360
                     /locus_tag="DEHA2F01826g"
                     /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
                     YOR367W SCP1 Component of yeast cortical actin
                     cytoskeleton binds and cross links actin filaments"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01826p"
                     /protein_id="XP_460443.2"
                     /db_xref="GeneID:2903946"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX7"
                     /translation="MNYLNYNRYEQKSEQNANTNLDQDLTNSRHQKYTKSEPEIKHWI
                     FSVLSTPQSTIDAYSNRSLDLIDILKDGELLCKLGKLLEIPNNPCSKYKSSKMPFVQM
                     ENISFFLKACELIGISHDEIFQTIDLYERKDPYQIIITLISFSRRANEINSTNFPNVI
                     GPKIVKIKPPVPKKPINLSAK"
     gene            <160739..>161650
                     /locus_tag="DEHA2F01848g"
                     /db_xref="GeneID:2903947"
     mRNA            <160739..>161650
                     /locus_tag="DEHA2F01848g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_460444.1"
                     /db_xref="GeneID:2903947"
     CDS             160739..161650
                     /locus_tag="DEHA2F01848g"
                     /note="similar to uniprot|P10962 Saccharomyces cerevisiae
                     YAL025C MAK16 Essential nuclear protein required for
                     normal concentration of free 60S ribosomal subunits"
                     /codon_start=1
                     /transl_table=12
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_460444.1"
                     /db_xref="GeneID:2903947"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX6"
                     /translation="MSDEIVWQVINQQFCAFKIKTTKEQNFCRNEYNVSGLCSRQSCP
                     LANSRYATVKNVDGKLYLYMKTAERTHMPSKWWERIRLSKNYNKALSQIDGHLEYWQK
                     FLIHKCKQRLTRLTQVAITERRLALREDERHYVGVKHKVKRREENRERKALAAAKIEK
                     AIEKELLERLKSGAYGDKPLNVDENIWKKVLGKVDNEEEEEEEDEDDVELESDDESDV
                     GEVEYVEDDGDDELVDLEDLEKWLDDSSEESASEESDDESDSEDKSSKRKAAADDKAN
                     KRRRRPKVEIEYEQEEQEPSIQTNIAA"
     gene            <162317..>163720
                     /locus_tag="DEHA2F01870g"
                     /db_xref="GeneID:2903948"
     mRNA            <162317..>163720
                     /locus_tag="DEHA2F01870g"
                     /product="DEHA2F01870p"
                     /transcript_id="XM_460445.1"
                     /db_xref="GeneID:2903948"
     CDS             162317..163720
                     /locus_tag="DEHA2F01870g"
                     /note="weakly similar to uniprot|Q08417 Saccharomyces
                     cerevisiae YOR049C RSB1 Suppressor of sphingoid long chain
                     base (LCB) sensitivity of an LCB-lyase mutation and
                     similar to CA3607|CaRTA2 Candida albicans CaRTA2 Unknown
                     function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01870p"
                     /protein_id="XP_460445.1"
                     /db_xref="GeneID:2903948"
                     /db_xref="GOA:Q6BMX5"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX5"
                     /translation="MSSMNFESMNWSPSTIPTSTTLRSVAATKSSGLMETLTSATARI
                     HTATARPELISLSRNIRGAEASLSILQAEGEIATATDDSVKSMATQAIFNATLNLKDL
                     EWEENVYSMRSLSRPANIIYLAVFIITFLYFTLMIWKSRFHWFNVAFFCGIGLEFAGF
                     IGRVMSFSDMTDINYYILQLVCLTIAPAFIMGGIYYLFAQLVVVYGREYSILRPMWYS
                     YIFITCDVLSLIIQAGGGGAASYASNNFEDARPGSYVMIAGIAFQVFAMSFFLLFWFH
                     FISQTFFKYRPSRNESTDGESKYDPAWKNASVGNFFKMLFNTKSAYAHRTTYLEPYYN
                     PQFAKIRTRRLFYWFPLAMTIAVVAVYIRCIYRVVELAQGFSGYLITHEVYIMVLDAL
                     MIAITAIVFVPFHPVHVFGAKNRIRLAAIKKNLDEASDNPADIADDNTAYDNTAGDNT
                     AYVSAKGSIKEENSDSY"
     gene            <164192..>165613
                     /locus_tag="DEHA2F01892g"
                     /db_xref="GeneID:2903949"
     mRNA            <164192..>165613
                     /locus_tag="DEHA2F01892g"
                     /product="DEHA2F01892p"
                     /transcript_id="XM_460446.1"
                     /db_xref="GeneID:2903949"
     CDS             164192..165613
                     /locus_tag="DEHA2F01892g"
                     /note="similar to CA2671|IPF5856 Candida albicans IPF5856"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01892p"
                     /protein_id="XP_460446.1"
                     /db_xref="GeneID:2903949"
                     /db_xref="GOA:Q6BMX4"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR005956"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX4"
                     /translation="MAKYLELSMGFEEVAYRGLETNSRRLASHVVRNGNILFEIINTL
                     ESVAEHYPTVPMSKEEALSIKLDYSADEAHILKSLKEKIIKLTAEIVDENLDRYKYAM
                     DIKAAKENLERSIINSTNFTAAISTIRKSINECVETSKKAIQDNFESFLIQEFVKIHG
                     EGVMDISFNVLDVDSAFQKAIESGAYIIKLPQTMSDVHGSVKLATIAVPYTDIHHTLI
                     QNKDYSGPFLPNYTKSIIEKPETYMHQLESLPPIRLDCIDHCVENYSWNQMMEHARFY
                     ANIFGFHKYWSVDEKDVFTGETALKSIVMASSNGKVKMPINEPAKGRKKSQIEEFYDF
                     NGGPGVQHIALKTNDIIATVTSLRKRGIEFNPASQKYYDTLKQRLINDDIILKEDFNS
                     IQNLNILVDYDPETRNNASKTCNYILQIFTKPLHDRPTLFIEIIQRRHHNGFGKGTFK
                     GLFETIEAQQKLRGTLVSSDKAE"
     gene            complement(<165951..>167057)
                     /locus_tag="DEHA2F01914g"
                     /db_xref="GeneID:2903950"
     mRNA            complement(<165951..>167057)
                     /locus_tag="DEHA2F01914g"
                     /product="DEHA2F01914p"
                     /transcript_id="XM_460447.1"
                     /db_xref="GeneID:2903950"
     CDS             complement(165951..167057)
                     /locus_tag="DEHA2F01914g"
                     /note="some similarities with uniprot|P36093 Saccharomyces
                     cerevisiae YKL043W PHD1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01914p"
                     /protein_id="XP_460447.2"
                     /db_xref="GeneID:2903950"
                     /db_xref="GOA:Q6BMX3"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX3"
                     /translation="MTGPGHQIYYNSNNANDSNSDQIVNPSSNSNSNNNMSNTQYANQ
                     QSGSPLEPLHSISYHAYPSSRLKNTFNEPNFTFQQMYQSSSQPQEYYNNEYPALINQS
                     PLPLSSTIPSSVEAQGQMIGLQQSQPSNYSGANVLFQSDGAVRNSQSQTARVSHSPQS
                     SNSTHSRNSSASTKRPSFDNSEFVKPDKPRIATTFWEDEKTICYQVEAQGILVSRRED
                     TNYVNGTKLLNVAGMTRGKRDGILKTEKTKSVVKVGAMNLKGVWIPFERASEIARNEG
                     IDGLLYPLFVKDLKSFYHEKGSMLRHDSYLKSLNSENLSNITLSDVSSPTIQSAIIPS
                     SNNDYHDKDIKSIEHHEYFEEKSPSPKGLKAENA"
     gene            <168349..>169914
                     /locus_tag="DEHA2F01936g"
                     /db_xref="GeneID:2903951"
     mRNA            <168349..>169914
                     /locus_tag="DEHA2F01936g"
                     /product="DEHA2F01936p"
                     /transcript_id="XM_460448.1"
                     /db_xref="GeneID:2903951"
     CDS             168349..169914
                     /locus_tag="DEHA2F01936g"
                     /note="similar to uniprot|P47082 Saccharomyces cerevisiae
                     YJR001W AVT1 Vacuolar transporter imports large neutral
                     amino acids into the vacuole"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01936p"
                     /protein_id="XP_460448.2"
                     /db_xref="GeneID:2903951"
                     /db_xref="GOA:Q6BMX2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX2"
                     /translation="MSHFSDNDENDCCNHPKERRRSFLDLGGANSLNKFASSYTRAQS
                     YLGSSLVETSVVQGTEDDLSPCTSLDDVVTESAIDDSPRGNERALDQINAFSFERNEE
                     SSLLSRRTSKADSERLITGDSTAPQTIFNCINTLMGIGMLSLPFGFRLSGWVLGTLML
                     LFSSIVTNISAKMLGKILRKYPHLMSYGDIAHLYGGRGINIVVTLVFSFDLLGAMISL
                     IILFSDSFHILFPSLQRVLLKGIIVAVLFVLSFLPLSILSLCSLLGIICTSLLIVVII
                     ICGLLTSTSPGSLVTPAVTNLWPSEYKYLFLSLGLFMAPWGGHPVFPELYRDMRHRSK
                     FSKCCNIAFGITFNLDYLIAAIGFLMFGINCQDSLTKNLMTNKNYPDWVRPLICLFMG
                     LLPVSKLPLITRPIITVYESFFKLNQTNYAVIKNGIRQEVYGIKRVLSRVVFCVLLLL
                     VSLIFNSFGKVISFLGSAICFTICMTLPLIFYLKFYDDEITVMERLLIKFGILIGVVF
                     SLIGTYGSIVIDI"
     gene            complement(<170176..>173199)
                     /locus_tag="DEHA2F01958g"
                     /db_xref="GeneID:2903952"
     mRNA            complement(<170176..>173199)
                     /locus_tag="DEHA2F01958g"
                     /product="DEHA2F01958p"
                     /transcript_id="XM_460449.1"
                     /db_xref="GeneID:2903952"
     CDS             complement(170176..173199)
                     /locus_tag="DEHA2F01958g"
                     /note="weakly similar to uniprot|Q03735 Saccharomyces
                     cerevisiae YML117w and similar to CA2674|IPF5846 Candida
                     albicans IPF5846 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01958p"
                     /protein_id="XP_460449.2"
                     /db_xref="GeneID:2903952"
                     /db_xref="GOA:Q6BMX1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX1"
                     /translation="MAPPVTPLDLSYSQSMLPSNLLVNSPYIQQTQNIVPMSPILPRQ
                     YAPPSLNLSHGNLAHHQQQLSQMHSHHQHQNQQHHSQHPHYVPNSPYLTPLSSNSNLE
                     QLNLSRTVILKNIDENVSLNELLNSIDFGPIEYCKMYSRPAPERLRDTENLKTCVISF
                     VNSKISINFHIKYSKNRYNLNKLKEKLRNSKYLKVSLNESTNASSNGSINNFNSHLNN
                     QDYIKLKTLNYILEFNATRCLLIRLHSSEFTSSNIEGIENDVTRQCSKFGEIEDLKIS
                     TNETKSEVKCLIHFTSIDAAIKSYEFYLKKIQADKQDQIDFEGTDKSKDAIEYLQASF
                     HRDRCDRTVIDKPSSGSNTNSPIFSKRQTTTINHNNIIPEDLNEPTPDTEGEELETFG
                     EESVLDDQSILENHESIRSSLLSNAKDPQEPSYDQISSKSSSSQNIDQSYISNSSSYM
                     LNTYPSINQSQVRMQIPQVPNNNSASSYQYNPDPFNVGNRTIYLGNLHPNTTVEEIAN
                     NVRAGGLVESIRYHPDKRVCFITFIDPTIALKFYLNHQVLHQLIIHGYDITVGWAKNH
                     SGALNRDISLAVTAGASRNVYIGIKLNKDENNGSSSTTKDNKIRLPNESVLRSDFSKF
                     GELEQINFYHNKDCGFLNFINIADAIKLVDSFESRNISKINKIVGDNGEFYDKYNVFK
                     ISFAKDRCGNPPKFSFKKKFGKRKNKDLAKPEDDSVIGKLDHNEDGRDEVRDEAMNEE
                     AAMVFGIMSTTESKKEVSTSNEDEEPEETRKAFEQSDITISGKAEKENNKNEKYEKTQ
                     ANIKDVKSEIPGAADEDDEDDEDEDDISIIIGSDETTYSARDELKKSRNSGDKFYNNK
                     VNTSDTFIPFRKSSRNSSNISLNSHNPNYMKYYNQDSKFPPSPYHHHQQQSQHQQLYY
                     MQNSQRPMASRMNSFGYGGYYPPPNPNPNQYTYTANPSKNPYSTSGSQVMSQYLAKSQ
                     HDNLVYAASILSNDVGMDEDKEYHYKPNSRRNSKK"
     gene            <174737..>175381
                     /locus_tag="DEHA2F01980g"
                     /db_xref="GeneID:2903953"
     mRNA            <174737..>175381
                     /locus_tag="DEHA2F01980g"
                     /product="DEHA2F01980p"
                     /transcript_id="XM_460450.1"
                     /db_xref="GeneID:2903953"
     CDS             174737..175381
                     /locus_tag="DEHA2F01980g"
                     /note="highly similar to uniprot|P32835 Saccharomyces
                     cerevisiae YLR293C GSP1 GTP binding protein (mammalian
                     Ranp homolog) involved in the maintenance of nuclear
                     organization RNA processing and transport"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F01980p"
                     /protein_id="XP_460450.1"
                     /db_xref="GeneID:2903953"
                     /db_xref="GOA:Q6BMX0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMX0"
                     /translation="MAQEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEV
                     HPLGFHTNFGELKFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLVGNPQLEFVASPALAPPEVQVDADLMQRYQQEMEQATALPLPDEDDADL"
     gene            complement(<175832..>176146)
                     /locus_tag="DEHA2F02002g"
                     /db_xref="GeneID:2903954"
     mRNA            complement(<175832..>176146)
                     /locus_tag="DEHA2F02002g"
                     /product="DEHA2F02002p"
                     /transcript_id="XM_460451.1"
                     /db_xref="GeneID:2903954"
     CDS             complement(175832..176146)
                     /locus_tag="DEHA2F02002g"
                     /note="similar to CA2676|CaYHC1 Candida albicans CaYHC1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02002p"
                     /protein_id="XP_460451.2"
                     /db_xref="GeneID:2903954"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW9"
                     /translation="MSVRKSHLMGKNHIRYYCNYYEMKAKETGIWDPLDSMYEINLSY
                     LNKGAPGASNEGNTSSSKGDFSLPPPPSLTNYPNPPPSAFRNTEEYQQSVTEHTQNQE
                     TY"
     gene            <176436..>176882
                     /locus_tag="DEHA2F02024g"
                     /db_xref="GeneID:2903955"
     mRNA            join(<176436..176453,176574..>176882)
                     /locus_tag="DEHA2F02024g"
                     /product="DEHA2F02024p"
                     /transcript_id="XM_460452.1"
                     /db_xref="GeneID:2903955"
     CDS             join(176436..176453,176574..176882)
                     /locus_tag="DEHA2F02024g"
                     /note="weakly similar to uniprot|Q12349 Saccharomyces
                     cerevisiae YLR295c ATP14 F1F0-ATPase complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02024p"
                     /protein_id="XP_460452.1"
                     /db_xref="GeneID:2903955"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW8"
                     /translation="MFRQSVRSLSARRLFSISPQRSNLVSDLYIQQIKAFKPTPLSNK
                     DAESSIKSFQLPNKPSVPESEISADALSQYESSDVETAATEPSSAAEPAAEEDWFVFE
                     EEEVHH"
     gene            <177614..>178867
                     /locus_tag="DEHA2F02046g"
                     /db_xref="GeneID:2903956"
     mRNA            <177614..>178867
                     /locus_tag="DEHA2F02046g"
                     /product="DEHA2F02046p"
                     /transcript_id="XM_460453.1"
                     /db_xref="GeneID:2903956"
     CDS             177614..178867
                     /locus_tag="DEHA2F02046g"
                     /note="similar to uniprot|Q59P70 Candida albicans Putative
                     uncharacterized protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02046p"
                     /protein_id="XP_460453.1"
                     /db_xref="GeneID:2903956"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW7"
                     /translation="MASESPYLDTESILNASDLINSTLISKGYITEKLNFNSINWKDL
                     VQDQIENNIQELAKLDELKVTETIYNNDKNIINIIYSLLQSIERNKAQNKSFNKVISK
                     KDSTIRDLQKKIESLEHQVDQSESRLNRFVQIDQLQLSKRVQDLSHVNKLQTQDLNKL
                     KNWCTDIKTKYHVKLKKKNIEIDHLKNQLLDKKNLSTTTTFGIPLSYDSSRNNDTTSF
                     DQDINSNIIYNHNPIIDNTNPNTHLNSSLQPVLNKQYEQIVIDLTQLIENLISENHKF
                     SRFIKLINNYYQSLNIQLSNINHKHLDVRSLPNPSDLIDLNEFTGDLDPANINSKDSL
                     DEIESFEYITKPLLNNVYKNYHYVSNLVELVDSNSAQINENENGFSSKKIDELKTELE
                     IVTRNWQDAIKTLENWKNYQQTNDD"
     gene            complement(<178926..>180167)
                     /locus_tag="DEHA2F02068g"
                     /db_xref="GeneID:2903957"
     mRNA            complement(<178926..>180167)
                     /locus_tag="DEHA2F02068g"
                     /product="DEHA2F02068p"
                     /transcript_id="XM_460454.1"
                     /db_xref="GeneID:2903957"
     CDS             complement(178926..180167)
                     /locus_tag="DEHA2F02068g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02068p"
                     /protein_id="XP_460454.2"
                     /db_xref="GeneID:2903957"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW6"
                     /translation="MASNSVVIGSIIGAVIGTCFLLSFVMILYCYWCCVIYVKSPQDE
                     YNVSDLHFRDKQKTTHTLRHMFKAMSWIYGGSRSKDLEDQIDIDKPPSSVTNCDTNLN
                     SNSTFSRLALKSYTLPSEDGETPQVCMGNVKDVNIIPCFNKDDTTSYSSVYKDAIDRF
                     DLSDGLASTNVDRRNSLKAKHLSNIRRMSSLTYRMDDSEPSNFVTTVAKPSESEQSYI
                     SDQYDSFTRTLMLQNLIGNSVNAIKKNVIRELYDPYSENLISVGGIVVVVKPFDGVND
                     FEFNSLQTGDLLRVVRFYVKGELDIDKSKMKHDEDSIDIAESRNNSSTDATIRSGICI
                     GRSDPNYNSVYCTGILLNTYLEYNKQTRDLSLRLKKDAEENEFELLKDFPLRIVSLET
                     TVLKKVSESSVAKDKFENHFS"
     gene            complement(<180297..>180839)
                     /locus_tag="DEHA2F02090g"
                     /db_xref="GeneID:2903958"
     mRNA            complement(<180297..>180839)
                     /locus_tag="DEHA2F02090g"
                     /product="DEHA2F02090p"
                     /transcript_id="XM_460455.1"
                     /db_xref="GeneID:2903958"
     CDS             complement(180297..180839)
                     /locus_tag="DEHA2F02090g"
                     /note="weakly similar to uniprot|Q05863 Saccharomyces
                     cerevisiae YLR281c and similar to CA2325|IPF10977 Candida
                     albicans IPF10977 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02090p"
                     /protein_id="XP_460455.2"
                     /db_xref="GeneID:2903958"
                     /db_xref="GOA:Q6BMW5"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW5"
                     /translation="MPRNSSFRIPVRCFVSTSYVNYAIPKKNKMPPRPKWLIVEEEID
                     EAFLKGGRGPGGQKINKSNSKVQLTHKPTGLVVTCQYSRSQEQNRKRAREILALKLDE
                     LQNPEGCRTAIVNERKTKTKQGKTKKANKKYKVLDEERMKTKEEEHEILSNFIDIDAE
                     FDSHVKSTLNSTTTGEKGPV"
     gene            <181112..>183310
                     /locus_tag="DEHA2F02112g"
                     /db_xref="GeneID:2903959"
     mRNA            <181112..>183310
                     /locus_tag="DEHA2F02112g"
                     /product="DEHA2F02112p"
                     /transcript_id="XM_460456.1"
                     /db_xref="GeneID:2903959"
     CDS             181112..183310
                     /locus_tag="DEHA2F02112g"
                     /note="highly similar to uniprot|P29496 Saccharomyces
                     cerevisiae YLR274W CDC46 Component of the hexameric MCM
                     complex which is important for priming origins of DNA
                     replication in G1 and becomes an active ATP-dependent
                     helicase that promotes DNA melting and elongation when
                     activated by Cdc7p-Dbf4p in S-phase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02112p"
                     /protein_id="XP_460456.2"
                     /db_xref="GeneID:2903959"
                     /db_xref="GOA:Q6BMW4"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008048"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW4"
                     /translation="MSYERSEVYGAQVLPGEDPEDNSFNEITKAFRSFILEFRLNSQF
                     IYRDQLRENLLIKNYFLKVNSEHLIGFNEELNKKLTDDPAEMIPLFENAITDIGKRIA
                     YLSNEEVPTDFPNCQLILFSNASKTSIRDLDSDHISKIVRVSGIIISSSVLSSRATQV
                     QLLCRNCKHTMRQKISSGFGSLNLPNRCQGTHNFDDTSTQDKCPSDPYTIVHDKSTFI
                     DQQVLKLQESPDMVPVGEMPRHIILQADRYMTNQVVPGTRVTIVGIYSIYQAKQKSSS
                     NVNTVAIRNPYLKILGIQTDVDNSISGQGLTFTEEEEEEFLKISRLPNLYDVFSKSIA
                     PSIYGNEDIKKAITCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKIS
                     PISVYTSGKGSSAAGLTASVQRDQVTRDFYLEGGAMVLADGGVVCIDEFDKMRDEDRV
                     AIHEAMEQQTISIAKAGITTILNSRTSVLAAANPIFGRYDDLKSPGENIDFQTTILSR
                     FDMIFIVKDDHNEARDISIAQHVMNVHTGNANNNQDQNQEGEIPIDVMKRYIQYVKLK
                     CAPRLSPEASERLSSHFVSIRRRLQINEVEMNERSSIPITIRQLEAIIRITESLAKLR
                     LSPIALEEHVEEAIRLFTASTMDAVDQGVSSGGLITTGDMNKEINKVEQELRRRLPIG
                     WSTAYKTLRREIVDSGKASPGALDKALYILERHEVIRFRHQRQNILRCGV"
     gene            <183570..>186017
                     /locus_tag="DEHA2F02134g"
                     /db_xref="GeneID:2903960"
     mRNA            <183570..>186017
                     /locus_tag="DEHA2F02134g"
                     /product="DEHA2F02134p"
                     /transcript_id="XM_460457.1"
                     /db_xref="GeneID:2903960"
     CDS             183570..186017
                     /locus_tag="DEHA2F02134g"
                     /note="similar to uniprot|Q06224 Saccharomyces cerevisiae
                     YLR277C YSH1 subunit of Polyadenylation factor I (PF I)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02134p"
                     /protein_id="XP_460457.2"
                     /db_xref="GeneID:2903960"
                     /db_xref="GOA:Q6BMW3"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /translation="MTVDSQPADGTDDFKFFGLGGCNEVGRSCHIIEYKNKVIMLDAG
                     VHPGLQGLSSLPFYDEYDLSKVDILLVSHFHLDHAASLPYVMQHTNFNGRVFMTHATK
                     AIYRWLLSDFVKVTSIGGGSDARLNNSDPNANTGSSNLYTDDDLMRSFDRIETIDYHS
                     TIELDGIRFTAYHAGHVLGACMYFIEIGGLKVLFTGDYSSEEDRHLQVAEVPPIKPDI
                     LITESTFGTATHEPRLEKETRMTNIIHSTLLKGGRILMPVFALGRAQELLLILEEYWS
                     LNDDLQNINIYYASSLARKCMAVYQTYTNIMNDSIRLTTSATNSSKKQNPFQFKFIKS
                     IKNLDKFQDFGPCVVVASPGMLQNGVSRELLERWAPDPKNAVIMTGYSVEGTMAKDLL
                     TEPHTIQSAMNSDMTIPRRLSIEEISFAAHVDFQQNASFIEKVNPSKIILVHGESNPM
                     GRLKSALLSKYASRKGTEQEVKVFNPRNCDEVTIGIKGLKVAKVLGTLAEEQLSYLKK
                     EISTQIKKDNVKIEELSDDNMDKETMPESDEKADKESEDTKNDIDKNNDENANEKNII
                     STGKALSGVLVSKDFDLNLLQLQDLHEFTQLSTSIVKSKINLKINADISLMKWHLEQM
                     FGFISILADDEETWECVIMDMIDISVEKNNSQSAGGLLINVEWVNDNLMADSLADSVI
                     AILYSIDSSPASVKLTSKSCSHSHNKVKEEVDDDAMIESTPPPEKNAHANSEISSRIH
                     RITSLLKAQFGDSLKTAAGEEGKKATIVIGKNEAKIDYLNLTVDCNSRVLRDRIENII
                     KRGCGLAAPLSQYEKTT"
     gene            <186181..>186589
                     /locus_tag="DEHA2F02156g"
                     /db_xref="GeneID:2903961"
     mRNA            join(<186181..186185,186247..>186589)
                     /locus_tag="DEHA2F02156g"
                     /product="DEHA2F02156p"
                     /transcript_id="XM_460458.1"
                     /db_xref="GeneID:2903961"
     CDS             join(186181..186185,186247..186589)
                     /locus_tag="DEHA2F02156g"
                     /note="similar to uniprot|Q06217 Saccharomyces cerevisiae
                     YLR275w SMD2 U1 snRNP protein of the Sm class"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02156p"
                     /protein_id="XP_460458.1"
                     /db_xref="GeneID:2903961"
                     /db_xref="GOA:Q6BMW2"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW2"
                     /translation="MAELIDRPRSELTELELQKLEEFEFTHGPMSLLQNAVNNGSPVV
                     ISCRNNHKLIAKVKAFDRHCNLILENVKELWTESVKNNKGKKIKSTSKERFVSKMFLR
                     GDSVVIVLKAQAS"
     gene            <187071..>188057
                     /locus_tag="DEHA2F02178g"
                     /db_xref="GeneID:2903962"
     mRNA            <187071..>188057
                     /locus_tag="DEHA2F02178g"
                     /product="DEHA2F02178p"
                     /transcript_id="XM_460459.1"
                     /db_xref="GeneID:2903962"
     CDS             187071..188057
                     /locus_tag="DEHA2F02178g"
                     /note="weakly similar to uniprot|Q02574 Saccharomyces
                     cerevisiae YLR288C MEC3 Involved in checkpoint control and
                     DNA repair"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02178p"
                     /protein_id="XP_460459.2"
                     /db_xref="GeneID:2903962"
                     /db_xref="GOA:Q6BMW1"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW1"
                     /translation="MKLKLRTQNIEALKTTLSLISHIRKFVILRFTPTQLLIISVNGS
                     SITQEPQVWCKLQINNMFDQIEIQSLRDNTISLEINIEQLLQTLHNFNRANSDGLNIR
                     LQKKDTSGGQGINISNGRIASLALFYSNININSNAINHTFRLPVKILKNTDDIMLLKE
                     PELTEVDLMMRLPKEFLSTYKRLEKFKKTSSNDLVNIKSSRRNGGFLGFVLEEDGKFK
                     VTISWNDKLEVQKPNRSNFDGESLRLANLHNPGSVLSQDVDEDDIHEDKEILVRLKDW
                     KMASKIVATCKTVIFLLTHKEACVLHCLLDDTDDVEIIYYISGVKIRDILDN"
     gene            <188271..>189452
                     /locus_tag="DEHA2F02200g"
                     /db_xref="GeneID:2903963"
     mRNA            <188271..>189452
                     /locus_tag="DEHA2F02200g"
                     /product="DEHA2F02200p"
                     /transcript_id="XM_460460.1"
                     /db_xref="GeneID:2903963"
     CDS             188271..189452
                     /locus_tag="DEHA2F02200g"
                     /note="similar to uniprot|P33330 Saccharomyces cerevisiae
                     YOR184w SER1 phosphoserine transaminase and highly similar
                     to CA2320|CaSER1 Candida albicans CaSER1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02200p"
                     /protein_id="XP_460460.1"
                     /db_xref="GeneID:2903963"
                     /db_xref="GOA:Q6BMW0"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:Q6BMW0"
                     /translation="MAQERTLNREEPHYFGAGPALLPTSVLQEAAYDLITYGDENIGV
                     GEISHRSKPAIGIIDSTKEKLSELMNIPDTHEVFFMQGGGTTGFSSIVYNLMANYTKR
                     TGKKGKAAYAITGSWSAKAAEESKRLGFETDIVVNTKNRKYGDIPPYSEWKSIDKEST
                     AYLYVCDNETVNGNEFQDTPGPNYLPEGVELVSDMSSNILSKEIDVSKYGLIMAGAQK
                     NIGLAGLTIYIIKKSLLEQASDEELNSKNIPLTPIAFHYPTVVKNNSAYNTIPIFTCH
                     MINLVLKKLQDAGGVSAMEKTNEQKAKTLYGALENYPNFYKMPVTNRSVRSRMNVVFN
                     LPNADLEAKFVSEAAERKLTGLKGHRSVGGIRASIYNAVSLESVELLVKFVNDFAEAN
                     K"
     gene            <189685..>191595
                     /locus_tag="DEHA2F02222g"
                     /db_xref="GeneID:2903965"
     mRNA            <189685..>191595
                     /locus_tag="DEHA2F02222g"
                     /product="DEHA2F02222p"
                     /transcript_id="XM_460462.2"
                     /db_xref="GeneID:2903965"
     CDS             189685..191595
                     /locus_tag="DEHA2F02222g"
                     /note="similar to uniprot|P46943 Saccharomyces cerevisiae
                     YLR289w GUF1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02222p"
                     /protein_id="XP_460462.2"
                     /db_xref="GeneID:2903965"
                     /db_xref="GOA:Q6BMV8"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSMKKTAAVEDKKISLDKESYIKSVQERIAKIPISNYRNFSIVA
                     HVDHGKSTLSDRLLELTGVIQPGDANKQVLDKLDVERERGITVKAQTCSMFYVDPKSK
                     EEYLLHLVDTPGHVDFRAEVSRSYASCGGALLLIDASQGVQAQTVANFYLAYSMGLKL
                     IPVINKIDLDAADIPRAMDQVETTFELPREDCIPVSAKTGLNIENIIPAIIRDIPGPR
                     GSVDKPLKALLVDSWHDPYVGVVMLIHVVDGVVKKGMKLLSAHSEKRYDVKEVGIMYP
                     DKMPMDCVKAGQVAYIIPGMRNPREAMIGDTFYQYGKHEGLEPLPGFEEPKPMVFVGA
                     FPADGGEFKVMNDHMENLVLNDRSVTLEKETSNALGLGWRLGFLGSLHASVFKERLEN
                     EYGAKIILTAPTVPYKLIFKDGEESIVTNPDEFPGADFRNHNIEMLMEPYVNALMTIP
                     DEYIGTVMSLCENNRGIQKELEYLTTGQVLLKYEIPLAQLVEDFFGKLKGCTKGYASL
                     DYEDAGYKKSDIVKMELCVNGEPQDALTQVMHRSQVLSRGKEYVTRFKEYLKFQLFEV
                     AIQAKVNNKVVARETIKAKRKDVTQKLHAADISRRKKLLSRQKEGKKQMKATGKISIN
                     QEAYQAFLRRAD"
     gene            complement(<191719..>193437)
                     /locus_tag="DEHA2F02244g"
                     /db_xref="GeneID:2903966"
     mRNA            complement(<191719..>193437)
                     /locus_tag="DEHA2F02244g"
                     /product="DEHA2F02244p"
                     /transcript_id="XM_460463.1"
                     /db_xref="GeneID:2903966"
     CDS             complement(191719..193437)
                     /locus_tag="DEHA2F02244g"
                     /note="similar to uniprot|P00927 Saccharomyces cerevisiae
                     YER086W ILV1 Threonine deaminase catalyzes the first step
                     in isoleucine biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02244p"
                     /protein_id="XP_460463.2"
                     /db_xref="GeneID:2903966"
                     /db_xref="GOA:Q6BMV7"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:Q6BMV7"
                     /translation="MMIARNLLKGIHKPVNRRVCIPKIGSLTSAKFYSTQSTVQQFPE
                     LQEADFTPEGEPDYIKLILTSRVYDVVDEGGSPLTHAVNLSQKCNTNIFLKREDLLPV
                     FSFKLRGAYNMIAHLHSNSKSPVSGVIACSAGNHAQGVAFSASKLKIQSTIVMPTATP
                     SIKYKNVSRLGSQVVLYGDDFDSAKKECDRLSSLNGLTNIPPFNHPYVIAGQGTIALE
                     ITRQLRLDKLDALFVPVGGGGLIAGIAVYLKKIAPHVKIIGVETFDADALYQSLQNHQ
                     SKTLDQVGVFADGTAVKVLGDETWKLCHKYVDEVVRVSTDELCAAIKDIFEDTRSIVE
                     PSGALSVAGLKRYLSDNSEIDHRNKNYVPILSGANMNFDRLRFVSERAVLGEGKEVSL
                     AVTIPERPGEFAILQNIIDPRAITEFSYRFNNSGPANIFVSFNVTNKDKELAPIVESM
                     KSNDYEVIDISENELAKTHGRYLVGGKSTTANCNKISKERLFRFEFPERPGALTKFLQ
                     TLKYDWDITLFHYRNHGHDVGKILCGFVLPEGTSDEDFQDFLKKIGYNFVDETDNVVY
                     KKFLQS"
     gene            <194046..>195059
                     /locus_tag="DEHA2F02266g"
                     /db_xref="GeneID:2903967"
     mRNA            <194046..>195059
                     /locus_tag="DEHA2F02266g"
                     /product="DEHA2F02266p"
                     /transcript_id="XM_460464.1"
                     /db_xref="GeneID:2903967"
     CDS             194046..195059
                     /locus_tag="DEHA2F02266g"
                     /note="some similarities with CA2317|IPF13586 Candida
                     albicans IPF13586 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02266p"
                     /protein_id="XP_460464.1"
                     /db_xref="GeneID:2903967"
                     /db_xref="UniProtKB/TrEMBL:Q6BMV6"
                     /translation="MDSQLQYNISELVQFMDQCNDSNVVTSYSGLNHVNSPTAFNYTA
                     QYELESKSGNEQQKSVRQESNAQHFSAMSFFPLHTSPKIQVLNLRDQEYKEIQKNCRF
                     SKVVEDVHATAPTDLRETLNYDELFDTFINSEVDIQTLKDSVGVLRTHSPLPLPLPLT
                     PKPTPNINMKDSMSRSYVFENENSKDRSYFDVADERDVGRIFRYPDNSNQIFNIGTLK
                     LASNSYKEAKVVSASVNKTIDDEFELKSKYFRSFDNSLKRRQKSQSEEIRSKIRKRNN
                     PTTDEVEWKPLSIFTVYTNFKPEAIDDTDYFENIPQTSCFGRLNMRVKRAWTRGPNKA
                     KLK"
     gene            complement(<195632..>195940)
                     /locus_tag="DEHA2F02288g"
                     /db_xref="GeneID:2903968"
     mRNA            complement(<195632..>195940)
                     /locus_tag="DEHA2F02288g"
                     /product="DEHA2F02288p"
                     /transcript_id="XM_460465.1"
                     /db_xref="GeneID:2903968"
     CDS             complement(195632..195940)
                     /locus_tag="DEHA2F02288g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02288p"
                     /protein_id="XP_460465.2"
                     /db_xref="GeneID:2903968"
                     /db_xref="UniProtKB/TrEMBL:Q6BMV5"
                     /translation="MRMITRDQGPLSESIHVLRNESEAARIEHKEKRKLQDKKQLTEK
                     LECFLCWPSLSLTQVIKILRVSEDLTLTQLIIIVGRNMTGRAETWYLELKENYMNISL
                     "
     gene            196481..196554
                     /locus_tag="DEHA2F02310r"
                     /db_xref="GeneID:8998858"
     tRNA            196481..196554
                     /locus_tag="DEHA2F02310r"
                     /product="tRNA-Ile"
                     /note="tRNA Ile (AAT) cove score=72.18"
                     /db_xref="GeneID:8998858"
     gene            196573..196645
                     /locus_tag="DEHA2F02332r"
                     /db_xref="GeneID:8998859"
     tRNA            196573..196645
                     /locus_tag="DEHA2F02332r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (AGC) cove score=72.43"
                     /db_xref="GeneID:8998859"
     gene            <196917..>198716
                     /locus_tag="DEHA2F02354g"
                     /db_xref="GeneID:2903971"
     mRNA            <196917..>198716
                     /locus_tag="DEHA2F02354g"
                     /product="DEHA2F02354p"
                     /transcript_id="XM_460466.2"
                     /db_xref="GeneID:2903971"
     CDS             196917..198716
                     /locus_tag="DEHA2F02354g"
                     /note="weakly similar to uniprot|P38687 Saccharomyces
                     cerevisiae YPL243W SRP68 Component of the signal
                     recognition particle (SRP) ribonucleoprotein (RNP) complex
                     that functions in protein targeting to the endoplasmic
                     reticulum (ER) membrane and similar to CA5902|CaSRP68
                     Candida albicans CaSRP68"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02354p"
                     /protein_id="XP_460466.2"
                     /db_xref="GeneID:2903971"
                     /db_xref="GOA:Q6BMV4"
                     /db_xref="InterPro:IPR026258"
                     /translation="MEYPLIVTLGARMSAYLSSSEDYHKQRKRLNKRLLKLRHELDLI
                     TPDTKDYKKKEKISKISSSDYDQDEKYGLLLLLTAERDSLYSSEIKSLLEISNDNASS
                     YRNLMISRIKKSLSSSKKLLEITVNEKDEYKRIEYYTYAALIQGNLSVNKKQWSKALN
                     AFSIAKCALDFLYSQEDSKMDIEEEQEESTQFKKTLISEITETLVDPSLALAISQDDT
                     AYSTTTDLKTVSRQHCRDNKLSYLQPVIEIIARIDPEAVSEVSSSTELIKSVQWRDHE
                     ATLYNDELAYKIMKLTNDNETNWKNFNDANQFDVLLSGWSELLEIHTNDMDKNKDEDD
                     LEKVQDRAIVLTYINFNLLFTRLKRDLLIIDQLSSQGDNVFALKKLEFNKDIIRLYGT
                     IITTTQEIKDLPGVYNDEDLHESLDNLEKFFVAKKSAVLARSFALNNKFPEALKIFDH
                     VDNTLSSSDNKFYKIDEFPYNVSSNVEFEKFKKELPSQVLQAQILAQFSVDLSKNLNQ
                     SNFVIENMNKYPVSNETLDNIANFNKNLSIAPVLSKPVLFDIGFNYINYGMGRSSSYN
                     NSNSATSTTSDSTTDQNDPNKKKSGFFGIFGRS"
     gene            <198879..>199943
                     /locus_tag="DEHA2F02376g"
                     /db_xref="GeneID:8998860"
     mRNA            <198879..>199943
                     /locus_tag="DEHA2F02376g"
                     /product="DEHA2F02376p"
                     /transcript_id="XM_002770680.1"
                     /db_xref="GeneID:8998860"
     CDS             198879..199943
                     /locus_tag="DEHA2F02376g"
                     /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
                     YPL244C HUT1 Protein with a role in UDP-galactose
                     transport to the Golgi lumen has similarity to human UDP-
                     galactose transporter UGTrel1 exhibits a genetic
                     interaction with S. cerevisiae ERO1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02376p"
                     /protein_id="XP_002770726.1"
                     /db_xref="GeneID:8998860"
                     /db_xref="GOA:Q6BMV3"
                     /db_xref="InterPro:IPR013657"
                     /translation="MKKEGGGSIITLAACILGLYASFLTWSVLQERISTKPYGSNPDT
                     GSPDFFKAPLVINIIQAFFASIVGLIYSVVSSRSNPLSIFTQNEKPVALKFFKSFVII
                     SLTSSLSSPLGYESLKHVDYLAYLLAKSCKLIPVMLVHFVLYRTKFPLYKCMVAGSVT
                     VGVIIFTLSHSSTKSKADISDGKTALGMAQLIGSMLLDGLTNSTQDQLFKLRGTSPSN
                     KHTKLTGAYLMCILNAFIFINTLAYALIFKYQSEITYTVNFVHHYPQVMMNILEFAIL
                     GSVGQVFVFIILEKFDSLILITSTVTRKMISMILSVVLFGHQLNGLQWGGVGLVFGGI
                     GYEALVKMSMNKAPTTKKNQ"
     gene            <200078..>201295
                     /locus_tag="DEHA2F02398g"
                     /db_xref="GeneID:8998861"
     mRNA            <200078..>201295
                     /locus_tag="DEHA2F02398g"
                     /product="DEHA2F02398p"
                     /transcript_id="XM_002770681.1"
                     /db_xref="GeneID:8998861"
     CDS             200078..201295
                     /locus_tag="DEHA2F02398g"
                     /note="weakly similar to uniprot|P42836 Saccharomyces
                     cerevisiae YNL326c PFA3 Palmitoyltransferase for Vac8p one
                     of three yeast DHHC-cysteine rich domain proteins (Pfa3p
                     Erf2p Akr1p) with palmitoyltransferase activity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02398p"
                     /protein_id="XP_002770727.1"
                     /db_xref="GeneID:8998861"
                     /db_xref="GOA:Q6BMV2"
                     /db_xref="InterPro:IPR001594"
                     /translation="MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVY
                     ALIVHGCYDTLMTTQETSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRI
                     RNILSLSKPKYNSANPYDTNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLK
                     SNNSSYRYCTKCSVWKPDRCHHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMY
                     LTAYSGFDFVVSLSILWKFFADEKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYL
                     VFRNKTTIEFQENRWNFKNDKNGKSFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPS
                     WYYWLLPVTVTNKSIDARLENGINFEIDQDVYDRWCYNAQLQDQLNQQLADYKNRIRM
                     EREANQTTDTNPF"
     gene            <201635..>203128
                     /locus_tag="DEHA2F02420g"
                     /db_xref="GeneID:2903047"
     mRNA            <201635..>203128
                     /locus_tag="DEHA2F02420g"
                     /product="DEHA2F02420p"
                     /transcript_id="XM_460469.1"
                     /db_xref="GeneID:2903047"
     CDS             201635..203128
                     /locus_tag="DEHA2F02420g"
                     /note="similar to uniprot|P32561 Saccharomyces cerevisiae
                     YNL330C RPD3 Histone deacetylase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02420p"
                     /protein_id="XP_460469.1"
                     /db_xref="GeneID:2903047"
                     /db_xref="GOA:Q6BMV1"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6BMV1"
                     /translation="MYVQLPFDDLKVDPTQKKRVAYFYDADVGNYAYGAGHPMKPHRI
                     RMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVSPDNLDMFAKEQIK
                     FNVGDDCPVFDGLFEYCGISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFC
                     YLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTG
                     ELRDIGVGKGKYHAINVPLRDGIDDATYKSIFEPVISKVMEWYQPSAIVLQCGGDSLS
                     GDRLGCFNLSMSGHANCINFVKSFNVPMMVVGGGGYTMRNVARTWSFEAGLLNNVVLP
                     SELPYNEYYEYYGPDYKLDVRPSNMYNANSPEFLNKILTNILTNLENTKHAPSVQMNY
                     VPNDAEDLGDIDEDTQEAIDTKGGSQQARDEITQPDNEFYEDDDKDAGSRDIQNFSKS
                     ASASESKPAELETTAQPETLEEPEDEKMLTDEELKEINELNSNENNA"
     gene            <203514..>204929
                     /locus_tag="DEHA2F02442g"
                     /db_xref="GeneID:2903048"
     mRNA            <203514..>204929
                     /locus_tag="DEHA2F02442g"
                     /product="DEHA2F02442p"
                     /transcript_id="XM_460470.2"
                     /db_xref="GeneID:2903048"
     CDS             203514..204929
                     /locus_tag="DEHA2F02442g"
                     /note="similar to uniprot|Q06892 Saccharomyces cerevisiae
                     YPL188w POS5 Mitochondrial NADH kinase phosphorylates
                     NADH"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02442p"
                     /protein_id="XP_460470.2"
                     /db_xref="GeneID:2903048"
                     /db_xref="GOA:Q6BMV0"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:Q6BMV0"
                     /translation="MMLKTWKIPQYSYISNGIRMTHIGQLRFTRNISSSLMRKSDILM
                     SNDLLTIKSCKHLRNSTFPEFVRSPNSQLSNIIWNSPLENIYVVKKPWDQDVRDATVR
                     FITHIHDNYPSVNVVVSEDVADEIIHETNTGGSVTSILKKQSPKFSSNSKYVIYTGEL
                     SQIVNKTDLIVTLGGDGTILRAVSTFSNANVPPVLSFALGTLGFLLPFDFSTFSESFR
                     MVYESRGKALHRHRLECHVVRKSLNESTQTPITDATPIKNIRQSESGISPQENVTTML
                     HAMNDISLHRGSQPNLISLDIYIDNEFLTTTTGDGLVFSTPTGSTAYSLSAGGSITHP
                     LVPCIILTPICPRSLSFRPLILPASSHIVIKLSDKNRNASIKLNIDGISQQDLQPGDQ
                     IHVAGENDSALATSSRSEKVSGSTSENEQTDSTDSTPSSKQDLCQKGIWCVARSENDW
                     TKDINELLGFNSSFKASKSKL"
     gene            <205824..>207950
                     /locus_tag="DEHA2F02464g"
                     /db_xref="GeneID:2903049"
     mRNA            <205824..>207950
                     /locus_tag="DEHA2F02464g"
                     /product="DEHA2F02464p"
                     /transcript_id="XM_460471.1"
                     /db_xref="GeneID:2903049"
     CDS             205824..207950
                     /locus_tag="DEHA2F02464g"
                     /note="similar to uniprot|P14922 Saccharomyces cerevisiae
                     YBR112C CYC8 General transcriptional co-repressor acts
                     together with Tup1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02464p"
                     /protein_id="XP_460471.1"
                     /db_xref="GeneID:2903049"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6BMU9"
                     /translation="MATSIPVQMTMGNNGHKQANGSIPVPSPQPVAPPTNPSNILMET
                     TAGTWLAIGSLAESLGDVEKALASYDSALRHSPNNPEILTKLANMYRSKDVFFKAAEL
                     YEQALNFHPENGETWGLLGHCYLMLDDLQRAYAAYQRALYYLDNPNVPKLWHGIGILY
                     DRYGSLEYAEEAFVRVLELDPNFDKSNEIYFRLGIIYKHQGKLQSALECFQYILTNPP
                     HPLTQPDVWFQIGSVLEQQKDWNGAKEAYEKVLQVNPQHAKVLQQLGCLYSQAEPAPS
                     GNSNQQPFQQDLNIALKYLLQSLEIDQSDAHSWYYLGRVHMIRGDFNAAYEAFQQAVN
                     RDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQIS
                     DALDAYRQAERLDPSNPHIKARLDQLIKYQQDGNTQPPQPPPVSQQPKLPQGMILEST
                     QMQQQGPQQPQLLPGHPPPPPSAQQQSQLHQQPPLLQPHQQGPPPPHSLPQPHQISQP
                     NQPAVSPIPPVHQPPPLAQSNPQTSYLPSIPQPSSQIQSSTHTPNQASVKPPSPPPQS
                     SLPPPQNSPPQKSTSIPSIQQNNGTKRDLEDKKDTKVTKKQSKKSAKSQQNSSLNSLA
                     NAANNASSAKSETPKTDEREPKSTKQSPKADKESSKSKTEVPQFSSNVTGKKEDEEEE
                     TEEKKSSEPVEPPLRRVDEDENYDDD"
     gene            complement(<208043..>209896)
                     /locus_tag="DEHA2F02486g"
                     /db_xref="GeneID:2903050"
     mRNA            complement(<208043..>209896)
                     /locus_tag="DEHA2F02486g"
                     /product="DEHA2F02486p"
                     /transcript_id="XM_460472.1"
                     /db_xref="GeneID:2903050"
     CDS             complement(208043..209896)
                     /locus_tag="DEHA2F02486g"
                     /note="similar to ca|CA5908|IPF5960 Candida albicans
                     IPF5960 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02486p"
                     /protein_id="XP_460472.2"
                     /db_xref="GeneID:2903050"
                     /db_xref="UniProtKB/TrEMBL:Q6BMU8"
                     /translation="MSTDIDVCSFCLGGETDIPPFGSLRDAEDLVHPCSTCSLTAHRK
                     CLLDWFNSLSSDKLQVVNASTLTEGSVRRPHSHSHDESIGVGQPQHETRIHINISSQQ
                     LNNWITNIAASLSGNVTAENLSSNSDSQYSSNGFVVLLLAPCPQCKDDIVFSMRRSSF
                     LTFTTATRTLITRSITYGGLFIGITSAVTGVVSMGYIGLTSLGLKMMDSLIPTPILLK
                     MLTKNSSPNAALSNSSLSQVLFGNVNNYAIDNLEQALSKGLVDPLKFSRIPVLPIVLY
                     RMRSTSIMNCLLGSSKENSFNNWLTEFMISGYISSLGNHELFRSVTTNFQHSVSRIFQ
                     NPRSISEGLGLLNGINLWKANNMISMLVPLRWVYDLFFRMTLNRLHFNIAMSIRPRDI
                     ANSLDASELDELEEIGANIGKLEFKFKSFRDAVDDQVEKEFKSKSSYPLITTLFKFIK
                     KKLLYYERCFNSNLQLSYSRLKVLSWIHETKACINNDYSSAFLYKSITMRFVTTVLWP
                     IASSKLGNMIFKLLQTKKFSDIPQNQLVLLGNIIGMVAVVFVKDCINLYLSKKKAEQI
                     SQMSVLCIDVDRHQTTNDQQSDDNDNANDDSNWITEDEDEFAQRFPGRYVE"
     gene            complement(<210112..>210747)
                     /locus_tag="DEHA2F02508g"
                     /db_xref="GeneID:2903051"
     mRNA            complement(<210112..>210747)
                     /locus_tag="DEHA2F02508g"
                     /product="DEHA2F02508p"
                     /transcript_id="XM_460473.2"
                     /db_xref="GeneID:2903051"
     CDS             complement(210112..210747)
                     /locus_tag="DEHA2F02508g"
                     /note="similar to uniprot|Q01976 Saccharomyces cerevisiae
                     YBR111c YSA1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02508p"
                     /protein_id="XP_460473.2"
                     /db_xref="GeneID:2903051"
                     /db_xref="GOA:Q6BMU7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6BMU7"
                     /translation="MPKNTKGSPYDAKLVSVEPLEQGKWIQTRKLNYKDPRGNDRVWE
                     MAIRTTRSETTDIDGVAIVALLNHPNKKKEIVLTKQFRPPVGAVVIELPAGLVDPKES
                     VESTAVRELIEETGYHSTFNHSTDSMADLVSDPGLTNANMAIAYVDVDLTKPENVTPK
                     PQLEEGEFIDSFSVPLEDLVKELHRLVKEEGCVVDARLYHLAVGIELAKSL"
     gene            <210977..>211282
                     /locus_tag="DEHA2F02530g"
                     /db_xref="GeneID:2903052"
     mRNA            <210977..>211282
                     /locus_tag="DEHA2F02530g"
                     /product="DEHA2F02530p"
                     /transcript_id="XM_460474.1"
                     /db_xref="GeneID:2903052"
     CDS             210977..211282
                     /locus_tag="DEHA2F02530g"
                     /note="similar to uniprot|Q6WNK7 Saccharomyces cerevisiae
                     YBR111W-A SUS1 Protein involved in mRNA export coupled
                     transcription activation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02530p"
                     /protein_id="XP_460474.2"
                     /db_xref="GeneID:2903052"
                     /db_xref="GOA:Q6BMU6"
                     /db_xref="InterPro:IPR018783"
                     /translation="MTQQQDELDQIKSQIQEHLISSGNYDIINKQLKLQLYESGWFDK
                     VTQLANRELQENSAHDTAVSFDQLFSFVKPKAEEMVPSNIKEDVLERLKDYLDDVIQ"
     gene            <211743..>212369
                     /locus_tag="DEHA2F02552g"
                     /db_xref="GeneID:2903053"
     mRNA            <211743..>212369
                     /locus_tag="DEHA2F02552g"
                     /product="DEHA2F02552p"
                     /transcript_id="XM_460475.1"
                     /db_xref="GeneID:2903053"
     CDS             211743..212369
                     /locus_tag="DEHA2F02552g"
                     /note="highly similar to uniprot|Q9UUT7 Yarrowia
                     lipolytica nukm Subunit NUKM of protein NADH:Ubiquinone
                     Oxidoreductase precursor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02552p"
                     /protein_id="XP_460475.1"
                     /db_xref="GeneID:2903053"
                     /db_xref="GOA:Q6BMU5"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006138"
                     /db_xref="UniProtKB/TrEMBL:Q6BMU5"
                     /translation="MYSLARRSILSVGRHQSMKMIPYGAVRSISSKDLTPKPLATDFP
                     LMSQKTASAPVDYALTSLDAIANWARKSSFWPVTFGLACCAVEMMHVSTPRYDQDRLG
                     IIFRASPRQSDIMIVAGTVTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYS
                     VVRGCDRLIPVDVYVPGCPPTAEALMYGVFQLQKKMMKTRITRLWYRS"
     gene            <212953..>213363
                     /locus_tag="DEHA2F02574g"
                     /db_xref="GeneID:2903054"
     mRNA            <212953..>213363
                     /locus_tag="DEHA2F02574g"
                     /product="DEHA2F02574p"
                     /transcript_id="XM_460476.1"
                     /db_xref="GeneID:2903054"
     CDS             212953..213363
                     /locus_tag="DEHA2F02574g"
                     /note="highly similar to uniprot|P02303 Saccharomyces
                     cerevisiae YNL031C HHT2 One of two identical histone H3
                     proteins (see also HHT1)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02574p"
                     /protein_id="XP_460476.1"
                     /db_xref="GeneID:2903054"
                     /db_xref="GOA:Q6BMU4"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPVSGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQEAVEAYLV
                     SLFEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
     gene            complement(<213771..>216014)
                     /locus_tag="DEHA2F02596g"
                     /db_xref="GeneID:8998862"
     mRNA            complement(<213771..>216014)
                     /locus_tag="DEHA2F02596g"
                     /product="DEHA2F02596p"
                     /transcript_id="XM_002770682.1"
                     /db_xref="GeneID:8998862"
     CDS             complement(213771..216014)
                     /locus_tag="DEHA2F02596g"
                     /note="some similarities with uniprot|P32831 Saccharomyces
                     cerevisiae YBR212W NGR1 negative growth regulatory protein
                     and similar to CA5915|IPF10735 Candida albicans IPF10735"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02596p"
                     /protein_id="XP_002770728.1"
                     /db_xref="GeneID:8998862"
                     /db_xref="GOA:B5RU82"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B5RU82"
                     /translation="MSFLQSNKGEYVSNNAETGSDTPVGVDSENTGIKPSSVANPSVS
                     SNLHGAVAPLEQPALTSSTASHQHQQEQEMLSGFTIPRPPVSTQQSSVAAEKEQGSNT
                     GQPDSPRTLWMGDLDPWLDEGAISDLWWQILHKKVTVKIIKPKTPKPENNAQGLSHSG
                     YCFVEFESFDDAQQALGLNGQLLPDIAMPSQQQFPNNPDNQKKYFRLNWASGATLSAP
                     IVQTPEYSLFVGDLSASTTEAHLLAFFQKSFPTSIKTVRVMTDPVSGKSRCFGFVRFT
                     DESERQRALVEMHGAWFGGRPLRVALATPRNVGGKLRYPNIPSPNFYNPDQGRQMFIP
                     PNAMPMGGSPFGFFGNPQMPPPPHHPHQVPPRQSYPSHMSPMDMQPTKEYSDDRDQNV
                     SSNGQPNVEQLRSPNLQGGQHGQPFTDPNNTTVFVGGLSSEVTEQTLFTLFKPFGIIQ
                     QVKIPPGKNCGFIKYSSREEAEEAIAAMQGFIIGGNRVRLSWGRVSMNNKKYQQQQQQ
                     VAQAAQMQAATALSMGMDPASAIAAAAAAAAAGGYPPPIPGAHGHSQNAGMPMMGGMP
                     PMGLPPHISMQSRGNLRSPNPSNIQNYSTSSEDNDASFDKSDVDSNERPSNESQGRGH
                     GIAPPPFYMGGLPTDYHIPPPGSQQGQDELADSMAHMNLNGENHDSNANSENFMAYQG
                     DHRFMMPPMFNGGFPMHDLQYQQFIPSQQLDPQAMYPPQDDRAANDDSIDNAKADDND
                     SKNDNDD"
     gene            <221708..>222040
                     /locus_tag="DEHA2F02618g"
                     /db_xref="GeneID:2903062"
     mRNA            <221708..>222040
                     /locus_tag="DEHA2F02618g"
                     /product="DEHA2F02618p"
                     /transcript_id="XM_460479.1"
                     /db_xref="GeneID:2903062"
     CDS             221708..222040
                     /locus_tag="DEHA2F02618g"
                     /note="highly similar to uniprot|P53173 Saccharomyces
                     cerevisiae YGL054C ERV14 Protein localized to COPII-coated
                     vesicles involved in vesicle formation and incorporation
                     of specific secretory cargo"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02618p"
                     /protein_id="XP_460479.1"
                     /db_xref="GeneID:2903062"
                     /db_xref="GOA:Q6BMU1"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:Q6BMU1"
                     /translation="MYSDLECDYINPIELCNKLNPWFIPEGGLHAFITALFLVNGYWF
                     VFLLNLPLLAFNVNKFLNKNHLLDATEIFRTLSKHKKESFIKLGFHLLMFFFFLYRMI
                     MALIADDS"
     gene            complement(<222288..>223523)
                     /locus_tag="DEHA2F02640g"
                     /db_xref="GeneID:2903064"
     mRNA            complement(<222288..>223523)
                     /locus_tag="DEHA2F02640g"
                     /product="DEHA2F02640p"
                     /transcript_id="XM_460481.1"
                     /db_xref="GeneID:2903064"
     CDS             complement(222288..223523)
                     /locus_tag="DEHA2F02640g"
                     /note="weakly similar to CA5919|IPF8926.3 Candida albicans
                     IPF8926.3 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02640p"
                     /protein_id="XP_460481.2"
                     /db_xref="GeneID:2903064"
                     /db_xref="GOA:Q6BMT9"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT9"
                     /translation="MTINSEGVNDMNSDNLSPDGTQNTHKEAIDESDSSPVHNNGKTF
                     VNGVKTEMDEDSKRMKDSTQTENDDTPDDIQFGDEFDDDFHEDSTSNTNPVQELNQED
                     AKKPEKRGRGRPRKITKPEEIAATPKIKRKRGRPRKGTETTSSIENMATDTPRRSARI
                     LRKETPSYRIEKDYDEKTSSKPIQPKRKSLRPNIYENKKPVSLAKTRPNETQKPMYIN
                     TERIITSQNRDKRLRINTLDVIKHLIENFNPVNSNSQILNEPLIHNEFKNHVLHHLGY
                     LFDAHANINDISQEINEIQKKKTQLRNKIFELKKSHTDIGSELNKMRGNYQNERSKFK
                     NFNKMTNKLQSLSSTVDGYKAGNRNSSEIPEQNNKSTGEAIDKDIFTLSKVINPNSGM
                     FKKLILINKKLSKIENELS"
     gene            complement(<224039..>224473)
                     /locus_tag="DEHA2F02662g"
                     /db_xref="GeneID:2903065"
     mRNA            complement(<224039..>224473)
                     /locus_tag="DEHA2F02662g"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_460482.1"
                     /db_xref="GeneID:2903065"
     CDS             complement(224039..224473)
                     /locus_tag="DEHA2F02662g"
                     /note="similar to p|P48589 uniprot|Q02545 Saccharomyces
                     cerevisiae YOR369C RPS12 Protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_460482.1"
                     /db_xref="GeneID:2903065"
                     /db_xref="GOA:Q6BMT8"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT8"
                     /translation="MSDIEEQPVVEEVAVEQQESGSISIEDALKVVLRTSLVHDGLAR
                     GLREASKALSRGEAQLCVLCDSVTEESIIKLVEALCNEPEEKIPLIKVSDAKLLGEWA
                     GLCQLDREGNARKVVGASCVVVKNWGNDSDERNILLEHFSQQ"
     gene            complement(<225048..>226931)
                     /locus_tag="DEHA2F02684g"
                     /db_xref="GeneID:2903066"
     mRNA            complement(<225048..>226931)
                     /locus_tag="DEHA2F02684g"
                     /product="DEHA2F02684p"
                     /transcript_id="XM_460483.1"
                     /db_xref="GeneID:2903066"
     CDS             complement(225048..226931)
                     /locus_tag="DEHA2F02684g"
                     /note="similar to uniprot|P32864 Saccharomyces cerevisiae
                     YOR370C MRS6 Rab escort protein forms a complex with the
                     Ras-like small GTPase Ypt1p that is required for the
                     prenylation of Ypt1p by protein geranylgeranyltransferase
                     type II (Bet2p-Bet4p) and highly similar to CA5922|CaMRS6
                     Candida albicans CaMRS6 geranylgeranyltransferase
                     regulatory subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02684p"
                     /protein_id="XP_460483.2"
                     /db_xref="GeneID:2903066"
                     /db_xref="GOA:Q6BMT7"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT7"
                     /translation="MSSFNRSERRKSVAERRPSVPYIAPVIPHLAGLEKPQEHSLKMD
                     HCDVLIMGTGLVESILAAALSWQGVEILHIDNKQYYGDSTSTLTIDQLKKWCMEVNQG
                     KVQHFHDAQFYMPGGKLKDQFHSKDYGIDLTPKIMFAQSDLLSLLIKSRVYKYLEFQS
                     LSNFHVFENDNFNKKLSNTTKEDIFTDQSLSLVTKRYLMKFLKFVLQDNNDQNKKSML
                     QDNANVPIGEFLTKNFNLETPQINELVYSIGLCAKTTTKTPEALTRIKRFLVSFDVYG
                     NFPVMVSKYGGPGEISQGFCRSAAVAGTTYKLNTTLVDYDPQSKIARFNDGSNIKINE
                     KVVVSPTQMPKFLQQSYNEITEDLKPYNVTRLVTIVKNDCKEWMSEQETSAIVVFPPN
                     SLPTSNQQSVQVIIQNGGSGVCPEGQAVWFSHSSEQDLNKAKQDLECAHEKMESAILR
                     ESSNNLDEVLDDKDFVLSAQGTPVLVNSIKLGESLQSFVPEEKLEIVCKLGYVQKTFV
                     KPDLSNVIAPTPENNVSSATISDAEDIIFSNMPSSEISYDGIIGECKSIFSRITGSDE
                     DFFDVDFEDEDDDYNNHQAPSTNSKTTSDSTTTNNIGSPILDSVLDDEGHHEPFGADE
                     MEL"
     gene            <227902..>228777
                     /locus_tag="DEHA2F02706g"
                     /db_xref="GeneID:2903067"
     mRNA            <227902..>228777
                     /locus_tag="DEHA2F02706g"
                     /product="DEHA2F02706p"
                     /transcript_id="XM_460484.1"
                     /db_xref="GeneID:2903067"
     CDS             227902..228777
                     /locus_tag="DEHA2F02706g"
                     /note="weakly similar to uniprot|P15807 Saccharomyces
                     cerevisiae YBR213W MET8 Bifunctional dehydrogenase and
                     ferrochelatase involved in the biosynthesis of siroheme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02706p"
                     /protein_id="XP_460484.2"
                     /db_xref="GeneID:2903067"
                     /db_xref="GOA:Q6BMT6"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028161"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT6"
                     /translation="MGPGIQTKPSGSLLLAWQVKDKHCLVIGGGDVALSRIHHLIRAQ
                     AKITVIGGTSEKGINAEILQLNKEGYIYKLVERDYESSDLTMYEKTKLDLGGEDCYVY
                     DLISSDHYEEIDRQVKNEVFANVCCCIDDYKLSTKIYYQCKFLRLPVNIADKPPLCDF
                     YFGSMFNQDNLQIMISTNGKSPRLSKLIKDNIAKQFEGIDLNKAVENLGLIRSRLRET
                     IVLDDDLVSIDTRMAWIKKLTDFFTLKQWSNLDLISGDQDRFERVDRIIKYFPEYPPR
                     EFDNFKLAIYNQCLE"
     gene            complement(<228806..>230134)
                     /locus_tag="DEHA2F02728g"
                     /db_xref="GeneID:2903068"
     mRNA            complement(<228806..>230134)
                     /locus_tag="DEHA2F02728g"
                     /product="DEHA2F02728p"
                     /transcript_id="XM_460485.1"
                     /db_xref="GeneID:2903068"
     CDS             complement(228806..230134)
                     /locus_tag="DEHA2F02728g"
                     /note="similar to uniprot|P54885 Saccharomyces cerevisiae
                     YOR323C PRO2 Gamma-glutamyl phosphate reductase catalyzes
                     the second step in proline biosynthesis and highly similar
                     to CA5926|CaPRO2 Candida albicans CaPRO2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02728p"
                     /protein_id="XP_460485.2"
                     /db_xref="GeneID:2903068"
                     /db_xref="GOA:Q3V7I2"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="UniProtKB/TrEMBL:Q3V7I2"
                     /translation="MAESIAKDANNAFSLLKTLSNDQRSSALQKIHDALQKNKGQIIE
                     ANKIDMDNAVKGNLSSSLVKRLDLSNSGKFDTMLQGILDVANLPDPVGKCTLAKKIDE
                     GLNLYRVSAPIGVLLIIFESRPEVIANITALAVKSGNAAILKGGKESYQTFKIMSDIV
                     NTTLDKETDVPGPAVQLIQSREEVGDLLSQDKYIDLVIPRGSNELVRNIKSNTKIPVL
                     GHADGICSIYIDKEADLDKATRVLVDSKTNYPAGCNAVEQLLIHQDIANDDEKLSKII
                     NSLINAKVTSHVVPEIKSKLTNFNQEFIKDAADDAFDKEYLSFDISVKPVASAADAIS
                     HINTHSSKHTESIITENKATAETFMKAIDSAGVYWNCSTRFADGFRYGFGTEVGISTN
                     KIHARGPVGLEGLMSYQYQLRGDGHIVADYVGGGGKKVFVHEDLDTNVNV"
     gene            <230417..>234355
                     /locus_tag="DEHA2F02750g"
                     /db_xref="GeneID:8998863"
     mRNA            <230417..>234355
                     /locus_tag="DEHA2F02750g"
                     /product="DEHA2F02750p"
                     /transcript_id="XM_002770683.1"
                     /db_xref="GeneID:8998863"
     CDS             230417..234355
                     /locus_tag="DEHA2F02750g"
                     /note="similar to uniprot|P39524 Saccharomyces cerevisiae
                     YAL026C DRS2 Integral membrane Ca(2+)-ATPase potential
                     aminophospholipid translocase required to form a specific
                     class of secretory vesicles that accumulate upon actin
                     cytoskeleton disruption"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02750p"
                     /protein_id="XP_002770729.1"
                     /db_xref="GeneID:8998863"
                     /db_xref="GOA:B5RU83"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:B5RU83"
                     /translation="MSYSNHRNKDENGMNNLNNHTNPFSEPENLIDLDLDTRNSFNAN
                     VENSPYSHVTSQNQHAQPANPFEDNFIISDDEIERDDTIESLGHGSSSQRKVPLLSTA
                     NDKSQQRSGLFGGLLANRNDEYIGMENGPEERQFKDNNLNDGSSDFDIRKIYRKTKAK
                     FSRSNAEAEDAAAVNKGPRQIYIMNQMLNSSFKYYGNHISTTKYNFATFIPKFLFEQF
                     SKYANLFFLFTSIIQQVPNVSPTNRYTTIGTLTIVLLVSAIKEIMEDLKRAGADKELN
                     NTKVLVLDASSGVFHSKKWIQVKVGDVVKINNEEPFPADLLLVSSSEPEGLCYIETAN
                     LDGETNLKIKQAKSETSYLVNPRDLLSDLSRSEILSEQPNSSLYTYEGNLKNFGSVGD
                     IPLSPDQLLLRGATLRNTQWIHGVVVFTGHETKLMRNATAAPIKSTDVERIINLQIIA
                     LFSILIFLSFVSSIGNVIKISVDSNELGYLMLGGTNKASLFFRNLLTYCILFSNLVPI
                     SMFVTVEIIKFYQAYMIGSDLDMYYAETDTPTGVRTSSLVEELGQIDYIFSDKTGTLT
                     RNIMEFKCCSIGGKCYTEEITEDNQVQSHDGIEVGFYSFDNLHEHLKDTSSQQSAIIN
                     EFFTLLSACHTVIPETNDVDDTIKYQAASPDEGALVQGAADLGYKFRVRKPKGISIRN
                     TLTGVDSEYELLNICEFNSTRKRMSAIFRCPDGVIRLFCKGADTVILERLSDDGRPFV
                     DATLSHLESFAAEGLRTLCIASKIISEEQYESWSTKYYEASTSLENRSEKLDEIAEVI
                     ENDLFLLGATAIEDKLQDGVPETIHTLQSAGIKIWVLTGDRQETAINIGMSCKLLSED
                     MNLLIINEETKNDTRLNLQEKISAIQEHQYDIEDDTLESSLALVIDGHSLTFALEPDL
                     EDMFIQLGSLCKAVICCRVSPLQKALVVKMVKRKKKDSLLLAIGDGANDVSMIQAAHV
                     GVGISGQEGMQAARSADVSIGQFKYLKKLLLVHGAWSYQRISNAILYSFYKNVTLYMT
                     QFWFVFANCFSGQSIIESWTLTFYNVFFTVFPPFVMGVFDQFVNARLLDRYPQLYQLG
                     QKKKFFNVPIFWGWIANGFYHSAIIFLCSIFIYQHGDQLSNGLVANNWTWGTAVFTTC
                     TLTALGKAALVVTMWTKYTLLAIPGSFLLWIGIFPAYATVAPMINVSQEYRGVLKATY
                     PSLTFWSMIFGVSVLCLLRDFAWKFFKRSYSPESYHYVQEIQKYNIQDYRPRMEQFQK
                     AIRKVRQVQRIKKQRGFAFSQVDNQDQEKIVRLYDTTKKRGVFGELSEGN"
     gene            <234553..>236145
                     /locus_tag="DEHA2F02772g"
                     /db_xref="GeneID:2903070"
     mRNA            <234553..>236145
                     /locus_tag="DEHA2F02772g"
                     /product="DEHA2F02772p"
                     /transcript_id="XM_460486.1"
                     /db_xref="GeneID:2903070"
     CDS             234553..236145
                     /locus_tag="DEHA2F02772g"
                     /note="weakly similar to uniprot|P12754 Saccharomyces
                     cerevisiae YGR083C GCD2 Delta subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02772p"
                     /protein_id="XP_460486.2"
                     /db_xref="GeneID:2903070"
                     /db_xref="GOA:Q6BMT5"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR027363"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT5"
                     /translation="MSEQSVSDKTPSAENAVTEASAAVVAGEKELSNKELKELKKKEK
                     AAKRAAQKEASGITPEQQDQLAQQKMERKKQQQTATNTNLKKQLNQTLIKDASAKKKI
                     PALFSHLETREQRNASSPSISHIVHPAILSLTLKYSNYKIVGSISRLRNMLETFKIVI
                     SDYQTPPNTTLTRHLTGHLSHQIEYLKTARPLSVSMGNAIRLLKQEISHISIDTTEQQ
                     AKEILNQRIDDLIKEKIDLSDMLIIENASKHVTNGSTILTFGHSHVLENLFKYCVNQQ
                     DKKFNLIIVDSRPLFEGKNLLTNLVNTNYSPGTEEDDNSDAESATRKIFKSKPITQDH
                     LKVQYVLINSLSSTILEDVDCVFLGAHAMLSNGRLFSRVGTGLIAMMCHTRNIPVLAF
                     CESIKFSDKVQLDSVTTNELADSGDLIQDIGSKRPPQKKSFALEQFIKQCDEEKAKVT
                     NNLNNKNKQQKQKNNNTDEEISGKDANESLLKNWQDIDNLNILNIMYDLTPPEYIKKV
                     VTELGALPPSSVPVILREYKSA"
     gene            <236350..>241857
                     /locus_tag="DEHA2F02794g"
                     /db_xref="GeneID:2903071"
     mRNA            <236350..>241857
                     /locus_tag="DEHA2F02794g"
                     /product="DEHA2F02794p"
                     /transcript_id="XM_460487.1"
                     /db_xref="GeneID:2903071"
     CDS             236350..241857
                     /locus_tag="DEHA2F02794g"
                     /note="similar to uniprot|P38737 Saccharomyces cerevisiae
                     YHL030W ECM29 Major component of the proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02794p"
                     /protein_id="XP_460487.2"
                     /db_xref="GeneID:2903071"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024372"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT4"
                     /translation="MAEIELALINKVELRIALAEDDKKFEETLNLYLAPLLLKLSSPY
                     TEVRQAILKIIQYLIPRISAARAIKLPVNALLDQVKNPKLPAGEGPPLVRLYSLLLIS
                     RSIERLSPEEKMNLVPKVIEHISTYPTSVSSRLFNVFCKLLESWKVPERDSNEFNDMN
                     RFLQFDKYPQDEQFLAKAIGKFLLLQPNSTANPLQSPGLSIKDTSFFTQDAGVSYKSS
                     QEIYLIKIRLLEFLKSGFQPKNIAIPLLIASCDSSSSISDPSEILFRKLDLNLEDSSI
                     IDSLIELFLGSTETFIPPARPVLQEKILSILVKSKLAAQHSDISKLSSVALASDYSKL
                     KRTAVHFIKWVSKNNGENHSLQAVKEFNIDMASQLRSNLMGEGWPRIDMAGVRNYSSA
                     ISQRSLQYEALGNILKSNPELIVQDFTYFEFLFQSLEGEESDLRSAIQDALSGLTTHL
                     PNISLTSKNKLKNLAKRYLSFDKSESKENLQSCRYIAIKYINCAFPFSDSEARVICIL
                     GTSKDNRPDTIEEAQKGLHPHWFNILQSSNTLEFKATADLLGSNSKVEFPSFSDIVFT
                     LKNELNTMKDQENARLLGCMGCSIQFILHTLVMQSIAGKSTVVVPDEEWLTRIEKAIE
                     VDRTVINCLIKEISLVSQEDAIMDETSKSHESSFSVFLSIIFDCFVGQYRNNNKILSN
                     ITYGTTFTKLISLSPPKVIEKLSSFLNDLLSICNDKSLNESSSTQIAKSIGIIASHPI
                     NDNSVVNELLKKLVIEELQGSLSKSKLLSAGYLFSRLALRKRINFIDSELPSIFCEKL
                     VGALKNLNTYNVALDCISQLAMFGVLGPELEVDIRIKACVSKLIEEIKIRVKKCDEKS
                     VLTLSYLAMACNDTTNTEQLDQYEKLVYDTHVSKQIEYVFTSGEAFTILAAGWDSKVL
                     ERQMDIQDEAIEYIPKNTSRLPFILKMTLQSCKNTKPSLRKAGCIWLLSLVQYCGHLS
                     DVKDRATEIHLMFMRFLADRDELVQESASRGLSIVYEMGDYDLKDTLVRGLLKSFTDS
                     NSSALASGSVGHETELFEPELLKTNDGSVSTYKDVLNLASDVGDPSLVYKFMSLAKSS
                     ALWSSRKGMAFGLGSILSKSSLDELISSNKSLANKLIPKLYRYRYDPNSSVSKSMNDI
                     WNALIKDSSKTVNDNFDLILNELLKEMGNKEWRVRQASTAALNDLLQTVSLEAYEERL
                     EQIWSMSFRAMDDIKESVRKEGSGLTRSLATTLTRTADVKSGASTNKAKKVLSNLIPF
                     LLGSKGLLSDAEDIKKFALETILKLCNVGGSAIKSFIPDLLDNFIGLMSSLEPEAVNY
                     LVLNADKYNMKSNDIDAQRLQSLGHSPMMDAIEKLLDSLDDSLMPKTVRILQQSIKKS
                     IGLPSKVCGSRVLVSLVIKHLELIKPYGDQLLKICINQLNDKNDTIASSYATAAGYLC
                     RISSIDKIVEYSKVLSKLYFEGDDDRSREIAGIGSESMSKYSGDKFELALSAFLPLSF
                     IGKHDNVKSVKQPFEREWIENTSGNNSIKLYMKEICDICETYLNSNQYGIRKTIGKAI
                     VALCNSIEETSAFPQHVMNELFKILIEACKGKSWSGKELILESLISISIKSRMLINND
                     NDLFNKVNKVVLTEAKRRNKEYQKHSVKLMGKYLKEFPSNELIESYVDLMTGLLSDDY
                     YEDSDDEMEQVKSSISMVKLEEERLLFIKNLFETISMPINDDLCNLMLKSSINLFKSK
                     IDITWRSKVQINQNFLGFVKELIINDEVINTEEMELLFSIWKLLEDECLQSSTIENVK
                     IQFIRFSKMLIVYLERVNEVKKAEIVTSSLTEFQNVETSAIIQSELLKTYD"
     gene            complement(<242269..>243642)
                     /locus_tag="DEHA2F02816g"
                     /db_xref="GeneID:2903072"
     mRNA            complement(<242269..>243642)
                     /locus_tag="DEHA2F02816g"
                     /product="DEHA2F02816p"
                     /transcript_id="XM_460488.1"
                     /db_xref="GeneID:2903072"
     CDS             complement(242269..243642)
                     /locus_tag="DEHA2F02816g"
                     /note="highly similar to uniprot|P04838 Saccharomyces
                     cerevisiae YLL039C UBI4 Ubiquitin becomes conjugated to
                     proteins marking them for selective degradation via the
                     ubiquitin-26S proteasome system"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02816p"
                     /protein_id="XP_460488.1"
                     /db_xref="GeneID:2903072"
                     /db_xref="GOA:Q6BMT3"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT3"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
                     ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
                     LRLRGGQ"
     gene            <247638..>249560
                     /locus_tag="DEHA2F02838g"
                     /db_xref="GeneID:2903890"
     mRNA            <247638..>249560
                     /locus_tag="DEHA2F02838g"
                     /product="DEHA2F02838p"
                     /transcript_id="XM_460489.2"
                     /db_xref="GeneID:2903890"
     CDS             247638..249560
                     /locus_tag="DEHA2F02838g"
                     /note="weakly similar to uniprot|P38738 Saccharomyces
                     cerevisiae YHL029C Cytoplasmic protein required for
                     replication of Brome mosaic virus in S. cerevisiae which
                     is a model system for studying replication of positive-
                     strand RNA viruses in their natural hosts and similar to
                     CA5934|IPF2802 Candida albicans IPF2802 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02838p"
                     /protein_id="XP_460489.2"
                     /db_xref="GeneID:2903890"
                     /db_xref="GOA:Q6BMT2"
                     /db_xref="InterPro:IPR000195"
                     /translation="MSQDFINTDNHTSNLSSNNLYTNINAGNSIMSEELAVKDNSNST
                     VASDNTERTPCDAENGSIYTTGRSVVSDNAGNQDKGKNFPNGESSSASGKSENSHADD
                     ENDGSTENNSKLGQPSFSYDSEIFQLCQHYLTTKNHQGLALVARQKGLPPFLRFKIWP
                     ILLKHHPFVVNPFIEPDNEVNNENDTNTEEDLKSDIKRDLLKYIHRLNYTNLIDLNNA
                     SPEEQEVFKILESSILKFVKKWGKIMKYDHALTWIALGLAEWFPPIPNTSWVLVGRDF
                     PSSKTSCIKNLFHDYSNYINNVPNLNEYLEDLVNDKEIINMSFRDVYERLVLVLLHAP
                     EEKIKNKSKDLLGPKKINRKILPINGGTIEERVSFFIYCFRKLLPELSQYFQEEQILN
                     KFGSHDDEWLIWWLKWCGSKVWSRLDRGRIWDLIFGWRLQNFKKSNSYYVEKLNLSDN
                     LINKLGPDNFWSVSKDNDDSTIENYKKSSSFKDLINELNINESSNSNSPTSNSPSNSS
                     INEDLLPPSPLSSSSFSSSNIAPADEFNIPFSKLDPHVELLFVTLALLKSKENTLMEL
                     DQHEIRQFLSRLPTKSINISNKYKHFKPQESDMNNNIISNDSRNNHKIDFMDNIINES
                     GELWRKWLWSEMIDDN"
     gene            <250047..>251210
                     /locus_tag="DEHA2F02860g"
                     /db_xref="GeneID:2903891"
     mRNA            <250047..>251210
                     /locus_tag="DEHA2F02860g"
                     /product="DEHA2F02860p"
                     /transcript_id="XM_460490.1"
                     /db_xref="GeneID:2903891"
     CDS             250047..251210
                     /locus_tag="DEHA2F02860g"
                     /note="similar to uniprot|P53883 Saccharomyces cerevisiae
                     YNL175c NOP13 Protein of unknown function localizes to the
                     nucleolus and nucleoplasm"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02860p"
                     /protein_id="XP_460490.1"
                     /db_xref="GeneID:2903891"
                     /db_xref="GOA:Q6BMT1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT1"
                     /translation="MSKEEVEIKKESKKDKKEKKERKKEKKEKKQKKAVDEDSDNENE
                     SSGDSDDEEIAIDLNAGVPLSKKQKRLLKKGKLNLEKLAKKNPPPKPILTEEEQIKKD
                     AQEPKKSEYGVWIGNLSFDTTKEDITRFIMGKTNAYDADSNDGLVKIEQSDFIRINIP
                     KKENKIKGFAYVDLPSAKHVDTVISLSESHLNGRNLLIKNANSFEGRPQKDTNPLSKN
                     PPSRILFVGNLSFDTTQDLLREHFRHCGDIVKIRMATFEDTGKCKGFAFIDFRDESGP
                     TTALKSKLAKSLINRPLRLEYGEDRSKLTPKKFARNRDNFEPSEQDSISQPPPQVSTT
                     RERTKPQATPFKRKYDKPENNSNKRQKSSIALATAQRASVAIVPSSGKKTTFD"
     gene            complement(<251516..>254773)
                     /locus_tag="DEHA2F02882g"
                     /db_xref="GeneID:2903892"
     mRNA            complement(<251516..>254773)
                     /locus_tag="DEHA2F02882g"
                     /product="DEHA2F02882p"
                     /transcript_id="XM_460491.1"
                     /db_xref="GeneID:2903892"
     CDS             complement(251516..254773)
                     /locus_tag="DEHA2F02882g"
                     /note="weakly similar to uniprot|Q02455 Saccharomyces
                     cerevisiae YKR095W MLP1 Myosin-like protein associated
                     with the nuclear envelope connects the nuclear pore
                     complex with the nuclear interior"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02882p"
                     /protein_id="XP_460491.2"
                     /db_xref="GeneID:2903892"
                     /db_xref="InterPro:IPR024527"
                     /db_xref="UniProtKB/TrEMBL:Q6BMT0"
                     /translation="MSEVVEQRASNGDNASTKTSSTQNTRLKKLTSGSEWVSPFRESG
                     HSQKNLRQQLKEDNSIKNIHVPSKFTTHPTLDAQKKEKKEKEKAAKLEKKKKEKEAKE
                     KEAKEKEAKEKEAKEKEAEDKGDEEETKAVTLKNTEVDPLKAVTLKENGADPKSSKDA
                     SMRSLKDEPIDTPKESVFGGNKETEDLEYGEDLYEDDVKADNESERPLSEAEQAEVED
                     EVNGDTKKDEPATTDEATKEVSETAVKDKDASGSDEIENVVKEAPIELVTQPGSKYEP
                     VPLPNQEVLDKLKDKPKLLSRYQELNAAAVSSLSRSLDDPNKVVDLGSGLRMTQQQLL
                     DIAAKRVAPVITNINDEVSKTRNEDEIKRKKELDSKVASHEKKLQKDFDKHNKKLEKQ
                     KSKFTTDIGNKLQDLKKKMKNSDLTAANFEKETRKEIDTANEDYKERETTAVEKHSKD
                     KDTIIKNHEELEGTKKQELEDAKANQETTTQEIEELHERKTELDNANSELSTRIEELT
                     AELNERTIELDDLKAKHAAKQDGISKNLASKDELDNKITTTKKELETKKKQHDKLSAE
                     VGVLGGVLSTYAAKLTDLKSEASSHGDRLTDAKKKYKDWEDEKDQLATEIAREHERKR
                     ATAQEEAETKRVEDELEEKRLKNEAERKEAEERVAAKKEEERKLQESHEKAEADRLAN
                     DPEHQFMLATQKRESDVKKLEDERAEKERVYNEHKDKEAEEAQKLQEEIEELKQQKAA
                     HDESAREEADKLAEAKLVQIEQLKKEHEERVKMFKEKLEFEELQKSRLLDEVDNLNKI
                     KELRAEKARLTSELNKDVDVKDVNKLIEERELEVSKLSKQIELDNADLNNFNATQRSA
                     LAEGQKSTEPSKDITEADRPSKVSNAPIFANIGGSSKEQNIANKSDHSKPVKNEDNSN
                     SSSQKKSGARATGLATAGLAGAAGAGTAVALDAKNNAKNVSNVNDSKSTGGSFSKLKS
                     LTKRIRGESVSDANAEEPAVSSKEKKPSTKSAAPVNISKQPDGKSTKTKAVPVTSSSK
                     RADNAASFSDSSSAYETYSVYEEVSEAEYQKNLKNPDYMEMTAEEFEKRRKAGDH"
     gene            <255711..>260384
                     /locus_tag="DEHA2F02904g"
                     /db_xref="GeneID:2903893"
     mRNA            <255711..>260384
                     /locus_tag="DEHA2F02904g"
                     /product="DEHA2F02904p"
                     /transcript_id="XM_460492.2"
                     /db_xref="GeneID:2903893"
     CDS             255711..260384
                     /locus_tag="DEHA2F02904g"
                     /note="weakly similar to uniprot|P53094 Saccharomyces
                     cerevisiae YGL197W MDS3 Protein with an N-terminal
                     kelch-like domain putative negative regulator of early
                     meiotic gene expression"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02904p"
                     /protein_id="XP_460492.2"
                     /db_xref="GeneID:2903893"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS9"
                     /translation="MSTLVPSASSCYGLRLPPTEKDDRLNLNVRTGSASTLYKSLVFT
                     YGGLTIGLDIGDESVDELIRIFHSKISNLKSNSIDKYLSGEFFYLDLIEKYWTRVDIP
                     SGERKPKPRVFHEITAVNNCIYVFGGLIVNEKYDSHTHEDTNERELVPCNDLWEFSLE
                     SRKWNLLHDGSKYEYDAAVPRPRFSHKMTTLSSLSFANRKDHFGIFIAGGRDDESRPL
                     YDNFVFDLVTKEYVGSSPIELTLDTKKNSQKFRNVNSIVTSEDYKISVDYVNNVIISF
                     IKEPTHHHHHSRTRSTNKAISSDYTSTMEGDESLIVYSQVDSSKDQSINTLLSFKVGK
                     SIKEGKILPVHNKVSTKENETKRITNHTIPYNLKFPTGGLFGQNIVITGFLPNDNDIC
                     VFIYNKPTGKWSRLNFFCDHDYGSHRCWGGFAWQSHHKVVLLGNYLTSRTTSSIRYFT
                     LMITVSLPITNILASLELEGGHYHCPDGTKVFYKDDNSSTDDNNRDRISEEDAYSSSD
                     ALSDGEKKMLKRHHSVSASSDKAPQSISFSEYVHYVAPKTKFTTIRSVFPPAAITLGR
                     NAMDRYGDLISDFELVSSKGDRIPVSLRILMERWGRYFVQLLAKGYVQAVDRFERDQQ
                     LDSESTRNASSASESMNSANKTQNKLRSSMSTCGGSSISSSNSEVSINQSKPSKKGHH
                     QSSYHVSIPAPSKYSKEPPQFRLPFQESSLTNNSVSEKANETINQHFEETKRGIETNN
                     NEKLPDLPGSSHIKDEQPDTSRKGSVSSFSSSNSLLNSHLQNIPPQLPLPNEPIPAVP
                     ASTSFRGSSRKNSADLNSPRASLMYTLTALRNIPATKSPRESPFSSPRASVSGGPAPM
                     GNELSSLAIPNLKQSSLSTDRNNHRLTRSLDSSPNGSTDALPIKTAAGECITDQNFRN
                     KKVSNSSSMASSETFNSDKKFSPLSSIQPNTNKIYAKDADDRQDYEETNTTEANNSLF
                     SNPLLDFENAESGKFRMEPSLIPRKLYMPFATSSIKAFCEYLYTGQVGNKWLLSPVTL
                     DNLAISKFLDVPLLYDLISEVLFGVIGRKESFIIREGNKLKRRYHELLELTGSVKESG
                     FKFPLDEYEGFMDTIDDGFLDITLLKKSSASHKDSSASAMSSKRNKSSLNSASSFRYS
                     ISIDDINENAMSLREVPIDETLRSTNTESNQENIPTNNQEESTDDSIEKSTSNSEEDT
                     DFELGYLDARDNSSLNVGPRAKSIFDKSGTDMQFHSALDNDQKEKESEMEKSKSLNLT
                     LEQLVSPQSPLPSDYTIDLIYETATLCRDIKLMLRAANVKNMGDVFNQSKLELNIAIE
                     ELENKYDEQQKQQDEEQKIEHPQFKGKIPSQPSGNESDTGLEHIRSNMSSSSLSTLGL
                     RSVDLEKTKSNTGFRAIGGFGPFKSKTDLKASKMTSFENNKELDRRITRSIKNDEKLK
                     SKTAKDEKLKRLQDQKLERRQTDKPKLMTRKSIFTKYKDEGSTSTLASEASTNKKKHG
                     FLHHLSHKKKNEAPINQGDNSSLESSNLSRTLSASGSISSANSKKSQGSRIKNSLFGK
                     KRLSN"
     gene            <260637..>261521
                     /locus_tag="DEHA2F02926g"
                     /db_xref="GeneID:2903894"
     mRNA            <260637..>261521
                     /locus_tag="DEHA2F02926g"
                     /product="DEHA2F02926p"
                     /transcript_id="XM_460493.1"
                     /db_xref="GeneID:2903894"
     CDS             260637..261521
                     /locus_tag="DEHA2F02926g"
                     /note="similar to uniprot|P14065 Saccharomyces cerevisiae
                     YOR120W GCY1 Putative NADP(+) coupled glycerol
                     dehydrogenase proposed to be involved in an alternative
                     pathway for glycerol catabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02926p"
                     /protein_id="XP_460493.1"
                     /db_xref="GeneID:2903894"
                     /db_xref="GOA:Q6BMS8"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS8"
                     /translation="MAVTLKNNTDTVTLNNGDKIPAVGLGTWQATEKDAAYKSVKAAL
                     QNGYRHIDTAAIYGNEEEVGRGIKDSGVPREEIYVTTKLWNADHKKAEEALNTSLKKL
                     GLDYIDLYLIHWPYSVQPDTKQPYSDWDYLDTYKELQKLKATGNVKAIGVSNFTVKQL
                     ERLLADKDITIKPAVNQIEAHPLLTQPELTEYLKKNDIVIEAYSPLGSSNSPLFKNET
                     VVAIAEKYQVEPAQVLVSWAIQRDTVVLPKSVTESRIISNLKTFKLSDEDFNTLNNLS
                     QKDGVVRTCNPEFNDFDD"
     gene            <261995..>262882
                     /locus_tag="DEHA2F02948g"
                     /db_xref="GeneID:2903895"
     mRNA            <261995..>262882
                     /locus_tag="DEHA2F02948g"
                     /product="DEHA2F02948p"
                     /transcript_id="XM_460494.1"
                     /db_xref="GeneID:2903895"
     CDS             261995..262882
                     /locus_tag="DEHA2F02948g"
                     /note="similar to uniprot|Q12458 Saccharomyces cerevisiae
                     YDR368w YPR1 strong similarity to members of the aldo/keto
                     reductase family P6.5.f6.1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02948p"
                     /protein_id="XP_460494.1"
                     /db_xref="GeneID:2903895"
                     /db_xref="GOA:Q6BMS7"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS7"
                     /translation="MTTRTANNTDYYTLNNGEKIPAVGFGTWKATKKEGAHTAVKIAL
                     QTGYRHVDTAVMYDNEEEVGRGIKESGIPREEIFVTTKLWNTDHKQVSKAFDSSLQRL
                     GLDYVDLYIMHWPLPLDPKTEKPYEDWNYIDTYKEMQKLVESKKVKSIGISNCNIEQT
                     KKILDDKDITIKPVVNQVEAHPLLPQLELFDFLKQNDIALEAYSPLGSDNSPLFKDDT
                     IIGISQKYNVHLAQVLVSWAVQRGSIVLPKSVTESRIISNLKTFKLREDDFATLNNLS
                     KEVGPVRTNDPDWFDFGKD"
     gene            <263118..>263807
                     /locus_tag="DEHA2F02970g"
                     /db_xref="GeneID:2903896"
     mRNA            <263118..>263807
                     /locus_tag="DEHA2F02970g"
                     /product="DEHA2F02970p"
                     /transcript_id="XM_460495.1"
                     /db_xref="GeneID:2903896"
     CDS             263118..263807
                     /locus_tag="DEHA2F02970g"
                     /note="similar to CA5728|IPF2471 Candida albicans IPF2471
                     maltose acetyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02970p"
                     /protein_id="XP_460495.2"
                     /db_xref="GeneID:2903896"
                     /db_xref="GOA:Q6BMS6"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS6"
                     /translation="MSEESIKQEVVDYAYKNLRGIPKGNKEYEKMISQLSYNCFDHEL
                     LMSRNLAHERAIDYADIRMKDYDFDPEKHYKAREEYLRTIFGKLGDKSFIEAPFFVDY
                     GFNVSAGKNFYCNFNCTFLDCCLIVFGDNCMCGPNVTFCTPTHAIDPERRLAGEESAG
                     PITVGDNVWFGANAVVLQDITIGDNSIIGAGAVVTKDVPANTVVVGSPARVVKHLTSE
                     QDKIESANHLT"
     gene            <263919..>264962
                     /locus_tag="DEHA2F02992g"
                     /db_xref="GeneID:2903897"
     mRNA            <263919..>264962
                     /locus_tag="DEHA2F02992g"
                     /product="DEHA2F02992p"
                     /transcript_id="XM_460496.2"
                     /db_xref="GeneID:2903897"
     CDS             263919..264962
                     /locus_tag="DEHA2F02992g"
                     /note="weakly similar to uniprot|P53093 Saccharomyces
                     cerevisiae YGL198W YIP4 Protein that interacts with Rab
                     GTPases"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F02992p"
                     /protein_id="XP_460496.2"
                     /db_xref="GeneID:2903897"
                     /db_xref="GOA:Q6BMS5"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS5"
                     /translation="MNTLIVDILFHTIKTNITSMSSGTWNPPSYSAQDADEFIIADED
                     ETSSQRIQPDVTEHTPMSTSSHNANANANTNSMFSSFSFGPKVDLSSTFAPFTQSKTF
                     TDSNTIKERQYSGGDTLDEPVWNTLKRDLSQIGRRLAIVVWPMQLASLAAKQQSRLID
                     FASNNGINLPQSIVNARRISVSENQNDDEDEDRETGVTGDELLSQTTLEWDLWGPLIF
                     SLAYSVTLGVSASKNETNSVFSGSFSFIWLFFIVIGLNIQLLGGNISFMSAISATGYS
                     MFPITCGTLICTLVVKWKLIRIIIMSILGAWSIYSGVMSLKCSGVLPGRVLLAIYPVG
                     LMYSVLSWLCIIT"
     gene            complement(<265464..>266492)
                     /locus_tag="DEHA2F03014g"
                     /db_xref="GeneID:8998865"
     mRNA            complement(<265464..>266492)
                     /locus_tag="DEHA2F03014g"
                     /product="DEHA2F03014p"
                     /transcript_id="XM_002770684.1"
                     /db_xref="GeneID:8998865"
     CDS             complement(265464..266492)
                     /locus_tag="DEHA2F03014g"
                     /note="similar to uniprot|P23642 Saccharomyces cerevisiae
                     YML115C VAN1 Mannosyltransferase with a role in protein
                     N-glycosylation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03014p"
                     /protein_id="XP_002770730.1"
                     /db_xref="GeneID:8998865"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B5RU84"
                     /translation="MPLRNAESVLPMAFHNLMNLTYDHSLIDIAFLVSDCSPDDRTLE
                     TVFEYSVALQNGTLLNKLQLGERQRHANVIKGSSDLYQLYMDPDYMNNIKKSYNPETF
                     HENYHKPFRSISIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTSNALKSYH
                     SWVYWRDVDIETCPGSVIQDLMKHDYDVMVPNVWRPLPTFLGNEQPYDLNSWVESEAA
                     VELAKSLDEEDVIVEGYAEYPTWRVHLAYIRDPNGDPNEIIDIDGVGGVSILARARIF
                     RQGVHFPAFTFLNHAETEAFGKMAKSMGFRVGGLPHYTIWHIYEPSEDDLREIAKMER
                     KKRRQKGK"
     gene            complement(<267088..>268992)
                     /locus_tag="DEHA2F03036g"
                     /db_xref="GeneID:2903899"
     mRNA            complement(<267088..>268992)
                     /locus_tag="DEHA2F03036g"
                     /product="DEHA2F03036p"
                     /transcript_id="XM_460498.1"
                     /db_xref="GeneID:2903899"
     CDS             complement(267088..268992)
                     /locus_tag="DEHA2F03036g"
                     /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
                     YMR278w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03036p"
                     /protein_id="XP_460498.2"
                     /db_xref="GeneID:2903899"
                     /db_xref="GOA:Q6BMS3"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS3"
                     /translation="MEEYSEEQIKTLNTLVEQWISVDINPKSRKEIIELQQEGNYSKL
                     NEKLSKRIAFGTAGLRSTMTSGFAHMNDVTILQASQGLIKYLLEKNESNQNLSIVVGY
                     DHRFHSQRFAEITASVALTQGFKVYYLGSTTNLSRESIELSEAKFNELQEADRGYVHT
                     PLVPFAIDYFKASAGVMVTASHNPAQDNGYKVYYGNGCQIIPPNDSGIANSIERNLDP
                     WLNQHVWDIVGNFKKNADKLLFGVKGKATEMYVNAVNELLIQNHKLSYDFTYTPMHGV
                     GMEIFDKIISLFETKSDIKPVTEQMNPDPEFSTVKFPNPEEKGALALSIKNANESGHK
                     LVIANDPDADRFSVAIKSYKTNEWVQLTGNEIGFLFAMYVIEELTPENKLDKTYLINS
                     TVSSQVLASMAQHHGFKFIDTLTGFKWIGNKAIDLKKEGFNVPFGYEEAIGFMFSVAN
                     DKDGISALVIWLQLYETWFANKENYDPVDKLNEGYEKYGWYKEANGYYKLNDLSMTQK
                     IFENTIRKSYEGRPHPQTLGDTFLVDSWRDLTLGYDTSTPTHVPDLPVDPTSQMITAT
                     LKPKDAQSDNELVRFTCRGSGTEPKLKIYIEGKSDIGENRALSLAKLCWNTLKTEWFK
                     PEENGLQEVI"
     gene            complement(<269170..>270761)
                     /locus_tag="DEHA2F03058g"
                     /db_xref="GeneID:2903900"
     mRNA            complement(join(<269170..270683,270749..>270761))
                     /locus_tag="DEHA2F03058g"
                     /product="DEHA2F03058p"
                     /transcript_id="XM_460499.1"
                     /db_xref="GeneID:2903900"
     CDS             complement(join(269170..270683,270749..270761))
                     /locus_tag="DEHA2F03058g"
                     /note="weakly similar to uniprot|P32523 Saccharomyces
                     cerevisiae YLL036C PRP19 Splicing factor associated with
                     the spliceosome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03058p"
                     /protein_id="XP_460499.2"
                     /db_xref="GeneID:2903900"
                     /db_xref="GOA:Q6BMS2"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS2"
                     /translation="MICSISGETPKEPVISPKSGSIFERRLIENYISTSGKDPVNDED
                     LTIEELVGINSVTSTIAPPKPPSFNSIPSLLSTFQNEWDSLALEVFALRKQLHKAREE
                     LSAALYHHDAAVRVAAKAIKERDEARSALQQLAVSIGKDEPMDDVVIESTSNGDAKAS
                     TQLPVEIINQARDELFQLHKSQKPTLPITPEQNITVEFIANHAQPFKKAENSFVNATN
                     KILLVGSSTGSVAVYNFNNPGKNNVTKITHKGLVTAVNQVIHKDEQVPILAYKEKVFV
                     RDSKTLFEHNHEGEIFQIVSHPTLTNLFILFSRDGTWSLNDLDEMAVLFRSSKVNNIC
                     CGDIHVDGALLGTGTENGEVTIYNLTSGQSVFNIKSKYPNIKKLSFASNGYWLLVSSA
                     NGENASCLDIIDLRKNAIIHSIEFSNELVDFAIDPSSSIIITYDSRNMLSLHRYIKKG
                     KKWLDNLSEKTIEESNSALLSLDILNTADDEEFKNTGEIKFAGVTQNSSILEFQLAYA
                     "
     gene            complement(<271020..>272102)
                     /locus_tag="DEHA2F03080g"
                     /db_xref="GeneID:2903901"
     mRNA            complement(<271020..>272102)
                     /locus_tag="DEHA2F03080g"
                     /product="DEHA2F03080p"
                     /transcript_id="XM_460500.1"
                     /db_xref="GeneID:2903901"
     CDS             complement(271020..272102)
                     /locus_tag="DEHA2F03080g"
                     /note="weakly similar to uniprot|Q06991 Saccharomyces
                     cerevisiae YLR414C Protein of unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03080p"
                     /protein_id="XP_460500.1"
                     /db_xref="GeneID:2903901"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS1"
                     /translation="MFRIVRLIIILLSIATTVLSIFALVGSYKNEAYLTKIYLLDFHL
                     TDLDVSQLIDFNGFSKRDTIHPDSKRDTILPGRTVVEKDLASSLSDIGSTISGIVNSI
                     TYEDMGLAQVYSISLWGYCKGEVKGSSKTEKGFDNSDIDFKWCSDPKPAYFFDPLEII
                     KQELNNTINDKITGASGSIDISSDVRTVLEQIVDNITYETLNLPGNLNKQLTLLNNLT
                     KAAFALILIMAILSAIGVFVQLIGCCVDPSNCCLSCINFLFQTLVFLTGIIGAGLATG
                     AYIYVRKQINENTGELGIKSFLSIAFYALIWSAVAAALLVLIFTIIGHCCGCLSNNRK
                     KYKPLDAPAVPEKNGYEMGYNHHQNY"
     gene            complement(<272630..>275017)
                     /locus_tag="DEHA2F03102g"
                     /db_xref="GeneID:2903902"
     mRNA            complement(<272630..>275017)
                     /locus_tag="DEHA2F03102g"
                     /product="DEHA2F03102p"
                     /transcript_id="XM_460501.1"
                     /db_xref="GeneID:2903902"
     CDS             complement(272630..275017)
                     /locus_tag="DEHA2F03102g"
                     /note="similar to p|Q03254 uniprot|Q03254 Saccharomyces
                     cerevisiae YMR277W FCP1 Carboxy-terminal domain (CTD)
                     phosphatase essential for dephosphorylation of the
                     repeated C-terminal domain of the RNA polymerase II large
                     subunit (Rpo21p)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03102p"
                     /protein_id="XP_460501.2"
                     /db_xref="GeneID:2903902"
                     /db_xref="GOA:Q6BMS0"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6BMS0"
                     /translation="MAELTSITLPQSVPFPVTISSILCRQGETVPKHQTLFKYKYWDY
                     QDDPNSKEETPPKIRVERIGTYESPIEGEVNSINVCLSDEIAHSGVELCFIKEPCAHA
                     VQYGGLCALCGKAVEDEKDYSGYNYEDRATISMSHDNTGLKISLDEATKIEHNTTDRL
                     SREKKLILVVDLDQTVIHATVDPTVGEWQSDPSNPNYPAVKNVRSFCLEEDPIAPPGW
                     TGPKLPPSKCWYYVKLRPGLEEFLRSASDLYEMHIYTMATRNYALAIAKIIDPEGEYF
                     GDRILSRDESGSLTHKNLKRLFPVDQSMVVIIDDRGDVWQWENNLIKVVPYDFFVGIG
                     DINSSFLPKKFGQLTGPTKKRKSIAKLEALENEKNSTDDEESEANENDKEASEEDDNP
                     SQENDTPSSSPVDRILEMGGGEDNASLLMEQSISRNMSLEQQQHDRPLAKLQHDLDKI
                     HEHDSHSPSGSSSPEESDGDKKEEEDEEEDNLLYDDDNELYSLKKALVRIHSEYYKIL
                     AANKIKSPHLKPDLTHIIPFLKSKCLEGITILFSGILPLGINLDTADIVIWCKQFGVK
                     VVNEVYPEVTHVVCRDPNANSFKSGPTFKVRVAKKILPNVKIVNPDWLFACLSAWGKV
                     DETDYLVESEEDNWYLEDKDLKKYQKGLESQKQKQINTIESRPRFDSIGSVEEYDLDN
                     ANQEVDDFLAGISEDDNSEKDDDDNDNDDDNNDNEDTDNDKAEVSKPFDSFIKDAYKV
                     NKKRSLEADEDIILQQEVTSKKQKTQQAEPESEVDLDELEKELLDGFDDMEEANV"
     gene            complement(<275252..>277345)
                     /locus_tag="DEHA2F03124g"
                     /db_xref="GeneID:2903903"
     mRNA            complement(<275252..>277345)
                     /locus_tag="DEHA2F03124g"
                     /product="DEHA2F03124p"
                     /transcript_id="XM_460502.2"
                     /db_xref="GeneID:2903903"
     CDS             complement(275252..277345)
                     /locus_tag="DEHA2F03124g"
                     /note="weakly similar to uniprot|Q03750 Saccharomyces
                     cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved in
                     RNA polymerase II transcription initiation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03124p"
                     /protein_id="XP_460502.2"
                     /db_xref="GeneID:2903903"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR9"
                     /translation="MVSEDKAADIKKEEQSNSTINSAQDDVQNKHHEADETKEDMIRS
                     NNNENEEKDINSDGQEEKKADISEKLNGHEVITIDNKSTQNESEASNADDTVMNTETI
                     NKKGEEVPINISNNDKETHFNKPVLNLPDLEVPFSERRLAPETINLLNKPVDKKLAMS
                     GIEFQFSKIIGVILKSKGLDYSEEFLSQMNDLSITYFHDIIEMLRKFTEVQRRKKPSI
                     SDTELCFRMKGIKAGKLYKEYEETKLIAKKYKSEIDLVNSQTTELINEFKEDNKFDEN
                     DPSLPFFTNEHYEITELIPKQSSKPIYIPFYLPELPPDYTYQKTPKYMNMITDLKQLR
                     LKLVDESRLTEKSLYNLIDDDEKKWKEDFEKQIRDTLSEVDDDIDSENENSLMSEVEQ
                     KNQTDIETPIPDHQLEEHETKPRPTELNTKDGIPDEVDAASETLHNKTEEQIAKVDGE
                     PRKLLQDVKTFDFVAYAQKRRDLERSKELKIDRKRKLRESNIFFKTEKYYSPYATLPV
                     TPEVDLFFANIVQEEFKSVIGSVRTAEKRKKRKVENILREKAEREQAKEKEREKMGLG
                     FSFGPISHMSDDDNDDSDRDEDMGFPTFDFGDSNGSQDKQETDANPNNNNNFPLDNNE
                     TEIGSVPKADGTDAAHVNINTDEEMDSDSFEAELEDAIPADSAPKVTLLENNMKISND
                     LPSDSSDDEIELEDV"
     gene            complement(<277517..>278614)
                     /locus_tag="DEHA2F03146g"
                     /db_xref="GeneID:2903904"
     mRNA            complement(<277517..>278614)
                     /locus_tag="DEHA2F03146g"
                     /product="DEHA2F03146p"
                     /transcript_id="XM_460503.1"
                     /db_xref="GeneID:2903904"
     CDS             complement(277517..278614)
                     /locus_tag="DEHA2F03146g"
                     /note="similar to uniprot|P48510 Saccharomyces cerevisiae
                     YMR276W DSK2 Nuclear-enriched ubiquitin-like
                     polyubiquitin-binding protein required for spindle pole
                     body (SPB) duplication and for transit through the G2/M
                     phase of the cell cycle involved in proteolysis interacts
                     with the proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03146p"
                     /protein_id="XP_460503.1"
                     /db_xref="GeneID:2903904"
                     /db_xref="GOA:Q6BMR8"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR8"
                     /translation="MSDTISITIKSSGDTKYEVTVSPTITVLELKNEIADKSSVPADR
                     QRLIYSGKVLKDTETVASYKVQTGHTIHLVKSAGPKTNNTDNRGAASTDAPRNESESS
                     GNNSGVPSNIAAGQGSFNPLADLTGARYAGYTQLPSASMFGPDGGMNSGMPDPEQMSE
                     MMSNPMFQESMNSMLSNPQMLDYMINQSPQLRAMGPQAREMLQSPLFRQMMSNPEMMR
                     SMMQMGRGGAGGAGGFPGFGGQGGAGAFPAPGANPTVDSSDDNNATGAANENTNASTN
                     APANPFASMFPGGMPPMDPFALLGGAGGAGGAGAGQAAPQDTRPPEERYEEQLRQLND
                     MGFFDFDRNVAALRRSGGSVQGAVEYLLSSI"
     gene            complement(<278750..>279526)
                     /locus_tag="DEHA2F03168g"
                     /db_xref="GeneID:2903905"
     mRNA            complement(<278750..>279526)
                     /locus_tag="DEHA2F03168g"
                     /product="DEHA2F03168p"
                     /transcript_id="XM_460504.1"
                     /db_xref="GeneID:2903905"
     CDS             complement(278750..279526)
                     /locus_tag="DEHA2F03168g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03168p"
                     /protein_id="XP_460504.1"
                     /db_xref="GeneID:2903905"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR7"
                     /translation="MRSVQYKAERKYRAAEYMKQERDTKWKWSDQKRVKFHPTIITEY
                     IESVWQDKQELVNYRRDLDLLYPDIPYSERCQRRSENCNKTKQRLRNNKSYDRLYMDH
                     PSGLYNLPSYADCDCDLEYESYAIKKKIAWELSTAPPIFSHIHPFDDNLTLFFNSYLG
                     RTIDKRPIYQESHGDERIESPYYVEEDIFNMPYEIERRLWVYRIAKFREWKLSFSKKN
                     VVLPTNDSTTGICKYSSSFDCDAYPFKRIEDPMMYFKSSF"
     gene            complement(<280012..>281571)
                     /locus_tag="DEHA2F03190g"
                     /db_xref="GeneID:2903906"
     mRNA            complement(<280012..>281571)
                     /locus_tag="DEHA2F03190g"
                     /product="DEHA2F03190p"
                     /transcript_id="XM_460505.1"
                     /db_xref="GeneID:2903906"
     CDS             complement(280012..281571)
                     /locus_tag="DEHA2F03190g"
                     /note="weakly similar to uniprot|P34233 Saccharomyces
                     cerevisiae YKL185W ASH1 Zinc-finger inhibitor of HO
                     transcription"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03190p"
                     /protein_id="XP_460505.1"
                     /db_xref="GeneID:2903906"
                     /db_xref="GOA:Q6BMR6"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR6"
                     /translation="MSVLNTTNMFNNQLNSFTSGHINSRSYNELSSKLKANIKTNKLS
                     QPLQQYAENDVHYIKKRSYSDLLRESSAFGDRGSIKGQDTKRSRTAPPSPPSQPYDTN
                     FQANGVPQFKFKSIKTNSNVRSRSLSPNKKFVTCLSPCNSPSLPNTPHSSPSKKPTLP
                     SISTVLQSTPMTPKAPLRLKPITPTVSLDYFDTYKPNDENWRYGLLDTINKGPNQFNL
                     NQYDYLNKHKISHTSSVPSPVFVKDRPSFNSRISSKIIQNSSPRVNTFDKSNYPPCIQ
                     EKVYSERKINFPYESNYTYLNKTYLNDVKKYPEYLELAHSLIQLSQPQSNTPDSHCQP
                     MTPVNTSNNNSVNDTIIEPIYQQNVSHSVYPPTSTPPSSTRLPNPQYNSFLGIISEGP
                     TTPPAENDNKTKFIPVTPPSSKCKSRSELLKSSPRQQHQHAPRVCISCGSDQSPCWRP
                     SWSIKEGQLCNSCGLRYKKTSARCLNDECKKIPAKGEWSLMQSKGKSVFEDGLEGYSC
                     LDCGWRVEVKK"
     gene            complement(<282429..>282614)
                     /locus_tag="DEHA2F03212g"
                     /db_xref="GeneID:8998866"
     mRNA            complement(<282429..>282614)
                     /locus_tag="DEHA2F03212g"
                     /product="DEHA2F03212p"
                     /transcript_id="XM_002770685.1"
                     /db_xref="GeneID:8998866"
     CDS             complement(282429..282614)
                     /locus_tag="DEHA2F03212g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03212p"
                     /protein_id="XP_002770731.1"
                     /db_xref="GeneID:8998866"
                     /db_xref="UniProtKB/TrEMBL:B5RU85"
                     /translation="MPDDKLNMAKSIGASIAGSVGGAKVADKLHLGNGGHMATSIAGS
                     IGANNVLHHFEDKDGKK"
     gene            complement(<283102..>283287)
                     /locus_tag="DEHA2F03234g"
                     /db_xref="GeneID:2903907"
     mRNA            complement(<283102..>283287)
                     /locus_tag="DEHA2F03234g"
                     /product="DEHA2F03234p"
                     /transcript_id="XM_460506.1"
                     /db_xref="GeneID:2903907"
     CDS             complement(283102..283287)
                     /locus_tag="DEHA2F03234g"
                     /note="some similarities with CA5650|IPF7109 Candida
                     albicans IPF7109 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03234p"
                     /protein_id="XP_460506.1"
                     /db_xref="GeneID:2903907"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR5"
                     /translation="MGGDDHHKLDQAKDIATGVAGGVGGGAIANKLGLGQAGGIVGSV
                     AGSIGANKADHKAEEKK"
     gene            <283536..>284149
                     /locus_tag="DEHA2F03256g"
                     /db_xref="GeneID:2903908"
     mRNA            join(<283536..283560,283638..>284149)
                     /locus_tag="DEHA2F03256g"
                     /product="DEHA2F03256p"
                     /transcript_id="XM_460507.1"
                     /db_xref="GeneID:2903908"
     CDS             join(283536..283560,283638..284149)
                     /locus_tag="DEHA2F03256g"
                     /note="weakly similar to uniprot|P34232 Saccharomyces
                     cerevisiae YKL186C MTR2 mRNA transport regulator essential
                     nuclear protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03256p"
                     /protein_id="XP_460507.1"
                     /db_xref="GeneID:2903908"
                     /db_xref="InterPro:IPR019488"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR4"
                     /translation="MSNIQRDPKPYLKKILSSLDIQYQGPSQQFPNVESYATQFGKQL
                     KPQCAIIMNGKPLIPTNNDAKLEFQKKWLLSPLTFHQLNSFDSHLIPGTGTFVINASG
                     KVKFDESGRNRLGETSDLIHPINNATVKGRPVWGSWFGFNLNLIVDESILNNPESEAI
                     NSYNYRFTYKPDDSVIQI"
     gene            complement(<284191..>286110)
                     /locus_tag="DEHA2F03278g"
                     /db_xref="GeneID:2903909"
     mRNA            complement(<284191..>286110)
                     /locus_tag="DEHA2F03278g"
                     /product="DEHA2F03278p"
                     /transcript_id="XM_460508.1"
                     /db_xref="GeneID:2903909"
     CDS             complement(284191..286110)
                     /locus_tag="DEHA2F03278g"
                     /note="similar to uniprot|P38887 Saccharomyces cerevisiae
                     YHR202w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03278p"
                     /protein_id="XP_460508.2"
                     /db_xref="GeneID:2903909"
                     /db_xref="GOA:Q6BMR3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR3"
                     /translation="MNMIENKRKCQYGFIVLAFILGIFLFPVSWLQLSKQHKSDSSLI
                     RNIEWNDINFIHTTDTHGWYSGHINQKQYNADWGDFISFTIHLRDIAHSKKQDFLLVD
                     TGDRHDGNGLSDVTIPNGAKSLPIFMRQDYDLLTIGNHELYIWENSQQEYDLVRDHFK
                     SNYISTNVEYKLQNGTYIPMGQRYKYFTTPIQSIRILSFAFLFDFARYNSETKVEPIM
                     KVLDEDWFKDILIDHPADEVDLLVIIGHIPVSHNDEELFQLHSFLRKYYPKTKIQYFG
                     GHSHIRDFSIYDEYSTGLQSGRFCETAGWVSINLESANNNLNGVDKVKNTFSRSYIDF
                     NLNSFMYHTNISSTEEFHTGVGLNVSRQISDTRKELNLEAIIGYVRNSNYFMDYVSIT
                     NPKNIFKLLTDKVLPTLEIENPDIATSDQRLIIINTGSIRYDLYKGPYTLDSQYIISP
                     FENDWVKLTLPKNVAIKIAPKLNELQYIIRSASDNTFDNRRLLPEHQYSRLLKNDYAS
                     FNKRTEDWGQHHFENRASERFQEIGKLKSASRKNRLSKGYVTYDDFGHDGDDTLHRPV
                     VNHPIPNVVQSEELNYSDGGSSVDVVFYSFITPNILWALKEIGFEEDVSNQIEFYSKN
                     YLGLLLNEYIRNNDI"
     gene            complement(<286296..>287087)
                     /locus_tag="DEHA2F03300g"
                     /db_xref="GeneID:2903910"
     mRNA            complement(<286296..>287087)
                     /locus_tag="DEHA2F03300g"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_460509.1"
                     /db_xref="GeneID:2903910"
     CDS             complement(286296..287087)
                     /locus_tag="DEHA2F03300g"
                     /note="highly similar to uniprot|P05753 Saccharomyces
                     cerevisiae YJR145C RPS4A Protein component of the small
                     (40S) ribosomal subunit and highly similar to
                     uniprot|P05753 Saccharomyces cerevisiae YHR203C RPS4B
                     Protein component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_460509.1"
                     /db_xref="GeneID:2903910"
                     /db_xref="GOA:Q6BMR2"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR2"
                     /translation="MGRGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPL
                     VIFLRNRLKYALNGREVKAILMQEHVKVDGKVRTDATFPAGFMDVITLEATNEHFRLI
                     YDVKGRFTVHRITAEEASYKLAKVKKVQLGKRGIPYVVTHDGRTIRYPDPLIRANDSV
                     KVDLATGKITDFISFDTGRLVMVTGGRNMGRVGVITHREKHEGGFDLVHIKDSLENTF
                     VTRLTNVFIVGTEAGKPHISLPKGKGIKLSISEERDRRRNQQLIN"
     gene            complement(<287332..>289563)
                     /locus_tag="DEHA2F03322g"
                     /db_xref="GeneID:8998867"
     mRNA            complement(<287332..>289563)
                     /locus_tag="DEHA2F03322g"
                     /product="DEHA2F03322p"
                     /transcript_id="XM_002770687.1"
                     /db_xref="GeneID:8998867"
     CDS             complement(287332..289563)
                     /locus_tag="DEHA2F03322g"
                     /note="weakly similar to uniprot|Q12344 Saccharomyces
                     cerevisiae YPL249C GYP5 GTPase-activating protein (GAP)
                     for yeast Rab family members"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03322p"
                     /protein_id="XP_002770733.1"
                     /db_xref="GeneID:8998867"
                     /db_xref="GOA:B5RU86"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:B5RU86"
                     /translation="MMPPSDDEFQDAASNSFPTGSEVDNGKESPPITNQSTKNKKKNK
                     KKNKKQQQTDTASVSSFTGESSNYENNNESNELVNTNEKIDLTNNDDPIDKRGNDDTI
                     TEDTEDVNNPVEKQTEQLKVVLPNPVKVATPDTSFTGEPANDEQNSTLPNGKPSLPNR
                     KPISECLRLDQPSAQILEGTTEASNDKMNTISNSYRKESNNFLLESKFNQLNREFESK
                     DLKLKESINSGTENIKKTFNDIKNTVGGFSDMFDYQIDWEFWTRIVNDYESVIQNESN
                     ELNNLINKGIPKEFRGIIWQLIAKSKNFQLEEFYFNLKSESSVHEKSIKRDLTRTSFF
                     TNVEQVNKGEELFNVIKAYSLFDPDVGYTQGMIFITVPLIMNMSESECFCLLVTLMKD
                     YNLRSLFCPEMKGLHLLLYEFDRLLEINLPNLYNHLVKQGIKSSMYASQWFLTFFAYK
                     FPLDIVLRIYDILITQGIESILKFAVNLMIKNESNITSLKFDKLLDFLKNNLFNVYVN
                     DEFINGINSTNTSQSDLSGSGVSRRFSLLGGRRSSAGGARSKSHNYYKLNELVEDSMQ
                     INVIPLDLSKFEAEFENIYLNEKSKTTEIENLRIENGKLRHDIKLLETDFSSLNSDHI
                     NIVQKMVDIKVTLPDIANDNEDLQRSIAELKDKIEGLESKINAGSGDNNSSESSLGLQ
                     APALPTNIENNIQELLTINAQETERFANLEEELSNLQMEDERLNSELSNVKQSKWLFN
                     RWK"
     gene            complement(<290147..>291370)
                     /locus_tag="DEHA2F03344g"
                     /db_xref="GeneID:2903912"
     mRNA            complement(<290147..>291370)
                     /locus_tag="DEHA2F03344g"
                     /product="DEHA2F03344p"
                     /transcript_id="XM_460511.1"
                     /db_xref="GeneID:2903912"
     CDS             complement(290147..291370)
                     /locus_tag="DEHA2F03344g"
                     /note="some similarities with uniprot|P42933 Saccharomyces
                     cerevisiae YMR191W SPG5 Protein required for survival at
                     high temperature during stationary phase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03344p"
                     /protein_id="XP_460511.2"
                     /db_xref="GeneID:2903912"
                     /db_xref="UniProtKB/TrEMBL:Q6BMR0"
                     /translation="MRSQTMKNLISLKKNITRRIKQTLEEIAENLGHPQQRPVPVPIP
                     IPVRSGRNASRLSKQFSRYYSTSSNFTGGHYKFRAFQFLNVKYQNGGKLGRIIQNNSN
                     WIRFNIQNSNFNQYRSFRTFHKSFLYNNFSQRYQSQFGNKMANMNFFRHPNGSSPIKN
                     LNLNIRAFMNSKKFDTSDPSTYKQDLVLHSRPQVKSNIRLNVSLTPKFSELTLSMART
                     VSSAGCEETSHNTQTSNGCYVDFPMSSKFSIPAMTILNNEILDELMQDLKILESKIAE
                     LKSDLQNLFELGELPMKYLHDQNIIRVYFANCDKARLESLLREKNIINGIIYEEAVYG
                     CSSDCANVSEADILSSYYGSSSSLGSSTEYDDDVLSDSSHHPLSNDHIIRPESGNQSQ
                     NSQHVSFCDEDICWV"
     gene            complement(<291746..>292789)
                     /locus_tag="DEHA2F03366g"
                     /db_xref="GeneID:2903913"
     mRNA            complement(<291746..>292789)
                     /locus_tag="DEHA2F03366g"
                     /product="DEHA2F03366p"
                     /transcript_id="XM_460512.1"
                     /db_xref="GeneID:2903913"
     CDS             complement(291746..292789)
                     /locus_tag="DEHA2F03366g"
                     /note="some similarities with uniprot|P04386 Saccharomyces
                     cerevisiae YPL248C GAL4 DNA-binding transcription factor
                     required for the activation of the GAL genes in response
                     to galactose"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03366p"
                     /protein_id="XP_460512.2"
                     /db_xref="GeneID:2903913"
                     /db_xref="GOA:Q6BMQ9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR004035"
                     /db_xref="InterPro:IPR005600"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ9"
                     /translation="MKIPTNLAAESHHDNNLIEQACDSCRKRKLKCSKESPKCSKCIQ
                     HNWCCSYSPRTVRSPLTRAHLTQVENKVKSLENLITYLLPQEVNSRGIDQLLYQNTFK
                     DVLRPYKDMLQNGSTSDEGQDGRNRGSTPGGGSGTTTPPAFEEDLNQSSSVTPQGGSP
                     GKGEHSRLNTNGCNSLAQSPSYSIFSMDDSISNASIDHSDHHDHNRIDNDKIKQEIID
                     DFILNSIPTDNKRSQCQFITPSAIKHEYSPYPYQQHQPRPKNISNTTTSATSLTSPSS
                     LLSLNSYGDNINEDEEIPKKSYASPTRSSANKKFEDLDLLISSNGINNGINDSNYNLI
                     FDEVMDDSPMING"
     gene            complement(<294495..>298598)
                     /locus_tag="DEHA2F03388g"
                     /db_xref="GeneID:2903417"
     mRNA            complement(<294495..>298598)
                     /locus_tag="DEHA2F03388g"
                     /product="DEHA2F03388p"
                     /transcript_id="XM_460513.1"
                     /db_xref="GeneID:2903417"
     CDS             complement(294495..298598)
                     /locus_tag="DEHA2F03388g"
                     /note="similar to uniprot|P35187 Saccharomyces cerevisiae
                     YMR190C SGS1 Nucleolar DNA helicase of the RecQ family
                     involved in maintenance of genome integrity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03388p"
                     /protein_id="XP_460513.2"
                     /db_xref="GeneID:2903417"
                     /db_xref="GOA:Q6BMQ8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ8"
                     /translation="MIGNNLAEHLKWVDLNKPQIPNAKIISILARHGSDSSINNGIRG
                     STGSVFRATGHMGEMNSSVGSQQTIPKSGATSTRINIRPPSDQPLQQSTQTANNMETL
                     SIPETGSIASKDRASNVSDIDSTTKPAKHTNIQSESNGNIANNNNKTTNINNPKEEED
                     ENVIDLTMEAPRNQKKQKLNPDSQTSIQQAYIQICEQKIALLMERFTTIESTAISLDD
                     KKNYLNKTFGPKFKQINENQSSLRGKLLFLTDDLQHDDTSSLSELNEFPNFDSDRISD
                     SPKNLNTIDKIDFCSQFSEVNQSNIARAMNIRENLESTNPNSQKPSSASNEESEFHLV
                     DETSSPSRYADNLNEARELVMQSNLRNKSNPPKIINNSESEDDEDNFGDNTMDGLRTP
                     SQDRNDEYDLGSFIEFEKQNLDNESVDESYIESQRNKHESDNSDNYTELDSDNEIDNI
                     RLSPDVAENFGIKYNDLPNSEIDLISNIDNNNDMNDDNGNDDDNGNDDDIEEIEDFTT
                     QLNQERELNNTEDIIEISSDDEGDANYDMFVKPSTIKNTLVETKPNPLIVSKSPLTEN
                     NLAMNVPSQHLDSDIDFSDDEDELINILNNHKPNKENIPPNSEAFIKEVYSKLNSVFK
                     LSNFRPNQLHAISSTLNGKDVFVLMPTGGGKSLCYQLPALVKSGKTRGTTIVVSPLIS
                     LMQDQVQHLLNKNIKAGMVSSKGSASERKSTLDSFRNGQLDLVYLSPEMINASQHIQR
                     IITKLYDMNELARVVVDEAHCVSSWGHDFRPDYKGMNYFKHNYPKVPVMALTATANEK
                     VRMDIIHHLKMDNPILLKQSFNRLNLFYEIKWKTSNTLEWIKNYILTKQVNKTGIIYC
                     HSKQSCEHTSEKLNEWGVNASYYHAGLSPTDRFEIQNKWQQNELQIICATIAFGMGID
                     KPDVRYVIHLFIPRTLEGYYQETGRAGRDGAYSECIMFYSYKDARSLQNMIQRDEELD
                     REGKENHLAKLRQVVQYCENTTDCRRKQVLHYFNEQFNPITCNKKCDNCINSSNITIV
                     EKDVTGYAKDILKLVKSIQDDRVTVLHCQDVFKGSNNSKIMKFGHNLNPYHGKGRALD
                     KTDVERIFFYLLSEGCLCEYQIMKGGFASNYVKLDKQAESVLHDRKFIKINFSSESKQ
                     RSTGNATISGSVNPTNGYQFQSFVSASRIQIPSITNFTSAGVQNSDHIKHSCNELNNM
                     RMQIMVDSSLNSAENVFNDDTLKDMAHKLPTNKRDFGKLASITKEQLNYFPQFKKLLG
                     SLSKERKNQVPDSTPSSTTSPYFGNQQDSNDPSTWRSTYSQTENSTAYVNIKNKYSRG
                     NRRSSQSSQRGYKSQRGRNQKTQRSQRSQRVSKPRSNQKNTPRGMPL"
     gene            <300008..>300871
                     /locus_tag="DEHA2F03410g"
                     /db_xref="GeneID:2903418"
     mRNA            <300008..>300871
                     /locus_tag="DEHA2F03410g"
                     /product="DEHA2F03410p"
                     /transcript_id="XM_460514.1"
                     /db_xref="GeneID:2903418"
     CDS             300008..300871
                     /locus_tag="DEHA2F03410g"
                     /note="some similarities with uniprot|P47977 Saccharomyces
                     cerevisiae YLR136C TIS11 mRNA-binding protein expressed
                     during iron starvation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03410p"
                     /protein_id="XP_460514.2"
                     /db_xref="GeneID:2903418"
                     /db_xref="GOA:Q6BMQ7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ7"
                     /translation="MTAYQQVPLQTLPLNDNMMGYRQVNNEQYQKLAGVGGFGSVEST
                     GVDVGAVKGDLLADLWSMPSSHECASSTSSTSSSSSPSHNNMWKSPASITPPLMSQGN
                     GNYGYLPGGGVGSAMQPNYGMRDSIEYKPLSSNMVFNDLPALTEENLMYGTDSNSFAY
                     IGRNSSLSDHSDEIFNFEQQQLHQQQQQQQQQVLLSQQAAQYPSIEQTQQQKNKQLNV
                     NTQLYKTELCASYIKMGICPYGNKCQFAHGENELKSVSRPPKWRSKPCANWSKFGSCR
                     YGNRCCFKHGE"
     gene            <301854..>310064
                     /locus_tag="DEHA2F03432g"
                     /db_xref="GeneID:2903419"
     mRNA            <301854..>310064
                     /locus_tag="DEHA2F03432g"
                     /product="DEHA2F03432p"
                     /transcript_id="XM_460515.1"
                     /db_xref="GeneID:2903419"
     CDS             301854..310064
                     /locus_tag="DEHA2F03432g"
                     /note="similar to uniprot|P33892 Saccharomyces cerevisiae
                     YGL195W GCN1 Positive regulator of the Gcn2p kinase
                     activity forms a complex with Gcn20p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03432p"
                     /protein_id="XP_460515.2"
                     /db_xref="GeneID:2903419"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022716"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ6"
                     /translation="MTSETDVTWDQLSDIYEKEIFDSLTSKRIPFLRKVQHLLDTNKI
                     TDDKQELLELCQTLLKTYNYYQDVNSRNELLKTLEKIVLFKNEFLPVFIKFTYDIAVK
                     ERSMAVTDYLTLLSWINKFSIITSDLGVSNQELIDKVVLSQAYLFNNCVNTILNESNQ
                     SFQHRRRINDSVLSSTKYSITHTFVKSDGSTKVIDNYINALTSPSNKVPPTVVISYLG
                     VISDAIVDALPTYPGLLNHLNESGGNVKSSILNYYTNQVLLNKIPPHDYSLKLFGKYI
                     ESSINENDFNTVIVPVLDKAILRSSEVSFGYLIPRLIEFLSKDIDLSNTLVNTKLLNN
                     FLNAFKSPKELTRNGAFTSMELLIHNHFEGAADDILAKLIDECLKSFKGTSNNESKYL
                     IVKTLSMLKFKNTGISLRILNGLLPLVSKDQNEISLNGLINAFINQYLDLIVNNEEIS
                     DEDNSKFVDQFKLGLSDKKMPLRRIWFLELGAYVYNTMRIVHNVKFLQLIETLYPIFI
                     SSIEEAQQSPLPTITTKGISCSYVLITLSSLVKKSLKLIDDKKVFINSLRNTEKPSIL
                     TSSKVFTKLTNSTEIIWFLRALREASGYINSLDQNDKNAYGHAWIYMAISENIPYDLR
                     LQCLKFMGDCLNENAEEFSKLIIDSIYCVLIEADNQKDQEVYSYNFKFLSPVLSVITQ
                     SKNHHTSKISLQKLLVAANHDLIPIRNEWVGLCQRSNVNIGDLVGNNSDEIFASTLEF
                     LKNNAFAGLIYKAAIKSMSMISFIKPEVFGPKLSALMSSDLDIDKIVNIDNQSIQIWQ
                     GTDGVLVLDVLNNSSDSKRNDDKNNRDYETRKWEEEMRKELANKNKGKITKKLTKEEH
                     VLVNEQLNKESNTRKEVQILVNDFHRGIDIINDLVSNATQVDNGSAHWYPVAISKILI
                     LTESKVIPQLLHDLPLKSFLHLAELISSRLGSLKGFVGVAILRLNGVVGLKENLLEEP
                     ILSLTSRILFRIKFLSDQNPLDSLSLSYILPLLTKVLENGKMVAMKNATKQKVTSEFV
                     EEDPEEEQLLLAIEIISSHAEVFEDDTIPRQKILEVILSLMRLPSKAKLSKECFLAMC
                     QHISVSITKNDLKILFDNVISPEVFVRNAVLEGIDSEFDLTTEMNYSNELWIAIHDND
                     PNSAELARTIWEDNKFELSQEAPTQLLQYAGNKDSGLRLSIANAIYSSVLALLDSNKN
                     IFEETLNELIDLYHVKKNPPPPALDRFGLVIKSSSDQRDTWEERSTIALTIKLLSPFF
                     EKQTIEKLFRFLVDEKALGDKEDLVRQELQEAGVEVIKKHGFTNIETLIPIFEACLAA
                     KDDGSKTQDNIRECVIILYGALARHLDESDSRLDLIVDRLIKTLDTPSEDVQYAISEC
                     IAPLVVSFTPKLQHYFDILFEKLFEGKNMASRRGGAYGISGLVKGSGIKSLSTYDIIR
                     NLTDAADDKKNSQRREGVSFAFECLSQSLGKFFEPYVIEILPILLKSLGDQVPEVREA
                     TDSAAKQIMKNTTSFGVKKLIPVAISNLDEIAWRSKKGSVELLGSMAYLDPTQLSSSL
                     STIVPEIVGVLNDTHKEVRKAADQALKRFGEVIRNPEIQAIVPDLINAIGDPTKYTES
                     ALDKLIQTQFVHYIDGPSLALIIHVIHRGMKDRSAATKKKACQIVGNMAILVDSKDLR
                     PYLSALVGELEVAMVDPVPGTRSTAARALGSLVEKLGEEQFPDLIPRLLDTLRDETRA
                     GDRLGSAQALSEVISGLGINKLEELLPDILSSASSPRNYIRAGFMPLLLFLPVCFGSQ
                     FSPYLNRIIPPILSGLADTDEEIRDTALRAGRLIVKNYAKKAVDLLLPELEIGLSDTN
                     YRIRLSSVELTGDLLFQVTGISGKSELTEEVSEFSGEVNKTLIEVLGQDRRDRILSLL
                     FVCRSDVAGIVRSAAVDIWKALVANTPRTVKEILPSLTQIIVRRLASSDEEQRTIAAQ
                     TLGEMIRRVGANALAQLLPTLQSSLVSGDNDAKQGICIALSELIKSTSYDGLVEYQGV
                     FISIIRDALIDPATKVREAAAEAFKALQEQLGKVVIDAILPYLLNMLESDNTENALLA
                     LKDIMATRADVIFPILIPTLLSPPIDAFKARALSSLASVAGHALYKRLSLIINTLVSA
                     VIDSKNESEASQDEIKSAFDKILLAIDDDEGVHPLMQQLLSLVKHEDAAKRAVIYERL
                     GSFFAHTNLDYTVYIQDMVSQFILSLGDRSPEVVKGSFDALSALVKRQSKESLERLIK
                     PARQALSITGVRGEELAAFTLPRGPNCILPIFSHGLMYGNSDQREMSAHGIADIIDKT
                     PAANLKPFATTITGPLIRVIGERVSSDIKAGILYALTSLLSKIPQFLRPFIPQLQRTF
                     VRSLSDPQNDALRSRAVIALGTLIEHQPRVDSLVTELVTGARNASEQGVKTAMLKGML
                     EVVSKAGENMNEASKTSILSLVEDEITLVSDKSAVSYARLIGSLSQILSTEEATSILK
                     SKILEKQNDVSVDNHKFAILSINSFLKDAPHHIFQTGLLDEIVTFIINCANSSNDYIS
                     ANATVAIGKLCLLLSETKSPVTSSTIVNDKQFEIDDDNIHKLVEQLATNMVKPNSNSP
                     DTRRLSLVIVRTIARFKYQELVKPFYDLLVPSVFTCVRDTIIPIKLAAEKAYIAIFNL
                     VDDEQMNDFNQWFNSKQSNISGVVGISIIPRSIGDYTKRVATRLAGVERERIEAGGDE
                     ETLFSDRIEDESEVWAIGGVDLSK"
     gene            complement(<310397..>311737)
                     /locus_tag="DEHA2F03454g"
                     /db_xref="GeneID:2903420"
     mRNA            complement(<310397..>311737)
                     /locus_tag="DEHA2F03454g"
                     /product="DEHA2F03454p"
                     /transcript_id="XM_460516.1"
                     /db_xref="GeneID:2903420"
     CDS             complement(310397..311737)
                     /locus_tag="DEHA2F03454g"
                     /note="some similarities with uniprot|P27705 Saccharomyces
                     cerevisiae YGL035C MIG1 Transcription factor involved in
                     glucose repression"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03454p"
                     /protein_id="XP_460516.2"
                     /db_xref="GeneID:2903420"
                     /db_xref="GOA:Q6BMQ5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ5"
                     /translation="MTTKAQDKRKDPASRPYKCTMCDKAFHRLEHQTRHIRTHTGEKP
                     HSCSFPGCFKKFSRSDELTRHSRIHTNPNSRRNKNLSKSQQKIPVPPQTSRGDQSDQS
                     KEEIQIINEKPQSEHVKTEKGDIEDSVMQPSVTHHAHGVLGAPLKVSSSESSFSSNPL
                     SKKKSHNSDHLANKGHRSEISDDEMQSTPPSDDCASHPNGKKNIDVLASAASEELENL
                     NSKSLPSLTDYFNNGKNAPFSAPAPKPINSSNSTNNLQYLSNVAMMSSNKPQSKSSTT
                     LASKGLTNALSVLQRMTPLNPVPQNSHALQDSDFDYVKQRLKKSRPNSPVNGKHFTLP
                     NSPVLGLSSTTTPIISASNSSTNLAALMMAPSSNNVITDGGFIPRQNNSSPPPHNAFD
                     RNNLKDENSLPPLRSLKLELPTNLPMQSINASFDMGSTLRNTPFPSNTGEGRQY"
     gene            <314173..>316068
                     /locus_tag="DEHA2F03476g"
                     /db_xref="GeneID:2903421"
     mRNA            <314173..>316068
                     /locus_tag="DEHA2F03476g"
                     /product="DEHA2F03476p"
                     /transcript_id="XM_460517.1"
                     /db_xref="GeneID:2903421"
     CDS             314173..316068
                     /locus_tag="DEHA2F03476g"
                     /note="weakly similar to uniprot|P38741 Saccharomyces
                     cerevisiae YHL024w RIM4"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03476p"
                     /protein_id="XP_460517.1"
                     /db_xref="GeneID:2903421"
                     /db_xref="GOA:Q6BMQ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ4"
                     /translation="MQKKQYIEDQRSISPVLESGSYKQNDGYMKGDEKNTLAMFNQLF
                     IDSNKLAADDENDNTDGEAGESSNGEEYEEEIIHLGDGDHHDDTAMVDGEKKIVDSEE
                     DCNDYEAETNGNEDGNTDENKENCDPNHGDMKLTNEKPLARGRPSSCVFVASLCSSRS
                     DDELCVSVTKHFGQWGKLSTVKVLRDPANRPYAFVQYTNDKDSRTAIYRGHNSILNGR
                     NLRCEAAKVNRTLFISSKFLKTEKGFKDALQEFGEIEQLIPSDEFGNVKSSKPHTKSS
                     KHWFCKYVYRDDAIRAFANLSENNLFHIEWAQNIETFSSNKNHNSYHNAVKQEENKMK
                     FDKFSVFVGQLNCSVTEEELIKRFKRHGKIEEVTIIKKTSNTFGFVKYKEESSAASAV
                     ERENHSMFKDKTMHVQYRELHSNTLKHSPKAQGVALAPPPINLKKRTTLGAKKTSDLR
                     KISPFNHHLYPMPIPIPTKKNFNSYTTNHSKQRNITNPYNTNSIGRRRYSKFGDVYDK
                     LKPEIKEDSPTPPESVQTYDSHTITKSGYSPSSAVNSERSEGNKNLKSTNKTKNVPYF
                     YYIPTNEVASGSNSGYYNPYQYFIPYEASPEFQSQNGYGVPFPMYYPPTNNDQEFNFE
                     DSFETPN"
     gene            <316263..>317672
                     /locus_tag="DEHA2F03498g"
                     /db_xref="GeneID:2903422"
     mRNA            <316263..>317672
                     /locus_tag="DEHA2F03498g"
                     /product="DEHA2F03498p"
                     /transcript_id="XM_460518.1"
                     /db_xref="GeneID:2903422"
     CDS             316263..317672
                     /locus_tag="DEHA2F03498g"
                     /note="weakly similar to uniprot|Q12468 Saccharomyces
                     cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03498p"
                     /protein_id="XP_460518.2"
                     /db_xref="GeneID:2903422"
                     /db_xref="GOA:Q6BMQ3"
                     /db_xref="InterPro:IPR000555"
                     /translation="MRCIHELADVFINDSDERILTQSLDATEIDKHADYESFFSINSD
                     ESIMKARPWKSNAKYFKKTYISSLALCKMSVHAKSGGAIEVMGMMTGKIIKNSIIVMD
                     VYPLPVEGTETRVNAQAEGYEYMVQYLENSKQVGRDENIVGWYHSHPGYGCWLSGIDV
                     ATQSLNQNFQDPYLAIVIDPMKTEDQGKVEIGAFRTFPDNYKSPDSAAPTNNTRGVPP
                     SKQKDFGVHSDKYYSLDIQIFKSNLDTEILNIISNKSWIGKLIKSVNTANHQEQNMIE
                     NVFKLINKLQKKEVNQLNRFEISFIKKFDLIFEDIISKKLMNDNRFYSTISQSSYDSF
                     SGHGNSSSNDEMDDESDLDDRDKSSAPLDISDTGNDDVMSMESSVNVYTDKRGDDNDD
                     DDDNDGYDKRPMYTNYRSRANLTKPRKSGSSPEEHVKLSNNVNKTITNISNHSKDIGL
                     TELQDLIALKTKESIFLGK"
     gene            <318210..>320303
                     /locus_tag="DEHA2F03520g"
                     /db_xref="GeneID:2903423"
     mRNA            <318210..>320303
                     /locus_tag="DEHA2F03520g"
                     /product="DEHA2F03520p"
                     /transcript_id="XM_460519.1"
                     /db_xref="GeneID:2903423"
     CDS             318210..320303
                     /locus_tag="DEHA2F03520g"
                     /note="similar to uniprot|P53874 Saccharomyces cerevisiae
                     YNL186W UBP10 Ubiquitin-specific protease that
                     deubiquitinates ubiquitin-protein moieties"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03520p"
                     /protein_id="XP_460519.2"
                     /db_xref="GeneID:2903423"
                     /db_xref="GOA:Q6BMQ2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ2"
                     /translation="MSGQANVLSNSVTPLIDRILANPLTFISGKQIESDNFEKPASYI
                     VLSKSSKKGDSSESSKASTQEKEPKSPEMRKPRSMAEAVAVYTGKKFLTKAEKKAAKK
                     RKVTQPLVDSEEEDVGEVIGGDIKMAESDSDSISDSQYESASEFQSDSNVELPFAEFK
                     SESDVKSSSESRSDSELKTESESKSDSESTSESPAGGEEDDEGNDDDDDDDNKDYSLE
                     DNESFSESDSGSASDVEDSSNDEEDLEALKHDLKQELQHDPRDISSKDPSLSGSDDDD
                     EEKEEENSDKNTTPPTSPEDEPEKPPATVNASDDLHVLPLNKFYSINEVSSDRGSNNS
                     TRIYKNWRELSKRKPVGLLNHGVTCYMNSAIQSLIHIPAVQHYLTDINSGKHNKTLKP
                     RSVSHVLAELSKRMWALDDNTSKAKQPKYVNPKRIIQRLDDINCMMSEWQQEDSHEYF
                     MSLMSRLQEDSTPKGVKLNQSIIYDIFGGLLHQSVTCKNCNYVSDTKQEFYDLSLGLN
                     RKKNKDVTENSGPQRYTIEKSIQEFFSSELIKLDRKDKSSGYDCENCKQKSNACKIST
                     IDRSPETLTVHLKRFKFNGNSSSKVKQSISYPNYLDLTKFTTLKTPTKYQLVSVIVHE
                     GRSISSGHYIAHCLQPDGTWSTYDDEYINKINEKEALSDPSAYVLVYTKLTPRLMKRS
                     NEGNDNLVNAKKLKR"
     gene            complement(<320662..>321300)
                     /locus_tag="DEHA2F03542g"
                     /db_xref="GeneID:2903424"
     mRNA            complement(<320662..>321300)
                     /locus_tag="DEHA2F03542g"
                     /product="DEHA2F03542p"
                     /transcript_id="XM_460520.1"
                     /db_xref="GeneID:2903424"
     CDS             complement(320662..321300)
                     /locus_tag="DEHA2F03542g"
                     /note="weakly similar to uniprot|P38191 Saccharomyces
                     cerevisiae YBL049W MOH1 Protein of unknown function has
                     homology to kinase Snf7p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03542p"
                     /protein_id="XP_460520.2"
                     /db_xref="GeneID:2903424"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ1"
                     /translation="MGLKYTNFFENSSYESSDTQIVICKNCSSHLCLSNLILSDNFRG
                     STGPAYLVDKLINYQSENGSQETRMLTGNYLINKVKCHQCSNQLGWTYKKAFSYSETY
                     KEGKFVIEKDYIKLIPNNFSTASLVEKAKLNNSRRRSSGSSSSSVDYNTTSDDLFKFN
                     SVDPTKEKMEESVGDSSINFRDNDGVSILGRLRFQGIDKEEFDEDQDVFVDV"
     gene            complement(<321897..>322763)
                     /locus_tag="DEHA2F03564g"
                     /db_xref="GeneID:2903425"
     mRNA            complement(<321897..>322763)
                     /locus_tag="DEHA2F03564g"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_460521.1"
                     /db_xref="GeneID:2903425"
     CDS             complement(321897..322763)
                     /locus_tag="DEHA2F03564g"
                     /note="similar to uniprot|P53881 Saccharomyces cerevisiae
                     YNL177c MRPL22 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_460521.1"
                     /db_xref="GeneID:2903425"
                     /db_xref="GOA:Q6BMQ0"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:Q6BMQ0"
                     /translation="MFNRLGLLQRAVGVQPARIQTSLLRSVKQFHTTKYLQNGNVFGE
                     LTKGKESDEAEIEKQNNIDASQITPATDSTLQEYYLEEAKKSQLTSDKYITPLKRKLF
                     QLNVQQNGFFMNNEIFKDPETGKVYKLALTEEEIDILEPSIYLQSYRIKSSMKKATQV
                     NRFVRGYKVKNAINQLHFNPKKMSTELEKLLKKGLEQARESNYNEDELYIQALWVGSD
                     GSWRKRLDAKGRGRTGIIEHPHIHLKAILRTDQTANRLKWEKHQKQLNQKPRMFLNNE
                     PLNFRVHPFYRW"
     gene            complement(<323850..>324503)
                     /locus_tag="DEHA2F03586g"
                     /db_xref="GeneID:2903427"
     mRNA            complement(<323850..>324503)
                     /locus_tag="DEHA2F03586g"
                     /product="DEHA2F03586p"
                     /transcript_id="XM_460522.1"
                     /db_xref="GeneID:2903427"
     CDS             complement(323850..324503)
                     /locus_tag="DEHA2F03586g"
                     /note="weakly similar to uniprot|Q02774 Saccharomyces
                     cerevisiae YDL212W SHR3 Endoplasmic reticulum packaging
                     chaperone required for incorporation of amino acid
                     permeases into COPII coated vesicles for transport to the
                     cell surface and similar to CA0700|CaSHR3 Candida albicans
                     CaSHR3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03586p"
                     /protein_id="XP_460522.1"
                     /db_xref="GeneID:2903427"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP9"
                     /translation="MAYKDIVPVGSGLIIGATSFGLGVLYANLPYDVNTLWRQDETGT
                     AFITSLAHYSVWGNSPAYVHHIFHSVIGLGFIGAFIKLYKPSEDAKYFEYGSLFLYMV
                     GVIIYLTNLRIGVNSCLAGDWGEVDMPTGINVMAASQVMIGFALFGVLLLQGGLYYAE
                     WYDNRLKVKFFEEEERAALAAASAKTDNLAESEVVGSKGASASGASASSTKAKKKSK"
     gene            <325442..>326089
                     /locus_tag="DEHA2F03608g"
                     /db_xref="GeneID:2903428"
     mRNA            <325442..>326089
                     /locus_tag="DEHA2F03608g"
                     /product="DEHA2F03608p"
                     /transcript_id="XM_460523.1"
                     /db_xref="GeneID:2903428"
     CDS             325442..326089
                     /locus_tag="DEHA2F03608g"
                     /note="similar to uniprot|P19073 Saccharomyces cerevisiae
                     YLR229C CDC42 Small rho-like GTPase essential for
                     establishment and maintenance of cell polarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03608p"
                     /protein_id="XP_460523.2"
                     /db_xref="GeneID:2903428"
                     /db_xref="GOA:Q6BMP8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP8"
                     /translation="MRSIKSVVIGDGGVGKTCLLISYTTNTFPNDYIPTVFDNYSATA
                     MFNGEPIKLGLWDTAGQAEYDRLRPLSYPQTEIFLCCFSIVSPESLENVKAKWIPEIL
                     HHSPKDILVLLVGTKADLRDDLSVLDKLDDGNQKPTTAAQGERLAKELGLVGYKECSA
                     ATQMGVKEVFDFAIKSVVSPPEGNQGRNGGTNNAATNMRNSQARKVKKAKKCTIL"
     gene            complement(<326445..>327053)
                     /locus_tag="DEHA2F03630g"
                     /db_xref="GeneID:2903429"
     mRNA            complement(<326445..>327053)
                     /locus_tag="DEHA2F03630g"
                     /product="DEHA2F03630p"
                     /transcript_id="XM_460524.1"
                     /db_xref="GeneID:2903429"
     CDS             complement(326445..327053)
                     /locus_tag="DEHA2F03630g"
                     /note="similar to uniprot|Q07623 Saccharomyces cerevisiae
                     YDL213c and highly similar to CA3006|IPF12152 Candida
                     albicans IPF12152 Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03630p"
                     /protein_id="XP_460524.1"
                     /db_xref="GeneID:2903429"
                     /db_xref="GOA:Q6BMP7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP7"
                     /translation="MSDTAKLTKKQKKALDFRQKKSKDSTEEDTSANTEKDNKKRAAD
                     AEGTSETGEEPKKKRKTRRGKKGKGVNEGKGPRFILFVGNLPYNVTQPELVSHFKNSN
                     PDRIRLRQDKGIAFMEFDNDSREIQSKMELALRMHHSTLRNRKINVELTVGGGGNSDN
                     RVNKLKEKNEKLEDERRSRVTKDGKKGEVPEGVHPSRAALLS"
     gene            <327236..>327769
                     /locus_tag="DEHA2F03652g"
                     /db_xref="GeneID:2903430"
     mRNA            <327236..>327769
                     /locus_tag="DEHA2F03652g"
                     /product="DEHA2F03652p"
                     /transcript_id="XM_460525.1"
                     /db_xref="GeneID:2903430"
     CDS             327236..327769
                     /locus_tag="DEHA2F03652g"
                     /note="some similarities with uniprot|Q871R2 Neurospora
                     crassa 7F4 Hypothetical protein 7F4.280"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03652p"
                     /protein_id="XP_460525.2"
                     /db_xref="GeneID:2903430"
                     /db_xref="InterPro:IPR013957"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP6"
                     /translation="MVLSNKNKIKINLKQTPKFDASRSRSRSPHISSESLTSNSQGSD
                     QKDQNYRDRSQERSIDKMQKSDLYKKDNTSLQDLPLSNSSFNNKIKLPEHKQEQDSRG
                     RQRERNDEDHINMESPVEAQDDDMISLMGFGGFGTTKGKHVKGTKGGNTKKEAKSEYR
                     TYMNRSKGFNRPLSPTR"
     gene            complement(<327815..>329362)
                     /locus_tag="DEHA2F03674g"
                     /db_xref="GeneID:2903431"
     mRNA            complement(<327815..>329362)
                     /locus_tag="DEHA2F03674g"
                     /product="DEHA2F03674p"
                     /transcript_id="XM_460526.1"
                     /db_xref="GeneID:2903431"
     CDS             complement(327815..329362)
                     /locus_tag="DEHA2F03674g"
                     /note="similar to uniprot|P53877 Saccharomyces cerevisiae
                     YNL182C IPI3 Protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03674p"
                     /protein_id="XP_460526.2"
                     /db_xref="GeneID:2903431"
                     /db_xref="GOA:Q6BMP5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MDESVFYISEGDPADKHSQESFGHSSSVHSSQQHAGFRQADCPQ
                     NGACLSGVGTGERLFVASPNKALINVYSWGKESPDQRIPIPEQLSCLTLCKHPRIKVS
                     EGRQSDERNLPSFRTPWLLAGGSKTGKIYVWELASGNLLCVKEAHYQAITAIKFSQCG
                     TFLVSGSSDARCMVWRTSDLISVYNKDEESSINIKPFASFTDHSLPITDLAISEAGII
                     SDLRLYTVSRDSTLRIYDIMTKSLLTTFVLPSGIECVTKDPANRACYVGLSNGLIRTV
                     PLYQINPNTSVLESIGGRGKIVTLDTDPNLLSTFVHHQQRLSTEPLHKTLNKKTTTEE
                     KPILVTRLSITMDGSNLISGDSAGRVYVSDIVSRQVVKTFAPCKSSISYIQVNACAAE
                     KVSVSNTSSNNNDKRHRLIPQFKRVLANPDPLEHQLYMEIPKQQEDEEDFESWLARKS
                     QEELEFRNLTHINSSVTVTGAAPTTNDSTVKELEEKLAKVSKAYTDLRGKHEELYEEH
                     NRLLSDS"
     gene            <329553..>330968
                     /locus_tag="DEHA2F03696g"
                     /db_xref="GeneID:2903432"
     mRNA            <329553..>330968
                     /locus_tag="DEHA2F03696g"
                     /product="DEHA2F03696p"
                     /transcript_id="XM_460527.1"
                     /db_xref="GeneID:2903432"
     CDS             329553..330968
                     /locus_tag="DEHA2F03696g"
                     /note="similar to uniprot|P53878 Saccharomyces cerevisiae
                     YNL181w protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03696p"
                     /protein_id="XP_460527.2"
                     /db_xref="GeneID:2903432"
                     /db_xref="GOA:Q6BMP4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP4"
                     /translation="MPIDILGTAIYEGPEAIPGWEYIKTYTPAIMALAGIKYYFGGTS
                     NTWERDYHGKVYIMTGATSGLGANLAYELASKGAQLILLVRSTEDSWLVDYIEDLRER
                     TDNFMIYAEECDLNSLYSIRKFATKWLDNQPPRRLDGVICCAAESIPIGKARQVTVDG
                     VEKQMGINYLAHFHLLTLLSPALKIQLPDRDVRIVMATCVSQALGDLDMKDALWLNRR
                     YPTREPWKLYGTSKLMLTMFAKEFQRRLNSFERKDKAPCNVRVNMVNPGIMRTPSTRR
                     FLSMGAIWGLLVYFVLFPIFWIFFKSTTQGAQSFLYALAAPVFKNLDGGNVIQECKIL
                     KPARKELSDEDLQKALYDETEKLLEALEKSSAIERKRQEKIQESKMPLADKLRAQNEE
                     SRKKADIHTKPESPEELQAKLASLKRSIGIPSDANDELPLFPSQPNSSQSESRAENLS
                     TTKSTPKSKSKAKKSKSKKID"
     gene            <331402..>333918
                     /locus_tag="DEHA2F03718g"
                     /db_xref="GeneID:2903433"
     mRNA            <331402..>333918
                     /locus_tag="DEHA2F03718g"
                     /product="DEHA2F03718p"
                     /transcript_id="XM_460528.1"
                     /db_xref="GeneID:2903433"
     CDS             331402..333918
                     /locus_tag="DEHA2F03718g"
                     /note="similar to uniprot|P22211 Saccharomyces cerevisiae
                     YNL183C NPR1 Protein kinase that stabilizes several plasma
                     membrane amino acid transporters by antagonizing their
                     ubiquitin-mediated degradation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03718p"
                     /protein_id="XP_460528.2"
                     /db_xref="GeneID:2903433"
                     /db_xref="GOA:Q6BMP3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP3"
                     /translation="MNLETPNRKANGGKLPISSLTRLLNESSSNNTTPILSKNHSQTS
                     LDSTSETITPSHQNHDILEGNGHRPDLGSEDVDAITGGVGGFSMDENYDDGSLDVAQP
                     QVINGFDPSIDIVPEDSFLVPESPRTQGGRNSGNTAFQYRDVPIKPPTVASPRTKRTG
                     SVSHSSFLNTGGYGGESMSSSIPYSAPGGRSHLSSSFTNLNGLGTNSSANQSSSFSSE
                     APITHDNSHIPNLPNGQPISSIHIQSPQVNSSSIEPRFVISKQRVAQAQAQASLSTSN
                     KSSSQSGLSYFFSSKNKGPNKKPSSSTDLGSFYNNAYQDYNNSVVLSSPSSISSNESI
                     SSNAFPAPSRHNSMANLKRFFKKSTPTNPAPASSLSSSLRSNGSDRNSIPVNSDFNTT
                     MSSSFQPGSYGQSLTESSSNASYSQSPNTGLTIGSSSVSRSSSVLQNKMNYQRERRGS
                     VSVLINPQQQLPFSKRYGKLGDNLGAGAGGAVKLVNRLSDKQVFAVKEFRAKYQNETK
                     RDYAKKITGEYCIGSTLKHPNIIETIEICYENERILQVMEYCDFDLFAIVMSNKMSRE
                     EINCCFKQILSAINYLHSMGLAHRDLKLDNCVIDNRGIVKIIDFGSAVVFSYPFTKTL
                     IEAQGIVGSDPYLAPEVCVFNKYDPRPVDVWSAAIIYCCMILKKFPWKVPKLSDNSFK
                     LFASRGEMIPLSEMLKKTPEQSSNDLNERGDELDISEMNPISISKSESSNPQSLNSQG
                     KPHTSSESGAGRLLLALPEDCRPLIGKMVELPPACRISIEECFNDDWLTSIDMCYVEQ
                     TLTSDGSTNFEVVPCDNHDHTQVDQSKAHIAAFDKTKKKQ"
     gene            complement(<334136..>334567)
                     /locus_tag="DEHA2F03740g"
                     /db_xref="GeneID:2903434"
     mRNA            complement(<334136..>334567)
                     /locus_tag="DEHA2F03740g"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_460529.1"
                     /db_xref="GeneID:2903434"
     CDS             complement(334136..334567)
                     /locus_tag="DEHA2F03740g"
                     /note="highly similar to uniprot|P53875 Saccharomyces
                     cerevisiae YNL185c MRPL19 ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_460529.2"
                     /db_xref="GeneID:2903434"
                     /db_xref="GOA:Q6BMP2"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP2"
                     /translation="MSAKNVMVKLIVGAGQAAPAPPVGPALGSKGVKAIDFCKEFNAR
                     TGNYQPGIPIPCLLTIKPDRSFTFEMKSPPTSWLLLKAAQAKKGSDKPTHNIVGEVSL
                     KHVYEIAKIKKTDDRHKEVDLQAICGAVISTAEAVGVKIVP"
     gene            complement(<334843..>336489)
                     /locus_tag="DEHA2F03762g"
                     /db_xref="GeneID:2903435"
     mRNA            complement(<334843..>336489)
                     /locus_tag="DEHA2F03762g"
                     /product="DEHA2F03762p"
                     /transcript_id="XM_460530.2"
                     /db_xref="GeneID:2903435"
     CDS             complement(334843..336489)
                     /locus_tag="DEHA2F03762g"
                     /note="some similarities with uniprot|P53214 Saccharomyces
                     cerevisiae YGR023w MTL1 and similar to CA0076|IPF8866
                     Candida albicans IPF8866 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03762p"
                     /protein_id="XP_460530.2"
                     /db_xref="GeneID:2903435"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP1"
                     /translation="MTYVESMMGNVRDIFRRADEDTGNGGGLQDDGGFNATSSSSSSR
                     GPTSSSGDDGPTGGSSLTSDNSETIGPTSDGSETVSETSGPTSGPASATSSDITSESS
                     SENSSSSSSSSDTSSSDTSSSETSRSSSSRSSSSSSVSSSSVRSSSSRSSSRSLSSSN
                     NPSSSSFISSSSSSSASPSSSFLTSSSIPFSSSESSSSHSSSQERSSSSVTLSSSSSS
                     PSSTPSQASSTSHSESSTRASSSRSSSRSSSRSSSSHTQSSSSPSSSSDRTSSDRTSS
                     DRTSSSHVTPTSSSSFSSYYTTIEDSGTTITSLVTVPTSAANDQTDTPSSTSEKNAKL
                     IGGLVGSIGGTIVIGLLVALFLFLKKRKKVTNQSPDFNDNTSGDSDSYKDKSGFKKLF
                     SSKNTNTYGGVAGVTDIERQNNTPVIQADDESNEESDDFVYRGVTNNNNLDSIFRSTA
                     SNSSGQNTAAGGSANQSANHTRMNSIGHALDIPYETRESEEHDPFASHTRINSDGTDN
                     FSPSDYDIDQNDLVPADRSNIFGEESHSNNSRSRFHEEII"
     gene            complement(<337144..>338682)
                     /locus_tag="DEHA2F03784g"
                     /db_xref="GeneID:2903436"
     mRNA            complement(<337144..>338682)
                     /locus_tag="DEHA2F03784g"
                     /product="DEHA2F03784p"
                     /transcript_id="XM_460531.1"
                     /db_xref="GeneID:2903436"
     CDS             complement(337144..338682)
                     /locus_tag="DEHA2F03784g"
                     /note="weakly similar to uniprot|Q12523 Saccharomyces
                     cerevisiae YPL247c and similar to CA3884|IPF6367 Candida
                     albicans IPF6367 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03784p"
                     /protein_id="XP_460531.2"
                     /db_xref="GeneID:2903436"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6BMP0"
                     /translation="MEWQNPTKYKRSSVSMGMPYSQGGYGLSYTSPQQQQRTQFYSGR
                     HALLPPSSNGNNRGLANEGGSGVLDRHSYYFSPDPLYCSDWTYLNGGEMDCIALSSYK
                     EGFSNKISVVHGVGYGREATCAGNGDMDDDDVTMGSPTSSAYQDDAIEGFDFHKVAEV
                     SVDYPVTNLQWDPSMLRMGNGVSERLGASSEVLRLYKVDHEALDKNSDYKLTQTHILA
                     NNTATASSSTSSSAQSNTGASGSASEDMNTFPPVTSFDWNKVDPNLIITSSVDTTCTV
                     WDLNRSSLTADPSSDSGAATDTATVKTQLIAHDSEVFDVKFIHNSTNVFASVGNDGSM
                     RVFDLRSLEHSTIIYEPSHPPTSASTLTTPHHNSRALLKLSASNIDQNYLATIGVNSN
                     QVIIIDMRMPGLPVAALDGSLGGANTAAINSIQWHPSSNYLLTGGDDCQALVWDCNNI
                     RHPGAPKTPSSASSHPPEFTSLVESPVLAYSDDLEVNNVCWRRDQGDWMGVVSGKGFQ
                     AVSI"
     gene            complement(<338944..>342051)
                     /locus_tag="DEHA2F03806g"
                     /db_xref="GeneID:2903437"
     mRNA            complement(<338944..>342051)
                     /locus_tag="DEHA2F03806g"
                     /product="DEHA2F03806p"
                     /transcript_id="XM_460532.1"
                     /db_xref="GeneID:2903437"
     CDS             complement(338944..342051)
                     /locus_tag="DEHA2F03806g"
                     /note="similar to uniprot|P49095 Saccharomyces cerevisiae
                     YMR189W GCV2 P subunit of the mitochondrial glycine
                     decarboxylase complex required for the catabolism of
                     glycine to 5 10-methylene-THF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03806p"
                     /protein_id="XP_460532.2"
                     /db_xref="GeneID:2903437"
                     /db_xref="GOA:Q6BMN9"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN9"
                     /translation="MISRVVARSARANRLSTLTRSVPRAYNLNLKLAASNRFLASKAD
                     TSSADYEKVYDPSAKTVSLGNLDTFARRHLGPTPENVKTMLSALGYKDLDEFLSKAIP
                     EHVLYKRALQIQPQQGFTESEMLEHLHNLANKNKIVKSFIGKGYAGTKVPPVIQRNLL
                     ESPEWYTSYTPYQPEISQGRLESLLNYQTMVTSLTGLNMANASLLDEGTAAGEAMSLS
                     FHSLKGKRGKYAVDTNLHPQTLDVMKSRAENIGVEIVELPLSTQEGLEELERIASDSC
                     GALVQYPGTDGSLNNYTKVGEIVHAHKGLFAMATDLLALTLIKSPAEFNADIALGTSQ
                     RFGVPFGYGGPHAAFFATNMKYSRKIPGRIVGLSKDRLGKPALRLALQTREQHIKREK
                     ATSNICTAQALLANMAAMYAVYHGPKGLKDIASRVYGYTTVLANEISNNSQHEIVNDK
                     WFDTLTVKLGGGVKSDEILNKALNEYNINLFKAGEDKVSLCLDETVEEKDLIALVDVF
                     TGNDSFSTSSISELPKLPTELLRTDEILAHPVFNTHRSETSMLRYLHLLQSRDLSLAN
                     SMIPLGSCTMKLNATVEMQTLSMPGFNQIHPFAPLNQAQGYKELVDEFEKDLNDITGF
                     DATTNMPNSGAQGEYTGLSLIRQYHKSKGEYEQRNICLIPVSAHGTNPASAAMCGLKV
                     VPVKCLNNGSIDVDDLKVKAEKHAENLCSIMITYPSTYGLFEPGIKTAIDLVHNNGGL
                     VYLDGANMNAQVGLTSPGDLGADVCHLNIHKTFALSHGGGGPGQAPVCVKEHLKPFLP
                     KHHFLDTPHSTNESIQAVNSAPYGSASVIPVSYSYIKMLGAKALPHVSSIAMLNANYM
                     LEKLKDDYQIMFVDHSASTDEGLKHCAHEFILDLREFKAVGVEAIDVAKRLQDYGFHA
                     PTMSFPVAGTLMIEPTESENLEELDRFINSLLSIRKEINAMANKEPLGQVLKNAPHSL
                     NDIVSTSQADWEARGYTREQAAYPLPFLKESKCWPSVSRVDDTYGDMNLMCTCPSVEE
                     VAADQ"
     gene            complement(<342728..>344104)
                     /locus_tag="DEHA2F03828g"
                     /db_xref="GeneID:2903438"
     mRNA            complement(<342728..>344104)
                     /locus_tag="DEHA2F03828g"
                     /product="DEHA2F03828p"
                     /transcript_id="XM_460533.1"
                     /db_xref="GeneID:2903438"
     CDS             complement(342728..344104)
                     /locus_tag="DEHA2F03828g"
                     /note="highly similar to uniprot|P02994 Saccharomyces
                     cerevisiae YPR080w TEF1 translation elongation factor eEF1
                     alpha-A chain and highly similar to uniprot|P02994
                     Saccharomyces cerevisiae YBR118W TEF2 translation
                     elongation factor eEF1 alpha-A chain"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03828p"
                     /protein_id="XP_460533.1"
                     /db_xref="GeneID:2903438"
                     /db_xref="GOA:Q6BMN8"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN8"
                     /translation="MGKEKTHVNLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKFHVTIIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGIGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSVKW
                     DKNRYDEIVKECSNFVKKVGFNPKSVPFVPISGWNGDNMIEASPNCPWYKGWEKETKA
                     GKSSGKTLLEAIDAIEPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVV
                     TFAPAGVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDTPKG
                     CDSFAAQVIVLNHPGQISSGYSPVLDCHTAHIACKFDTLIEKIDRRTGKKLEDNPKFI
                     KSGDAAIVKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAGKVTK
                     AAQKAAKK"
     gene            complement(<345117..>346769)
                     /locus_tag="DEHA2F03850g"
                     /db_xref="GeneID:2903439"
     mRNA            complement(<345117..>346769)
                     /locus_tag="DEHA2F03850g"
                     /product="DEHA2F03850p"
                     /transcript_id="XM_460534.1"
                     /db_xref="GeneID:2903439"
     CDS             complement(345117..346769)
                     /locus_tag="DEHA2F03850g"
                     /note="similar to uniprot|P53172 Saccharomyces cerevisiae
                     YGL056C SDS23 Spindle pole body protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03850p"
                     /protein_id="XP_460534.2"
                     /db_xref="GeneID:2903439"
                     /db_xref="GOA:Q6BMN7"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /translation="MSNSFSFQRQNPGSPLQQHSPIHNINTGGNSNSVSNQSNNHPQT
                     PGHHVPSRKPSIVEMLSSPPPLPNTPDQEDIHSFSLSRNTSVSSRASSIYGNVNGGTS
                     KGSIVGVDWAEIPLVELTESNKLVSINSGFSVQKAFETLMEHNLTSVPVSLSKTDSTD
                     LTNCLTFDYSDVNTYLLLIMNKINLNDLSIYEGGDDVLSNQQKDSITKSINKAKKGEE
                     VPVDFIVKLHPKNPFVKFSEQDTLYKAMESLGNGVHRVAITNMNGTKITGILSQRRLI
                     KYMWENARRFPSLDFYINSTLQDLKIGSNNPITIYEDQLLIEALLKMFTERVTSLAVV
                     DKTMALIGNISIVDVKNVTSSKNSHLLFKSVLGFIGYNLTQKGIEEGQDQFPIFHVNN
                     QSSLGRVIAKLVATKSHRLWVVENRGSVHHGSVSSTSSSNSNSNSKSVTQSPKASPST
                     IESTLNQSVSTPSNVQNIPPGSEPGGLPGKLVGVVTLTDILGLFASSKSNKKIDPQFA
                     RNQRRRSSTSTTRSSFEGSSAGQDLFRKSYTTSAPAKTEGKR"
     gene            <348314..>349768
                     /locus_tag="DEHA2F03872g"
                     /db_xref="GeneID:2903440"
     mRNA            <348314..>349768
                     /locus_tag="DEHA2F03872g"
                     /product="DEHA2F03872p"
                     /transcript_id="XM_460535.1"
                     /db_xref="GeneID:2903440"
     CDS             348314..349768
                     /locus_tag="DEHA2F03872g"
                     /note="similar to uniprot|P21147 Saccharomyces cerevisiae
                     YGL055W OLE1 Fatty acid desaturase required for
                     monounsaturated fatty acid synthesis and for normal
                     distribution of mitochondria and highly similar to
                     CA3921|CaOLE1 Candida albicans CaOLE1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03872p"
                     /protein_id="XP_460535.2"
                     /db_xref="GeneID:2903440"
                     /db_xref="GOA:Q6BMN6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN6"
                     /translation="MSDKVEVADVTSLNALAAGTNKKNPRVVAAGLGGRLMGTKSLVD
                     VTADEITKDSESSLAEKDRKDKEKWTKMTHISDQPWTWSNWSEHINWLNLILVVLVPT
                     VGFVCALRHPPQLKTAVMGVILYILSGLSITAGYHRLYSHKAYDAAVPVKIFFALFGA
                     GAVEGSIKWWGHSHRVHHRYTDTARDPYDARQGLWYSHMGWLLIKANPKNRARADISD
                     LTGDWVVNFQHRHYLVIMIFMALVLPTLIAGLGWGDYWGGFVYGGIIRSFFIQQATFA
                     INSLAHWIGSQPFDDRRTPRDNVITALVTFGEGYHNFHHEFPSDYRNALIWYQYDPTK
                     ITIWVLSKLGLAWGLKTFSQNAIEQGLIQQQQKKLDRMKSKLEWGTMLNELPLMDKEE
                     FTARAKKDGLILISGIVHDVKQFIKQHPGGQALIRVSLGKDATKAFNGMVYAHSNAAH
                     NMLANMRIAILKDHAVNGNTFDLQQEFLDKEKVN"
     gene            <350988..>351571
                     /locus_tag="DEHA2F03894g"
                     /db_xref="GeneID:8998868"
     mRNA            join(<350988..351098,351161..351223,351278..>351571)
                     /locus_tag="DEHA2F03894g"
                     /product="DEHA2F03894p"
                     /transcript_id="XM_002770688.1"
                     /db_xref="GeneID:8998868"
     CDS             join(350988..351098,351161..351223,351278..351571)
                     /locus_tag="DEHA2F03894g"
                     /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
                     YOR357C GRD19 Sorting nexin required to maintain
                     late-Golgi resident enzymes in their proper location by
                     recycling molecules from the prevacuolar compartment"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03894p"
                     /protein_id="XP_002770734.1"
                     /db_xref="GeneID:8998868"
                     /db_xref="GOA:B5RU87"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:B5RU87"
                     /translation="MSKPFQSINDVINTTSKHKQQSFNELYGEPENFLEIEVRNPQTH
                     YGKELFTDYEIICRTNIPAFKKRNSRVRRRYSDFVIFRKLLEQETTRVIIPPLPGKIL
                     LNSNKFNDLNIEKRRQGLEKFISIVSGHPLLQTGSKTLIEFIQSDKWEPRGYY"
     gene            <353110..>353343
                     /locus_tag="DEHA2F03916g"
                     /db_xref="GeneID:2903187"
     mRNA            <353110..>353343
                     /locus_tag="DEHA2F03916g"
                     /product="DEHA2F03916p"
                     /transcript_id="XM_460536.1"
                     /db_xref="GeneID:2903187"
     CDS             353110..353343
                     /locus_tag="DEHA2F03916g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03916p"
                     /protein_id="XP_460536.1"
                     /db_xref="GeneID:2903187"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN5"
                     /translation="MQCLHISLVICTSLRINTLLHYVREYMEPKSAILKFPNTLCSLK
                     RDFLSPKQIVGFQALARFSMTKHIDHFYFMVFM"
     gene            <353823..>354863
                     /locus_tag="DEHA2F03938g"
                     /db_xref="GeneID:2903188"
     mRNA            <353823..>354863
                     /locus_tag="DEHA2F03938g"
                     /product="DEHA2F03938p"
                     /transcript_id="XM_460537.1"
                     /db_xref="GeneID:2903188"
     CDS             353823..354863
                     /locus_tag="DEHA2F03938g"
                     /note="similar to uniprot|P00331 Saccharomyces cerevisiae
                     YMR303C ADH2 Glucose-repressible alcohol dehydrogenase II
                     involved in the production of certain carboxylate esters"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03938p"
                     /protein_id="XP_460537.2"
                     /db_xref="GeneID:2903188"
                     /db_xref="GOA:Q6BMN4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN4"
                     /translation="MSIPKTQKAIIFETSGGELKYADIAVPKPKPNEILINVKFSGVC
                     HTDLHAWKGDWPLPTKLPLVGGHEGAGEVVAIGENVQGWEIGDLAGIKWINGTCLNCE
                     FCQNSNESNCAKADMSGYTHDGTFQQYATADAVHAARIPKGTDLASVSPILCAGITVY
                     KALKTSGAKPGQWVAISGAAGGLGSLALQYAKAMGFRVLAVDGGDKGEFVKSLGAESY
                     VDFTKSKDVVKEISETTGGGPHAVINVSVSVAAMNQSTEYVRSCGTVVLVGLPHAKLE
                     AGIFNTVVKCVSIKGSYVGNRADSAEAIDFFARGLIKCPIKVVGLSELASIYKLMEEG
                     KILGRYVVDTSK"
     gene            complement(<355158..>357194)
                     /locus_tag="DEHA2F03960g"
                     /db_xref="GeneID:2903189"
     mRNA            complement(<355158..>357194)
                     /locus_tag="DEHA2F03960g"
                     /product="DEHA2F03960p"
                     /transcript_id="XM_460538.1"
                     /db_xref="GeneID:2903189"
     CDS             complement(355158..357194)
                     /locus_tag="DEHA2F03960g"
                     /note="highly similar to uniprot|P23254 Saccharomyces
                     cerevisiae YPR074C TKL1 Transketolase 1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03960p"
                     /protein_id="XP_460538.1"
                     /db_xref="GeneID:2903189"
                     /db_xref="GOA:Q6BMN3"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN3"
                     /translation="MSQDLDQLAISTIRLLSVDSVDKAQSGHPGAPLGLAPAAHAVWQ
                     KMKFNPKDTNWINRDRFILSNGHACALLYSLLVLYGYDLTVEDLKQFRQLNSKTPGHP
                     EALDVPGCEVTTGPLGQGISNAVGLAMAQKQFGATYNKPDHKISDSYTYAFLGDGCLM
                     EGVASETCSLAGHLQLNNLIAFWDDNHISIDGNTNVAFTEDVMLRFKAYGWHLIEIAE
                     GDTDLDAIAKAIDEAKKVEDKPTLIRLTTTIGFGSLAQGTHGVHGAPLKADDIKQLKE
                     SMGFNPEETFVIPKEVTDYLKKHVEENQKVQEDWKKLFESYKQKYPELGAELQRRLDG
                     KLPENWSDALPTYSPSDSAVATRKLSETVLTKILPVIPEIIGGSADLTGSNLTRAAGS
                     VDFQPPATGLGDYSGRYIRYGVREHGMGAIMNGIAAFGANYKNYGGTFLNFVSYGAGA
                     VRLSALSHHPVIWVATHDSIGLGEDGPTHQPIETLAHLRAIPNLSVWRPADGNETSAA
                     YLQAIESTSTPSIIALTRQNLPQLEGSSIEKAAKGGYTLVKQDKPDVIIVSSGSEVSI
                     SADAAKKLESEGFKAGVVSMPDFLTFDKQPLDYRLSVLPDGVPIMSVEVMSSFGWSKY
                     SHEQFGLNRFGASGKGPEIYKFFEFTPEGVADRAAKTIQFYKGKPLLSPLNRAF"
     gene            complement(<357848..>359272)
                     /locus_tag="DEHA2F03982g"
                     /db_xref="GeneID:2903190"
     mRNA            complement(<357848..>359272)
                     /locus_tag="DEHA2F03982g"
                     /product="DEHA2F03982p"
                     /transcript_id="XM_460539.1"
                     /db_xref="GeneID:2903190"
     CDS             complement(357848..359272)
                     /locus_tag="DEHA2F03982g"
                     /note="some similarities with uniprot|Q06810 Saccharomyces
                     cerevisiae YPR075C OPY2 Protein of unknown function
                     overproduction blocks cell cycle arrest in the presence of
                     mating pheromone and similar to CA3925|IPF13257 Candida
                     albicans IPF13257 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F03982p"
                     /protein_id="XP_460539.2"
                     /db_xref="GeneID:2903190"
                     /db_xref="InterPro:IPR018571"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN2"
                     /translation="MTVIPYSIFEKRTKCVDCPSKPKNSCPKCESGKECVLAHQTCDT
                     CAYYKCTRIDGDSTKSKPVGGIIGGSIGGFVLILMVVGILYYKFVYRKKHPVLLEDDD
                     DILMSGIESESDRKSDYTISNLDSYQGDPNMAPLGGLTRNGSTQEKTGTRPAAANKRI
                     SSYESFTRPKTKYNKNTRRTGGRGGARARTRVGAYSDNNSSRHSVATTMSTTNASNIL
                     PIAYIPGVTVRPTKNNTRSIYSYETESVFSDLNTIENASIIGDVMRANQLQDANAGQA
                     DANANGSTNKDSTMTAIKAHPKLINVDRIEEEDEDDITDEDDDTYADTYDDSSVAYEA
                     QQDATNTTNMRDSQTSIPQENPVDMSSEEHHYINVNADDDADSDSDVDSDIGEITRAT
                     SVKRPAESIPQSREVLLDVTGGPNSTSSITVDTHHEAVELSQLGRPTGPLHQYNETDS
                     PTNTSAGSFILDVEFEDSRPFSDP"
     gene            complement(<359634..>361454)
                     /locus_tag="DEHA2F04004g"
                     /db_xref="GeneID:2903191"
     mRNA            complement(<359634..>361454)
                     /locus_tag="DEHA2F04004g"
                     /product="DEHA2F04004p"
                     /transcript_id="XM_460540.1"
                     /db_xref="GeneID:2903191"
     CDS             complement(359634..361454)
                     /locus_tag="DEHA2F04004g"
                     /note="weakly similar to uniprot|Q12514 Saccharomyces
                     cerevisiae YPR072W NOT5 Subunit of the CCR4-NOT complex
                     which is a global transcriptional regulator with roles in
                     transcription initiation and elongation and in mRNA
                     degradation and similar to CA3926|IPF16198 Candida
                     albicans IPF16198"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04004p"
                     /protein_id="XP_460540.2"
                     /db_xref="GeneID:2903191"
                     /db_xref="GOA:Q6BMN1"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:Q6BMN1"
                     /translation="MSTRKLQQEFDKTNKKIAEGLTVFDDIYDKLMTTEISSQKEKLE
                     SDLKKEIKKLQRSRDQLKTWISDTSIKLDKSLIQDNRTKIEHAMDQFKDLEKSSKIKQ
                     FSNEGLELQSQKTKYNKFTDPEDAKKQEACNYIGDIIDQLNQQNESLESEIHSLATQL
                     KKTKSANSYSVQSSIDDCKYNVERNNNHLSKLEMILRNIENENLDPERVDDIKDDLEY
                     YVETNQEDDYVEYDDFYDQLEMSEENDILGSGQDANEDNEENKAEVKEGPKEEPKDGP
                     KEEPKPETKTETKPEAKTESKRETKPEIKSEAKSEPKSSNESTSAASTLARKGKTTVV
                     PAANPPPLNTAQSYSNIIKASMSSPAAAKVLPPGLNQAKSSTSSPQRTPQKLHQADDS
                     KKRVVSQTQHIPSTQPETRSETQSPILNVNKPIFDTVNRLSTLPQSRLHNPLPFQSIV
                     SLLESSLLNCPDSFDAEKPRQYHPTSIHPSSVDYPQEPMYELNSSHIMKKFDNDTLFF
                     CFYYSEGIDNLAKWNAAQELSKRGWIFNTDVKQWFLKDNKNGGKNRSMSIIQKEEDEQ
                     NKQDDSANNEENYKYFDYEKTWLTRRKENYKFSQDFRESF"
     gene            complement(<361642..>362204)
                     /locus_tag="DEHA2F04026g"
                     /db_xref="GeneID:8998869"
     mRNA            complement(join(<361642..362080,362140..>362204))
                     /locus_tag="DEHA2F04026g"
                     /product="DEHA2F04026p"
                     /transcript_id="XM_002770689.1"
                     /db_xref="GeneID:8998869"
     CDS             complement(join(361642..362080,362140..362204))
                     /locus_tag="DEHA2F04026g"
                     /note="similar to uniprot|P40347 Saccharomyces cerevisiae
                     YPR073C LTP1 Protein phosphotyrosine phosphatase of
                     unknown cellular role"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04026p"
                     /protein_id="XP_002770735.1"
                     /db_xref="GeneID:8998869"
                     /db_xref="GOA:B5RU72"
                     /db_xref="InterPro:IPR000106"
                     /db_xref="InterPro:IPR002115"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:B5RU72"
                     /translation="MTATSRTVDKKISVAFVCLGNICRSPMAEAIFKHKVHELGYSEY
                     FKIIDSYGTGGYHIGDPPDSRSAKTCRKHGVPVDHSAQQITSKDFKKFDYVICMDQSN
                     LSDLLFMKPRESKARVALFGEWKADSKFNTVVQDPYYGGINGFETNFQQISHFSEEFL
                     KREVGEL"
     gene            complement(<362409..>365648)
                     /locus_tag="DEHA2F04048g"
                     /db_xref="GeneID:2903193"
     mRNA            complement(<362409..>365648)
                     /locus_tag="DEHA2F04048g"
                     /product="DEHA2F04048p"
                     /transcript_id="XM_460542.1"
                     /db_xref="GeneID:2903193"
     CDS             complement(362409..365648)
                     /locus_tag="DEHA2F04048g"
                     /note="weakly similar to p|P19659 uniprot|Q08221
                     Saccharomyces cerevisiae YOL051W GAL11 Component of the
                     Mediator complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04048p"
                     /protein_id="XP_460542.2"
                     /db_xref="GeneID:2903193"
                     /db_xref="GOA:Q6BMM9"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM9"
                     /translation="MNNLQQQPGNTNSWHAMYSVSDRQKVVQILSGTLKELQNGNYDA
                     QKAANMAQEFEKFTFMKSQSRDEYLRLIKQKVTQLRAGIRNPANGNNMGGNNPMVNQN
                     MGQNMGSGMGMQQQPNMNPQSNMRPQNMNFLQQQAQARQQSAAQIQAQLRNGNIANQT
                     PSQTQPVHHIQQQQQQQPSQPPQPQQSQPPQQPQPQPNQQQLHQISNMIRNAPIPQAL
                     LSKIPNLPPNVNTWTQIFDCFQKKIIPQAAMPVIKEIHNTHLQLTLRQHQQQKINQMQ
                     SQRMNQQQHQQQHQQQPQLPQQQQQQQQPQAMNNMAGTVNNSNNNTPVMNSGNFNMNN
                     LNPQQKQQLLRRQMQQRNSLAGQNPLMQQQGQVPSQPPQPQPQQQPSQPQQQKPQMVQ
                     SSPQNPQQSKPPNFTITPDDILKYSSDAMRLLTRLQSNGSIQPNLDQSQKESFIRKYI
                     HHQKTTMWKQGQVTNNMTNVPNTANAGNTVNQAQVQRRLQQQTGVNSMPMQSQPQTQP
                     SAPLSQQSPMINNMQMGNQQPMPHTQMNNQNSPMMQQRAVNTPTMPMNNNDPSAATKK
                     QAAMGSLSALLPPLTDEMKLQLRQLIEEVSRNNVALKDVTMLLSQQDKNAVRDTVVRI
                     SQQYANVDSIISYFYIITRNVEGTKRLIQMKYMTKNIIENVQRGIYLAAPDLLEKLRS
                     QYQKYFEYVKEQFAIRRQRMQSQQPQGQPPQQQFLNNQQRNGPIQNQIPQQQVQGMPQ
                     QQNGQTLMNIGPVNSWPNVAPPMQQRNNIGSSPMIPNSVSPIIPKQMHPFQSPASNIN
                     TAPPKQGGRAQNKKSVSGTTPGATGTSRKKSINKSISSVGGIPTPANNATTPAALANS
                     IKTPNSIPTPQVPPTQSNKNTPAEQQSPNSQMKRAPSNAGLKITEDTVGTIFNNSEVD
                     PKLAKRRELSDTDPLKFFYASLSNLLEIDDLAGDQQGLPTPAQSSSSTGSKIGIAKSP
                     LSPVITSNEWTCEIKPMAITSSFKQVGTIRELTASDIVQTCADLALTEVEEFSKKGVK
                     RENDEMDDSDDIDNLFSDKKPKVEDDDYKFMYEPVEFDEWQKFMVASMQ"
     gene            complement(<366261..>369188)
                     /locus_tag="DEHA2F04070g"
                     /db_xref="GeneID:2903194"
     mRNA            complement(<366261..>369188)
                     /locus_tag="DEHA2F04070g"
                     /product="DEHA2F04070p"
                     /transcript_id="XM_460543.1"
                     /db_xref="GeneID:2903194"
     CDS             complement(366261..369188)
                     /locus_tag="DEHA2F04070g"
                     /note="similar to uniprot|Q12220 Saccharomyces cerevisiae
                     YLR129W DIP2 Nucleolar protein specifically associated
                     with the U3 snoRNA part of the large ribonucleoprotein
                     complex known as the small subunit (SSU) processome
                     required for 18S rRNA biogenesis part of the active pre-
                     rRNA processing complex and highly similar to
                     CA3927|CaDIP2 Candida albicans CaDIP2 beta transducin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04070p"
                     /protein_id="XP_460543.2"
                     /db_xref="GeneID:2903194"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM8"
                     /translation="MVKSYDRYEQEKCFGVIASQSNIVYLPPTSNQSSKTIGRAISSG
                     LEEILVWDIKTGEVLNRLRDGLTPGASNAPTAQAPSPVSYLAYHEDTNIVAAGYLDGS
                     IKIWDLTSGSALISFQGHKSSISILKFDRSGTRLLSGSNDATIILWDLVGEEGLFKLK
                     GHKSQITGLNFLTENPESKGSDDLEDYLLSVSKDGLIKLWEVKTQQCVETHLAHSNEC
                     WSLGMNTSNNVAITTGNKDQVKVWEIDLSQPDTQKLIEKGSFEKQSKARCADIQFQKL
                     KTSSANITDLFYLQNADRTVEIFRVRSSDEIKKGITKRTKRLKEKGYDEDEILQSLKE
                     SEISMMITPFTTLRTISKVKSCTWVNNDKNSKKLDLLVSLTNNSIEYHNIPIPESIKK
                     TQASDIYSVKQHSVDLLGHRTDIRAMDIAADNKLLATASNGELKIWNIKTQNVIRTFA
                     LEGGYALCCKFLPGGTLIAIGFKNGDLELYDLATSSVVDRIEKAHDSKSAVDDENGSA
                     IWSLDLTPDGKTLVTGGNDKSVKFWNFKVEQEMIPGSNSSVSKLKFVHNQTLELNEDV
                     LCVRISPDSRFLAVSLLNNNVQVVFLDSLKLFLTLYGHKLPVLSIDISDDSKLIITSS
                     ADKNIKIWGLDFGDCHKSIFGHQDSIMNVKFIPDSHNFFSSGKDGLIKYWDGDKFECI
                     QKLPAHQSEVWCLAISSDGRFMISTSHDHSIRLWLATDDQVFLEEEREKEMDELYENT
                     LLESLEEDPTHNNNEEDDEKEDGEEVSKVTKQTMETLKAGEKLMEALDIGTEDVLATE
                     DYESHLKNFQAKRIAAPPVKPTPNPILLALGINGQEHVLNTVTKIRPAQLDDALLVLP
                     FSYSLKLLKFIEIWTNKQNVTNNVVNISLICKILFFVIRSNAKEFIHQKSPELKNQLA
                     TVKKQLREELSKTSNQLGYNIQGLKFTKQQWKLTHESEFIDEAEQREYEDKKAIKRSF
                     TTI"
     gene            complement(<369807..>371987)
                     /locus_tag="DEHA2F04092g"
                     /db_xref="GeneID:2903195"
     mRNA            complement(<369807..>371987)
                     /locus_tag="DEHA2F04092g"
                     /product="DEHA2F04092p"
                     /transcript_id="XM_460544.1"
                     /db_xref="GeneID:2903195"
     CDS             complement(369807..371987)
                     /locus_tag="DEHA2F04092g"
                     /note="similar to uniprot|Q08108 Saccharomyces cerevisiae
                     YOL011W PLB3 Phospholipase B (lysophospholipase) involved
                     in phospholipid metabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04092p"
                     /protein_id="XP_460544.1"
                     /db_xref="GeneID:2903195"
                     /db_xref="GOA:Q6BMM7"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM7"
                     /translation="MQLLKPKGSSNLSWYSYFVVVLCLCTNVRAITWPWEDSSSSSSD
                     SSATSSSSDSSSTNGITWPWQDNSDSSSSASSESSSSSASSSSGGSSASSESSTRKNQ
                     YAPYETSCPSGDISREAKNISSSERDYMSNRHETTNKNLIGFLSKRANLSDFDAKSFI
                     NDYSDEHNISIGLAFSGGGYRAMLNGAGQILGLDDRYDEAKENGLGGLLQSSSYLAGL
                     SGGNWLVGSLVLNNWISVADIIEGDIDIWNLEDSIFNPSGINLVKTVRYYNNIRTSIE
                     AKQDAGFDTSLTDLWGRALSHQFFPDEDGGENVTWSSIRDLSKFSDYEMPFPIVIADG
                     RTPGTFIMDSNSSVFEINPFELGSWDPSVHSFVDVKYVGSSMKSNDPNTSKCAVNFDN
                     GGFIMGTSSTLFNQGLLRISNTGLNKAVKSIVSSILGKLSYAEDDIAAYEPNPFYEND
                     FGTYNSISTNNTLFLVDGGEDQQNIPLYPLIQNARDVDIIFAYDNSADTDSNWPNGTS
                     LVHTYRRQFSKQGKGTPFPYVPSEETFVKDELNKQPVFFGCDAGNLTSLLDFHKNSDI
                     NETDVPLVVYMPNYRTSYNSNTSTYKMSYDEDEKMGIIKNGFEVSTSNNLTDDSDWAK
                     CVGCAIIRRSQERLGQEQSSECKKCFDNYCWSDGEKAAASSSVSGSSSTSESSSTSKS
                     SSKSSSTSQSSSSDKPKDSNANALYISLPLAFFTSFIIALSLLV"
     gene            complement(<372259..>373254)
                     /locus_tag="DEHA2F04114g"
                     /db_xref="GeneID:2903196"
     mRNA            complement(<372259..>373254)
                     /locus_tag="DEHA2F04114g"
                     /product="DEHA2F04114p"
                     /transcript_id="XM_460545.1"
                     /db_xref="GeneID:2903196"
     CDS             complement(372259..373254)
                     /locus_tag="DEHA2F04114g"
                     /note="weakly similar to uniprot|P36069 Saccharomyces
                     cerevisiae YKL128C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04114p"
                     /protein_id="XP_460545.2"
                     /db_xref="GeneID:2903196"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM6"
                     /translation="MSLLIPTVTDYEDAHGQESEEVTYQEKLTQLSDKKDSNGNLVYP
                     WTFETINGFFKQSDPSTDDLKFNYATEDFGRTKSWPEIIEELERLNKEAGENECYKLM
                     FFARHGQGFHNVCVNKYGLDEWHRKWHALSTDGEIVWAPDPMLTDLGVDQAKENNQAW
                     KAQIAQGAPIPAKFYVSPLQRSSYTLVYTWGDIKPEEKRPLVTDSIRETIGINLCDKR
                     STKSVIRERFDKHGFIIDDSLTEEDELNERDTREQLHEQAIRVNGFLQGLFNEDWDSK
                     ASALDEKKKLQNSVISTTSHAGTIRSFIMVLGHRHFTISTGGMIPILVKGTRKSD"
     gene            complement(<373608..>376103)
                     /locus_tag="DEHA2F04136g"
                     /db_xref="GeneID:2903197"
     mRNA            complement(<373608..>376103)
                     /locus_tag="DEHA2F04136g"
                     /product="DEHA2F04136p"
                     /transcript_id="XM_460546.1"
                     /db_xref="GeneID:2903197"
     CDS             complement(373608..376103)
                     /locus_tag="DEHA2F04136g"
                     /note="weakly similar to uniprot|P31384 Saccharomyces
                     cerevisiae YAL021C CCR4 Component of the CCR4-NOT
                     transcriptional complex which is involved in regulation of
                     gene expression"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04136p"
                     /protein_id="XP_460546.2"
                     /db_xref="GeneID:2903197"
                     /db_xref="GOA:Q6BMM5"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR025875"
                     /translation="MNIPKYQQAQVQGQQPNLQAQQILLQQLQQGQSQQSQPSIGGSG
                     SAGQFSQQDIYNDNIAQQGLYQNSYQRPVQAQQPPQLQNIHQQQQFFPQQFSSQQQNQ
                     PQASSLQQYQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQIHLPQQYQQSQGQQVPHQ
                     PPHIQQQQFFNQQAAALQQQQQQQQQQQQQQQQPAQKLNSINIENPNSIYWQHQQQLC
                     QLSRNANIPHYYARQYAANSRKNKNPYSDVKTVSLIDATRSIVSALNEQENSKSNPGS
                     ATNSALLQNKKLAQDLDDDHLQEEQRMRQKTQGRQLWCQLDLSGQGLVNLSPKLFQYD
                     FLESLYLNNNKLTSVPPIVNKLRSLRTLDLSHNRINEVPSELGMCFNLRYLYLFDNNI
                     KTLPNEFGNLIELLFLGIEGNPIDLKIANLVAEKGTKELIAYLRDLKPSFSKPPPRQW
                     LLLEDDGEIIDPINNPDAYTNDNNNSDTNDTFTMMSYNTLCQHYATTKMYKYTPSWAL
                     EWGFRRAALQEEVLHFKSDLVCMQEVETRTFHEFWVPVMQGFGYKGVFFNKTRSKTMS
                     ESDSKKVDGCATFYKTDKFELLHKQNFEYNSVCMGSDKYKKTKDLFNRFMNKDNIALI
                     TYFNHIQTGEKILFVNTHLHWDPAFNDVKTLQVGILLEELRTIMKKYHHTNSIDEIKN
                     ASMVICGDFNSTKENAVYQLFSTGAVSNHEDLEGRDYGKFTDEGFRHSFKLKSAYDHV
                     GELPFTTISPAFTDAIDYIWYSTPTLQVKGLLGKIDEEYSSHCIGFPNAHFPSDHIPL
                     VTKFQIKKSGGNKKPDFKPDFKPDFKSGSSRKT"
     gene            complement(<376485..>377705)
                     /locus_tag="DEHA2F04158g"
                     /db_xref="GeneID:2903198"
     mRNA            complement(<376485..>377705)
                     /locus_tag="DEHA2F04158g"
                     /product="DEHA2F04158p"
                     /transcript_id="XM_460547.1"
                     /db_xref="GeneID:2903198"
     CDS             complement(376485..377705)
                     /locus_tag="DEHA2F04158g"
                     /note="some similarities with uniprot|P31384 Saccharomyces
                     cerevisiae YAL021C CCR4 Component of the CCR4-NOT
                     transcriptional complex which is involved in regulation of
                     gene expression"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04158p"
                     /protein_id="XP_460547.2"
                     /db_xref="GeneID:2903198"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM4"
                     /translation="MYFDSKSTKLDDITWSDMHKLISRNGKESILCIGQRLYSNMRIP
                     LNYDATKYRNWHHFDEPSTSKKQKISVMSFNLLSRHYMWKPVFGYLEQEYLSWSDYRF
                     PLINLMIRQFNCDIMCFQEMEHLIYEKFWSKGFPSPNYHSFYVRKSEPVYWGDRPSEN
                     IDGVGIFVNGDKFDVLDSHAIHFGEYIMQHHVKFNVTKATVERVIPRNTVALLVKLRD
                     KQNGKILYVTNTHLYWSPKFNDVKIIQTKLLLNVLHDFIDHNCLCDPCIIMCGDFNSN
                     PSSKVFQLLNTGTIDAFKCNEFALHDYDHKANSELFHNGHIENPFHLACAYESLLTHS
                     HINPRKKLEFTSFTKGLIDVVDHIWYSKNHFKVTKLLGEVDQSYYTETGVVGFPNSQF
                     PSDHIPLVTELAYL"
     gene            complement(<377949..>379076)
                     /locus_tag="DEHA2F04180g"
                     /db_xref="GeneID:2903199"
     mRNA            complement(<377949..>379076)
                     /locus_tag="DEHA2F04180g"
                     /product="DEHA2F04180p"
                     /transcript_id="XM_460548.1"
                     /db_xref="GeneID:2903199"
     CDS             complement(377949..379076)
                     /locus_tag="DEHA2F04180g"
                     /note="weakly similar to uniprot|Q08214 Saccharomyces
                     cerevisiae YOL043C NTG2 DNA N-glycosylase and
                     apurinic/apyrimidinic (AP) lyase involved in base excision
                     repair localizes to the nucleus and similar to
                     CA2220|CaNTG1 Candida albicans CaNTG1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04180p"
                     /protein_id="XP_460548.2"
                     /db_xref="GeneID:2903199"
                     /db_xref="GOA:Q6BMM3"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM3"
                     /translation="MTVAKSKRLREVNGTDVLNKRVKTEETLSFESITIPNIKHESDL
                     IITPSIKPESDSVIPSNKLEPDSISNTKKYLTVEIEDKKPNVFAKVTSDDVDSIPSTC
                     KAPPKWSELYNEVVAMRSKFLSPVDTMGCERIPEGISPNVAKTNPRVFRFQLLISLML
                     SSQTKDEVNFQAMRNLHSGLMALGHKDGLSLESIVTLSEGEIDAFISKVGFHRKKAAY
                     IKKACAILQSNFDSDIPKNITDIVTLPGVGPKMGFLLLQRGWNINDGIGVDVHIHRLA
                     QMWGWVAKSEKPESTRTELESWLPKKFWGDINPLLVGFGQVICVPKASNCDICTLGIN
                     KLCKSSNKKLLNASMTDARRAKLLKGRGNLTELITEIEDLV"
     gene            <379292..>382510
                     /locus_tag="DEHA2F04202g"
                     /db_xref="GeneID:2903200"
     mRNA            <379292..>382510
                     /locus_tag="DEHA2F04202g"
                     /product="DEHA2F04202p"
                     /transcript_id="XM_460549.1"
                     /db_xref="GeneID:2903200"
     CDS             379292..382510
                     /locus_tag="DEHA2F04202g"
                     /note="weakly similar to uniprot|P39113 Saccharomyces
                     cerevisiae YMR280C CAT8 Zinc cluster transcriptional
                     activator necessary for derepression of a variety of genes
                     under non-fermentative growth conditions active after
                     diauxic shift binds carbon source responsive elements and
                     similar to CA2219|CaCAT8 Candida albicans CaCAT8"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04202p"
                     /protein_id="XP_460549.2"
                     /db_xref="GeneID:2903200"
                     /db_xref="GOA:Q6BMM2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM2"
                     /translation="MSQVTNIETKSDISTQPENRVKAKVKSRSNGTTTNTKTIKTPGT
                     RVERVAQACDRCRAKKTKCDGKVPTCSSCAAVGFKCIVSDKLSRRAFPKGYTETLEER
                     IRQLEIENKKLVGILDLRDEQLDMLNTRMNGQDASFDDIRSSGSVKDNEMQPVTSSNL
                     SLLDKQHTERLHEHDDGCPCGCSNFPHSMHERPVSIAGSVYDTATGQASVPGSINLSD
                     NDDNESLLSDNDLSSIYSSNNRALLNANISNLTKTGHVIGGETTPAPGAFAAATAIAQ
                     MQKNRPLSQQQQLEHKEQNKKQMLTSLVAMSIPRSTEETLFIPTLLSKICQVHGYNSK
                     PAILTANAIASLKENTNETMKNDSSSNKSRDDEMLLKIIMNRSNLQKLPEAEAIYFIR
                     NLISLPNSRIDLDHLITVYFQDWGNAFPIIDKNSFLKKYVKFTELLESGSTDSFSNEE
                     SSESIEKFGVLMILILSLSLLSNKHSHMSSKGNIDSNEIAKKYVSYLNHYDYLIHQFI
                     NSNCIMTKHCSIQSLQILTLSLQYCLVIGDITTCYELRCRVITMAQQLRLHRCPAAVL
                     GVTGNNGGSVNLQNFMQGERRILFWCIYCLDIYSSLNLGVPRLLKDFEIECALPFSGK
                     NDDDNDDNENILIVNNTKLSIVGKVSKLALSVMLYCKVLGRILDSIFARFENTDGQNK
                     AMDQERMLDCWRRELPTDLKFDIDVNGFSLADNDSSNDAENSNWKNYSKQQLTLIFLY
                     YHAKFLIYLPIISKYGNHYNVGLSQKEQLTKEKGNIAAIVSSVSMIQQSSTRILEVLK
                     SLSKYSSSYVLPIPINISRQQARFALLVAKGSLEYIKGGPLYQNSKTLLLDTVAYLTA
                     ETNHEIPGGLTKNSVKLLELAILSIFGLSCNKTPQNMKKKPNPSGVPITKMAVAREPV
                     SQLDSYNNNFIIRPNNISSKTPSPTVFDKNSVPQDNSINVEKNEDGISLQQQDYGGYL
                     SSLGPEGSQNNSNNLFNDDGLENIESILKFDPFKVTLNSQLMMNEFAADGSLGLVPFL
                     DMSNPPSGDEASQMYDGSSQVKIEDSDQRVSDGQYSSFFEWS"
     gene            <382705..>383661
                     /locus_tag="DEHA2F04224g"
                     /db_xref="GeneID:2903201"
     mRNA            <382705..>383661
                     /locus_tag="DEHA2F04224g"
                     /product="DEHA2F04224p"
                     /transcript_id="XM_460550.1"
                     /db_xref="GeneID:2903201"
     CDS             382705..383661
                     /locus_tag="DEHA2F04224g"
                     /note="similar to uniprot|P32643 Saccharomyces cerevisiae
                     YER175c TMT1 Trans-aconitate methyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04224p"
                     /protein_id="XP_460550.2"
                     /db_xref="GeneID:2903201"
                     /db_xref="GOA:Q6BMM1"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM1"
                     /translation="MATFSKVNFKTINYNSFRPHYPSSFYQILSKYATEGKESRLPLN
                     KSLDLGCGTGVATYSLLNFVDDVTGIDVSPPMIETAKSLIPERCEQMNVKDRSRIKFK
                     TGSAESFVSSGSREVEDNSIDLIVAAQCIHWFQDYNIFYKSCASLLKQGGTLAYWYYV
                     DPIVIDFQGPAKGEKMEILKKAFQIYSKYVYDDPKFIGPHWEQPGRNIIKNLCVEVNE
                     AIPKDLYSDIKIQTYVPDFDGNVKPTDDDLKLEKSNMSINDFIKYLNTYSGFHNYKDA
                     TGDKENLIELFLSECETELGWDREKTRIDIVWRTGYTFMKKK"
     gene            <383808..>384728
                     /locus_tag="DEHA2F04246g"
                     /db_xref="GeneID:2903207"
     mRNA            <383808..>384728
                     /locus_tag="DEHA2F04246g"
                     /product="DEHA2F04246p"
                     /transcript_id="XM_460551.1"
                     /db_xref="GeneID:2903207"
     CDS             383808..384728
                     /locus_tag="DEHA2F04246g"
                     /note="weakly similar to uniprot|P23797 Saccharomyces
                     cerevisiae YMR281W GPI12 ER membrane protein involved in
                     the second step of glycosylphosphatidylinositol (GPI)
                     anchor assembly the de-N-acetylation of the
                     N-acetylglucosaminylphosphatidylinositol intermediate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04246p"
                     /protein_id="XP_460551.1"
                     /db_xref="GeneID:2903207"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:Q6BMM0"
                     /translation="MLVRIWRFVLRVIGLSFLLWLILSTTIPQIIAKYSHSNESENLA
                     CPYNSITSPSPLPIHNANVYFIIGHPDDEVMFFSPTLIELNKKEYNNRVKLICFSNGD
                     AVHESMGRVRTEELYKSGGILGLKENDIKVIDSFKDGMDEKWDVDDIQRTLEETVGKK
                     SKETLVLITFDEDGVSKHPNHISLYYGTKKFFQTYYNNPERNGKLYVLKSLNFLEKYS
                     FNILTNVELFVDHLSKLLISNILKIKVNVSFFNNKTNNQSIKIYSDLNMLSVSYAAMS
                     YGHYSQMVWFRYGWLILSRYLTFNHLIEIN"
     gene            complement(<384769..>385998)
                     /locus_tag="DEHA2F04268g"
                     /db_xref="GeneID:2903208"
     mRNA            complement(<384769..>385998)
                     /locus_tag="DEHA2F04268g"
                     /product="DEHA2F04268p"
                     /transcript_id="XM_460552.1"
                     /db_xref="GeneID:2903208"
     CDS             complement(384769..385998)
                     /locus_tag="DEHA2F04268g"
                     /note="weakly similar to uniprot|Q12509 Saccharomyces
                     cerevisiae YLR085C ARP6 Nuclear actin-related protein
                     involved in chromatin remodeling component of
                     chromatin-remodeling enzyme complexes and similar to
                     CA0593|CaARP6 Candida albicans CaARP6"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04268p"
                     /protein_id="XP_460552.2"
                     /db_xref="GeneID:2903208"
                     /db_xref="GOA:Q6BML9"
                     /db_xref="InterPro:IPR004000"
                     /translation="MSQQYFVIDNGSYNIKAGFSNQDAPIKHQNALSKARDGLIYVGN
                     EYLVQTNNYSGMIFKRPYDHGHLISWETEKAVWDYTFNKASPNQELDASITHLTLTET
                     PFQLPQLSMNTDQIVFEEYGFNEYYRCAPASLVPWSNLGSSESKNNDFTLVVDSGYSG
                     TWIVPIIYQNVYWKGVKKLPIGGAALNGLLREIISFRHYDIADEPVLINTIKEKTCFM
                     ATDFEKSLANRKKYRCEFILPDFKTTTTGFVKTKDTPIDTTGDVQSLALIDERFTIPE
                     SFYHPEIIFDNTTSSTSTIQNASFKNITDLVVECIMSCPKVTQPLLSGNIITVGGNTN
                     LPGFTDRLRHELVKELPIDWHVQVKETEHNPDEASWFGGAQLTNDEIINNISISKKDY
                     FEHGSNWCQKQFGFKNL"
     gene            <386481..>388625
                     /locus_tag="DEHA2F04290g"
                     /db_xref="GeneID:8998870"
     mRNA            <386481..>388625
                     /locus_tag="DEHA2F04290g"
                     /product="DEHA2F04290p"
                     /transcript_id="XM_002770690.1"
                     /db_xref="GeneID:8998870"
     CDS             386481..388625
                     /locus_tag="DEHA2F04290g"
                     /note="weakly similar to uniprot|Q12502 Saccharomyces
                     cerevisiae YOR322c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04290p"
                     /protein_id="XP_002770736.1"
                     /db_xref="GeneID:8998870"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:B5RU88"
                     /translation="MAILSRVLHHNTEKLNEKPSLKHTLSSNGSLSSKGSGSHHTLTL
                     SIALESPPVILYGQPQDSSGSIISGLLNIDIKDTRSQKSLELASVSSHSSITSAHSHS
                     DEVELESITLSLIQTVKYTKPFLIPSASVVSCKDCCTKKNVIAKWDVLISRSSFSVGT
                     HAYPFSHLLPGSLPASSKLGSTYASSFIKYSLIATAKRPNVPKEVKVVLPLNIARSIL
                     RGPERNSLRVFPPTEATASVILPNVIYPKSNFSLQLRLDNIVNINNDRRWRMRKLAWR
                     IEEHTKVKATTCKKHAVKLKQIQESQRKTETTKELRSRTTPGGTHNSNPGQGLNKTPN
                     LHHSTIQTNMFLSTCPSTQTNNSLHASNNHIEGINGAPLVTENDALEDQENNITNSSH
                     TAENLIEEFLSPTPRRSNNDSNEASFSPPDITPEYNQNVIQDDYRNNRPESSKDTESL
                     YLDEIRTATYGEIKSGWKSDFSGRGNIELVTDIDAFDFSTGLNRHMMKRSSDDPKIDE
                     VQEGLRNGANISCDIDDPTLGIYVNHTLIVEVIVAEEVVPRSSEKKSNSLKNVPSSLS
                     PVSSNSPASKQKSNSTSNKQKQSNTSGQTQPGVTTGAARVLRMQFKVTLTERSGLGIA
                     WDDEVPPTYEDIRAFSPPTYAETSASATPVSTPGSTIATPQLSANRPVSVEAFGGTPS
                     QSYFNLGTRSTSNSLTIDGVVDLDERIQDFTL"
     gene            <389074..>392688
                     /locus_tag="DEHA2F04312g"
                     /db_xref="GeneID:2903211"
     mRNA            <389074..>392688
                     /locus_tag="DEHA2F04312g"
                     /product="DEHA2F04312p"
                     /transcript_id="XM_460553.1"
                     /db_xref="GeneID:2903211"
     CDS             389074..392688
                     /locus_tag="DEHA2F04312g"
                     /note="weakly similar to uniprot|Q08217 Saccharomyces
                     cerevisiae YOL045W PSK2 One of two (see also PSK1) PAS
                     domain containing S/T protein kinases"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04312p"
                     /protein_id="XP_460553.2"
                     /db_xref="GeneID:2903211"
                     /db_xref="GOA:Q6BML8"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BML8"
                     /translation="MTNRTNSDTKKNHTTFYVNDDEVSFENEGGSESIERKESDLKIP
                     KRQDKTFNKPHGSNNKQNLVIDADQGCIELRSPSTSTAGTTVLLPNKEQFNSINDILR
                     FPIESTHAYSYAHLSPNSLALRLNVLKRSLEILKDRPGLLKFMNLGTDKQFGKAPSRL
                     EKPKIPNFGNRIYSNPHASNSSEFFNNSDKYKIQSNASSAALSELFRPSMKRSDSLPV
                     NQIYATKVDAAQGAAIHIKSSARKDPIINDDFKDIITLLENDNEALTEQSFDTSALRD
                     LSQATAKDDQKLKKSLLKNKLIYALATPFVENSSSLLGDQYSLVAPQFSASSTSLSSL
                     SKVPSTPTTGSAANSNARPFHSISSGKHALPQSIFTVETDSPWSVKAANDLALLMFGI
                     SKNMIKSLNLMDLIAPQFREFVADKLTRSMADNILTDSKHEQGNNGRDMRDIMFAGEI
                     VAIMRPGDKDFAWTSVWAKKRGNLIFCTFEQIPCDAFDVVISSDKGQDEAYNVDSINE
                     VAGKLMRNVDTGKMKVLSDISESMGSDLSDRDENEEDDLIDEYLSHDIIDSEKINKTR
                     YYTLQLKTDENIPCAVTSYPLELNDDKDEVKLKIHSLPYIGGMFVIDSLSYNIISCNN
                     AIAKNLFGKSSIYLKNKSINNLIPDFTEILNIGLKNHGDSLDIVPGLVLPEHFFRKFD
                     AIRRHSSYKEESEESLFFSSQGIRGLHRDGKSIWVDVQLRASSSEAFVVWITYSRSTG
                     TKDSNISKEVEKLNSSTSSLSIKSMNDKERFKTRSSSGYRRNEVNLPSQLKLFPHDDS
                     EILEFTPGSGDISRETSTRRPKANTFAIPISDMNKDLEKAMNLDNGNRGPSKRKRMTS
                     NTDSSGSYVSRKSTSESATMSPDTIATTVYNDNEGTNSNAIISNETYRKYSEEEILKI
                     EDEMLENKTKNSTHWPTVIGARRRTKKFSEFKVLKELGEGAYGKVVLAQHKEDPVYTI
                     IIKCIDKERILVDTWVRDRKLGTICSEIQIMAFLNNEPHVNIMRIIDFFEDSKYYYLE
                     TPLFGDPPAIDLFDFIEIRKDLSERECRFIFKQIVSAIYHLHKHGIVHRDIKDENVIV
                     DENGVVKLIDFGSAGYTKSGPFDVFVGTIDYASPEVLRGEKYEGKPQDIWALGILLYT
                     MLYQENPFYNVDEIMEGDLRIPYVVSENSLNLIKKILVRDIKSRPTITDIVEDVWLDI
                     "
     gene            <392855..>395431
                     /locus_tag="DEHA2F04334g"
                     /db_xref="GeneID:8998871"
     mRNA            <392855..>395431
                     /locus_tag="DEHA2F04334g"
                     /product="DEHA2F04334p"
                     /transcript_id="XM_002770691.1"
                     /db_xref="GeneID:8998871"
     CDS             392855..395431
                     /locus_tag="DEHA2F04334g"
                     /note="weakly similar to uniprot|P53135 Saccharomyces
                     cerevisiae YGL113W SLD3 Protein that interacts with Cdc45p
                     in initiation of DNA replication"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04334p"
                     /protein_id="XP_002770737.1"
                     /db_xref="GeneID:8998871"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:B5RU89"
                     /translation="MSEDNPKTPRVKLPFTFEVQSALSTSCPNTITVLSKIDSILLEN
                     LPENFYDNQQIFKLQDNVYEFLGSLFSNFFYVKIQERITDKDWKIGVIYNIHDRYYGM
                     IQVPKDIKSKDIDSKVQGRIPISSYRNKDDFISGWNFNLERLDKSEVKTPIVDNFTMK
                     PPSTNISAEYFPNMSDHSPQSQTDPVKFLYSRYYSILYSLNTPLSYFPKTTISRFKNL
                     CGNDNSAVKEHLSSLHLSVKELDDRHGGKYGILKTLDVSKIGTGDFDMKTKYENQNQK
                     EFLNKNHDLFVKLTATEKNQNDINDTNTNANQEKQVHSSDDNNLSFALDLKVREAQLQ
                     ILILLELLDCWQVVESDFLATNLKRQEKEEKQMTKQKKKSLVRKKSITSKKIVPTFLG
                     MGVDIQDKHIVSQPASTEINEFIVYETLNTLLDRMGLWDTLLDKSTGDQDESSFGFLA
                     YVLIPYFRQRLPLTIKYIIERVKGLSLKLNSKPNRQNMPKQLNLNETNEITNEVTNER
                     DSTANTQASRTSKFAKVHIDPRRVPFLKKSSSTIASKYDLLPAFSLKRSKSTLSSKNL
                     QKRQVDMSSNLKSFSESNRDNIEKSSTLSRSLSEKSDSGSRRQIIFGNAKKLKSQPDI
                     ILNNPQTAFSQVEATPAKRKPEAVTAGISSEITTPTHPNRYQKISIAKTPVDQFIRPT
                     IAASYKETTIPCSTVKERPSLGDRLISASLAPPVDMAINSSPMSTIAVPKRDQSTAEV
                     IASSPFNSIGAAVDIKSSPFKGGSSRKRNKPGEPISFQESAFFDTTLNGSPVSTLLRE
                     ANTNDSTSIFKRNSTKRRKPISTNIKQTTTDITNGGDIMSNINKQDQAFEEDINETAT
                     LL"
     gene            complement(<395554..>397038)
                     /locus_tag="DEHA2F04356g"
                     /db_xref="GeneID:2903213"
     mRNA            complement(<395554..>397038)
                     /locus_tag="DEHA2F04356g"
                     /product="DEHA2F04356p"
                     /transcript_id="XM_460555.1"
                     /db_xref="GeneID:2903213"
     CDS             complement(395554..397038)
                     /locus_tag="DEHA2F04356g"
                     /note="similar to uniprot|P53040 Saccharomyces cerevisiae
                     YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA complexes
                     involved in transcription initiation of RNA polymerase II
                     and in chromatin modification similar to histone H4 and
                     highly similar to CA5745|CaTAF60 Candida albicans CaTAF60"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04356p"
                     /protein_id="XP_460555.1"
                     /db_xref="GeneID:2903213"
                     /db_xref="GOA:Q6BML6"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6BML6"
                     /translation="MDPSSKVPLSHTLWSPHDTVKDAAESLGINLPEEAAKNLAMDVE
                     YRIHEILETAIKFMRHSKRKLLMTSDINHALKILNIEPLYGYDNSQPLSFKEALVGAG
                     GQTLYYIDNHEIEFEKLINQELPSVPRQTTFTAHWLAIEGVQPMIPQNPLPSEIKSLP
                     PIIRGATSSILGNDILNSGFSNENSVKDAPNGADAGAKNKKLTEKEVEVKPLVKHVLS
                     KELKLYFDKVVEVLISTDPEKESLKYAAINSLKNDPGLHQLVPYFIQFVAEQITNQLR
                     NIDILSTMLEVISALADNKTIFLDPYVHALMPCILTLLLAKRIGPIIKDNSSNEVLKN
                     QLAVREFAAILLEHIIKVYGSSYSTLKPRVTRTLLRALLDSSKPIGTHYGALLGLKNM
                     GNEVVKLVLIGNLKMWCKLVVDEGDKNDSEKEILLNTTLDILRNLRIDLDKADDMEVD
                     DTGFSDEIKDKLKDRLGDTLADLVLKQPDVKSIVRGLFFGEINI"
     gene            complement(<397400..>398215)
                     /locus_tag="DEHA2F04378g"
                     /db_xref="GeneID:2903214"
     mRNA            complement(<397400..>398215)
                     /locus_tag="DEHA2F04378g"
                     /product="DEHA2F04378p"
                     /transcript_id="XM_460556.1"
                     /db_xref="GeneID:2903214"
     CDS             complement(397400..398215)
                     /locus_tag="DEHA2F04378g"
                     /note="similar to CA5748|IPF2905 Candida albicans IPF2905
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04378p"
                     /protein_id="XP_460556.2"
                     /db_xref="GeneID:2903214"
                     /db_xref="UniProtKB/TrEMBL:Q6BML5"
                     /translation="MKAFFNSGTSRNSFFKQEQERIESIIKEPLLEYVLQDLPHLQTT
                     KEQQDDIWEMIAIKLNTDQFQSTLTSTDNNNKEVDEIATLNGPYIKDVYIKLMDDFMQ
                     RVYSINRYKQIYKAEYTRPPDGGPAPIGYAAFSLPIREILAERTDKLLCELFYLKGYD
                     IEVMAKLSKERFEEQQRNEHKNKSAVANNLNQDQEPHKESSDNTSADDDKEKTHKALE
                     QMKEQSGKSKLDFYEKEFVKKNKKLDQLNNENKRLLELNHELVIELQKLREKS"
     gene            complement(<398397..>398771)
                     /locus_tag="DEHA2F04400g"
                     /db_xref="GeneID:2903215"
     mRNA            complement(<398397..>398771)
                     /locus_tag="DEHA2F04400g"
                     /product="DEHA2F04400p"
                     /transcript_id="XM_460557.1"
                     /db_xref="GeneID:2903215"
     CDS             complement(398397..398771)
                     /locus_tag="DEHA2F04400g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04400p"
                     /protein_id="XP_460557.2"
                     /db_xref="GeneID:2903215"
                     /db_xref="UniProtKB/TrEMBL:Q6BML4"
                     /translation="MGSCFSKSDKEPVGSKRSTGNNRFSRNEQKLGGNTESDTAGNGN
                     QIINEKYKNNTNRNVQGSNTRSHGKTLGGEETNEKNPNTKEAAAKAAELRYNKQRQSL
                     KESQDKLKTMSKKSKLEKGLQS"
     gene            complement(<399030..>400898)
                     /locus_tag="DEHA2F04422g"
                     /db_xref="GeneID:2903216"
     mRNA            complement(<399030..>400898)
                     /locus_tag="DEHA2F04422g"
                     /product="DEHA2F04422p"
                     /transcript_id="XM_460558.1"
                     /db_xref="GeneID:2903216"
     CDS             complement(399030..400898)
                     /locus_tag="DEHA2F04422g"
                     /note="some similarities with uniprot|P38330 Saccharomyces
                     cerevisiae YBR238c and similar to CA5749|IPF2908 Candida
                     albicans IPF2908 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04422p"
                     /protein_id="XP_460558.2"
                     /db_xref="GeneID:2903216"
                     /db_xref="GOA:Q6BML3"
                     /translation="MFRLLSANTQQTLRPAILSKVRSNKANISLPSSSIQVNPPSPAQ
                     YNLTCQFTRHNSSASSQKTKSSKVDAFVNKAQRDPVLREALDSEANSKLNYFKEQLSL
                     AFQYRSAKDRDSQRAFVATVDNLFKAFEDESLRSSYSSRDLYSYTQILNFSVYHNRTN
                     RLSSSRNRDSDQYQNENLHDEVLIKSAVLNLSETIISGEFNKILNANILSYLFYSMKQ
                     FQLYPEMLNLWENGVNDGETGKLFLNEKILAVILPIAYEQKRFSYEEILHIYELNTKE
                     LSTVQHELLCSIGKIAIGSGDYSRGLDSLEALLQLYESKQQSTQHVLASLGELHLNFI
                     GSCKDIKISKHFFDKVVQYDLPYYVCLKVPYIQSLLQNCFELNESLDNIIYFWKSTIT
                     HYSNEKNSAGLNSRYSILNNTFFTIFFKIYPTLNAESFNKLREVIALYAEIKPVDEVF
                     LNTIIGNYSWGDKNVLEQLIENYSIYNVKRTPVSYRICLKKTGELPQYTNEDILIKWN
                     DSLQHLDQNGFNYIPIADWAALRDATILSNSGSDRKDFYLAVANQYKDYIQDQRSCIR
                     FVKYWLKKREHLKSFSTLTFGSDADFSNEVDIVVPQFRHLKPNINYQKISSKIIGK"
     gene            <401470..>405441
                     /locus_tag="DEHA2F04444g"
                     /db_xref="GeneID:2903217"
     mRNA            <401470..>405441
                     /locus_tag="DEHA2F04444g"
                     /product="DEHA2F04444p"
                     /transcript_id="XM_460559.1"
                     /db_xref="GeneID:2903217"
     CDS             401470..405441
                     /locus_tag="DEHA2F04444g"
                     /note="similar to uniprot|Q9C258 Neurospora crassa
                     NCU03784.1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04444p"
                     /protein_id="XP_460559.2"
                     /db_xref="GeneID:2903217"
                     /db_xref="GOA:Q6BML2"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6BML2"
                     /translation="MPSRSSGWNRSGNATETSTLLPVHKSTKIDSEIASEDEKVAEKR
                     PKLGTFEGVFLPTALNELSILMFLRFGFIIGQMGIMGTFLLLIMSYTIDILTVMSISA
                     ISTNGTVKGGGAYYMISRSLGPEFGGAIGVIFCIGQILNASLNVVGLIEPILVNFGEH
                     NGDILQILPVGYFWQALYCSIVLACCTGVALVGAKLVSKTAFYLFIILSLSTLSIPVS
                     ALFVKPFNPLPPPHQNLAYTGFSWSTVKQNLWPHFTSGAAGSVLAPGEKESFKNLFGI
                     FFPSTAGIFAGASMSGELANPSKSIPQGTLKGSLLTFIFYSLVIASLGSTISRDLFYQ
                     DIKVIQTVNMHKVVVLLGEISTSLFSAIMGIVGAATMLSAIADDKIIPGLSAFTVSKM
                     PARERKLGESLSVLATWCVAQTFLFADINQIATFITMAFLMTFIVTNLACFLLRVGSA
                     PNFRPSFKYFSSRTALTGCLTSIFAMFIVDGISASLIIVFLMLLIIIIHYLTPPSKFG
                     DISQLLIYHQVRKYLLRLKLQMSVKYWRPQILLLCDDPRTSWNLIGFCNHLKKGGLYI
                     LGHVVVLNDEAKAENNESEFGINSYKEIQKQRHAWSKLRDMSNIKAFVQIALGPTLPW
                     GVRNVYLGSGLGGMRPNITVLGFYDFVKHGVELPFLSSFKDKNKITELPTDECRKERK
                     VSIGQWVQIVEDLIIMQATVAVAANFGTLNLPQPDVKRHHFWSQPKTSNSDTRKYIDL
                     YPIQMSSINHLENGKSVLSTNFDTYTLILQLGAILATVPEWKYSLYTLRVIVFVENQS
                     EVNDEKKRVSELLSTLRIEAEVKIICLDDGSLDSYNLLVKGYARTSGNKKVFDRLDRT
                     LKNDQWWKNLCNARRILKELEKQKVRKQFKKNLSTQSDVDEALKNITSLDLNHPSSRA
                     VPSNYPSSNNGFKNNRRYTISNLQDKGLSLSFNMKTQQHDFFAFEDSSTSDSSDSERD
                     DGSTSIKNHFGTTTLDNYPSRFSNTDDNQSPSNKNLQDMDEHAQLKTLARLKEYDDSK
                     LGRNEASTDRLSIMSSRSNLMPNFSSVKFPKAKFDDDDHEVDGDNPSIRFVIDDDSDS
                     DDEKEKEDAKEEATEVAKRNRFTKVTTSADRERGISHGSRLEQKGKKGSKKSDIINAL
                     KSKGILEEPPKSSPFMTNDDDIIRRMNSPEFLSVENEGENDTEKIPSGGLSSLPNSAL
                     SGFEEGSGVHSTSESGPQSAESHEGKGLTQKQLQDALKSLSFNDLPAKGQHLILNELM
                     RINSPLDQTDVIFSTLPAPLIGTHLDEEESFIYTHNVAIWADGLPPLLLINSQTVTVT
                     TAL"
     gene            <405634..>408375
                     /locus_tag="DEHA2F04466g"
                     /db_xref="GeneID:8998872"
     mRNA            <405634..>408375
                     /locus_tag="DEHA2F04466g"
                     /product="DEHA2F04466p"
                     /transcript_id="XM_002770692.1"
                     /db_xref="GeneID:8998872"
     CDS             405634..408375
                     /locus_tag="DEHA2F04466g"
                     /note="similar to uniprot|P21372 Saccharomyces cerevisiae
                     YBR237W PRP5 RNA helicase in the DEAD-box family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04466p"
                     /protein_id="XP_002770738.1"
                     /db_xref="GeneID:8998872"
                     /db_xref="GOA:Q6BML1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MNSTGSNYSLKHNNTQDNNHNSEESVTNKTGELDKPGVKDGQAL
                     SKEEKLKRRQEQLAAWMQKRQQENQEPSGKVTISATDETNIDKEKLIRQQRIEEWKRK
                     RLQKSEGLETDRSKIKTFEVKSSNEPTIKINASMKKTITPANGRSKKRPIFGDEDEDD
                     EKESKPKFKKPTLDLAEIEEKKPEKSIDTEIDELDKYLSLLEEKEQGVENKKIENHDD
                     DGIANGPGVGNVNESDDEEIDEDQKQQDILSSKLNRLQNKQKQLDDVDHNQIQYHPFR
                     KDFYTEPTEISKLPEEEVANLRLKLDGIKVRGVNCTRPIIRWSQLGLPSTIMSIIEGR
                     LNYSSPSSIQAQAIPAIMSGRDIIGVAKTGSGKTLSFVLPLLRHIQDQPPLKKGDGPI
                     GLIMTPTRELALQIHKELNHFTKKLNISSCCCFGGSSIESQIAELKKGAQIIVGTPGR
                     IIDLLAANSGRVTNLQRVTYLVLDEADRMFDMGFEPQVTKVFTRVRPDRQTVLFSATF
                     PRKMELLAKKILDNPMEIVVGGISVVASEITQKVELFENEDDKSLEEAKFSKLLSTLN
                     DYGDKDAECKILIFVEKQIAADELLVKLLTEKYPCLAIHGGKDQIDRKHAIREFSSSN
                     SGVNILIATSIAARGLDVKGLNLVINYEAASHMEDYVHRVGRTGRAGRKGTAITFVSS
                     KQGRAITDLVKAMRLSKVSEDEINPRLIEISTKFLEGVKSGKEKYNFGFSGKGLDNLQ
                     EIRESNRDLERKVYGEENDSSTFKANEKKQNKTDIHQSDLDVKLPDFHIIEGRAPETA
                     GPDKCKFHSRITINDLPQKARWITVNRDSLSKVIESTGTSITNKGNYYPPNSKIPKTI
                     KQNGKEVTPPPKLYLLVEGLTEKAVHDAIILLREKMIEGLEVAAKEESMGPTGKYTV"
     gene            <408615..>409439
                     /locus_tag="DEHA2F04488g"
                     /db_xref="GeneID:2903219"
     mRNA            <408615..>409439
                     /locus_tag="DEHA2F04488g"
                     /product="DEHA2F04488p"
                     /transcript_id="XM_460561.1"
                     /db_xref="GeneID:2903219"
     CDS             408615..409439
                     /locus_tag="DEHA2F04488g"
                     /note="some similarities with uniprot|P28817 Saccharomyces
                     cerevisiae YDR036C EHD3 Protein of unconfirmed function
                     plays an indirect role in endocytic membrane trafficking
                     member of a family of enoyl-CoA hydratase/isomerases and
                     similar to CA5879|IPF12076 Candida albicans IPF12076"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04488p"
                     /protein_id="XP_460561.2"
                     /db_xref="GeneID:2903219"
                     /db_xref="GOA:Q6BML0"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6BML0"
                     /translation="MSEFNLEDYKKYDKFIVSEVEEGFYHVQFNNPKSLNAFTEQVWR
                     DYAEILERLDKCEETSVILISSAIPKAFSSGLDLKDAIKTMSSTVSNSEKERYDSLHQ
                     HIVDFQYCIAAPARIRTPTICLMNGINYGLALDISSACSIRVATADCKFSIREIKIGI
                     PADIGSLQRMPTIVNNKSLMYQYALTGGVFGADEATKLGFVSAVLPDLNAGVEYCKNL
                     GENINQHQQWAIKGTKESIQSIVDNGSPSEGLKNIAHYNATHIDGRFVRAMSGIKL"
     gene            <409664..>411577
                     /locus_tag="DEHA2F04510g"
                     /db_xref="GeneID:2903220"
     mRNA            <409664..>411577
                     /locus_tag="DEHA2F04510g"
                     /product="DEHA2F04510p"
                     /transcript_id="XM_460562.1"
                     /db_xref="GeneID:2903220"
     CDS             409664..411577
                     /locus_tag="DEHA2F04510g"
                     /note="similar to CA5880|IPF12074 Candida albicans
                     IPF12074 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04510p"
                     /protein_id="XP_460562.2"
                     /db_xref="GeneID:2903220"
                     /db_xref="InterPro:IPR024319"
                     /db_xref="UniProtKB/TrEMBL:Q6BMK9"
                     /translation="MAYALRRGQKIKGFSISKRFVSSPAVSLNDEIVGSFESHSTTKT
                     SRTIPNNALNTSRNTPSQLFLNSLSESYFAPTVKTGTTLPKNEVIKRELCKLVELRQF
                     DTLIDLFLKLTSRAESSSWSSILTSQELSYFIRDIIKHQIKLINQAADHKISLRSDTK
                     IKSKLAEARRFREKIRKLYGNLIYSDGQSSIYAVTMRSSLYNSNDLTGYKLSVTDYEN
                     LIMLELYNKKIDLASKWFQRFEQQYPQGQHYELMTYNMWVLKFQVYCGGSPFLWKIPQ
                     TDLYANYYNPRKSAFKSETSWLEVFTEFLKNHGKSSNTAVISDKLNETLIYSIGYARN
                     LDYLTKYIESIWGITPDGNVSENFTILKSDDPKFPSLNTLKAMVISLSYNQEFFQAMT
                     YVNAFQKIYGDSIDLSSAKAKNFWDSTFKWCDISTKFDEERALSYYIKQTTDTSTRNK
                     KKPSLKEAQENADFDYEGFLLFISELKSKRSTTMVKLWELHKDTNTFFSPKSYKVYLN
                     YLFEDQTEEKLYDVMSLLAKQYHYYHVSKNSFNKIHLTTNKLNDTDESVYSLYNTALR
                     ELINVKWKAGYAGQCQPLIDEWALNQQMHNTTSQWFKDTIMPQYRVMMENKREEVMIK
                     QKTEDDEKLLDLF"
     gene            <412469..>413272
                     /locus_tag="DEHA2F04532g"
                     /db_xref="GeneID:8998873"
     mRNA            <412469..>413272
                     /locus_tag="DEHA2F04532g"
                     /product="DEHA2F04532p"
                     /transcript_id="XM_002770693.1"
                     /db_xref="GeneID:8998873"
     CDS             412469..413272
                     /locus_tag="DEHA2F04532g"
                     /note="similar to uniprot|P35178 Saccharomyces cerevisiae
                     YDR087C RRP1 involved in processing rRNA precursor species
                     to mature rRNAs"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04532p"
                     /protein_id="XP_002770739.1"
                     /db_xref="GeneID:8998873"
                     /db_xref="GOA:B5RU91"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:B5RU91"
                     /translation="MSQTSGFVKKLAANDRKIRDAAFESLRKYLSSRSSSKLTLLEME
                     KLWKGLYYSMWLCDRPRPQERLAESLAQLYSEVIPVAAFSDFTEAFWVIMIREWPNVD
                     QWRVDKFYLLIRRILRHNFKRLKTEKWSSKAVDSFLSVYEKYPLSGDKSVSVALPYHI
                     CDIYLDELELVIFEELKDKQEALDEQEKKDMTKYQELVKSKIDIASEVPIQKLITPFQ
                     KLSKECPLKTLREKCKEEVLNDERLKDWNIFESEDTDSEEDDDEWEGFN"
     gene            <413438..>414550
                     /locus_tag="DEHA2F04554g"
                     /db_xref="GeneID:8998874"
     mRNA            <413438..>414550
                     /locus_tag="DEHA2F04554g"
                     /product="DEHA2F04554p"
                     /transcript_id="XM_002770694.1"
                     /db_xref="GeneID:8998874"
     CDS             413438..414550
                     /locus_tag="DEHA2F04554g"
                     /note="weakly similar to uniprot|Q02775 Saccharomyces
                     cerevisiae YDR088C SLU7 Protein involved in 3' splice site
                     choices acts in concert with Prp18p during the 2nd step of
                     splicing and similar to CA5883|IPF2425 Candida albicans
                     IPF2425 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04554p"
                     /protein_id="XP_002770740.1"
                     /db_xref="GeneID:8998874"
                     /db_xref="GOA:Q6BMK7"
                     /db_xref="InterPro:IPR021715"
                     /translation="MSSQEKHKPEYDSSGKEVNPYIPKFISAVPWYHNKSNDEKSDDY
                     LSHQRSNVADEAKDHSIPQPGSGINDEFEIKGETEIKKVEDYDSKRDRWHGYEAQEWD
                     KIAENWDKIKKKKQKTKNASVEEDSDDTDYELELVELGLDSKDIKNNLKEDPLEKTIR
                     DRQDVPAYILNITSSNKIHYDPKSRLTKDPSKGFINDKNQFVKKLTGEAKRLDNLQKF
                     AWEQNRQQEEMKQREAFEQKLTGKKHSEGGPDEYQVDLNLNMEANPTAMMLQARHKQE
                     QQQASHDQKKSDLVAKYGGGEFLNKSKEFVNVTESIQTGDKPINKDKNGLKRSIYPED
                     NYSMNHQSIWGSYYSGGQWGYCCCKQTTRNSRCTLN"
     gene            complement(<414585..>415652)
                     /locus_tag="DEHA2F04576g"
                     /db_xref="GeneID:2903223"
     mRNA            complement(<414585..>415652)
                     /locus_tag="DEHA2F04576g"
                     /product="DEHA2F04576p"
                     /transcript_id="XM_460565.1"
                     /db_xref="GeneID:2903223"
     CDS             complement(414585..415652)
                     /locus_tag="DEHA2F04576g"
                     /note="some similarities with CA5884|CaSLF1 Candida
                     albicans CaSLF1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04576p"
                     /protein_id="XP_460565.1"
                     /db_xref="GeneID:2903223"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6BMK6"
                     /translation="MGTGADIIKKLTPAPMPTFNAWNTIRAGSRLKTDGDDSELDAKV
                     SSKENTNGCEDSLESAKRGPIGKEHMLRAAMAAVKTTGDTDRGELVCVGENTTVVRPK
                     FKNKTWSRKDATSTIKGRSRRRAGSQAAIHHTTTCPNVTMTSDLFGGGNFYQGPGGSY
                     GGYAFGNPSDLVPPIYTPMCVNNSIPMPMPTHMPGPIPMMGTKPDDYPVQGKGPGSFM
                     ALPSSPIHPYFHQLSPSPPIDPYQMPYHPYYHPAHIHVDPMSNPYRIQEIKNQVLYYF
                     SPENLNTDDYLKSLIDRTTGGVLLTELIKFKRLNIMTNNGRDIIILQNIIKYECFPEL
                     ELIQMNQGIGVRSKYWRIQVV"
     gene            <416412..>417590
                     /locus_tag="DEHA2F04598g"
                     /db_xref="GeneID:8998875"
     mRNA            <416412..>417590
                     /locus_tag="DEHA2F04598g"
                     /product="DEHA2F04598p"
                     /transcript_id="XM_002770695.1"
                     /db_xref="GeneID:8998875"
     CDS             416412..417590
                     /locus_tag="DEHA2F04598g"
                     /note="similar to CA5885|IPF2419 Candida albicans IPF2419
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04598p"
                     /protein_id="XP_002770741.1"
                     /db_xref="GeneID:8998875"
                     /db_xref="GOA:B5RU93"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:B5RU93"
                     /translation="MSQLNESKETMPSPPVLKTTIIQLNKELDQDDSNYEILTNEYNQ
                     NKESTSVTTTNIPASMVGSIQGKKKRRRSSANVDSDELLKRKNDTKQLHSIIEKRRRI
                     KINREFEALKYLIPACRLTSSSGGTNGKGAGTNNGSKIDGMYKLTILKSSVEYILYLH
                     HIIQQQHNLINANMDNNKYKFDIDFAKIPLDVNTYRNINKDFNFKELITSIQDTPSFN
                     SPKERDSVIEEDYEEDSVNDDKSQLLSPDITPDMAPALSMLNKYMTIARESSTSSVSP
                     NGGLQSTFSCPSTTDNSPYNNPMKFSSTGKFNKFQLPDPALTPTEYENVDANQYQYGP
                     KKKLFKAKIPPNNTVLFNRPLNIKCVSSDRTREDKLSDQDASKTLLALRKSSIDSLLN
                     "
     gene            complement(<417674..>418529)
                     /locus_tag="DEHA2F04620g"
                     /db_xref="GeneID:8998876"
     mRNA            complement(join(<417674..418465,418527..>418529))
                     /locus_tag="DEHA2F04620g"
                     /product="DEHA2F04620p"
                     /transcript_id="XM_002770696.1"
                     /db_xref="GeneID:8998876"
     CDS             complement(join(417674..418465,418527..418529))
                     /locus_tag="DEHA2F04620g"
                     /note="similar to uniprot|Q12395 Saccharomyces cerevisiae
                     YLR128W DCN1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04620p"
                     /protein_id="XP_002770742.1"
                     /db_xref="GeneID:8998876"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:B5RU94"
                     /translation="MPRISLATKSSFRSQFVTVTGASVSLASQWLDKYDWNLQESING
                     YLNQDSYSRARPLKIDSKLNAIYDKYKDSNNENKIDINGTIAYLEDLNFDPEHPISLT
                     LAFFLEAPTMGVFTKEKFLNKWQNEKINSLSGMREFILRLHNDLETNHELFQELYNFT
                     FGFLMEVPGQRLLNYELAVDYWRLLLMNKKEFEPCYGRLEQWFDFILNEYKRGLSNDT
                     WKMFYLFIKTIALKDPSNFEDYDEMSAWPSVIDEYIEYLKENKLLN"
     gene            <418701..>420782
                     /locus_tag="DEHA2F04642g"
                     /db_xref="GeneID:8998877"
     mRNA            <418701..>420782
                     /locus_tag="DEHA2F04642g"
                     /product="DEHA2F04642p"
                     /transcript_id="XM_002770697.1"
                     /db_xref="GeneID:8998877"
     CDS             418701..420782
                     /locus_tag="DEHA2F04642g"
                     /note="some similarities with uniprot|Q874R3
                     Schizosaccharomyces pombe apc2 Apc2 protein and similar to
                     CA5887|IPF2415 Candida albicans IPF2415"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04642p"
                     /protein_id="XP_002770743.1"
                     /db_xref="GeneID:8998877"
                     /db_xref="GOA:B5RU95"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:B5RU95"
                     /translation="MITIPLSKENFNQVIPIPTLQDLAANSSNSDQQSNNIENDIDYL
                     LHWLSPFWPDNRVFNEPSQRVKSAVRSCLRDESSQLDFVKLYGNSIKPRFFEELSPVL
                     LDDRVLLTEAIDKIKFIKDYYNQYIKYLNLNKLPYDILNRNLNSLFHSILVENKQSKF
                     IKNLTNYLYEMLFGDEKCLHGSVHGYISVLLSIELIDELNSIIIRLSIKQIKDYILAT
                     CTKVWDKPLLEEINCWIKSDLFPSFNLIMRLSNFDFSEKYLYDLIKIAHDELVSLRIK
                     EIFGLVVDYPNSYIALSELHQCLSFKFNSHNTGTNISNLSTVINSNINTSEIDSANSL
                     ITISNFSSILINNSANSQAYQRAKLVDTFIQLCHEELLHSGANTVNVITCYTSTIKSF
                     LIIDPKGVLLDRVVRPIRRYLKTREDIIIKLVHGLLDQSESNDLLELAQELRNGTKKT
                     VIADDLMDLTWVPDPIDALPDFKKSKMTDIIESLISIFDSKEIFINEFTQLFGERLIN
                     LHDYDVKDVTDHLDLLKLRFGENEFTTLDIMIKDIEQSKITNEKINYRNEYSFHSTIL
                     SHLYWPTVCENVSHNDSFKLPDTISNQFEKFDKEFAGVKKGRGLKLLPSLGLVRLELS
                     IRNTKLSFEVTPDKASIISLFHDKVDELRLTNIASQLDMQPYVASKAIDYWIKQNVLT
                     ETSKGIYKVNE"
     gene            complement(<420860..>422437)
                     /locus_tag="DEHA2F04664g"
                     /db_xref="GeneID:8998878"
     mRNA            complement(<420860..>422437)
                     /locus_tag="DEHA2F04664g"
                     /product="DEHA2F04664p"
                     /transcript_id="XM_002770698.1"
                     /db_xref="GeneID:8998878"
     CDS             complement(420860..422437)
                     /locus_tag="DEHA2F04664g"
                     /note="weakly similar to uniprot|Q03761 Saccharomyces
                     cerevisiae YDR145W TAF12 Subunit (61/68 kDa) of TFIID and
                     SAGA complexes involved in RNA polymerase II transcription
                     initiation and in chromatin modification and similar to
                     CA1622|IPF10045 Candida albicans IPF10045"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04664p"
                     /protein_id="XP_002770744.1"
                     /db_xref="GeneID:8998878"
                     /db_xref="GOA:B5RU96"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:B5RU96"
                     /translation="MNNNNSGENMNTSGNPDSGASTPNLQNRQMAQRPVSIQPSQVNQ
                     LAQALRNEVSLAKAAGNDIAKAQQHYAKAESIKQVLLNYRDQQNARKAQQQQQQQQQP
                     VGTSNQVNQPASAGITPINRQSSPQPTPQGQSPVLNQSQPIHQSPTNSASPVPSIPAN
                     SNNNNAATIEKFNQAKARLGEFERKIQQLQNSKKSYNLNPEQVTSIESQLTELKSKYA
                     QYQRYAIYIKSQLVEQAKSNITSAPGMSNAPTPGTVANQRVPSIGNSAPQGISSPSMP
                     KQGSLPPDVGNLSNKQASVSAKGKSVSPPPTNVNATPSKSGPGSQSSSHGVPPINLSG
                     ITKPSVPSIPISSSINVKPPTAVTLKPTSNNNRATLSSGVANGIGQILGTPAILKLPT
                     YDLSSSGAGGAIPDNGGRVLTKRKLSELVNNIGADEGDGKTNIDGDVEELLLDLADEF
                     ITSVTGFACRLAKHRKVDSVDVRDVQLHLERNWNIRIPGYAMDEIRTTRKWQPNPSYN
                     QKVSGVEISKSVNGNIN"
     gene            complement(<422615..>424951)
                     /locus_tag="DEHA2F04686g"
                     /db_xref="GeneID:8998879"
     mRNA            complement(<422615..>424951)
                     /locus_tag="DEHA2F04686g"
                     /product="DEHA2F04686p"
                     /transcript_id="XM_002770699.1"
                     /db_xref="GeneID:8998879"
     CDS             complement(422615..424951)
                     /locus_tag="DEHA2F04686g"
                     /note="weakly similar to uniprot|Q06593 Saccharomyces
                     cerevisiae YPR194C OPT2 Oligopeptide transporter"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04686p"
                     /protein_id="XP_002770745.1"
                     /db_xref="GeneID:8998879"
                     /db_xref="GOA:B5RU97"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:B5RU97"
                     /translation="MSNPNSVSTDNRVMNHNESNDSQNEDQTDSLLSTSSSVAKRNYK
                     KIYGSTDEENLQSIELNNDVLELPKVVRESVPLEDDPNIPVMTFRYFILSTIFIVPGA
                     FLDTMNSYRTTSAVYSIFFVQIVSHWAGKWMAKTLPKKNVNVCGFEFNLNPGPWSIKE
                     TAMITITANSGATGNLATNAISLAELHFNEKVNAAIAILFMWAIVFIGYSYAAIAKCF
                     VLYDPQFTWPQALMQTTLLQSQARSDRDSKHGSMQMKVFFYVLLAVTIWEFLPEFAFP
                     LTSSLAILCWIAPYNKTVNFIGSGMGGMGVLNFSLDWANITSSIMLYPYWIQVIQFLG
                     FVLGAWIMIPLVKWGGVTSFKHGLMSNSLFLSNGTRYPTDELLTDDLRLNMTAYKYYG
                     PVNLGAQRAWNMFFDYAAYISGIVWVVLFGYDQMKNSLNVLRNTYTTKDQNGGFTSIH
                     LQYTDRLNKLQSKYEEVPMFWYLILFIISFSTLMFIFLSGQMFLPWWCCIVALALGSI
                     IVTPLSWLYALSNFQLAIGTFNELFYGYMVQNMKSVHPVSAVVFGAISGSAWYRAQYH
                     LLCMRLGFYIHLPPKAVFFSQIYGEIIGVPFNYIALRWVLDTKREYLDGTKEDPLHQW
                     TGQTITSYHTNTINYVILGPKRLFYHYPLLPYGFLLGAIAPVALYILHRKFPNSRLKF
                     RLWNTTVFFSTLSTFYGNLSTGYASKFIGGTVTMYWAYNYRHSLWKSYNYILAAAFDT
                     GYNFAVLLIFLLFSFGRTIRMPPWWGNNEQSVERCFAL"
     gene            complement(<425095..>429321)
                     /locus_tag="DEHA2F04708g"
                     /db_xref="GeneID:2903232"
     mRNA            complement(<425095..>429321)
                     /locus_tag="DEHA2F04708g"
                     /product="DEHA2F04708p"
                     /transcript_id="XM_460568.1"
                     /db_xref="GeneID:2903232"
     CDS             complement(425095..429321)
                     /locus_tag="DEHA2F04708g"
                     /note="similar to uniprot|Q06698 Saccharomyces cerevisiae
                     YLR419W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04708p"
                     /protein_id="XP_460568.2"
                     /db_xref="GeneID:2903232"
                     /db_xref="GOA:Q6BMK3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMK3"
                     /translation="MAKKKVKEVTPEVKEKRKNKKPIEEPEEIKKPQRGLAIGDNFGW
                     TGKLPATLLHEHCQKQKWGKVIFDMKKTSKGFIGIANLSWENPKTKEVIHIKMMPDSD
                     MYEPKETTNEARHYVATYALFRINYVKNMKMILPKIFRDYWSDLETKRLETLKSNKEK
                     HDVIYNGNPFTVFLEQRAKSEQLLKEKEQKQQNDLKVRKPTVNISSSNKTSSTSPNLK
                     STTKRQGNMNHNSPSFPKKVWANAPFIDFPSELRISIENSIKNHINWILDDDASQNNE
                     EHLHSLVRLGFRESHIKESFQYTSSFIDSLEWLLFHIPEDDLPPFFSKSDQDSSVSLK
                     ISKNIQFEYLVNRVSQSGFDMDEILTTLEENKNDELKTCVQLTHRIVEYSPVPGDFGE
                     SQELWEQEIDGIQMIDANKIHYIENSQNRIVTISLNSKNLKQDDLLSLKLYKSDNYPN
                     DLLGIQLIVNNNSFKLANYIKLSILRQLIQYIIKNGFLGDCYIFSIVEWLEDNISMII
                     DNPGPLIQGDLSRESSREKNQAISSKKAFKNKREKKLQPEDIDNLSKKYQVKLKSNEI
                     LNSLKKRSELPAWKKRDQLVSVINSNKVTIVTGETGSGKSTQIVQFILDYLNSTGDFE
                     SSIICTQPRRISTIGLAERISEERNDDLGKETGYIIRGENKTSNGTRISFVTTGVLLR
                     MLQSLMTSSDQNEIGIFNKLQYIFIDEVHERSVDSDFLLVILKKIMKKFPKLKIILMS
                     ATISVDKFRNFFNMDLNHIHIEGRTFPIEDYYLDSILNDLDYTITTNDQIIKPKADSH
                     FFKQGNINYDLIASLCLKIDKELSEDRNKGSILVFLPGIMEINHCIRNIEKAFDESRR
                     KNWCLPLHSALSSIDQKRVFKIPPKDVRKIVVSTNVAETSITIPDCVVVIDSGRSKTL
                     FFDSKIHTTKLIENWCSKAEVSQRRGRSGRITNGNCYHLYTKETETGMLDQPIPEIKR
                     TRLENLYLVVKAMGIKKVEEFLSGGLDPPDQHSLSKSKKVLTEIGALNKDNLSHLGNY
                     LSLLPTDLLSGKLLIFGCIFGCLEICLTLASIRSTGSPFLNNFENRERIKQTQNSFSK
                     GQGDLIGMANAFRQYEDLKGESKNAKKFLNENFLSYLTLKEIASTRTQYISILKDIGF
                     VAINYNPRNSNNEGHKSLNRNNENYSIVRAIIASSFYPQIARVQLPDPKYVQSLVGAV
                     EIDPDAKQTKFWIRNENYIDNVKNGVEANDVLPATRAFLHPSSVLFETNNVNDSNTPS
                     NEDFTNEEDINKVRQMYKDLKPRVPGSSNAAKATFVAYGTSHYTQKLYLRDITPTSTI
                     AALLFGGDIAYDMTSQVTSGKSSPGIVLDNWMPIRTWCKNGVLIKRLRILLDSLIEDK
                     LSNPHYSGNEDGSTSSNDEILVVIERILNI"
     gene            complement(429417..429488)
                     /locus_tag="DEHA2F04730r"
                     /db_xref="GeneID:8998880"
     tRNA            complement(429417..429488)
                     /locus_tag="DEHA2F04730r"
                     /product="tRNA-Trp"
                     /note="tRNA Trp (CCA) cove score=70.45"
                     /db_xref="GeneID:8998880"
     gene            complement(<429759..>431084)
                     /locus_tag="DEHA2F04752g"
                     /db_xref="GeneID:2903234"
     mRNA            complement(<429759..>431084)
                     /locus_tag="DEHA2F04752g"
                     /product="DEHA2F04752p"
                     /transcript_id="XM_460569.1"
                     /db_xref="GeneID:2903234"
     CDS             complement(429759..431084)
                     /locus_tag="DEHA2F04752g"
                     /note="similar to uniprot|O93870 Candida albicans FCR1
                     Fluconazole resistance protein 1"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04752p"
                     /protein_id="XP_460569.2"
                     /db_xref="GeneID:2903234"
                     /db_xref="GOA:Q6BMK2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6BMK2"
                     /translation="MTGGSPSSIEENDHHLRKKRVGKACDSCRIKKTKCDGKKPCNRC
                     MLDNKICVFTEKKKVKDKSHPNGYVELLETRLDLLRKSLEKMIQLSRPHLPFLNELMD
                     EETEENDVIPINRVVQYLINNEGLLYKVPVEWENGALIAANLEADSKNISEAAKKFYD
                     HKVDASDNPGRTNYYEEATKDKALNEEKDNSRIQNGSKLADTLNEELSDGGNSPTSTS
                     LTEKLNLDDFSLGGYSSNLLLGNAYPDIFSDFESDSNNSVNYAHNIPFGNSRQSSANT
                     NGNASLFTPIPISNSVTSLTNEFENHGIHSPTSIGSILPSQTSTSLRRSSSLHNQRPF
                     SPSHQKMKNNGHIFKPQHTGSSHSHLNSVYVSNNGNEFHLQKKLSSSSSSAASTPATT
                     AISPINTKLEEESTLPSDAIQLQNFNYEGLNIMDTANIDSFMINNPFMK"
     gene            <431726..>432568
                     /locus_tag="DEHA2F04774g"
                     /db_xref="GeneID:2903235"
     mRNA            <431726..>432568
                     /locus_tag="DEHA2F04774g"
                     /product="DEHA2F04774p"
                     /transcript_id="XM_460570.1"
                     /db_xref="GeneID:2903235"
     CDS             431726..432568
                     /locus_tag="DEHA2F04774g"
                     /note="similar to uniprot|P47137 Saccharomyces cerevisiae
                     YJR096w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04774p"
                     /protein_id="XP_460570.2"
                     /db_xref="GeneID:2903235"
                     /db_xref="GOA:Q6BMK1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6BMK1"
                     /translation="MKTIRLNSGKEIAEVGLGCYDIPNSVTKQIVFEACQAGYRHFDT
                     AVLYGNEYEVGQGISQWLKSSKDHKRSEVWYTTKLWNSQCGYMQAKAGIKSCLEKVAD
                     LQYIDMLLIHSPLCGPEERLNTWKACQEAVDEGLVKNIGVSNYGKHHIEQLLSWDGLK
                     YPPAVNQIEISPWCMRQELAQWCLQQNVHVEAYAPLTHGYKLSHPPSEFVPILEKYQI
                     DMAQLLIKWSLQKGYIPLPKTKTPARLKSNITLDFELTDEEMSIIDQPDAYDPTDWEC
                     TNAP"
     gene            <433769..>434776
                     /locus_tag="DEHA2F04796g"
                     /db_xref="GeneID:2903236"
     mRNA            <433769..>434776
                     /locus_tag="DEHA2F04796g"
                     /product="DEHA2F04796p"
                     /transcript_id="XM_460571.1"
                     /db_xref="GeneID:2903236"
     CDS             433769..434776
                     /locus_tag="DEHA2F04796g"
                     /note="highly similar to uniprot|P00359 Saccharomyces
                     cerevisiae YGR192C TDH3 Glyceraldehyde-3-phosphate
                     dehydrogenase 3 and highly similar to CA5892|CaGAP1
                     Candida albicans CaGAP1 Glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04796p"
                     /protein_id="XP_460571.1"
                     /db_xref="GeneID:2903236"
                     /db_xref="GOA:Q6BMK0"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /translation="MAITIGINGFGRIGRLVLRIALQRSDIKVVAVNDPFIAPEYAAY
                     MFKYDSTHGRYKGEVTSKDDSLVIDGQSIKVFGEKDPASIPWGKAGVDYVIESTGVFT
                     TTEGAQKHIDGGAKKVIITAPSSDAPMFVVGVNEQKYTPDLKIVSNASCTTNCLAPLA
                     KVINDKFGIEEGLMTTVHSITATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGK
                     VIPELNGKLTGMSLRVPTVDVSVVDLTVRLKKSATYEEISEAIKAASNGELKGILGYT
                     EDAVVSTDFLGSDYSSIFDQKAGILLSPTFVKLISWYDNEFGYSTRVVDLLEHVAKAS
                     N"
     gene            <435080..>435973
                     /locus_tag="DEHA2F04818g"
                     /db_xref="GeneID:2903237"
     mRNA            <435080..>435973
                     /locus_tag="DEHA2F04818g"
                     /product="DEHA2F04818p"
                     /transcript_id="XM_460572.1"
                     /db_xref="GeneID:2903237"
     CDS             435080..435973
                     /locus_tag="DEHA2F04818g"
                     /note="similar to CA5893|IPF2392 Candida albicans IPF2392
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04818p"
                     /protein_id="XP_460572.2"
                     /db_xref="GeneID:2903237"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ9"
                     /translation="MDKLFLDQTFKLYKSNDTLPQLTQPQLDYISTIICQYLFQTLAN
                     DIISEYRSYQDLFTDFKITHNVRQFNHFTITYISVRHRGLLPRQTIIFIKSPNNNDET
                     RPFNALVMIKATNSSLLSVLIQVIENLATEVPIIIRDLRFTEKYLNLIINNVSSGLVS
                     MNNYAEVIGDVELIYSTSHLVSNDSLRNITISVPEKDIQNLADSQGLVENINAFLKRT
                     SQLNFNNIPLFRFTSRLINLSQDGKLKISSDKLHLVRNSDFIDNIFTSNQSQHDALED
                     QENPFIWFLIGSIYNENFTQL"
     gene            <436222..>438519
                     /locus_tag="DEHA2F04840g"
                     /db_xref="GeneID:2903238"
     mRNA            <436222..>438519
                     /locus_tag="DEHA2F04840g"
                     /product="DEHA2F04840p"
                     /transcript_id="XM_460573.1"
                     /db_xref="GeneID:2903238"
     CDS             436222..438519
                     /locus_tag="DEHA2F04840g"
                     /note="similar to uniprot|P31382 Saccharomyces cerevisiae
                     YAL023C PMT2 Transfers mannosyl residues from dolichyl
                     phosphate-D-mannose to seryl and threonyl residues in
                     proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04840p"
                     /protein_id="XP_460573.2"
                     /db_xref="GeneID:2903238"
                     /db_xref="GOA:Q6BMJ8"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ8"
                     /translation="MSSSGIYSGEKDALRRVGKSSTKNDTVDSINSLNENAAPDFDKL
                     KRTQYDETKEFISSLKFLESFLAPILFTILSFSVRLYKIGINEHVVWDEAHFGKFGSY
                     YLRHEFYHDVHPPLGKMLIGLSGYLAGYNGSWDFPSGEMYPDYIDFTKMRIFNATFSA
                     LCVPLAYFTFKQIGFTIASTWLFTLMVCLELSYVTLGKFILLDSMLLFFTVATVFCFT
                     RFHNFNSDPNTKNFSRKWWKWLLLTGFAIGCTCSVKMVGLFVTTLVGIYTITDLWNKF
                     GDKTITWRKYSYHWIARVIGLIIVPIIIFLISFKVHFDLLYKSGTGDANMSSLFQANL
                     LGSDVVGGAREISIGHSVVTLKNQGLTGGLLHSHIQTFPEGSKQQQVTTYTHKDTNNN
                     WVFQRARGMEPYDTEKSQDIDYVLDGMVVRLVHPMTGRNLHTHNIPAPISKSEWEVAG
                     YGNLTLGDYKDNWVVEIMEQNGEEDKLRLHPLTSSFRLRNTELDCYLGVSGNNLPAWG
                     FRQGEVACYQNPFKKDKRTWWNIENNANKLLPPSPPDFKLPKTRFLKDFIQLNLAMMA
                     TNNALVPDHDKQDDLASSAWQWPTLHTGIRMCSWADDKIKYFLIGSPATTWPSSIGVI
                     LFAFIVLFYLIRWQRQYNDFPDQQKLKLFTMGGIYPMFGWGLHFMPFIIMGRVTYVHH
                     YVPALYFAMMIFCYELELFTLPLRNSSSAISKLAYALIFAAWYAIVIGTFWYWRHVSF
                     GIEGPKEDWTHLDLLPSWRIANDNY"
     gene            <438725..>439336
                     /locus_tag="DEHA2F04862g"
                     /db_xref="GeneID:2903239"
     mRNA            <438725..>439336
                     /locus_tag="DEHA2F04862g"
                     /product="DEHA2F04862p"
                     /transcript_id="XM_460574.2"
                     /db_xref="GeneID:2903239"
     CDS             438725..439336
                     /locus_tag="DEHA2F04862g"
                     /note="some similarities with uniprot|Q12425 Saccharomyces
                     cerevisiae YPR067W ISA2 Protein required for maturation of
                     mitochondrial and cytosolic Fe/S proteins localizes to the
                     mitochondrial intermembrane space overexpression of ISA2
                     suppresses grx5 mutations and similar to CA5895|CaISA2
                     Candida albicans CaISA2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04862p"
                     /protein_id="XP_460574.2"
                     /db_xref="GeneID:2903239"
                     /db_xref="GOA:Q6BMJ7"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ7"
                     /translation="MTYLTYRHGYSTETGTKSNTAPKAFKSSSFNQPKEIPKASTSQT
                     QTAEVPQEDIDDFNITKLIHGTTDMKIAITKRASNKLTSIAEDDKNPNAALKVEVESG
                     GCHGFQYNLKLTDLTEELKDENNELLVFKRMGDDGEVAQVVLDDSSLQILQDSKVDYT
                     KELIGSQFKIVDSPYTSTACGCGASFDFDFEKLEKVREREANK"
     gene            complement(<439525..>441408)
                     /locus_tag="DEHA2F04884g"
                     /db_xref="GeneID:2903240"
     mRNA            complement(<439525..>441408)
                     /locus_tag="DEHA2F04884g"
                     /product="DEHA2F04884p"
                     /transcript_id="XM_460575.1"
                     /db_xref="GeneID:2903240"
     CDS             complement(439525..441408)
                     /locus_tag="DEHA2F04884g"
                     /note="similar to uniprot|P31383 Saccharomyces cerevisiae
                     YAL016W TPD3 protein phosphatase 2A regulatory subunit A
                     and highly similar to CA5896|CaTPD3 Candida albicans
                     CaTPD3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04884p"
                     /protein_id="XP_460575.1"
                     /db_xref="GeneID:2903240"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ6"
                     /translation="MDSGHDDLYPLALLMDELKHDDVSNRVEAMQKLDTIAIALGPQR
                     TLNELLPFLNDVAQDDEEEVFAVLANKLGDFVPLIGGRENCEPLIQILLILASMEEPI
                     VRDKAIDSLNNISLELAHDQLIEIFLPMIQSLSQGNWFSKKIASCGLFKSIIIKVDSS
                     TRRDLLNVFYKLICDESPMVRRSAANSLPNLINKLTWFTENYPNNEDKVTNKDWEIIS
                     QLFQHLINDEQDSVKFLSIDVLISILDFFQQVNDQSHNSEFLISSLKLINDESWRVRY
                     TAADRFGKIAKNFATDESDLSKLIDPFISLMNDNEGEVRKAIAKQLPEFCELLSNFPT
                     TNQAILNKIIPIVNKLSQDPHENVRSSLASSITNLSPILGKQSTIDNLLPIFLVMLKD
                     EFPEVRLNIISNLSVVNEIIGINLLSINLLPAITELAQDNKWRVRLAIIEYIPKLANQ
                     LGESFFNDELLTLCMSWLWDPVFAIRDAAVNTLKELTIIFGSVWADNEIINRLLNNNN
                     SGNENIDEDNKIDYSNFIIRITCLFAITKLIPVMNNDIIVSKLLPFINNFIDDSVPNI
                     RFNIAKSYLVIAETLVKSKDNGAQKLINNEILPNLQKLQSDDDVDVRFFASKSIQGIK
                     DLN"
     gene            <441991..>442923
                     /locus_tag="DEHA2F04906g"
                     /db_xref="GeneID:2903241"
     mRNA            <441991..>442923
                     /locus_tag="DEHA2F04906g"
                     /product="DEHA2F04906p"
                     /transcript_id="XM_460576.1"
                     /db_xref="GeneID:2903241"
     CDS             441991..442923
                     /locus_tag="DEHA2F04906g"
                     /note="weakly similar to uniprot|P36069 Saccharomyces
                     cerevisiae YKL128c PMU1 and similar to CA5897|IPF2384
                     Candida albicans IPF2384 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04906p"
                     /protein_id="XP_460576.1"
                     /db_xref="GeneID:2903241"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ5"
                     /translation="MPQPSKLDILDSRLSPEDTFTFHNELHKQQEQKQEYWKFEIVPD
                     FFKQSDSETDETTFNYLKESFGRVKSWKDVFDGLGGLNETAESNVCYKVFFLARHGQG
                     YHNLAHDKYGNDAWNDYWSKINGDGEIVWGPDPELTELGQNQAKENYKQWQIELKDGC
                     RLPTKWFVSPLSRSIDTLTMTWENITKLGEARPLIKENIRETIGVHTCDMRSTRSIID
                     SKYSPKGYVIEPGFAEKDIYFKKDYRETVREHALRINEFFQEVFTVKDDIICVTSHSG
                     SIRASLLVLGHRQFSVGTGGMIPVFVKGTKIVNK"
     gene            <444072..>446474
                     /locus_tag="DEHA2F04928g"
                     /db_xref="GeneID:2903242"
     mRNA            <444072..>446474
                     /locus_tag="DEHA2F04928g"
                     /product="DEHA2F04928p"
                     /transcript_id="XM_460577.1"
                     /db_xref="GeneID:2903242"
     CDS             444072..446474
                     /locus_tag="DEHA2F04928g"
                     /note="weakly similar to uniprot|P38966 Saccharomyces
                     cerevisiae YDR089w and similar to CA5901|IPF2374 Candida
                     albicans IPF2374 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04928p"
                     /protein_id="XP_460577.2"
                     /db_xref="GeneID:2903242"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ4"
                     /translation="MKFGSNLNHLSIREWKWYNLDYNDLKYKIRILTQEDNYEISELY
                     QDFVNNFNRINLFIETKNDELIRKVTFFEANFNRLLEESNINTIVKQINFDEIFYQTI
                     EISVILKKLLKFITIQKIACRKIFKKLVKYYANKTEAGQFVSSLKDKLSRNERSFINF
                     SLANLTGRLTLLFNSIKVERGNLCQFVNEKSHIPRCKRTSLISLFHNTDDLEFDYNIS
                     LKKNFSMSCLISADVNNLNELFLNLNIYLGFNNCNVDKESTRMSYTYLFNDNMNDEPC
                     TIITHEDKKYSLIIACVGGLRKYSYCRIETDIADSLLKYLIDPSKNEVLDKLPTLYDD
                     NLTKATIDSILNNKLSPKFRLICNRSRFSLSNEADLHQEPDTFHNPEDDYLITVDEGI
                     LTTSDINIVSSTSFDFDRTHFERFPINKLSIYTNDLNLSNFEDNLTSEINNHKISNKF
                     QISYLKKLPTRIQKLVQIHSLNLFKNLDLYQYMLSCYMNVIPNDKYIDNHYSVLLNLD
                     LFKSFENIENYRNTLDIETKLINSKSDQILRHQSSLKSLPDYYAKHTQPSERPLLSKS
                     HQRNSLLSNNSSQTGLYTLHNSYSRENLNNSLTSHTSILNSDHSDEFDVDSELEYYDN
                     NNIASMNYESGDSVINKVILTIIQLKRKAYGVSRDVESYGSTNERYNNYKKDPSIVIR
                     STFNEYQYQFERDFDKILSFFYFSLIFISLFISGVEIGIIYSILSSQSNFDRFPIVQN
                     IWLILVIIIGLIVSSFLSLISLLLIFRRFHSCPKSHYLVITFGSFLIITSFFWCMFIL
                     FF"
     gene            complement(446586..446675)
                     /locus_tag="DEHA2F04950r"
                     /db_xref="GeneID:8998881"
     tRNA            complement(join(446586..446622,446637..446675))
                     /locus_tag="DEHA2F04950r"
                     /product="tRNA-Tyr"
                     /note="tRNA Tyr (GTA) cove"
                     /db_xref="GeneID:8998881"
     gene            <447286..>451713
                     /locus_tag="DEHA2F04972g"
                     /db_xref="GeneID:8998882"
     mRNA            join(<447286..447307,447425..>451713)
                     /locus_tag="DEHA2F04972g"
                     /product="DEHA2F04972p"
                     /transcript_id="XM_002770700.1"
                     /db_xref="GeneID:8998882"
     CDS             join(447286..447307,447425..451713)
                     /locus_tag="DEHA2F04972g"
                     /note="similar to uniprot|P47169 Saccharomyces cerevisiae
                     YJR137C ECM17 Sulfite reductase beta subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04972p"
                     /protein_id="XP_002770746.1"
                     /db_xref="GeneID:8998882"
                     /db_xref="GOA:B5RU98"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:B5RU98"
                     /translation="MGSQIEAISNIVKNIEGSVFVTQPAKSVESSFSKYLPNANTLID
                     SNDPYSVINNYAEHRTEGEEQDDEIITVITNGSTIFRNLPFLSSTAFKTSKIVSHVEL
                     VNFDFSIVSTLRDLNVPVLVSQSTNESVVFSKLSYNLSQRFGQPVFHFFAPSNYRSAL
                     SEKVDGKIIIDDLSKYEFNDLLSKFGVSPFEVVTGSSKAQHSIVYFGQLNDELISAAK
                     NENVVLVSIKVYKPFDLQKLLTIIPSSVETITFVSQTTSPSTSFAPLLLDFFQEYSKY
                     QTLKNFTKVAAAFFGYIKSEKYSEIIGNLLSNIKSESPVQNLSFGKTNTELATKASKE
                     RHGESLKAITNVHNLEQAYLKILQQVNTDSLNILNEFNADNIGVETNPEYGYGAYLNF
                     EEQQKQLTDLVYAAIQDNLFKSIDNEKLIDNLSKWLINVRENIETTSNSVLETIKLLE
                     TDTNSSNAAKILDLKEYFKVNKNWLIGSDAWSYDLGSSGVHNLITSNKNINMLIIDSE
                     PYEDKSNDKTVNGFRKKDVGLYAMNYGGCYVASVAIYSSYTQVLQAFIEAEKFNGPAI
                     VLAYLPYHNEFDNTLSILKETKLAVDSGYWPLYRYDPTIEDESKSFILDSSNLRNQLK
                     NFLDRENKLTLLAKKDPLLSRNLTSNATTEIKAKQLQAANDSYSKLLQGLSGPPLTVA
                     FASDGGNAEAVAKKINRQALGRGLKSIVLAMDDISMEDLPNETNIVFIASTSGQGEFP
                     TNGKQFWDGLKNSNDIDLSTIKFSVFGLGDSEYWPRKEDKHYYNKPSKDLFNKLKFYG
                     GVELIDIGLGDDQDADGFNTGLNEWEPKLWKALGVDNVEGVEEPKPLTNEDMKIQSDY
                     LRGTIVEGLNDQSTGAISAVDQQLTKFHGIYMQDDRDIRDDRKSKGMEPAYAFMVRVR
                     LPGGIATPSQYLRMDELSNERGNGTLKLTTRATFQLHGVVKHDLKPAIRGMNAALMDT
                     LAACGDVNRNVMVSALPHNAKVHSQISKTGALISEYLLPQTTAYHEIWLQGEDEGDKA
                     GASKNWENRKEGPKKEKTLVAGNALTDFEPMYGPTYLPRKFKVVITVPPYNDVDVYAH
                     DIGLIAIVEGDEVIGYNVLAGGGMGSTHNNKKTYPRTGSMFGYIAKDQIHIACEKIML
                     VQRDFGDRTNRKHARLKYTIDDLGVEVFKGKVEELLGFKFEKAKPFEIKSNVDYFGWC
                     KDETGANHFTAFIENGRIEDTPELPQKTGLSKIAEYLLQNERPGEFRLTGNQHILISN
                     INDDDLDTVKSLLAQYKLDNTDFSGLRLSSAACVAFPTCGLAMAESERYLPELITKLE
                     EALEDYGLRHDSVVMRMTGCPNGCARPWVAEVALVGKAFGAYNLMLGGGHHGERLNKI
                     YRYSIKEDEILSILKPLFKRWSLERNEGEPFGDFCIRIGIIKPTTEGKFFHDDLPEDA
                     "
     gene            complement(<451839..>452177)
                     /locus_tag="DEHA2F04994g"
                     /db_xref="GeneID:2903515"
     mRNA            complement(<451839..>452177)
                     /locus_tag="DEHA2F04994g"
                     /product="DEHA2F04994p"
                     /transcript_id="XM_460579.1"
                     /db_xref="GeneID:2903515"
     CDS             complement(451839..452177)
                     /locus_tag="DEHA2F04994g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F04994p"
                     /protein_id="XP_460579.2"
                     /db_xref="GeneID:2903515"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ2"
                     /translation="MPYTKAEKAKLIQYIKNHADKRLQTLNSESDRIAEVCENKVLRR
                     LNSVSVTLWNIKLKDVLEIERHHKPTIKGLLKDIRSLQENSTSNSNSSTNISYNIRNR
                     TTSNGKISKP"
     gene            <452467..>453306
                     /locus_tag="DEHA2F05016g"
                     /db_xref="GeneID:2903516"
     mRNA            <452467..>453306
                     /locus_tag="DEHA2F05016g"
                     /product="DEHA2F05016p"
                     /transcript_id="XM_460580.1"
                     /db_xref="GeneID:2903516"
     CDS             452467..453306
                     /locus_tag="DEHA2F05016g"
                     /note="similar to uniprot|P38886 Saccharomyces cerevisiae
                     YHR200W RPN10 Non-ATPase base subunit of the 19S
                     regulatory particle (RP) of the 26S proteasome"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05016p"
                     /protein_id="XP_460580.1"
                     /db_xref="GeneID:2903516"
                     /db_xref="GOA:Q6BMJ1"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:Q6BMJ1"
                     /translation="MVLEATMIAIDNSEYMRNGDYLTSRYDAQLTATEFIFQNKVNSN
                     PENTVGLLAYGGNGPQVLSTLTTDFGKILSGAHETKISGENHFSSGIQVAALALKHRQ
                     NKVQSQRIIIFVGSPVTESEKDLEKLAKKMKKNNVAIDIINFGEESVNTSKLEKFNSI
                     INNHDNSHLVSIPPGPRLLYEVIATSPILVEDGFDMGGNGTDMGMDAFGGGNGDIIDP
                     NMDPDLALALRLSLEEEKARQEREAADKAKDESGSNDLEQIAEDKEQPDHNNEDTNMK
                     DAN"
     gene            complement(<453539..>454510)
                     /locus_tag="DEHA2F05038g"
                     /db_xref="GeneID:8998883"
     mRNA            complement(<453539..>454510)
                     /locus_tag="DEHA2F05038g"
                     /product="DEHA2F05038p"
                     /transcript_id="XM_002770701.1"
                     /db_xref="GeneID:8998883"
     CDS             complement(453539..454510)
                     /locus_tag="DEHA2F05038g"
                     /note="some similarities with uniprot|Q04659 Saccharomyces
                     cerevisiae YMR048W CSM3 Protein required for accurate
                     chromosome segregation during meiosis and similar to
                     CA4317|IPF2109 Candida albicans IPF2109 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05038p"
                     /protein_id="XP_002770747.1"
                     /db_xref="GeneID:8998883"
                     /db_xref="GOA:B5RU99"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="UniProtKB/TrEMBL:B5RU99"
                     /translation="MDLEEELSLFQHEETVPTESGQQSQTNGSAEREGDDLLGLDQTI
                     KLSSRAKIAKIDNERIFNKSKGLNYVIRNHSKLIRVFQKNDKALQKTLSSKKSSLSSK
                     AVRSLKHENEFKNLSSMLQFYQLWCHGLFPKAKFKDCLQLLRSFGSKSGQLKLYRREL
                     IEQELRKLKENKGIMDTERMEMPETQNQQSEPLPENQGPEGIHDIADDDWSFMNTNQS
                     NGLFVGEDDDLYHTPTTPPAEAVSRDVGSAASNSGHNASLDAVNTKTNVPASSNDSDD
                     SDDPFSDDDIPIGSEPMNKYDEYPDEEIEVDDHEHEDELAIMREMGM"
     gene            <455061..>456101
                     /locus_tag="DEHA2F05060g"
                     /db_xref="GeneID:8998884"
     mRNA            <455061..>456101
                     /locus_tag="DEHA2F05060g"
                     /product="DEHA2F05060p"
                     /transcript_id="XM_002770702.1"
                     /db_xref="GeneID:8998884"
     CDS             455061..456101
                     /locus_tag="DEHA2F05060g"
                     /note="some similarities with CA1099|IPF12312 Candida
                     albicans IPF12312 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05060p"
                     /protein_id="XP_002770748.1"
                     /db_xref="GeneID:8998884"
                     /db_xref="UniProtKB/TrEMBL:B5RUA0"
                     /translation="MLYSLISNLLCFIWPLFLTLKSLSGEYCKKRTVDGKNSDQIKFL
                     LNYWICFIIVDYIERSVLYNAIFWPCFGFGFLPELFSCSIKLWLFYNHGCLVINYCYL
                     NQFLRKVTCELEAVDPLEVFEVNLVNPVMKTLLTENHLAPLKLLSSMKIGTISWTVGR
                     IVEFCQCFVKSADQSFLQFSLDYICYMDSKQELEKHFEITKRFLASVISFIQYQFIRL
                     NVQDEESLPKIVQLLLIPNVQQNVPLHHTPKFESHNDRIEPVRMDSKGTKANDTLEPE
                     LEYQSKSSISDQKYSINNKLLPRYVGNCQFTTYSKRKSQRTSSKPKYLDNAISGYVTT
                     TISNPFQFRKFR"
     gene            <456259..>457365
                     /locus_tag="DEHA2F05082g"
                     /db_xref="GeneID:2903519"
     mRNA            <456259..>457365
                     /locus_tag="DEHA2F05082g"
                     /product="DEHA2F05082p"
                     /transcript_id="XM_460582.1"
                     /db_xref="GeneID:2903519"
     CDS             456259..457365
                     /locus_tag="DEHA2F05082g"
                     /note="weakly similar to uniprot|P47172 Saccharomyces
                     cerevisiae YJR141w required for cell viability and similar
                     to CA4316|IPF2111 Candida albicans IPF2111 unknown
                     function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05082p"
                     /protein_id="XP_460582.2"
                     /db_xref="GeneID:2903519"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI9"
                     /translation="MYFTEYLPRINSISVIVENNDPIGNLIDIRLSSRDQVLIKFHDN
                     EISVNLPVKIKRDDKIRIANANQTADYLQLTIALTPHDSNDVSEKTESFMDFSSSNLV
                     QKWSCKDLKTKTPQTDNKNNFKLTCLKCSHAIIDSKEYDRFFDMPSELWSEMMEFWHC
                     HKPAEDPNEKDSHRNYNGNLKPGDNDVIIGSSYFLINKSKQLEISDQDVKCGLCKYNL
                     GILDNSTLKLFKWNLALKYKENIETFPSYIYVYNLIVDKINLSAIRKFNVTSESRQDY
                     MFIWIMNIGVDVSTENFVLNNSMKVFYYHDDIRGISKDDESIESVVLQDDVFNDFSKQ
                     LSKINNFIPNLKKTMTLKLDEEVKIFNVSFITGF"
     gene            complement(<457405..>458643)
                     /locus_tag="DEHA2F05104g"
                     /db_xref="GeneID:2903520"
     mRNA            complement(<457405..>458643)
                     /locus_tag="DEHA2F05104g"
                     /product="DEHA2F05104p"
                     /transcript_id="XM_460583.1"
                     /db_xref="GeneID:2903520"
     CDS             complement(457405..458643)
                     /locus_tag="DEHA2F05104g"
                     /note="weakly similar to uniprot|P38698 Saccharomyces
                     cerevisiae YHR201C PPX1 Exopolyphosphatase hydrolyzes
                     inorganic polyphosphate (poly P) into Pi residues"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05104p"
                     /protein_id="XP_460583.1"
                     /db_xref="GeneID:2903520"
                     /db_xref="GOA:Q6BMI8"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI8"
                     /translation="MSVRSYLVTLKKQLETNSIKSPLRFVTGNQSADLDSVISAISFA
                     YFNYKKDESLLIPLINISRTDFKLRRDIVTLLDSYSITEDSLYFIEDFKRITASDVPI
                     ELTLVDHCNIQGDVFTDYLSKGKLDIVGIIDHHQDESVFLNANPRIIHSNGSCSALVF
                     NYWYDQFSNKDIFYEKDNEIVPLLLGSLLIDTSNMSQKVEEGDVIAFKEYQNILQKNE
                     ILLKGLGNYACQSTDNIEKLLKGYYKQIKVAKKDMKGFKFYDILKKDYKQFKFTSRCN
                     VSTVVGFSSIGKSFYWLLSNYSMQEISETFNEIMKDFNLDLLIMTTSYTRQENDQYTR
                     EFSYAFNSSNPRKDILLQLANLANDELKLDSDIYKLENLNSYLADLGKGQTFKIYNQN
                     NTAASRKQIVPVIKDILENN"
     gene            complement(<458800..>461064)
                     /locus_tag="DEHA2F05126g"
                     /db_xref="GeneID:2903525"
     mRNA            complement(<458800..>461064)
                     /locus_tag="DEHA2F05126g"
                     /product="DEHA2F05126p"
                     /transcript_id="XM_460584.1"
                     /db_xref="GeneID:2903525"
     CDS             complement(458800..461064)
                     /locus_tag="DEHA2F05126g"
                     /note="similar to uniprot|P46971 Saccharomyces cerevisiae
                     YJR143C PMT4 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05126p"
                     /protein_id="XP_460584.2"
                     /db_xref="GeneID:2903525"
                     /db_xref="GOA:Q6BMI7"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI7"
                     /translation="MSQAVRKRGGKKSATPPTSSIVDDDLNKLKAYNEDSETPKEPER
                     KYYIALIIVTLCAIYTRFSKIDTPAKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLL
                     IAFVGYLVGYDGNFKFENIGDNYIEHNVPYVAYRSFSAIQGAAVVPVMFLTMKNLGYS
                     VPACLFSSLLVCFDNAHVAESRLILLDATLILSVALTIFAYTRFITYRKVPFSRKWWT
                     WLSLTGVFLSCVISTKYVGVFTYVTIGIGVLYELWYLLDFKRGLTLTDLSKHFFARLW
                     ALIIVPFMIYLFWFYLHFAILVKSGPGDSFMSSEFQESLLESPMARHAKDVHYNDIIS
                     IKHKETDAFLHSHLFDYPLRYEDGRVSSNTQQVTCVFDSENKESSDINNHWEILPPND
                     ADAEGKAVYTNDIVRFRHVGTGGYLLSHDVASPLKPTNEEFTIAYDDDANADHYNETL
                     FRLRLSESGNDKNKRKLVRTKAIPLKVIHVDTVVAMWTHDDELLPEWGFGHQEVSGNK
                     KVQDRSNIWTFDEIVNLKEDDKRAEYVPKVIRKIPFLKKWWELQLLMFHHNNILSSQH
                     PFASQPDSWPLALSGVSFWNDNEERKQIFFTGNVIGFWLEVGFLAIYVGLLLADQVTR
                     RRHVYILNNKARSRLYNTLGFLFIGWSAHYLPFFLMNRQKFLHHYLPAHLIAALFSGG
                     LVEFLCSNNSNKKTGQPKGVLKIRMAAFVSICAVGVVWFFFYFRPVTYGDISLSVEEV
                     KRRQWLDIKLHYAK"
     gene            complement(<461317..>464652)
                     /locus_tag="DEHA2F05148g"
                     /db_xref="GeneID:2903526"
     mRNA            complement(<461317..>464652)
                     /locus_tag="DEHA2F05148g"
                     /product="DEHA2F05148p"
                     /transcript_id="XM_460585.1"
                     /db_xref="GeneID:2903526"
     CDS             complement(461317..464652)
                     /locus_tag="DEHA2F05148g"
                     /note="some similarities with uniprot|P32380 Saccharomyces
                     cerevisiae YDR356W SPC110 Inner plaque spindle pole body
                     (SPB) component ortholog of human kendrin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05148p"
                     /protein_id="XP_460585.2"
                     /db_xref="GeneID:2903526"
                     /db_xref="InterPro:IPR007483"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI6"
                     /translation="MNGSSRSLIRALNNVADHWKDNANVDKISSEESELFEVISLFNE
                     KHNDLQSIKQSIDINGELFRIYNGYIKPASNLPREILFLEILIQLSPILIDNEIKLWS
                     KTYLKPAVDSAGYDIQLVLKSREFIRQLSMKTIPSKDPLLIERRDQIALIVMDTIIQL
                     YIGQSDERYDVIGLHLPKENSDSQLYYERIRYMKKNCEDLLHEYGLKKTKEYFSLINR
                     YFKTSSERLDMLTLLLRLVSSHTLQVYQIVDTDLFYNVLRSLLYDYNESILLVSLSLL
                     VMLIPQVCNKMVKSFPDLLVIYIRLANWESFNRHIPNRTDYLSKSLDENFKLWDLAEA
                     DSLNDVALTNSKIELDVSHFITLLYGLFPLNLSKFCQSPFNFLINRPTEIFKIKLLSS
                     IMEDKGSPRERNLELDVIDTTREFLRSFSFHPNFLQYDKLTLQNELENPLLWLLKETT
                     DNDLRSEEISLECLSFNPHLVINAVHGHEELARSSWDKPSSDTNTNTNNNNNNQFGFI
                     YTGTGESNAGSLSNSRHVSRKSSFATPTYLNLKDITLQKLPISLQHLNSKLSNQIGER
                     KSSISDIKFKDVKFDKGLKEEHQINENENEYTPPDSDLGAYNRFDLDVDGSQESKQYD
                     RFESNQSLSDMFSAHEKLYLFSPKSSDPKIDSNVPARDQSKNPNSPNEKVKNELLQRP
                     ITSPITSLETTSVHRKSISGTISNVTTLDSSQVQDNNITNNKFQHGTALEYYHRELLL
                     MKNELEFSNYMRDLNKTHYIKLKLKLNKLSKQTRQHDQSIEHKNNTLKIDSLKLGYNT
                     LTETLKELKLQLTESRSKFKDENSILFSKIKDLENENYKLKTDLKNATTEQQLLGSNL
                     SHSIQVVLPEKEFEVNRLKTKLSELEQMNETLNQEIKLVTEKNTSKETKHLDETQTSS
                     TFNLSEQEKQIYNLKNDILMLNDKNLKISQELIKAQDLYDAAIKSYESKLSSSKGDLT
                     KNISTFTSQYERRIQELAAIILKYEGLLDEKNSRIAQFSTSKPIEINNTKYNDATKAM
                     SDKSYDSGIPQARNNASQESYELESKGRETPTSVEGMYSGQPDHVPLHQNYVSSSHFP
                     SQTAVTPIVRGRGGIQKRSKKHM"
     gene            <464786..>465721
                     /locus_tag="DEHA2F05170g"
                     /db_xref="GeneID:2903527"
     mRNA            <464786..>465721
                     /locus_tag="DEHA2F05170g"
                     /product="DEHA2F05170p"
                     /transcript_id="XM_460586.1"
                     /db_xref="GeneID:2903527"
     CDS             464786..465721
                     /locus_tag="DEHA2F05170g"
                     /note="similar to uniprot|P47173 Saccharomyces cerevisiae
                     YJR142w"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05170p"
                     /protein_id="XP_460586.2"
                     /db_xref="GeneID:2903527"
                     /db_xref="GOA:Q6BMI5"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI5"
                     /translation="MTQTSYIDIIRKIDSFTYEEDEFYYKLRAHDGSATLGYITPTIS
                     KYFEDEQDILLDAEKKTLTISPYLDTIEKRNALFSSIATKWRKIPYFSESLDKGWRNE
                     LYTVYNPTHTPYVQIERAFSVLIGVITYGVHINGYIPPHKSSNGNLKMWVPRRSATKP
                     TYPGMLDNTVAGGLGYPYGIWETVIKECYEEAGLGEDFVNSHVRSAGVVSYIFEPNGH
                     KDTVQPEVEYIYDLEFDNETDVLPYPEDGEAEDFTLMDVSEVLDRLLNNEFKPNCGLV
                     VTDFLVRHGYITPESDENYLEIVSRCHRMMPFPTI"
     gene            <465827..>467698
                     /locus_tag="DEHA2F05192g"
                     /db_xref="GeneID:2903528"
     mRNA            <465827..>467698
                     /locus_tag="DEHA2F05192g"
                     /product="DEHA2F05192p"
                     /transcript_id="XM_460587.1"
                     /db_xref="GeneID:2903528"
     CDS             465827..467698
                     /locus_tag="DEHA2F05192g"
                     /note="weakly similar to CA4309|IPF2127.3 Candida albicans
                     IPF2127.3 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05192p"
                     /protein_id="XP_460587.2"
                     /db_xref="GeneID:2903528"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI4"
                     /translation="MVSEILYNTPDFDPGSNLNQLIKSILDYQSKRQSDESLRLKKNY
                     SPNDFISKVNNLEEFFYDNISYLTKIPQKNHQFLWLLSLESLATALYRYKLFYYENLL
                     NDSYVDRQEIYNTNHILGTIATRLESITSRFRDLANRFFSEHISIGKFICSGTYSTII
                     MNKLFNFITTSFKLLTIDEAEDMLYINEVTLTIQSIGEFLFRYYTYIGGLEEVAKQEL
                     NNDVFPTLTEFIKTIYVIGKSQLILPFMVPSEISNDEFKPIIHPKTPLKVIQSSTIDF
                     TFLKDYYKYIAFNLLSLSLSQETSIEHEYNVQSDIYFRVLLSFPNLSTTVYERFEISN
                     NQPENLFDTGQLQERIQNDNIDFSSVSLLERQEISLLFILNYLLQLTELRNLIEPEQY
                     YKSELTFLVRSLSTSISQDIHVSASRSGSLHPSTAPSYSQLNMLDSSNKIKQVSNIKF
                     SSLSSIILHGTYKEKLIMIINFCEKLNQKSLNIPHIIERFNLDSNLENDFQHLVSMID
                     TEKYPGKLIYAKTISKITRLLKMISIKHLVQSAGINNVPESYLNRLFCSKEPLSVSTK
                     VKEIVKFTQYSDSNKEVLIRFESLDNRTNPSLNSSIKNQINNYNTTKELEKLSDHLK"
     gene            467823..467911
                     /locus_tag="DEHA2F05214r"
                     /db_xref="GeneID:8998885"
     tRNA            join(467823..467860,467875..467911)
                     /locus_tag="DEHA2F05214r"
                     /product="tRNA-Met"
                     /note="tRNA Met (CAT) cove"
                     /db_xref="GeneID:8998885"
     gene            <467966..>468928
                     /locus_tag="DEHA2F05236g"
                     /db_xref="GeneID:2903530"
     mRNA            join(<467966..468018,468073..>468928)
                     /locus_tag="DEHA2F05236g"
                     /product="DEHA2F05236p"
                     /transcript_id="XM_460588.2"
                     /db_xref="GeneID:2903530"
     CDS             join(467966..468018,468073..468928)
                     /locus_tag="DEHA2F05236g"
                     /note="weakly similar to uniprot|Q9P7V3
                     Schizosaccharomyces pombe SPAC30.03c Translin-like
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05236p"
                     /protein_id="XP_460588.2"
                     /db_xref="GeneID:2903530"
                     /db_xref="GOA:Q6BMI3"
                     /db_xref="InterPro:IPR002848"
                     /db_xref="InterPro:IPR016069"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI3"
                     /translation="MSKLQGLFGLFQEEINTEINFKNKINDLENLFNAELAIIKSEYA
                     NLSTIQPSNLPYDFSSEDITSVPFVFALRELCQEKIINNENRDITELGTVNEVKVIDN
                     LNLLSDRYHRYLQELNGINCKAIFKDRFSHKINEEIIYVLMANRYFKTISYIYQVDLK
                     GKQLDKILHPLISKSDQDIMGLVITPEEIQRVLSLEKLNYNDYLLGLLRLIETVVEYT
                     IDTIISISISSENSPKQLQNIQYSLSLINLQIVTKLQNGFQMLDLKNDNIRRKFDGLK
                     YNFKKMNGIVYDLSLRKLIVNEVEIY"
     gene            complement(<469009..>474339)
                     /locus_tag="DEHA2F05258g"
                     /db_xref="GeneID:8998886"
     mRNA            complement(<469009..>474339)
                     /locus_tag="DEHA2F05258g"
                     /product="DEHA2F05258p"
                     /transcript_id="XM_002770703.1"
                     /db_xref="GeneID:8998886"
     CDS             complement(469009..474339)
                     /locus_tag="DEHA2F05258g"
                     /note="weakly similar to uniprot|P47171 Saccharomyces
                     cerevisiae YJR140C HIR3 Transcriptional corepressor
                     involved in the cell cycle-regulated transcription of
                     histone genes HTA1 HTB1 HHT1 and HHT2"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05258p"
                     /protein_id="XP_002770749.1"
                     /db_xref="GeneID:8998886"
                     /db_xref="GOA:Q6BMI2"
                     /translation="MIDDMIISLIYQEADEKLLNTLYEIFTYLNSAKLARFTLEYLIS
                     GKDESDDLFGLIPVEDLCKQKYKLLLQRLHISKPSSSDGDGTRELELIKEKLAFLEPI
                     KADYNTSIENTTNLKTVNINIEYAQRDLNWTSVIDDINKKVKHLQDKEKSQELSRLRI
                     KDLDPYLLTENPIERVRFTIPVPEDESTHDDDVEKNDSKEVDKENNEVPDGEILIDEG
                     SNHINSDEEIFLEAREFLEKEINDGKETQDSKNPSEKDVEGSTCKLDHIPANREVIEG
                     EKHISEENAISKSAPMIQRSSKRVRYRNEESSMEINDVEITRSCFVETERFFENLNSY
                     LDLFNKEAATNLTLTNIVNIYVPEKNNNDENSAEGYVNDFLFILNDWNTRKYTHSLFV
                     DDDTPAGSTASKSTEDEKIKLMEVLSTFGKKGDSLNSDLSKDIKDISSYETTEEIQKF
                     LHDINENPCHYEELKLLILRKLLSIQRPKGDFKGHAAYCLITDTIWNSKLYDRIREWT
                     IQCESIILNHLRLEGCDALGISHMLDDFSFSVAIYEILVDTYISIKDQINSMTSLNYK
                     RTTHKPNKATLNNISLELVKIGDKLNRWTQHFEDLLERIDLSFAMMDQDFFTYYCRYK
                     WSFIHKEKSQNTIWQEKGFIMSQLHELHDNISTKKEAEAHIPLPNYENINEISVDSIK
                     TQVTTTSILSILAKILYAKPGTNNDEAIHLLETILISDSSPDESIEALPLNKEVSTFD
                     KDALIAIKDFLEESPVDMKLSSWNILFSYYDENNQFAKFQHGFEQNVSFILYYLNSNT
                     YNGLIGTKFETLAKVLGSYGKHVRIFLSHLRENNWKLSRDSHRTSSSIERTFSELLKL
                     FELFYLFSIHEEAALISSSKLSVKARSNKAYERFKDIFISTVSVIVIYYKELLMNTVK
                     IEESKVPSEIEKTIGNLICDFHEQLGWRRVCDAAEGLFLNLAQDILVAFDNNLFEKQL
                     AQLISCRYHYSVSIDTFTPANHETKKTAEFDLSSTQRMADFILPLCFKKNPLKATPKS
                     DMKLLIDEFYEVVGDPDFDSCEILSRNDSLFEHFLESTSITSRFLRDTFYGLEELDFR
                     NPPDNANIIRSGLYYMQGLLMFASYKIRKKSTQSRAVELENIIMLLKNDLVYCTNRME
                     SWFLLGQAYGFLVEDDLIWTSDKLTVPERKIGTANLQRKSLICYLMAINESTKANIKK
                     DLPLKTTIGSLMALFSKEMYNAAMKPMDMHAFKVQNIPRFIKKPTGAAFVSVSTSSVN
                     SNLCLKVIQQSLHIAIKSKRNDWTYYYYLSKVQRKLNKSPRIVLDTLQQASNIAKEQS
                     NPSDPIIEPHYKKCSLIYKYAKEGSLSFQSGLEFLKNDMVINYEKGNKSIEKPMDFYE
                     IIVECLKAVISYDKKRWHHKPRYRLAKVLFEEFGKITEAKEEISSIVSLKSTNKTLVS
                     IWKPENERPGKHFYYTFQYAHFYVVLLSSDRNLIGLIQMLPKLRRSNSIMVSLYSLWE
                     TLCSSICKIIRNSLKVDEGFTERFMSSSGYQKFMMNSKSLLENMKGDGVPGELQIHLC
                     FLHAITDMKKLNNGFGPTSLIDDTMVAIFIRIYLYFEKQSNNLKPMGTPEPTESPNEK
                     AKKLAKRDFFPLISDMLKTFRRDIENILKDQPDIYNDFVSCSDKKVEKEGVVGKENNV
                     NSKILEEEQSREVIKTPELKMDSINFESVSDKHITQNKLEADTILQENNDKSPKNNGI
                     KDNENSIPDSRARTLDEMLFNKGLEKKVQGESPTAKKQKLNSDHHDSASE"
     gene            complement(<475004..>475930)
                     /locus_tag="DEHA2F05280g"
                     /db_xref="GeneID:2903532"
     mRNA            complement(<475004..>475930)
                     /locus_tag="DEHA2F05280g"
                     /product="DEHA2F05280p"
                     /transcript_id="XM_460590.1"
                     /db_xref="GeneID:2903532"
     CDS             complement(475004..475930)
                     /locus_tag="DEHA2F05280g"
                     /note="similar to uniprot|Q03193 Saccharomyces cerevisiae
                     YDR090c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05280p"
                     /protein_id="XP_460590.1"
                     /db_xref="GeneID:2903532"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6BMI1"
                     /translation="MYNAVAENVLGTIGTILWCIQLVPQIIRNYYVKDCEGVPSVMMF
                     LWALSGVPFSIYFFGTDGSIPLRVQPQLFTLCCVITWIQTLYYPPVQCGLRKVIIYAS
                     TFIIIAAGAEVGFILWLRPIYREGKEWPLLIIGIIAALLIALGLIPPYFELAKRRGRV
                     IGINFVFVSMDSLGAIFSLVSIVVGTMDILSIVLYAIVIALEFGIFASHTIWYIRFGK
                     KEKAKENNQERDHEQEQEAESAYESSQEYSQEHLQEHSKEHSQEHSKEHSQEHSQEHE
                     NSLNKMVEIQAQISRSDKSEYEYNEKYNNYDI"
     gene            complement(<476052..>478979)
                     /locus_tag="DEHA2F05302g"
                     /db_xref="GeneID:8998887"
     mRNA            complement(<476052..>478979)
                     /locus_tag="DEHA2F05302g"
                     /product="DEHA2F05302p"
                     /transcript_id="XM_002770704.1"
                     /db_xref="GeneID:8998887"
     CDS             complement(476052..478979)
                     /locus_tag="DEHA2F05302g"
                     /note="weakly similar to uniprot|P14736 Saccharomyces
                     cerevisiae YER162C RAD4 Protein that recognizes and binds
                     damaged DNA (with Rad23p) during nucleotide excision
                     repair"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05302p"
                     /protein_id="XP_002770750.1"
                     /db_xref="GeneID:8998887"
                     /db_xref="GOA:B5RUA2"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:B5RUA2"
                     /translation="MSEYRYKELLKESLKGSEVDNGTNTRKRRKTGGQYVFNGLDNTK
                     IENQEVITISDNDQESEDSVNSSDFEDVSLDDEEESHGLNLFPDNTDSNDKQESLSIT
                     INPVQEEVKKKRKFNSISKSEREQRRIIHQMYVGLMLTHGVIRNRWCNDYNLLMELKK
                     NVSPQILELLHQKDSDDVLPLVKSRRFLDGLKKLMMMYSLNYRVTSQGLVRKNWNELS
                     IKQSKIEANVTFSKFFNLVTKFRGSRDIAAQGFVSLLRSVDLNARLVFSLQPPDYTSI
                     TELPKINNNNQTTSSPEVTQSPLLQRFASRNSKRNLLDSMRKKSTTVTDEVKHANYFE
                     DSSYPIFWVEVWDKYVKKWVSIDPIVLQTIEVPPMRRKCKFEPPSTDIRNQLTYVIAY
                     DRLGGVKDVTRRYSLYYNAKTVKKKIHFRSEEDEIWYNRILKASCSQLRRNKINKIDI
                     LESKEFHTRDLAEGVPNNIADFKNHPVYALESQLKQNEIIFPKDESSTCGFFRNKSSK
                     KSQEKAVIPIYKRSHVHGLRSAKAWYLRGRVLKVGVQPLKLKKKQMHQKQPTSDDDEE
                     EETTRLYAEFQTKLYIPPPIVHGEIPKNAYGNIDIYTPSMLPDNGYLVDTTSQFSMKI
                     AERAAKIIDVDYAKAIVAFDFGKSGKKKSQSRNPTAREGGILIDIQYKEAVYLVMNTL
                     LEEEESLKRRVVELNSLNNWKYFLTKLRISERLNKVHGKLNSEDEESNFTDESEDDDF
                     SIHSDNSGSDTKEFGGGGFFISGNPESNSATEKYEATPEGFEEPYIGKSEGNEGVMEA
                     KYMVEDTDFIEEESGGGFFVEDPEPEAKYSQARIGGPSINVELDDMPDYYFKQDENGE
                     LIYDPSSDGNQLRSESSGADGTDTPKGNHDLSCTYLSKEALPDRVLTQDDTHEETSQM
                     ILSPEAANDIEATGKTIVDKNDSSVSSCGKSSSGVESFQDSLGEEIAKEEQVFGFEYS
                     DTD"
     gene            <479250..>481634
                     /locus_tag="DEHA2F05324g"
                     /db_xref="GeneID:2903534"
     mRNA            <479250..>481634
                     /locus_tag="DEHA2F05324g"
                     /product="DEHA2F05324p"
                     /transcript_id="XM_460592.1"
                     /db_xref="GeneID:2903534"
     CDS             479250..481634
                     /locus_tag="DEHA2F05324g"
                     /note="weakly similar to CA4348|IPF3638 Candida albicans
                     IPF3638 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05324p"
                     /protein_id="XP_460592.2"
                     /db_xref="GeneID:2903534"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH9"
                     /translation="MDKPHRSFYRSLDRERLLYKKKYVVIEPSIKYLLVKLQKEREGK
                     IHEMQVSGQVLPNPFKMQNLLEPIIYHTTLSLLYILDDRCLDSKYLQSQYANQVEHLT
                     IILNKIVTSKTTKLNYEQIRSQIEEQSGISLELMASEVISKFAGTDIPYNTNSVFIKP
                     LQMALLCFLALSRRAYKQQYSIERDLVPWMHSIMAPSVSVSCESLRSLSKIPPCITSD
                     ILLRTPMSKNEYYLQADIWLDFMKDIGAAYHKRIKHLKLCINNLIFYGIQYDSHKLPE
                     LIFRSLHFFTNTTTGYQFSLVTQEFLNGIIWKLVFDYLRSSITYKPNIMANIIKTQEV
                     VVQFLSKVGDKREKVHSKLNIEGNMGIVLAINNISQEKSEKLFKIAEKNLMHLDLHHS
                     NSKPMVAYHFTRIFLSVTPEELLHNFNNGASDYFQSATLWLGFIRKLNEFGLLDEKRS
                     KKILLELVNNKERILITKDIILILLQPIKTLDDIDEFISILQKNSGAKEKDSLLAMAH
                     SSSILPKYLTILYRNVHLRNRPHPEVKYPWDKYKKLHPITTIKDQESPQNFRNFSSIL
                     SYARYLYDTGFKKKTSKIVGIMLNGEINVQPENLYELYKSELFDKNNFNPDESCLSAL
                     IKAAMKQVDGNDKASCIMWGDMYAPQVAIHEFKQHVMTEAFDKDLGKADNDPGIYPQD
                     DLWQRYIHLLEKYDYISELSTIIQWWENLNFRPNYLTLLMLLGSLPTEYGSRYIKHVQ
                     KVREDSAKSTYAHIGEDPKSNAQNYLAWSWPSLEELERFKLKKSKLSNSSIRID"
     gene            <481869..>483347
                     /locus_tag="DEHA2F05346g"
                     /db_xref="GeneID:2903535"
     mRNA            <481869..>483347
                     /locus_tag="DEHA2F05346g"
                     /product="DEHA2F05346p"
                     /transcript_id="XM_460593.1"
                     /db_xref="GeneID:2903535"
     CDS             481869..483347
                     /locus_tag="DEHA2F05346g"
                     /note="highly similar to uniprot|P08417 Saccharomyces
                     cerevisiae YPL262W FUM1 Fumarase converts fumaric acid to
                     L-malic acid in the TCA cycle"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05346p"
                     /protein_id="XP_460593.1"
                     /db_xref="GeneID:2903535"
                     /db_xref="GOA:Q6BMH8"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH8"
                     /translation="MLRLTSKYTPVARSIQLRSLSSTSALLSSTRTESDAFGEIEVDS
                     AKYYGAQTARSKHNFKIGGEAARMPIPVVRAFGILKKSAAIVNEGLGALDPKLSKAIQ
                     QAATEVAEGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPND
                     HCNMSQSSNDTFPTVMHIAAATEISNSLIPELTKLRDALQAKSDEFKDIIKIGRTHLQ
                     DATPLTLGQEFSGYVQQLTNGIERIEKTLPNLQFLAQGGTAVGTGLNTVKGFDSKIAE
                     EVSKLTSIPFKTAPNKFEALAAHDAVVEASGALNTVAVSLFKIANDIRYLGSGPRCGY
                     GELSLPENEPGSSIMPGKVNPTQNEALTMVATQVFGNHSAITFAGASGQFELNVFKPV
                     MISNLLSSIRLIADGSASFREHCVVGITANVDKIEKTLHESLMLVTALNPKIGYDAAS
                     KTAKNAHKKGLTLKESALELGVLNEQEFDEWVRPEKMIGPKD"
     gene            <483586..>484647
                     /locus_tag="DEHA2F05368g"
                     /db_xref="GeneID:2903537"
     mRNA            <483586..>484647
                     /locus_tag="DEHA2F05368g"
                     /product="DEHA2F05368p"
                     /transcript_id="XM_460595.1"
                     /db_xref="GeneID:2903537"
     CDS             483586..484647
                     /locus_tag="DEHA2F05368g"
                     /note="weakly similar to uniprot|P06843 Saccharomyces
                     cerevisiae YER161C SPT2 Protein involved in negative
                     regulation of transcription exhibits regulated
                     interactions with both histones and SWI-SNF components has
                     similarity to mammalian HMG1 proteins and similar to
                     CA4352|IPF3642 Candida albicans IPF3642 Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05368p"
                     /protein_id="XP_460595.2"
                     /db_xref="GeneID:2903537"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH6"
                     /translation="MSLSNILQHVKRKGQIIPKTNQSGRDGTPETNRSTEESNNKNQY
                     RYSNGETRTVDPVVARLKAARKLERERKEQEAREKKGLAPKKPKSVPRTNTNSSRNNE
                     VKNNNGVGRMNNSSIRSGANMCPNVPPSHKPVKKMNFNDLMKKASKIDQSKLSVSIKP
                     KAKSPEVRPTTSKHKPSSRASSAPTEGYRNVPKRKEGRPTTSKYSNSDDNKPSARAPL
                     PVRKPSTKLEEKLKSSGKTKPSDTRSNRSRSYNDSEDEYSESFIVSDEEEADYGNSNV
                     PDYDRDEIWAIFNRGKKRSYYDRYDNDDSGDDMEATGAEIWEEERRSKRNAELEDRKE
                     LEEEQRLAALKKARKMKQR"
     gene            <484774..>486390
                     /locus_tag="DEHA2F05390g"
                     /db_xref="GeneID:2903538"
     mRNA            <484774..>486390
                     /locus_tag="DEHA2F05390g"
                     /product="DEHA2F05390p"
                     /transcript_id="XM_460596.1"
                     /db_xref="GeneID:2903538"
     CDS             484774..486390
                     /locus_tag="DEHA2F05390g"
                     /note="similar to uniprot|P23796 Saccharomyces cerevisiae
                     YMR283C RIT1 Modifies initiator methionine tRNA to
                     distinguish it from elongator methionine tRNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05390p"
                     /protein_id="XP_460596.2"
                     /db_xref="GeneID:2903538"
                     /db_xref="GOA:Q6BMH5"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="InterPro:IPR016519"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH5"
                     /translation="MDKLTLSHLDINSVTKELRKDSLSIKNRLQSIIYDASFVETTKD
                     KFKLPLIPNERCGLWYLPPNEQKDTSYFKSTDGHTGQWSFSLRRLNFHLLPIISAYGG
                     IAIIDSTRKGKLMPDALSKTIPIWCAVLNTILYEGDSDKDILDGLGLEKDSTDAKFLL
                     SLKNEHNWVSTPKYMVFASERNEISKLIDSFAKEVKKLGLVTKEKLMSHLDGKKKPLI
                     PQWHYPGCKNNDEEIVNNDSFFFDHRQESNTERTYFLVQCVTASKKTNVYGGSILTVR
                     NNLTNGEIKLTSWYYIQGSADDHELWATKDICNGNLNSGFFWEHIFADNGKRNDDIID
                     NDTGYIYDWISENELVLRMNRTYEKYVKHRALLSNEDLDLDLSHVKTDSNDTGIIFGI
                     IDRNMNYNSFITTYKNVSQLVILSELFSISNIPDNPKVTILQYKVESSKKGSKKLREI
                     FPTLIPQINLQNASKNNTIMILCDTGKDISAGLVLVLLCKHFDLDWAPLQCCPKINKD
                     LVKQQVGLLLNVRKVNPSRNTLQSVNTFIM"
     gene            <486550..>487335
                     /locus_tag="DEHA2F05412g"
                     /db_xref="GeneID:2903539"
     mRNA            <486550..>487335
                     /locus_tag="DEHA2F05412g"
                     /product="DEHA2F05412p"
                     /transcript_id="XM_460597.1"
                     /db_xref="GeneID:2903539"
     CDS             486550..487335
                     /locus_tag="DEHA2F05412g"
                     /note="similar to uniprot|P38777 Saccharomyces cerevisiae
                     YHR049W FSH1 Serine hydrolase that localizes to both the
                     nucleus and cytoplasm"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05412p"
                     /protein_id="XP_460597.1"
                     /db_xref="GeneID:2903539"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH3"
                     /translation="MTVTKKILCLPGYLQSGKVFAEKSSGLRKLLTKKLNLQLDYVNP
                     PFVIKNKEDLPFILAEEVEDADQKWKSIIDQNCNRCWWQHQDPNVYEGFDESLKFLVE
                     YIKTNGPYDGIIGFSQGAAMSAIVTNVISELLPNHKNFQIAVFFSGFAFTEPVDPSKD
                     NKLNLNYHIDDINEYKTKVKIINSYERYYNDMHSNTKILNIYGSKDMTVPGIRSQYLS
                     TTFKNENLTEYIHEGGHFIPNKKQFLSPIIEDFREIFDIRSNL"
     gene            <487462..>489036
                     /locus_tag="DEHA2F05434g"
                     /db_xref="GeneID:2903540"
     mRNA            <487462..>489036
                     /locus_tag="DEHA2F05434g"
                     /product="DEHA2F05434p"
                     /transcript_id="XM_460598.2"
                     /db_xref="GeneID:2903540"
     CDS             487462..489036
                     /locus_tag="DEHA2F05434g"
                     /note="weakly similar to uniprot|P32783 Saccharomyces
                     cerevisiae YBR236C ABD1 Methyltransferase catalyzes the
                     transfer of a methyl group from S-adenosylmethionine to
                     the GpppN terminus of capped mRNA and similar to
                     CA4342|IPF3629 Candida albicans IPF3629"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05434p"
                     /protein_id="XP_460598.2"
                     /db_xref="GeneID:2903540"
                     /db_xref="GOA:Q6BMH4"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR016899"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSDKEAGVASSLGSNSPINKDEVDVKNTEEHSKQESKSDINKPP
                     LKKIKADDGIDISDSFSRRENKGNNKVISSVYNDENKKTPAWMKSKTTDKYDKYGSRS
                     TPIATPTAPVNNPDERYSKYMTNSVNSNDRVRRPPTETTSSQYDKKRAHDEAEDDVVA
                     PYSNLAVANPSSNLYQTFQSHINNREGKDINSIVRSHYNQRTQQSKFQGSRTKSPIYK
                     LRNFNNAIKYILLGNWVKPNPDSNRPTVILDLCCGKGGDLNKCEFVSVDQYIGIDISD
                     ASIKEAFSRYSRNKARFIPQTAESKKERDTRRYNFEACFATGDCFSSSIPEILEPNFP
                     GIIDGLFPVDCVSLQFAMHYAFETEEKVHQLLTNVTKSLRAGGTLIGTIPSSDFIRDK
                     IVNRAFIDQENRKFGNDLYSVTFHKDPPDEGVFRPPFGNGYNYSLKDAIDDVPEYVVP
                     FEVFRGLCEEYGLVLKYKKNFIDIFNQEIPKYFSKLNKNLIEGMKRSDGKYGAEGLEK
                     EAVGFYIGFVFEKLGN"
     gene            <489470..>491965
                     /locus_tag="DEHA2F05456g"
                     /db_xref="GeneID:2903541"
     mRNA            <489470..>491965
                     /locus_tag="DEHA2F05456g"
                     /product="DEHA2F05456p"
                     /transcript_id="XM_460599.1"
                     /db_xref="GeneID:2903541"
     CDS             489470..491965
                     /locus_tag="DEHA2F05456g"
                     /note="weakly similar to uniprot|P47166 Saccharomyces
                     cerevisiae YJR134C SGM1 Protein of unknown function
                     required for wild-type growth rate on galactose and
                     mannose"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05456p"
                     /protein_id="XP_460599.2"
                     /db_xref="GeneID:2903541"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="InterPro:IPR022092"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH2"
                     /translation="MAKKNNKKATKKNEVAKKDIDMKKPDTKAVEEGESQETDREEST
                     VDETAIEDPIISEDVSNIEPDTEQNNEVGIDHEQDIPAVVVSESNPTDTVVDSEEARQ
                     ASIATTDTPPKTKKRLTLSERLALAAKGKKQRSSTPTPTSSAAGTPPATGSDEPKNVI
                     IKEENDPLAENKVTIKDEEKVGKTGSESELASDGKYRDELKQLAAEIENLKANNSELS
                     EENKQLKSQSSKPGNINKETIQLKEQLASKDETIEQLMKEGQVLSVKELKLNESIKKL
                     KASNNDLEQSLNDYSKKNEQVLLKLNEQEDFLKKHKFKSINQLIDDYNDISKKLSQSN
                     DDLEKEKQLDWEGKYKEQQRLYETESSERKQSIKKLNELKIQFDMSKKQNSLELESKN
                     TTINDLKRSISSIRDENSKEIYRLENKIESLRVENERSPGSLSGNKDYNNCERNDTDT
                     ISNPKQIDYEEFVKLSNNHHSLQQQYLSSQENWKLIESNLLNKIDVLTSSVDSLKKSK
                     SKSMNEIQKLQNSLQRKMEEYDQLIEKFDELTNEKEEIVFQNQVKDTDYQELQEKFDK
                     FQQIYNTDRQNLNSKIKQLTESLEKSKNNSNTSLGPFEQTSPNRQNLNGLHLNLEPPK
                     LMKHHSSNSINDASYNNSGWPDIKFGESSTTPAVSREYSAVFMNRSHNNSSASLMDNV
                     DTATELANDNYSFNSKYPSHMGNGSISGIIPTSGNNNIQLINKMSSNIRRLEIELSTM
                     KDENTQLSLDKEQAQQEILKQFKLMEEVNSLKKQITTLQTEIDQKSRQEETMLELIGE
                     KSEQVEELRADVQDLKDLCKLQVQQMIEIQESK"
     gene            <492131..>493921
                     /locus_tag="DEHA2F05478g"
                     /db_xref="GeneID:2903542"
     mRNA            <492131..>493921
                     /locus_tag="DEHA2F05478g"
                     /product="DEHA2F05478p"
                     /transcript_id="XM_460600.1"
                     /db_xref="GeneID:2903542"
     CDS             492131..493921
                     /locus_tag="DEHA2F05478g"
                     /note="weakly similar to uniprot|P38882 Saccharomyces
                     cerevisiae YHR196W UTP9 Nucleolar protein component of the
                     small subunit (SSU) processome containing the U3 snoRNA
                     that is involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05478p"
                     /protein_id="XP_460600.2"
                     /db_xref="GeneID:2903542"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="UniProtKB/TrEMBL:Q6BMH1"
                     /translation="MSDLRRCLDDSNLYFTNIISKNGRNEVQIFPINKKASESIILDS
                     LIVKIELQADEIVTSCCWINNSGINNSERAKKRGKRRQSSSESDLDEATSDNKNLAVA
                     LENGDILILSPLHNDIIDRISYGHKIISLTPSLIHDSVWGVLEESRSIVEISLAQSKE
                     VKNFKFKEDEQIQSAKTIRQTGGSSRSQHILIGSNNLYLVDPSKPKKSLLTTFPQISE
                     ASPISIIEQSRLKENLVVVVRENENQIYLYNTSDSAKFSTFKTSTSQIYGVQLIANTD
                     MTEELLMAVTSEGVEVFKIDFDSNHQEQIPTCLIKTNFHDSIDNIIFMDVFLREKQSL
                     IGVWYNGNEPKFENINWNFNSAGEIQVSIDYNEKVNGVVDNRIDDIEFPETTKINNLA
                     VNKLYKDLVKLLNVSKKTTEEKIIRLCSSNNNDDNIKETIKLFSTSESSSALITKLFE
                     IISKEVASQPSKNSALSVWLKWLLLVHGGFIAKQPDQHDNLKTLQTGLTEGMKLMPRL
                     LGLQGRLQLLKSQTQLRDNLNNMSIESDDEEDKESTDIMVNNDDSENITIANGESDDF
                     EEADVASFAIDAEADDEDEDKDEEEAEEED"
     gene            494150..494220
                     /locus_tag="DEHA2F05500r"
                     /db_xref="GeneID:8998888"
     tRNA            494150..494220
                     /locus_tag="DEHA2F05500r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (CCC) cove score=60.42"
                     /db_xref="GeneID:8998888"
     gene            <494390..>497548
                     /locus_tag="DEHA2F05522g"
                     /db_xref="GeneID:8998889"
     mRNA            <494390..>497548
                     /locus_tag="DEHA2F05522g"
                     /product="DEHA2F05522p"
                     /transcript_id="XM_002770705.1"
                     /db_xref="GeneID:8998889"
     CDS             494390..497548
                     /locus_tag="DEHA2F05522g"
                     /note="similar to uniprot|P46970 Saccharomyces cerevisiae
                     YJR132W NMD5 Karyopherin a carrier protein involved in
                     nuclear import of proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05522p"
                     /protein_id="XP_002770751.1"
                     /db_xref="GeneID:8998889"
                     /db_xref="GOA:B5RUA3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B5RUA3"
                     /translation="MDANLLLECFSATLQSDQSVRHQAELQLRQLVLTPGFLGGCLDI
                     ISSNNPAVSLPIKKAAAVFFKNRVVKYWGSEKQNKIDNDEKPGIRDRILPVLIESDYN
                     TKQQLIPVLRVLISYDFPNNWKDLLETTGALLQQVPVGATKDEDFSQLYTGLLCFSEI
                     SRKFRWVSNSDRERELDAIIVQVFPHLLNIGNSIIANSENMTELTAEILKLILKVYKF
                     VTYFDLPVVLQTRESLIAWGEFHGSIVNMNTPTYVLSSTLSEQEKSFLQISKCYKWAV
                     ANLYRIFTRYASKSLSKKFAYTDFQKMFCDDFIPHLITNFLSIIEQWCSKKRWLSLSC
                     IYYLLQFLSHCVTQKPTWVLIKPYFENLVSHLIYPLLCPSDHVLEIFETDPHEYIHSN
                     FDIYDEFDTPDVAALGLLVTFVDKRKKTTLEPIIKFVYNQLTDLQQQPETLEVAKKRE
                     GALRLMGGISHYVVIPHSPYYSQMEQFLTALVFPNLSSKFDFLKARTLEVSSKFADLN
                     FENKDNLSVLFHGILNNFSTSNEESSLPVDFECALVIQAYIHLPEFQEALSTIILPTM
                     SKLLDLSNQIDNDAISAVMQECVENFSEQLQPFGVDLMAKLVEQFMRLAVDINEASKV
                     DVDEFDGEYEDQTDKIMAAVGLLNTMITVLLSFENSREICAKLEEVFSPVIEFVLINK
                     IDDFLTEVGELMENSTFLSRSISPIMWKNFTYLYQSFTDGIALMYTEELSQCLQNFLI
                     YGQEDLMKSPQLVENFYNIFNIIIESEDAQVGFNDIVLACELAQTFILMLQTQAQAYI
                     PNLVNSVLKISQSMQQDEQHVKSSSFNITIQNVIIAAMVHDSNATLMNLQNHHQLVPF
                     FVEWFKTISILKRVYDLKLSTLGLISLMDNNEALNLLGNDIVAQIGSKLASIMKTLPK
                     AIENLEHKRKNFSESEFTSDQPYDDAWENHNDYDDDDDDVTGAQDLTHEPEASTTEYL
                     DFLQQENVKLKNSGFFDEEDLELIEDPLAASPLDSLNVFQIFKQFSQRLHANDNAKYS
                     IIFGSLDVSDQKIFTDIFEVVN"
     gene            <498821..>500173
                     /locus_tag="DEHA2F05544g"
                     /db_xref="GeneID:2903375"
     mRNA            <498821..>500173
                     /locus_tag="DEHA2F05544g"
                     /product="DEHA2F05544p"
                     /transcript_id="XM_460602.1"
                     /db_xref="GeneID:2903375"
     CDS             498821..500173
                     /locus_tag="DEHA2F05544g"
                     /note="weakly similar to CA1939|IPF8000 Candida albicans
                     IPF8000 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05544p"
                     /protein_id="XP_460602.2"
                     /db_xref="GeneID:2903375"
                     /db_xref="GOA:Q6BMG9"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG9"
                     /translation="MLIKTLLVIALQFVNLTLGLNILMSSKNSWVSKNTRHLYAGLKA
                     EGHNVKLIAPLNNNGHITEAGLASENNGASKREQGEQEEKREIVNGGDFGHLLPVHQK
                     YYKTIKKLNNLPRGAKNVILKKDLENSDGGSTETVRNNYFGQDPLDESVWYVNASPLE
                     SLLIAFDVLLPQFEPDFKPDLVVLGPDEGLSLTPSTSSHQPLFHENHPNSDNVLDSMM
                     RLTMLKKFPVIGVSTGDDHHIYFQDETFFNIQQNVLSKQLLKKNVFTKNIKFINARVI
                     DLINKLTTSEQGILPENVALNVNFPSINHDVSHCTTSWKNKNNNDPTFKQVVYDKKYD
                     HSKHNILPKYELVNDTIHIVGEYRVKIDEDAEQQTFVDKKSYYYSHISRRSSSTDSTT
                     EPSGVSQDYSDNDDINQIMSNIDELNVLKNCGISVSVNHLIKGHGLGKDFFDLESLFN
                     "
     gene            <500495..>502165
                     /locus_tag="DEHA2F05566g"
                     /db_xref="GeneID:2903376"
     mRNA            <500495..>502165
                     /locus_tag="DEHA2F05566g"
                     /product="DEHA2F05566p"
                     /transcript_id="XM_460603.1"
                     /db_xref="GeneID:2903376"
     CDS             500495..502165
                     /locus_tag="DEHA2F05566g"
                     /note="weakly similar to uniprot|P50276 Saccharomyces
                     cerevisiae YGR055W MUP1 High affinity methionine permease
                     integral membrane protein with 13 putative
                     membrane-spanning regions"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05566p"
                     /protein_id="XP_460603.2"
                     /db_xref="GeneID:2903376"
                     /db_xref="GOA:Q6BMG8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG8"
                     /translation="MAPTLLPKVSIGSSTFSRMPLLERRKYHKLGTLSCMSLIVNKMI
                     GTGIFSTPAIIFQYCQGNVGLYLFLWLVGGIIIFSGLVIFLEFALNLPFTNGGEKNYL
                     LRVFRKPKGLMGCIYSFQMVLLGFSSGNAFAFGKYVLFAVNGEEIKEEEWSVKIIGVL
                     CISFCIFLHIKFPNQGTSLFNLLGVFKIFILVLIIAIGLLVSVDIIKLPTTVDNFSNL
                     FESTTKKDNNYYSISVALLEIIYSFKGWENANYVLSEVSDPYHVLTIAAPSAVVITTI
                     LYFLVIISYLIVIPKQELLDSGVLVAGIFFNKVFGESITSRILPIIISSSNLGNVMVV
                     SFAHAHVNQELARNNYLPFSKYFEDINNSLLLHWFITVIIMVAPPSSEIYEFVVNLYI
                     YPGTWINLLITIGLIYLHLNSRGEKWGKHNTGNGLETNSANNSIYDDNDNLILQLNDD
                     SYTEFDSLISVENDNDTSKFSAPIICIVIFLFSNIFLAVFPFFPPPSDSSSSQSIIPY
                     WCFPVVGTSVLLSGVAWFYIRRWFHTWRYDKYKIGEPNVKYEDDYSTN"
     gene            <502571..>503641
                     /locus_tag="DEHA2F05588g"
                     /db_xref="GeneID:2903377"
     mRNA            <502571..>503641
                     /locus_tag="DEHA2F05588g"
                     /product="DEHA2F05588p"
                     /transcript_id="XM_460604.1"
                     /db_xref="GeneID:2903377"
     CDS             502571..503641
                     /locus_tag="DEHA2F05588g"
                     /note="weakly similar to CA0879|IPF19542.5f Candida
                     albicans IPF19542.5f unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05588p"
                     /protein_id="XP_460604.2"
                     /db_xref="GeneID:2903377"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG7"
                     /translation="MDESSTSLSSSMSMSSSQPRQLIESNYKLALKFFMNKNFSKSYE
                     IIKKLYQNSFGQFASDIISEQLFIKILNLYLTEIGLFIDKANQDTNFNLERNERQEVI
                     TTLTQDQILDELYKIYNDDINAIPSEILYNLFLIYYINGAIITNAGNLKLKFDKLYYQ
                     FDYSSRLEDVYLKKLIDLYVFQVLPDNENFDDASSIVSENPIFSSQIEESLSRLSNIR
                     VTKVKKQQEEEEKEKEKQQKLNEKKKREQQNQKELKDRQNLTYKSLNQIKQSSGKVDS
                     SKKDDGTARESNSGYDIASLRQKVLYSLNFSKNYIKTNSPLILLIILLLFISSRYLKV
                     RKINVMERLKSTLQMAFKISYL"
     gene            complement(<503661..>505163)
                     /locus_tag="DEHA2F05610g"
                     /db_xref="GeneID:2903378"
     mRNA            complement(<503661..>505163)
                     /locus_tag="DEHA2F05610g"
                     /product="DEHA2F05610p"
                     /transcript_id="XM_460605.1"
                     /db_xref="GeneID:2903378"
     CDS             complement(503661..505163)
                     /locus_tag="DEHA2F05610g"
                     /note="weakly similar to uniprot|P48581 Saccharomyces
                     cerevisiae YOR368W RAD17 Checkpoint protein involved in
                     the activation of the DNA damage and meiotic pachytene
                     checkpoints"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05610p"
                     /protein_id="XP_460605.2"
                     /db_xref="GeneID:2903378"
                     /db_xref="GOA:Q6BMG6"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="InterPro:IPR016587"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG6"
                     /translation="MSDESLDFQKSSGTSGNGVSSSPFTFTASTNQVSHLADVFSSIT
                     SINSQALMIITTNGIIIYSEYNHICNVQLSIDPSLFGTYNFYSENNTSSSQNNEELRL
                     GVDISLISDAFIAAASSSVSKSKTKATANNGNTVTANGSVDNQVCYITYNGEGYPLVI
                     EFEDSLMSEKIEFLTFYLDMTYPYDVSNSQEEEEEEQYNLVINHSEIQFEVILKSDVF
                     TNLLKDLQQINTIDLFMFISNEMRQLGSNRQNSKKSRKSGPLYLDKQFNFISKGPIGH
                     SKLIFPNEKTILEKLNIYGMDHDDSEMKPINTSLISCYNFGNFSKIFKAVKLSIKCKI
                     MKDLSGILSIQLLCKNPQLTNYSGTLITFNMLESTTIVDKFDKNEEPEEFERFHLNNI
                     FEDESYEYIKDYNDKNPKRVPMPNIESTNIQEYEELGNEKDEPPILSYASFRNNSKSA
                     TSNNVQINETIYEEDKNGNNKKRKKEIESAKDSDKDVKTVGSAIEIPLFL"
     gene            complement(<505423..>506481)
                     /locus_tag="DEHA2F05632g"
                     /db_xref="GeneID:2903379"
     mRNA            complement(<505423..>506481)
                     /locus_tag="DEHA2F05632g"
                     /product="DEHA2F05632p"
                     /transcript_id="XM_460606.1"
                     /db_xref="GeneID:2903379"
     CDS             complement(505423..506481)
                     /locus_tag="DEHA2F05632g"
                     /note="similar to uniprot|P32366 Saccharomyces cerevisiae
                     YLR447c VMA6 H+-ATPase V0 domain 36 KD subunit vacuolar
                     singleton"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05632p"
                     /protein_id="XP_460606.1"
                     /db_xref="GeneID:2903379"
                     /db_xref="GOA:Q6BMG5"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG5"
                     /translation="MEGIFFNVDYGYVEGVVRGYRSGLLGNNQYVNLTQCDNLEDLKL
                     QLSATDYGNFLASHSGPLSTSIMQDNLSKKLFQQFQYLKSQASGKLIRFLDFISYGYM
                     IDNVSLMITGTLHERDRSEILSKCHPLGWFDTLPTLSIATDIESLYNTVLIDTPLAPF
                     FKDCLTADDLDDLNIEIIRNRLYKNYLEAFVNFIEDEFTSPDKEIMTNLLNFEADKRV
                     INISLNSLNNPDLTAENKLSLFPSYGRLYPTYHSKLSEIDDVEQLKAIVDSIGEYKDL
                     FSEAPDSNSGGSKNLEDWFYLLEMQYCKNAFTQQFTLSTIWAWLRSKEQEIRNITWIA
                     ECIAQNQKNRIDNYISVY"
     gene            <506695..>508020
                     /locus_tag="DEHA2F05654g"
                     /db_xref="GeneID:2903380"
     mRNA            <506695..>508020
                     /locus_tag="DEHA2F05654g"
                     /product="DEHA2F05654p"
                     /transcript_id="XM_460607.1"
                     /db_xref="GeneID:2903380"
     CDS             506695..508020
                     /locus_tag="DEHA2F05654g"
                     /note="some similarities with uniprot|Q04632 Saccharomyces
                     cerevisiae YML071C COG8 Component of the conserved
                     oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
                     tethering complex that functions in protein trafficking to
                     mediate fusion of transport vesicles to Golgi compartments
                     and similar to CA0131|IPF13402 Candida albicans IPF13402
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05654p"
                     /protein_id="XP_460607.2"
                     /db_xref="GeneID:2903380"
                     /db_xref="GOA:Q6BMG4"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG4"
                     /translation="MSGILLDTLSEDLDPTLAEFLKSNSELRQISEQYLVDLLINDDL
                     LCTDTYTTTSKSSNTDVSNVEGQPRTLTEEIAELDSQQREIKMQLASITNNNRDLIID
                     ISKDLTSIREDVNSGFDKEINSMIKILDMENSNGEKFEIPENERLNNTMITYNSILSN
                     IDSVLDLLELPTLCKVCILQGNYQESLEISILVQTLVIRFPNLKIFQNIHYQVEQELK
                     LMVKGLIKLLNTNLKQNNILKIFQILNKLDLLNYNTSSAISSSVNVTSNKKLQKDKFL
                     KIVYLNARFKFIINELSNLTPLLKFNKLTYLKRYIEIYREFIFNSLSIYHAIFNFSPA
                     SNDIDIKHEEDNLLISQFIKNLASLLAEELKKYLPELIAPSEKDDNIDKQTQKDGLIL
                     QIIYLCQSLAKYNVDFESLITWELCYRNNSILSEEDWLKNMAKVKKFRA"
     gene            complement(<508137..>511622)
                     /locus_tag="DEHA2F05676g"
                     /db_xref="GeneID:2903381"
     mRNA            complement(<508137..>511622)
                     /locus_tag="DEHA2F05676g"
                     /product="DEHA2F05676p"
                     /transcript_id="XM_460608.1"
                     /db_xref="GeneID:2903381"
     CDS             complement(508137..511622)
                     /locus_tag="DEHA2F05676g"
                     /note="some similarities with uniprot|Q08562 Saccharomyces
                     cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
                     DNA-dependent ATPases plays a role in antagonizing
                     silencing during mating-type switching contains an
                     N-terminal domain that interacts with Sir4p and a
                     C-terminal SNF2 domain and similar to CA4382|IPF8576
                     Candida albicans IPF8576"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05676p"
                     /protein_id="XP_460608.2"
                     /db_xref="GeneID:2903381"
                     /db_xref="GOA:Q6BMG3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG3"
                     /translation="MASDEPSQNIINLSSDDDEEVDENVSLKDIQINGHEIHERGNNQ
                     DWRQANSNSNTTHINQPPKRQRLDSLYSNNGPFRSPSKQGNDLSHIGNSNHIQQRQLY
                     PKTLPNAVLDRTVFGPRSVSSNTTIQNHPRQSEPQSIPKNNLIQNQYMQADPQSIPNN
                     NTIQYQSRQADPQEDVIILSSEDEDMDSDGDIMILDAEEASRIGKFKTSSFERNANRS
                     SRDMGNYEAPANTGPYYSVPAVNPNEMHVTYNNPAPVPHFTKDDGPEVEKLNFQRAQE
                     TLEENVRRKDELLYKHEQLTSDFTKSSRQANELLQHLTLLQSHLKREEIQENRDENTI
                     LSLKNEISFKGAEYHNFRRSKDATATSLSGIASKLSWLTVSIRDAKSRIHNYGKHRNG
                     VNIIDNPFVLNNNSGRNNSDYENESIMNNPFGNIPGFSANVYSDNDQQHLQNLLNNIR
                     PDEELDEEGLSLTPSELAITLLKHQRMGLAWLLRMEESKSKGGILADDMGLGKTVQTI
                     ALIMAHKSDDDNRKTNLVIAPVSLLRQWAAEIESKIKPNAQIKIAIYHGSVKKNLRTF
                     NSLKKYDVVLTSYGTLSSEWKKHYQGPLEEARLSRNQNVIPDLDAGGTSYTSPFFATD
                     AVFYRIILDEAQNIKNKSAIASKASYCIKGIHRFCLSGTPIQNNVEELYPILRFLRIK
                     PYNDESKFRSDIVLPIRSKSSGYDDFDKKKSMQKLRALLRAILLRRSKNSLIDGKPIL
                     SLPDKLVTEDTVQMEDEELTYYRELEQGIQKKAKTLLASEKLGSTSSILTLLLRLRQA
                     CCHSFLVEMGRMKAAESEATKTLITRDWKSMYVNIQKFDEDTINRIRNEVHQGNLLKG
                     ENEGESNTNSDEDLFTCPICYDVLGYESIVLFSGCGHMICNNCIENFFERFETGDGSE
                     GNRLASCFSCSKSIKENELIDYNMFHMIHQEGYDRDKIAEFYNINYSSNGKTTNMQKI
                     RQLIQENKGFTPSAKMEKCMHLIKDVLENYPDEKIIIFSQFLSLFDLMKLVLANEKIP
                     FLRYDGSMSLDEKNSTIKQFYQGSTKVLLISLRAGNVGLTLTCASHVIIMDPFWNPYV
                     EEQAMDRAHRIGQQRDVRVHRILTEGSVEGRIMTLQNEKKEIISGALDEKGMKSVSKL
                     GRQELGFLFGLNELR"
     gene            complement(<511862..>512467)
                     /locus_tag="DEHA2F05698g"
                     /db_xref="GeneID:2903382"
     mRNA            complement(<511862..>512467)
                     /locus_tag="DEHA2F05698g"
                     /product="DEHA2F05698p"
                     /transcript_id="XM_460609.1"
                     /db_xref="GeneID:2903382"
     CDS             complement(511862..512467)
                     /locus_tag="DEHA2F05698g"
                     /note="similar to uniprot|P39742 Saccharomyces cerevisiae
                     YLR292C SEC72 Non-essential subunit of Sec63 complex
                     (Sec63p Sec62p Sec66p and Sec72p)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05698p"
                     /protein_id="XP_460609.1"
                     /db_xref="GeneID:2903382"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG2"
                     /translation="MNVALGYDAKTKKISLPDEAEKLVPSLKLEVDQLNTLTSELIAN
                     GADVPAPPTQENFNKDMTKMIRKLYEGGVQAFKQGKFQESAKQFTIGIDMICRRHKFE
                     AFQGTLQELSLFLMSRADAYLKTKNYLGAFNDADMLLGMMMCTPDNFLRRGVANYFLG
                     NYEAARADYQRGLAFDEDNERLVTELEICLDKILEENGDYL"
     gene            <512838..>514199
                     /locus_tag="DEHA2F05720g"
                     /db_xref="GeneID:2903383"
     mRNA            <512838..>514199
                     /locus_tag="DEHA2F05720g"
                     /product="DEHA2F05720p"
                     /transcript_id="XM_460610.1"
                     /db_xref="GeneID:2903383"
     CDS             512838..514199
                     /locus_tag="DEHA2F05720g"
                     /note="some similarities with uniprot|Q869X8 Dictyostelium
                     discoideum"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05720p"
                     /protein_id="XP_460610.2"
                     /db_xref="GeneID:2903383"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG1"
                     /translation="MNLEQKDIVVNDINFSSYGKDEDQQQDAKTAEGDSEQTEYKTVP
                     SSITHKFKPKKRRMGNLILKSNCLVTDENQDGNARGSDAEYEYTNRTIGKTVSGILSK
                     FFHSRRPDSFGETSEEPGNPEYPNLRSHDDLGESKTTRNKLSRVFETYRKRNGLQGQP
                     KDEGYYKSNSEGEKSFNRFLKLEQALDAKRDEKNSRSMNDETERVSYTSKDLSLGSTV
                     LNNSQEIYTENGSFVHPGSKGKIDTKFIINDSPKTESAALENTVFSPNSHRPSLRDIP
                     GIENIEVSTSDQNTWKQSYSTFRMAFKIKPVKNILNDKSLKPQNSQFKSLDDEIDSHL
                     YYQSRTNLLSKCFPNKNHINQNSKRESQNENIDFAPEMEEPDKLIPSIPTSPNSLSDN
                     FTAIKGILQQKYKSSFSRDKSKRQNLSVKFVSPTLSPIEMTNNEMNDNGHNNTEIISQ
                     TTS"
     gene            <514594..>515805
                     /locus_tag="DEHA2F05742g"
                     /db_xref="GeneID:2903384"
     mRNA            <514594..>515805
                     /locus_tag="DEHA2F05742g"
                     /product="DEHA2F05742p"
                     /transcript_id="XM_460611.1"
                     /db_xref="GeneID:2903384"
     CDS             514594..515805
                     /locus_tag="DEHA2F05742g"
                     /note="similar to uniprot|P07172 Saccharomyces cerevisiae
                     YIL116W HIS5 Histidinol-phosphate aminotransferase
                     catalyzes the seventh step in histidine biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05742p"
                     /protein_id="XP_460611.1"
                     /db_xref="GeneID:2903384"
                     /db_xref="GOA:Q6BMG0"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BMG0"
                     /translation="MFELKSLVRPNILTLEPYRCARDDFKTGILLDANENTHGPALKD
                     VSNEEETLELNRYPDPHQIDLKEQIIAFRNEKPNKFLKDYNQDKLTPENLCLGVGSDE
                     SIDLLLRCVCVPGKDKLLICPPTYGMYSICATVNDVALTKVPLEYPSFQVDIDGILNK
                     VTKDSSIKLAYLTSPGNPTGKLLKVSDIVQLVESAASKWNGLIVVDEAYIDFTTSEAD
                     TASESMTTLVNQYPNLVVLQTLSKSFGLAGIRLGITFANPELSKYLNAMKYPYNISSL
                     TANIALRATSIDSGLKIMSKYVLSIITQRNLLMDGLQKIDGVGRSIGGLDSNFVLVEI
                     LDKNKEPSNETAKALYNKLAVSNEVVVRFRGNELNCTGALRISVGTADENKILLEKLQ
                     KCLQEVYNESS"
     gene            <516020..>516754
                     /locus_tag="DEHA2F05764g"
                     /db_xref="GeneID:2903385"
     mRNA            <516020..>516754
                     /locus_tag="DEHA2F05764g"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="XM_460612.1"
                     /db_xref="GeneID:2903385"
     CDS             516020..516754
                     /locus_tag="DEHA2F05764g"
                     /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
                     YMR188C MRPS17 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="XP_460612.2"
                     /db_xref="GeneID:2903385"
                     /db_xref="GOA:Q6BMF9"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF9"
                     /translation="MAKQNFIGLVISQGKMSKTVKVRVQTKAYDTKVHKEVIKRKDYL
                     VHDEGNLCKEGDIVRIQAIPKISARKYFAIADIKINKGQQFALYESLAKEKVAKEATE
                     KIEQFLERRKEYENTIVQVEDLKTLDKLSNTFQSDPSADREFLLSEINAIKEKYNIKS
                     WPSTEPVLKLEVNEAAKDLTILQNRVDNIKIILEKLMSEEYASHRQQILSDLSKTPVE
                     ELKPFTQKNILRKFILDPRNECPVTL"
     gene            <517232..>518632
                     /locus_tag="DEHA2F05786g"
                     /db_xref="GeneID:2903386"
     mRNA            <517232..>518632
                     /locus_tag="DEHA2F05786g"
                     /product="DEHA2F05786p"
                     /transcript_id="XM_460613.1"
                     /db_xref="GeneID:2903386"
     CDS             517232..518632
                     /locus_tag="DEHA2F05786g"
                     /note="similar to uniprot|P31381 Saccharomyces cerevisiae
                     YAL022C FUN26 Nucleoside transporter with broad nucleoside
                     selectivity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05786p"
                     /protein_id="XP_460613.2"
                     /db_xref="GeneID:2903386"
                     /db_xref="GOA:Q6BMF8"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF8"
                     /translation="MVSNSPRYSEESARPEHHAMYDPTVFQINRRFRIKLSQLKYFTF
                     TIIGIALLWPWNCFLSASAFYSERFEHSPQLVRIYSSTMMSVSTITSALYNYYLSQVQ
                     VGVNYNHRVNVGFSMTIGVFIIMAFSCVLNVFITMDDYLFFTGLMIMVFISAAATCLA
                     QNGTMATVNVMGSLYANGVMVGQAIAGVLPSSALIISILIVGDKKADADKENQYMDKN
                     YGVFIYYITASLIAVLSISLLYFTNHYKIESTYKTLNHMVEEQQPLNSSDDDSEGEPE
                     VTQKKYVPFMVLWSKLKLIVSTIFLTFGITLIFPVFASTVESVHKDSDHTLLQRKIFI
                     PFIYLVWNLGDFLGRVCCGKPRLAVLIKNPKVLLMYSIARLIFIPLFLTCNVNSASSG
                     KSNAIINSDTWYIMLQFLFGLSNGQLCTSCFMIVGNNCDTDDEKEAAGGFTTVFLSVG
                     LAFGSVFSYLLVLMIN"
     gene            <518768..>521551
                     /locus_tag="DEHA2F05808g"
                     /db_xref="GeneID:2903387"
     mRNA            <518768..>521551
                     /locus_tag="DEHA2F05808g"
                     /product="DEHA2F05808p"
                     /transcript_id="XM_460614.1"
                     /db_xref="GeneID:2903387"
     CDS             518768..521551
                     /locus_tag="DEHA2F05808g"
                     /note="weakly similar to CA3733|IPF11897 Candida albicans
                     IPF11897"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05808p"
                     /protein_id="XP_460614.2"
                     /db_xref="GeneID:2903387"
                     /db_xref="GOA:Q6BMF7"
                     /translation="MSFWDNNKDTFLAAGKATAKGIGTGTKALGKAGYRTYKNSQGER
                     RGVPDNEADKAERSSYETRNNTNTSAYSGAYSGSNTGSNTGSNSGTSYYQSQPRHVDV
                     NAYPLPPKRVAGPGEVRPLGHQDQGQQHQQMQQPQQHYSQNAQYSQAPYQPQQPQYPQ
                     QPQQPQYPQQPYSQDTQYSQAPYHPQQQIQPQPLTEGERPIPTPPTQAGTQPQFQPQL
                     QQYQNGHIQQSHPAETQQPTYQVEQQQQSYSTEPQQQLQQPIFQPQPQSQDPYQQSPE
                     ANDSNQRPPAYDDSQLQNTQQEPTQVDSEPVKKSLPDPSSFAPPPIHKNRGVSEPSDS
                     ASYKKTGVSGKPSHVGKHGTSTTPKPTTLDMDPSKIGQPPPKPYRENSETTLNSASSN
                     VRQTPPLPTRQSSNTTQNQLQTTSTPVPPPRSNTASVNSTSSQASSLPAPLPLPDNTG
                     SEGSQKKAPPPKPIKKPMQLTSDGSSRNAEPDTLKQEPKNYMPNFAEEIALRKNTNSS
                     LSGKGNLNSEDFNSELNSKLEPVNFENHAKPEPSDATPSLVKPKPKVMPKPKIGPKPS
                     ISPKPETKGKPIIKSKSEIKAKPDLKPKPIIGTKPVTVFGSKKIGNDMPISDSPSNLH
                     VNKSNTPPPPIPRPRSAASNTSTPPPPPPSRNYRRAKAAAPPIESGPPNLDLQLSTGW
                     FATTSGPMVLPKDLSGLNYNTSYSYVTRGSDKSHTRNINLRLRDLAIISYAITWSNDN
                     INNAKMEVTKFIPSPISNKIPTVDELVANQNRFGEYVASWSENKMGQKVGTGECWDLA
                     RDALLKGCGKHAFVSTYYHHGYPIISLQGSENGVSYVDGKSPLDELRRGDILQYTSCI
                     FKDKIRGSVSTVGNPDHTSVVLENTGDKLIIAEQNINNLKIVKKTEICLQNLTQGIVV
                     GYRPMPAGWGGNL"
     gene            <521698..>523464
                     /locus_tag="DEHA2F05830g"
                     /db_xref="GeneID:2903388"
     mRNA            <521698..>523464
                     /locus_tag="DEHA2F05830g"
                     /product="DEHA2F05830p"
                     /transcript_id="XM_460615.1"
                     /db_xref="GeneID:2903388"
     CDS             521698..523464
                     /locus_tag="DEHA2F05830g"
                     /note="similar to uniprot|P32461 Saccharomyces cerevisiae
                     YKL191W DPH2 Protein required along with Dph1p Kti11p
                     Jjj3p and Dph5p for synthesis of diphthamide which is a
                     modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05830p"
                     /protein_id="XP_460615.2"
                     /db_xref="GeneID:2903388"
                     /db_xref="GOA:Q6BMF6"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /translation="MTTEGLVVPALSTQQDDSTFEFDKVCSKTVVRSHLGLPNDATDD
                     QVIKRIREYYNISEICNFLKQKVEGHELDMIPKYKHVTLQFPDSLICDSASIVHELQR
                     ELGLMPRTEDSSEVKCSADSCCKTGKVESPLSQKLWILADTSYSSCCIDEVAAGHVNS
                     DLVIHFGDACLNVVESLPAAYVFGKPSLKLDSVITQFKEIYANRDSKILIMADAPHTQ
                     SLNQLYNILKPEYPNLAYADLYLNPSSNASIIGYDPCPSQSSILNVLNRTIIGLDNGD
                     IDTDIDTILLEHDLFHIEVPAVPRLLQLTTRFQSVTTFEPKSGLASQGPYPKLMRRYR
                     YMHMARSAGTVGLLVNTLSLANTKTLINKIGQKIKEAGKKHYVFVVGKPNVAKLANFE
                     NIDIWCVLGCDHQGIIIDENNEYYKPIVTPYELLLALNKDQNWSGKWVTDFNKVLEDM
                     SLEDERNKQEINDGSDNNEEDSDDEAPEFNPVTGQYVSTSKPLRKLHHLQISSQEQHP
                     ELDNEGSQDLVKKFSSAVAIKDTVSTSAMHLQTRHWTGLGSDFQQNDSDEEANNEDGA
                     LVEDGRAGIARGYDYDRETKFQ"
     gene            <523569..>524736
                     /locus_tag="DEHA2F05852g"
                     /db_xref="GeneID:2903389"
     mRNA            join(<523569..523744,523800..>524736)
                     /locus_tag="DEHA2F05852g"
                     /product="DEHA2F05852p"
                     /transcript_id="XM_460616.2"
                     /db_xref="GeneID:2903389"
     CDS             join(523569..523744,523800..524736)
                     /locus_tag="DEHA2F05852g"
                     /note="similar to uniprot|Q06417 Saccharomyces cerevisiae
                     YLR426W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05852p"
                     /protein_id="XP_460616.2"
                     /db_xref="GeneID:2903389"
                     /db_xref="GOA:Q6BMF5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF5"
                     /translation="MRLSSSQFISSIMRLSKSEKLKLECLNHEIVSCNMNLDKFIIGL
                     WRSAKYFLAIVLFLSIFDGFHWKYNVTTILLGFCICLHGFSKKYKILPIFKAIDEMDI
                     ALITGGSRGLGLEIAKELILQKKIGKVIILDIISPEFQFIDKDLSKIEYHKCDVGNRR
                     ELQFVIEKVIENLNNQKKNISICINNAGIRHNESLLSLSQEKIDSIFNVNTMSHILVL
                     KAILKNHVEEVIPRELTNNNLFIVSVSSILGTLAPKNLSIYSASKAAIIQIHEALTQE
                     VSHLPMIRLLLVTTGQLTTSMFGDVIPPMKFLAPVVNHIDLAKDVVCKIEKGEKGVLC
                     APLYANFLPIVKCLPIFMQDYCRWFSGIDTQIKENQ"
     gene            complement(<524789..>525392)
                     /locus_tag="DEHA2F05874g"
                     /db_xref="GeneID:8998890"
     mRNA            complement(join(<524789..525284,525364..>525392))
                     /locus_tag="DEHA2F05874g"
                     /product="DEHA2F05874p"
                     /transcript_id="XM_002770706.1"
                     /db_xref="GeneID:8998890"
     CDS             complement(join(524789..525284,525364..525392))
                     /locus_tag="DEHA2F05874g"
                     /note="weakly similar to uniprot|Q04969 Saccharomyces
                     cerevisiae YML055W SPC2 Subunit of signal peptidase
                     complex (Spc1p Spc2p Spc3p Sec11p)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05874p"
                     /protein_id="XP_002770752.1"
                     /db_xref="GeneID:8998890"
                     /db_xref="GOA:B5RUA4"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:B5RUA4"
                     /translation="MSAIKKTNLNSIVQLRATCDDNLHASLSELGYTQSFSLIDTKLA
                     LGYSTVVIAGLLYVVDKKFGFEKTYNVTVLSVILYFLISGILFYLTSTKKYKNVKYIG
                     YDDSNKKISVATWTNKYDPIYHLKIRFNDEESLAIVTSFEFMKVFDAFGYYKQDELTR
                     LLKNELDKINKKSN"
     gene            complement(<525541..>527517)
                     /locus_tag="DEHA2F05896g"
                     /db_xref="GeneID:8998891"
     mRNA            complement(<525541..>527517)
                     /locus_tag="DEHA2F05896g"
                     /product="DEHA2F05896p"
                     /transcript_id="XM_002770707.1"
                     /db_xref="GeneID:8998891"
     CDS             complement(525541..527517)
                     /locus_tag="DEHA2F05896g"
                     /note="similar to uniprot|Q06436 Saccharomyces cerevisiae
                     YLR427W MAG2 DNA-3-methyladenine glycosidase II that
                     catalyzes of the hydrolysis of alkylated DNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05896p"
                     /protein_id="XP_002770753.1"
                     /db_xref="GeneID:8998891"
                     /db_xref="GOA:B5RUA5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:B5RUA5"
                     /translation="MSINNKDSIMSLTPKNDSNVPNRGYASDKSKETTSKKKSQQNKP
                     KPNQKVKYSKEFGTLNDDFSQKIENQIKSGKPVNGTNRKNQISINHLLEFQSYKDSKE
                     YQSRHLKSKRRNSNNSSRPANSHGHKSKDYFYSKVHLKGMSFINVNYKFVVDYRNDYK
                     AQQLDPNVPIDTKDILRIVVPKGNSCPICLSDEPLAPRMITSCGHILCLTCLLSLLES
                     EVPVFKKRENTAVVEKYRDCPLCFSVIRKNEIKPVLIDNIDERFEVPKVNDEVVLSLM
                     VRPHDKVLALPSSHKEYHEVIDSFPWVNQSISDMPDFGQFSRIFKGDLHYLLNMYESE
                     KQTILAAYEEEKLLYNDDGKFTNLAIKNIDEDIAKWKAYYEDIEGKSSKYAGDHRSKN
                     KDLDSSNSYFYYQTGFNASSTYVLSPLDMKVLKTNNNNNYTYLPSSIVAKIENIRYEE
                     LAPESSITKYKYLSHLPLGTTIGFLECNWSQNEFISPETWQMYKNDLLKRTKNSSKKF
                     RKEEKDRKRAMNEEEIKTRNFFERENNGSSESNDYYDSQIERGNFGSLSIIDHRELPP
                     LSSENVLEPSHNNEISSDSSVGEYQTTIWGTKIPKAEIMNGDSDSDDWDATEMIRKAK
                     EEINRQETDKGKGKGKQKKKKKLVLLSSNSNWQM"
     gene            <527847..>530363
                     /locus_tag="DEHA2F05918g"
                     /db_xref="GeneID:2903393"
     mRNA            <527847..>530363
                     /locus_tag="DEHA2F05918g"
                     /product="DEHA2F05918p"
                     /transcript_id="XM_460618.1"
                     /db_xref="GeneID:2903393"
     CDS             527847..530363
                     /locus_tag="DEHA2F05918g"
                     /note="similar to uniprot|Q08919 Saccharomyces cerevisiae
                     YPL176C Hypothetical ORF AND uniprot|Q08693 Saccharomyces
                     cerevisiae YOR256c Protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05918p"
                     /protein_id="XP_460618.2"
                     /db_xref="GeneID:2903393"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF3"
                     /translation="MSENHQSYERVSSNETDIPRQPPNYDDLESNLVDRTDNGIEQFE
                     IEDEDFEQPRENDGFMVRASFMTKKFASNFSARVMHPVSKMIDPIYEGYSHFNLLYEK
                     SILKLGNPLVVKRLLYVFFIMIVIFLITKYNISDGVNGVSGGAFSSGKFYDIDMLANS
                     ARDYIDAKVMKENLEYLSSMPHIAGSKGDLTLSKYVQSYMKENGIKMVDFEELQSFTN
                     YPAFDKKKTYVKLADDSYEATLYEQDKKDMEYLSYNPNSLNTNDEYESFYIYGNFGTQ
                     EDLKNLRDHNVNLQDSILLIKYGGSIPDANKIQIAQQQGVKAVIFISSKFDIGTGDNK
                     VTHDDVIQKENVGVSRFSPGDVLTPGWSSEDGYVTRLPWFKSQTTPKIPTIPISWKDA
                     SHFISQLGENGVKFDDGLYSGSKSSEAKHKIKLRITHDQRQTNQIWNIIGSIPGREQV
                     EKGIIIGASRDSTCFGTMSTNTGTVILLELIKIFSALQRQYNWSPARSIYFASFDASE
                     YNLAGSTEWIESRKETLKKEGYAYIDLSDAVAGDDLSIKSHPFLHSVIKDALKKVKSD
                     KDDSKHRRDDNRISLYDLYTQQNKGSDDISNNLIDQKNYIPIINLANIPSLEIKFTGL
                     NYPENSCYDNFDNFEKSGVDSSMSKHKQLVELLSKIALTLAEVPIIPYNFANMASKLV
                     SYSDDLENYANAKINQYEKQVVPIMHFTTLRNSIDRLKTSGVRFEEWCKAWKQFVKES
                     SDIEPSLLAMNRWKWNDNMIELNEKFIVKYVKPPRPGYVNVLFGVPFSAPDNGNEDYE
                     WNTFPSVRDYLEVNDFGRAQHEIDQLANLIDSAAQQFLLL"
     gene            530566..530655
                     /locus_tag="DEHA2F05940r"
                     /db_xref="GeneID:8998892"
     tRNA            join(530566..530604,530619..530655)
                     /locus_tag="DEHA2F05940r"
                     /product="tRNA-Tyr"
                     /note="tRNA Tyr (GTA) cove"
                     /db_xref="GeneID:8998892"
     gene            complement(<530711..>531496)
                     /locus_tag="DEHA2F05962g"
                     /db_xref="GeneID:2903395"
     mRNA            complement(<530711..>531496)
                     /locus_tag="DEHA2F05962g"
                     /product="DEHA2F05962p"
                     /transcript_id="XM_460619.1"
                     /db_xref="GeneID:2903395"
     CDS             complement(530711..531496)
                     /locus_tag="DEHA2F05962g"
                     /note="similar to uniprot|P32656 Saccharomyces cerevisiae
                     YER163C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05962p"
                     /protein_id="XP_460619.1"
                     /db_xref="GeneID:2903395"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF2"
                     /translation="MTNNEIPKPSGEGMWVIGYGSLIFKPLPYYQFKVSGYLKGFIRR
                     FWQSSSDHRGTPEAPGRVVTLVSLDDLKKNRKFHNDIHMYEAGDKYQETDLLSRTNSS
                     ADLGKEDIHDITHNISKLEEDDLKVWGCAYYVGPDDVAKVKDYLDIREKNGYTTHKVP
                     FHVLNVCDDSENAKEVMQNIPKNKNGDYIIESLIYIGTTDNVSFVGPEDIEKTGEKIR
                     TSRGPSGENSEYLIELCKAVRHLDDEGRSRDYYLEDLVKFVEL"
     gene            <531932..>534862
                     /locus_tag="DEHA2F05984g"
                     /db_xref="GeneID:2903402"
     mRNA            join(<531932..531952,532061..>534862)
                     /locus_tag="DEHA2F05984g"
                     /product="DEHA2F05984p"
                     /transcript_id="XM_460620.1"
                     /db_xref="GeneID:2903402"
     CDS             join(531932..531952,532061..534862)
                     /locus_tag="DEHA2F05984g"
                     /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
                     YLR138W NHA1 Na /H antiporter involved in sodium and
                     potassium efflux through the plasma membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F05984p"
                     /protein_id="XP_460620.1"
                     /db_xref="GeneID:2903402"
                     /db_xref="GOA:Q6BMF1"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF1"
                     /translation="MTWSQLELEKAHIAYACIGIFSTIFSLVSLFVKERLYIGEATVA
                     TIAGLILGPHCLGWFEPVTWGNSDYITLEICRIVLCIQIVAVAVELPRKYMKKHWLSV
                     AIFLLPVMTCGWLVVGLFIWVLIPHFNFSSALLVSACVTATDPVLAAAVVGKGKFAER
                     VPGHLRNVLSAESGCNDGMAFPFIFLSLNIILHPGNAGEIVKDWFLLTILWECFFGVA
                     LGVILGLLMRYAVAFAEKKGLIDRESFLAVFVFLAFNSAGIGSMLGVDDLLVSFAAGT
                     AFGWNGDFAKKTEESHVSTVIDLILNLSFFVYFGAIVPWPEFNNAAIGLNVWRLIILA
                     LVIIFLRRMPAVLILKPFTPDIKSWREALFCGHFGPIGVGAIFAAILARKDLEAHFTS
                     EETPLALLPENNFPHYQLLACIWPIVCFIVITSIIVHGSSVAVLTLGKRLNRMAITMS
                     FTTTNTQDQGPSWMSRLQKLDKASTSFSLHRIDTQAPSTEKGHKLQQSNTVETSGIKV
                     RPAGGAKRRKHKKKRDPRSRLKKSLSRASADSEADEIVPSQRHKPQAEFLQLGRTPST
                     AIRTPSDEESEPESAVGIDNSKEDFDDSPGSSNSIEVVANEDQGRMVFAVPPYDSHGR
                     VEQDEDQDNGKVSFARNAMEGRKSVPSTAFQEGEKIIIEDQAGEIIETLPLKSLQGQP
                     ENEDDLSIHSMNSLSRQLSKYSTAQSDRTSTETSLNTKEKPNSPLGKLARSSSLSLGR
                     KGKRKGYYKKNDPKHRKVFAHQVDNFIVIENADGDIIRRYKVNRHTANRARSNTGNSM
                     VGKALNFVGLKKNNPKNNVDANDLEKNDIENILIPEHDDTNNPNHPLKNPKFENAIES
                     KLTKILLDDRSKSSNFLSVGNKSETIQEDSERGVSDDDYDTSSGSEETDEDEDQVLEE
                     TDIEKKRRLAALGQMPTHRRKEDEED"
     gene            complement(<535042..>536349)
                     /locus_tag="DEHA2F06006g"
                     /db_xref="GeneID:2903125"
     mRNA            complement(<535042..>536349)
                     /locus_tag="DEHA2F06006g"
                     /product="DEHA2F06006p"
                     /transcript_id="XM_460621.1"
                     /db_xref="GeneID:2903125"
     CDS             complement(535042..536349)
                     /locus_tag="DEHA2F06006g"
                     /note="similar to uniprot|P07991 Saccharomyces cerevisiae
                     YLR438W CAR2 L-ornithine transaminase (OTAse) catalyzes
                     the second step of arginine degradation expression is
                     dually-regulated by allophanate induction and a specific
                     arginine induction process"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06006p"
                     /protein_id="XP_460621.2"
                     /db_xref="GeneID:2903125"
                     /db_xref="GOA:Q6BMF0"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BMF0"
                     /translation="MTSPNFNISSELAVKYETDYSAHNYHPLPVVFTKAKGAHVWDPE
                     GKEYLDFLSAYSAVNQGHCHPKIVEALVDQASKLTLCSRAFSSDVFGVFAKYITEYFD
                     YEMVLPMNTGAEAVETGLKLARRWGYVEKGIPEDEAVILSAVNNFHGRTLGVISMSTD
                     PEATSKFGPYLQGVGPQIPGEPKGTLLRYGEIEDVEKAFNNAGDKIAAILLEPIQGEA
                     GIVVPPEGYLTKVQALCKKHNVLLICDEIQTGVARTGKMLCYEHSANVKPDVILLGKA
                     ISGGVMPVSAVLSSKKIMLCLEPGSHGSTYGGNPLACRVATAALQVVKDENLVDRSNK
                     LGELLRSKLEELKAKSNGVISEVRGKGLLCAIVIDDSKTNGRTAWDLCLLMKDHGVLA
                     KPTHDHIIRLAPPLVISEADLLKGVDSIEKSLSELNDAPKAAH"
     gene            <536753..>537337
                     /locus_tag="DEHA2F06028g"
                     /db_xref="GeneID:2903126"
     mRNA            <536753..>537337
                     /locus_tag="DEHA2F06028g"
                     /product="DEHA2F06028p"
                     /transcript_id="XM_460622.1"
                     /db_xref="GeneID:2903126"
     CDS             536753..537337
                     /locus_tag="DEHA2F06028g"
                     /note="similar to CA2562|IPF19953 Candida albicans
                     IPF19953 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06028p"
                     /protein_id="XP_460622.1"
                     /db_xref="GeneID:2903126"
                     /db_xref="InterPro:IPR013900"
                     /db_xref="UniProtKB/TrEMBL:Q6BME9"
                     /translation="METADFKRAANKGIEPQHENSDIASLSTLGMRIRKSVADGYNVP
                     SNKYNGYNAYDRMGYTSHGEYGRVEPKAIGIFGGNQDGSNIDYEPARVPLPTHMSQPP
                     ALTNVGSTIGTCSNLSEWENNYASHAPAISTLGVFDQGAKGKRKFDDIDEDAVAYGSG
                     AGASPGAISTNTTYDMGTEYYRAKYGELKFDEDF"
     gene            <537804..>539672
                     /locus_tag="DEHA2F06050g"
                     /db_xref="GeneID:2903127"
     mRNA            <537804..>539672
                     /locus_tag="DEHA2F06050g"
                     /product="DEHA2F06050p"
                     /transcript_id="XM_460623.1"
                     /db_xref="GeneID:2903127"
     CDS             537804..539672
                     /locus_tag="DEHA2F06050g"
                     /note="similar to uniprot|Q2VQX1 Saccharomyces cerevisiae
                     YLR443W ECM7 Non-essential protein of unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06050p"
                     /protein_id="XP_460623.2"
                     /db_xref="GeneID:2903127"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6BME8"
                     /translation="MMFNNIGYHFLLPFRNLTAQARFLQIIRLFTCIAALTFIIATLI
                     GSLANRNIYIARINCARLDVARGLYNSLRSSVSLSSSILGDSEDNVLPVDSSLTNSEI
                     AVLTSYAENQVADAPQYIVTSLWSWCYGNYNITQHMDRHGVVHISKHNDVLTCSKSTK
                     RYIFDYKDELELIGLQSILAYAYQSSDLNDKKYEETIAKRNNKYKLVPSGLIFGASSQ
                     LVILIFGYILYSNRGPEQSLNKIPVFVMNIIALISVASFLSLAVSSSLVTNLLIEIRG
                     EIKSNLGDYGIALHFGDIWFSLLWLSFTFSLLSSVSWTFPLWCANPRDFDEEEDFDDF
                     PYGSDNITDNEEAGMSDLSGLRRNPSVSDKYNRFNKTSANISSGVQYKASADFGAKND
                     NDVEERDFSDDEDHEYETDYVYNDTSNRKYDAYGARNEDELRKLGETLSRKMSVRRLN
                     RNLSKKSRKSYLRDANYPIFEDESSNLLYHDVNISNSQYPMTDSMAHHYREETFDGYV
                     NSHKPTTSASTMSLGTSKILTSHINKVREEGNNTPTRNASDKSVDRRKNNKEQDTNFR
                     SNSLQERHFQHNTRNNPFLQSDTLESLENKRNSTGDSFLNFDEMEILDNNNYINRL"
     gene            <539882..>541132
                     /locus_tag="DEHA2F06072g"
                     /db_xref="GeneID:8998893"
     mRNA            <539882..>541132
                     /locus_tag="DEHA2F06072g"
                     /product="DEHA2F06072p"
                     /transcript_id="XM_002770708.1"
                     /db_xref="GeneID:8998893"
     CDS             539882..541132
                     /locus_tag="DEHA2F06072g"
                     /note="weakly similar to uniprot|Q04658 Saccharomyces
                     cerevisiae YML066C SMA2 Spore Membrane Assembly"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06072p"
                     /protein_id="XP_002770754.1"
                     /db_xref="GeneID:8998893"
                     /db_xref="UniProtKB/TrEMBL:W0TYT5"
                     /translation="MIYDRSQDSENSHSSLFDSSNSTLNISEKQIELQDFNLGDCLPE
                     AEHMDKDEISPSFRLGLQNYEDTVNSSLMGQYSNSNDGFPSEEEPIGTLSMRTGTMNF
                     AKSIWRMFCIAIILQVFLGFSYMMFLPQFSLQFRDDSPEARRLLSSISEGLKMISYLA
                     KDLSVTLNDNSNILNDINYIDTIDTFSDNYIYQFNAIQYCKYNTVNTTTECISTNGLD
                     IFTSLVTDIGLQLGNVSKAEDPGKLATSLVTTYSNLVDSLDEMRDSNTSHTFALAPID
                     LKTIKIAHGLKKSQKYGKMMSYLASPVNFMHPIIWMILGLSCLALSGTSKFAIFNQRN
                     LFGYSIIILVFLVLCFGITLFNWAATTWYFYRIHGQMNKVNIAQFKLGTGFIILTSCV
                     SLYAVLLYQLTQILRSKNSIYNFS"
     gene            complement(<541486..>542808)
                     /locus_tag="DEHA2F06094g"
                     /db_xref="GeneID:2903129"
     mRNA            complement(<541486..>542808)
                     /locus_tag="DEHA2F06094g"
                     /product="DEHA2F06094p"
                     /transcript_id="XM_460624.1"
                     /db_xref="GeneID:2903129"
     CDS             complement(541486..542808)
                     /locus_tag="DEHA2F06094g"
                     /note="highly similar to uniprot|P06106 Saccharomyces
                     cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
                     serine sulfhydrylase required for sulfur amino acid
                     synthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06094p"
                     /protein_id="XP_460624.1"
                     /db_xref="GeneID:2903129"
                     /db_xref="GOA:Q6BME7"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BME7"
                     /translation="MPSHFDTLQLHAGQPVEKPHKPRAPPIYATTSYVFDDSKHGAQL
                     FGLETPGYIYSRIMNPTNDVFEQRMAALEHGIGAVATSSGQSAQFLAIAGLAHVGDNF
                     ISTSFLYGGTYNQFKVAFKRLGIETKFVNGDKVEDFAKLIDDKTKAIYIETIGNPKYN
                     VPDFEAISKLAHDHGIPVVVDNTFGAGGYLINPIDHGADIVVHSATKWIGGHGTTIAG
                     VIVDSGNFPWEKYPERFPQFSKPSEGYHGLVLNDALGKAAFIGHVRIELLRDLGPALN
                     PFGSFLLLQGLETLSLRVERQSYNALKLAQFLEKSPYVEWVSYLGLPSHEYHERSKKY
                     LNNKENYGGVLSFGVKDLGENKEDPFQEASPRFVDNLKVASNLANVGDSKTLIIAPYY
                     TTHQQLSDEEKAASGVSKDLIRVSVGTEFIDDIIGDFEQAFKTVYESS"
     gene            <543172..>544026
                     /locus_tag="DEHA2F06116g"
                     /db_xref="GeneID:2903130"
     mRNA            <543172..>544026
                     /locus_tag="DEHA2F06116g"
                     /product="DEHA2F06116p"
                     /transcript_id="XM_460625.1"
                     /db_xref="GeneID:2903130"
     CDS             543172..544026
                     /locus_tag="DEHA2F06116g"
                     /note="similar to CA2566|IPF12122 Candida albicans
                     IPF12122 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06116p"
                     /protein_id="XP_460625.2"
                     /db_xref="GeneID:2903130"
                     /db_xref="UniProtKB/TrEMBL:Q6BME6"
                     /translation="MTKEYKQCKGITSKGIQCKINAPDGYCHYHIGQCGKGKKINSSP
                     ANVRSIDGKGREIIHGSPISRGTSPTKQTEKIGYIYVYTLTRLLSNNDKNWSLKVRNL
                     PNVSSKHRDTWVPFKSEKSPYMLIKVGMTTQTVQRRLRQWQDKCHHELTCLHPQKKIE
                     SSNKLDSIIHRFKGLSIKKERGKFRTYDGDQFGFLCPRGVNVAESEIHKMLIAKYGSG
                     DVYCTGCKENSPIENSSKLKTLKERLHTKDPFRNGYNIHVEWFLIPKKDLDTVYQLID
                     MVCSKYYN"
     gene            complement(<544121..>545872)
                     /locus_tag="DEHA2F06138g"
                     /db_xref="GeneID:2903132"
     mRNA            complement(join(<544121..545199,545644..>545872))
                     /locus_tag="DEHA2F06138g"
                     /product="DEHA2F06138p"
                     /transcript_id="XM_460627.2"
                     /db_xref="GeneID:2903132"
     CDS             complement(join(544121..545199,545644..545872))
                     /locus_tag="DEHA2F06138g"
                     /note="highly similar to uniprot|Q07478 Saccharomyces
                     cerevisiae YDL084W SUB2 Suppresses the cold-sensitive
                     snRNP biogenesis brr1-1 mutation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06138p"
                     /protein_id="XP_460627.2"
                     /db_xref="GeneID:2903132"
                     /db_xref="GOA:Q6BME5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSHEGQEELLDYSDSEEIAVPTTTAPSAAAGEGANDKEADKKGS
                     YVGIHATGFRDFLLKPELLRAIGDCGFEHPSEVQQVCIPQSILGTDVLCQAKSGLGKT
                     AVFVLSTLQQLDPVPGEISTLVICHTRELAYQIRNEYARFSKYMPDVKTEVFYGGTPI
                     TRDLEKLKNKDTCPHIVVATPGRLHALVTEKSIRLNNIKSFVIDECDKVLEAVDMRRD
                     VQDIFRNTPHQKQVMMFSATLSQEIRPVCKKFMQNPLEIYVDDEAKLTLHGLQQYYIK
                     LDEKEKNRKLSDLLDSLEFNQVIIFVRSTQRANELNKLLCSSNFPSIAVHSGLPQEER
                     IERYKSFKEFNKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTK
                     GLAVSLVSTKDDEEVLEKIQSRFDVKITEFPEEGVDPSTYMNT"
     gene            <546109..>546534
                     /locus_tag="DEHA2F06160g"
                     /db_xref="GeneID:2903133"
     mRNA            <546109..>546534
                     /locus_tag="DEHA2F06160g"
                     /product="DEHA2F06160p"
                     /transcript_id="XM_460628.1"
                     /db_xref="GeneID:2903133"
     CDS             546109..546534
                     /locus_tag="DEHA2F06160g"
                     /note="weakly similar to CA2569|IPF12117 Candida albicans
                     IPF12117 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06160p"
                     /protein_id="XP_460628.2"
                     /db_xref="GeneID:2903133"
                     /db_xref="UniProtKB/TrEMBL:Q6BME3"
                     /translation="MLRLSFCKIRSISAKSVPISRNIAFRYLAAAKRPIVYQRTYASS
                     SKPDDVSEEAQRVGNLINVFRQNPEIRSLLDDFQNLLAEKGLQPDGKQPTMFQMMKIL
                     ADKDVKASLLKLKEALDGANIQLTQEDLNAFMNLYGLKK"
     gene            complement(<546616..>547443)
                     /locus_tag="DEHA2F06182g"
                     /db_xref="GeneID:2903134"
     mRNA            complement(<546616..>547443)
                     /locus_tag="DEHA2F06182g"
                     /product="DEHA2F06182p"
                     /transcript_id="XM_460629.1"
                     /db_xref="GeneID:2903134"
     CDS             complement(546616..547443)
                     /locus_tag="DEHA2F06182g"
                     /note="similar to uniprot|P32263 Saccharomyces cerevisiae
                     YER023W PRO3 Delta 1-pyrroline-5-carboxylate reductase
                     catalyzes the last step in proline biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06182p"
                     /protein_id="XP_460629.2"
                     /db_xref="GeneID:2903134"
                     /db_xref="GOA:Q6BME2"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:Q6BME2"
                     /translation="MEDYTIAVLGCGVMGTAVTSAILKAKFEPYPSKIICCTNSEKSS
                     TELKSKLDSDVIETSYGSESNNKAVSKADIVILGCKPFMFKDVYEQVKGSLSGDQLII
                     SLLAGTTIEELSIMSPYVAKVMTNTPAQFGCGMAVVSFSDEAESKYSDLVMKLIDPVG
                     KAMKLPEKNMDAATALVGSGPAFCLLIMEALVDGGVRMGLPYAVAKESAAKVMEGTAK
                     MVLETGEHPAALRSKICTPGGTTIGGLLKMEDAGVRGGIARAVEEAANISASFAKKK"
     gene            <548122..>550662
                     /locus_tag="DEHA2F06204g"
                     /db_xref="GeneID:2903135"
     mRNA            <548122..>550662
                     /locus_tag="DEHA2F06204g"
                     /product="DEHA2F06204p"
                     /transcript_id="XM_460630.1"
                     /db_xref="GeneID:2903135"
     CDS             548122..550662
                     /locus_tag="DEHA2F06204g"
                     /note="weakly similar to uniprot|P47156 Saccharomyces
                     cerevisiae YJR119C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06204p"
                     /protein_id="XP_460630.2"
                     /db_xref="GeneID:2903135"
                     /db_xref="GOA:Q6BME1"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6BME1"
                     /translation="MTFNKDLLVPCPIVTPTMEEFSDPIKYLSSEEVAKLGSEYGLIK
                     VVPPKGWQPTFSISPEFKFHTRLQKLSDLGLTTRSRKFFIDNINRFMKMSRKRQLKLY
                     FRVGLNDAKEFSPTRLKVYYYDLHVMVEKMGGYDNMNGDKWAQINDLFGLKKESTHIE
                     DEYLINLRSYANFLSYNQKNYDFPESDSEDDYDNCLICGKHDNPSQTLLCDNCDNPFH
                     LSCLEPSLETVPSGSWYCDKCLIGTGEYGFEEQVDLKYSIPEFYQLCNEFERKFEHEY
                     NNDEPLSVDKIEQKFWEFIDVEKSDLEVRYGADIHNLKPGEISGFPMANTPGISPEDP
                     ETKYYMNHPWNLTKLPFAEGSLLNYINTSISGMTVPWIYIGSLLSTFCWHVEDHYTLS
                     ANYCHLGATKKWYGIPSYDADKFEKLMKDSAPDLFQKQPDLLHQLVTLLSPMTLVKNG
                     IKCVYADQRPNEFVITYPRVYHAGFNCGFNFNEAVNFTMNTWLGFGEKSISDYRLIKK
                     ENVFNHYQLVENILKKINTQDDINHTNLRLAEASLKCLREFVQTQLKYISMIDISKFE
                     VKFEPKLFKQRKFEDEQNGTFEATSEQEDEEDLCDICRTHISFQYCIINNRDRNLFST
                     HGVTGESLAPPHTVPPITSVKHESQDFPKISIHQLLTPESSPHELSVPQATPKTVHRI
                     SDSSSSTRLSALSETSITDTTSNPLPKLSEEQEFQNLIRAAKRSSSPDSSLCKTGKID
                     KTAPKRRKSSRIESLSKKAHITSFAARTLAGPRRGKMSVVQNNSRFKHLNDKPQIRLC
                     LACLVSSCPKSIISIPLGSVMLYEVDPSTMLQFISQTSRKIALLSTNI"
     gene            <550977..>552929
                     /locus_tag="DEHA2F06226g"
                     /db_xref="GeneID:2903136"
     mRNA            join(<550977..551092,551534..>552929)
                     /locus_tag="DEHA2F06226g"
                     /product="DEHA2F06226p"
                     /transcript_id="XM_460631.1"
                     /db_xref="GeneID:2903136"
     CDS             join(550977..551092,551534..552929)
                     /locus_tag="DEHA2F06226g"
                     /note="highly similar to uniprot|P00830 Saccharomyces
                     cerevisiae YJR121W ATP2 subunit of mitochondrial F1F0 ATP
                     synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06226p"
                     /protein_id="XP_460631.1"
                     /db_xref="GeneID:2903136"
                     /db_xref="GOA:Q6BME0"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BME0"
                     /translation="MVFPRLFNSASRNAFTAAKRNFVFNRGLASAAPVAGKVRAVIGA
                     VVDIQFDEGNLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTDGLVRGAPVN
                     DTGAPISVPVGRETLGRIINVIGEPIDERGPIKTKQKNPIHADPPSFVEQSTSSEVLE
                     TGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTRE
                     GNDLYREMQETGVINLEGDSKVSLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDV
                     LLFVDNIYRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQA
                     VYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIAVVGKEH
                     YDVASGVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFT
                     GIPGKLVRLQETVKSFKEVLDGKHDHLPENAFYMVGGIEDATAKAEKLASESK"
     gene            <553200..>554612
                     /locus_tag="DEHA2F06248g"
                     /db_xref="GeneID:2903137"
     mRNA            join(<553200..553217,553290..>554612)
                     /locus_tag="DEHA2F06248g"
                     /product="DEHA2F06248p"
                     /transcript_id="XM_460632.1"
                     /db_xref="GeneID:2903137"
     CDS             join(553200..553217,553290..554612)
                     /locus_tag="DEHA2F06248g"
                     /note="similar to uniprot|P47154 Saccharomyces cerevisiae
                     YJR117W STE24 Highly conserved zinc metalloprotease that
                     functions in two steps of a-factor maturation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06248p"
                     /protein_id="XP_460632.1"
                     /db_xref="GeneID:2903137"
                     /db_xref="GOA:Q6BMD9"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD9"
                     /translation="MFSLANSFSFLDSASINWKSIIVGFTVGQFLFENYLDYRQYQVL
                     KRTTPPDTLKAEVSQETFDKSQDYSRAKAKFGFLSDSINLFQNLAIIKYDLLPKFWNI
                     AGTLMAKSSFILPKFMGGIITQSLFFLFSTQIISTIVSLPLSYYSNFVLEEKYGFNKL
                     TVGLWLTDKVKGIALGIALGSPVVAAFLKIIDYFGDSFILYTCGFLFVVQLVGMTIFP
                     TLIQPLFNKFTTLDEGELKTAIENLACEQKFPLTKLYVIDGSKRSSHSNAYFTGLPWS
                     KQIVLYDTLIKHSTKEETVAVLAHEIGHWKLSHLPQMLVFSQAHLFLSFSMFSAFIHN
                     NSLYSSFGFTSVQPIMIGFMLFNDIFQPVECVAQFGMNLLSRKNEYEADAYAKKCGYS
                     DDLAKALIKLLSENLSTMDADWLYSSYHHSHPILSERLRAINYVSKEKVGKKDE"
     gene            complement(<554700..>555425)
                     /locus_tag="DEHA2F06270g"
                     /db_xref="GeneID:2903138"
     mRNA            complement(<554700..>555425)
                     /locus_tag="DEHA2F06270g"
                     /product="DEHA2F06270p"
                     /transcript_id="XM_460633.1"
                     /db_xref="GeneID:2903138"
     CDS             complement(554700..555425)
                     /locus_tag="DEHA2F06270g"
                     /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
                     YDL087C LUC7 Essential protein associated with the U1
                     snRNP complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06270p"
                     /protein_id="XP_460633.1"
                     /db_xref="GeneID:2903138"
                     /db_xref="GOA:Q6BMD8"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD8"
                     /translation="MAEEQRKLVEQLMGKDALISPAVKRRDPEMTSHRVCKSFLVGVC
                     PHDLFIGTKQDLGKCPKLHLEKHKLEYEYRTRKKGEAFPEFEYEYYKHLQTYINEIDR
                     NIEIALKRLEHTPEEKEKIAKVTKELDNLDTKIGLMTQEIDCLIKENETLKCLFESVK
                     LNDLCKERDQLAESARNIAENVGQSSQQKLQVCEECGAYLSRLDSDRRLADHLIGKIH
                     LGYVQMRAAYYELHNKFKRSTTY"
     gene            <555980..>557434
                     /locus_tag="DEHA2F06292g"
                     /db_xref="GeneID:2903139"
     mRNA            <555980..>557434
                     /locus_tag="DEHA2F06292g"
                     /product="DEHA2F06292p"
                     /transcript_id="XM_460634.1"
                     /db_xref="GeneID:2903139"
     CDS             555980..557434
                     /locus_tag="DEHA2F06292g"
                     /note="similar to ca|CA2555|IPF12105 Candida albicans
                     IPF12105"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06292p"
                     /protein_id="XP_460634.2"
                     /db_xref="GeneID:2903139"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD7"
                     /translation="MKKYQLIGRKKVFTKSKASVNYPTAHLCSLPVEILMEVFNCLEN
                     DLKTLLKLSLVCNKFHLIINKNFLYNNIIITNPRRFSKFSQTHLPSASHSITRRFGYN
                     EPSNNINLVKSVHFINPPTRNSTNRKTKIAGTYDVESVQSTDEEASFDEYIHSFTNLL
                     KEAYGLKTITISEISPEFSFPHDIPGDSSSVFSSFKSKRPPRTLGKLVLKVQSGWSIP
                     FRTSHISSLFNVYGAIDELVLHNFVLDDSKLTSSSKIGGINKLVLFSCIYSNSLSKKV
                     PNQKKRCPDILAEVTELRLLNILSGSDLSVIDVIKQNGKLSKLTLDLDSQVFYSMTKN
                     SSNEKQFNFARYNLFFKLLCSGQGFYANLTELELINFDLFDSFRHKHKIKEEDEDNDD
                     WVAPSTDTFESLLTYLSTIQNLSIVLKERPKKVRTCIKCGFTKSEQPDKKIHSLNNRE
                     WSILLHPLLSENEDCTVKIFDHKGNRVFVRSKYI"
     gene            complement(<557441..>559204)
                     /locus_tag="DEHA2F06314g"
                     /db_xref="GeneID:8998894"
     mRNA            complement(join(<557441..557523,557630..558165,
                     558217..558500,558603..558863,558917..559042,
                     559094..>559204))
                     /locus_tag="DEHA2F06314g"
                     /product="DEHA2F06314p"
                     /transcript_id="XM_002770709.1"
                     /db_xref="GeneID:8998894"
     CDS             complement(join(557441..557523,557630..558165,
                     558217..558500,558603..558863,558917..559042,
                     559094..559204))
                     /locus_tag="DEHA2F06314g"
                     /note="similar to uniprot|Q08271 Saccharomyces cerevisiae
                     YOL132W GAS4 Putative 1 3-beta-glucanosyltransferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06314p"
                     /protein_id="XP_002770755.1"
                     /db_xref="GeneID:8998894"
                     /db_xref="GOA:W0TYT0"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:W0TYT0"
                     /translation="MRCFLVITCLILKSVEAFIHPITIRGKSFVDSVTQEPFFIKGVD
                     YQPGGSSGVTDTKDPLSDPKECVRDIIMLQDLGINTIRIYSINADLNHDICMSMLAAA
                     GIYLVLDVNSPLPNHHLNRNEPWKTYNEQYLKNIYKVVEQFSYYNNTLGFFAGNEIVN
                     DKISAKNSPTYVKAVIRNLKKYIDYNSPRQIPVGYSAADDLDYRVSFSEYLECVDDSV
                     TDSVDFYGVNSYQWCGEQTFYTSGYNILANDYSSFSRPVFLSEYGCNEVLPRRFDEVQ
                     TLYSSKMNKIFSGGLVYEYSQEPNNYGLVSILDNGDIKVLPDFIALKSQFESLPLIDN
                     YQFIQNTLGNLKGSQKSSLPKCKKTYSNLNIDKTVPKIANDPMYSNIDVERGKYVELN
                     EDDLISSYNILNYKGEPYAVDDSMEIIFDHMSGAEIVRNNKNDKERNSGSSPSIHNLL
                     SKLLVYLIVLEITLWL"
     gene            559515..559587
                     /locus_tag="DEHA2F06336r"
                     /db_xref="GeneID:8998895"
     tRNA            559515..559587
                     /locus_tag="DEHA2F06336r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (TCT) cove score=75.37"
                     /db_xref="GeneID:8998895"
     gene            559595..559685
                     /locus_tag="DEHA2F06358r"
                     /db_xref="GeneID:8998896"
     tRNA            join(559595..559632,559649..559685)
                     /locus_tag="DEHA2F06358r"
                     /product="tRNA-Phe"
                     /note="tRNA Phe (GAA) cove"
                     /db_xref="GeneID:8998896"
     gene            complement(<559886..>562936)
                     /locus_tag="DEHA2F06380g"
                     /db_xref="GeneID:2903146"
     mRNA            complement(<559886..>562936)
                     /locus_tag="DEHA2F06380g"
                     /product="DEHA2F06380p"
                     /transcript_id="XM_460635.1"
                     /db_xref="GeneID:2903146"
     CDS             complement(559886..562936)
                     /locus_tag="DEHA2F06380g"
                     /note="weakly similar to uniprot|P38244 Saccharomyces
                     cerevisiae YBR074W Uncharacterized zinc metalloprotease"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06380p"
                     /protein_id="XP_460635.2"
                     /db_xref="GeneID:2903146"
                     /db_xref="GOA:Q6BMD6"
                     /db_xref="InterPro:IPR007484"
                     /translation="MAETESGTGNSPSHRLSETSNASGNRSHQQSKQIASYKSSKPNV
                     FIRFIRAIFGYRKTSVTLFVFITIIATLILVELSNSLDFSVKLPTNNLERTILDNSWL
                     DLQKIGKEEHPYTSKGNDYVHDYLEAKITELIGKSLFIECDNDVNYTNNIIFKTENDL
                     YNQVTYYESNNLLVRINGSDSSLPALLVSAHFDSVPSSFGVTDDGMGIASLLGILNYY
                     SSDGIDQPMRTIILNFNNNEEFGLMGATSFLHHPWFKQVRYFLNLEGTGAGGKAVLFR
                     GTDYGIVKYFKHVRYPFGTSLFQQGFNNHLIHSETDYKIYKENGGIRGIDLAFYKPRD
                     IYHTASDSIKNIDIKSLWHMLSNSLDFVEIVSSQRIDLDDEDTSPESDEKSREFAIFS
                     SFFNWFFVIPASQLVLINVTCLAVIPLISLPLLVIIFNYKKNWHIGFINAIKFPVSLV
                     LSICILNIITHNVIASINEFLPNSSYDSIVSTLYSLFLLLNYLFLNGINFIFKGYKGL
                     YHDEKLILIIQTSFIYWVLLIVSTNKLSKNKIGNDHTGEFPLIMLFLLQSIGALFGLF
                     SWSFKKTTPDELRNNDDEACQALLSREEHNNYGSNEAELESGEPISSNSSVSLNSSSS
                     QVTNNLVKNLRKSFSYDWSIQYVVIVPLSSLIVYNTGSLLLSGLNKSIQESLNAEKLI
                     FDLIQLVAVTLAIPFLPFIFKINRLLVTALVLVFCSGFISIFLKSPFDQLNPLKLRFV
                     QSINLDESSDISVVNVFGRYGSPMNNVLLDLPSLKETNESLECNNLQDGMQLCSYKTL
                     LSPNLSPDVTDFNDYLDVQVLKNSSSDYPYGLLSGEIKINVPENRVCRLSFNNSNFEN
                     SKQSLVRTILVYEDNNYENSSNKLFPFEVSEFQLANLPEGFSRDKKGTYIYKNLNGID
                     KLELNKLSWDKPYHVGFQWMPKFVDSVSAENENTNVPYTTDFNNLGIQVECFWGNLGY
                     ANNENKSEDERIPAYGEVLHYSPNYVSWANKESGLVSVSKYVEI"
     gene            <563137..>564276
                     /locus_tag="DEHA2F06402g"
                     /db_xref="GeneID:2903147"
     mRNA            join(<563137..563223,563275..>564276)
                     /locus_tag="DEHA2F06402g"
                     /product="DEHA2F06402p"
                     /transcript_id="XM_460636.1"
                     /db_xref="GeneID:2903147"
     CDS             join(563137..563223,563275..564276)
                     /locus_tag="DEHA2F06402g"
                     /note="highly similar to uniprot|P32347 Saccharomyces
                     cerevisiae YDR047W HEM12 Uroporphyrinogen decarboxylase
                     catalyzes the fifth step in the heme biosynthetic pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06402p"
                     /protein_id="XP_460636.2"
                     /db_xref="GeneID:2903147"
                     /db_xref="GOA:Q6BMD5"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD5"
                     /translation="MPEFAPLKNDLILRAARGEKVERPPMWIMRQAGRYLPEYHEVKG
                     KLDFFETCRNAEIAAEITIQPIEHFNGLIDAAIIFSDILVIPQVMGFEIEMVEGKGPV
                     FVDPLRSPKDLSRVNYKPDILKGLDWAFKAITLTRTKLNGRVPLLGFCGAPWTLLVYM
                     TEGQGSKMFRYAKEWIYEHTEESHKLLQATTDACIEFLAQQVVAGAQMLQVFESWASE
                     LGPNEFNEFSLPYLRQISEKLPKRLQELGITEKIPLTVFAKGAWYALDSLCDSGYDTV
                     SLDWLYKPEDAVKVVNGRRITLQGNLDPGTIYGSDEVISKKVEQMIKGFGGGKQNYII
                     NFGHGTHPFMKPEKVEHFLKECHRFGSQ"
     gene            <564498..>566402
                     /locus_tag="DEHA2F06424g"
                     /db_xref="GeneID:2903148"
     mRNA            <564498..>566402
                     /locus_tag="DEHA2F06424g"
                     /product="DEHA2F06424p"
                     /transcript_id="XM_460637.1"
                     /db_xref="GeneID:2903148"
     CDS             564498..566402
                     /locus_tag="DEHA2F06424g"
                     /note="similar to uniprot|Q66RH0 Saccharomyces cerevisiae
                     YDR049W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06424p"
                     /protein_id="XP_460637.2"
                     /db_xref="GeneID:2903148"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD4"
                     /translation="MDKVNNTDIDANDSYLYDLPEKILGSLELIYFDSSTTVVPSQSV
                     PSTSTQVVEVNTDTKEDKPIQNISVCSVCKPQYDLKATQNEKRDHYRSDYHRLNLKRS
                     ISNLPPLSESEFDRLIEEESIESISGSDDSSESESEDELSSSTKLDTIIEKFDSVSID
                     KNETNDDEEEGTISYLNTNSPFIYFKSILIPEGKVFGVYKSVFTERQLQEDPVETLRS
                     FSNPPIKTKKSALLMIGGGHFAGAIISHIPKNIKGNAPNFKESKQEQLTNIIESKTFH
                     RYTTRKKQGGSQSASDNARGKANSAGSSIRRYNEQALTREVRDLLMSWKGHIDDCTNI
                     YIRANGPSSRRILVGYDGCVLHTSDDRIRSFPFTTKRATTSELKKAWSNLSYLTIHDM
                     PKSNEKLKKRLQKQRDNLKNSQQQHSKKPEEIVLDENDKHSNELIGFLKKSKAPMLVN
                     YIHKNNLSPNHELSPKDQYVHNPTLLHFASSQGLSHMVQVLIVNLKADPTISNQFGKT
                     PFELAGNTATRRAFQIARYSLGEDYCDWQLSKVGSPKSKEEVEREQKEEQKKIDEDKK
                     KMIEDELAKRTEMEQKKPTYSSGGTLGSGKIPSSLTETSGLSEQQKMRIMREQRARAA
                     EARMKRMQGN"
     gene            complement(<566430..>569084)
                     /locus_tag="DEHA2F06446g"
                     /db_xref="GeneID:8998897"
     mRNA            complement(<566430..>569084)
                     /locus_tag="DEHA2F06446g"
                     /product="DEHA2F06446p"
                     /transcript_id="XM_002770710.1"
                     /db_xref="GeneID:8998897"
     CDS             complement(566430..569084)
                     /locus_tag="DEHA2F06446g"
                     /note="similar to uniprot|P38086 Saccharomyces cerevisiae
                     YBR073W RDH54 DNA-dependent ATPase stimulates strand
                     exchange by modifying the topology of double-stranded DNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06446p"
                     /protein_id="XP_002770756.1"
                     /db_xref="GeneID:8998897"
                     /db_xref="GOA:B5RUA6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B5RUA6"
                     /translation="MYKSGLRAAFKPPRRIDSSQSSLDAKSSSPAPINQCVDAKVSQD
                     KEASPYRAASSESSRQAYKRPKIGSNVMKAEDSPSVLAPGPKDEESVRMYMVQWRKFT
                     NKKNKTWDGDGLIVVSSSGITFKCDVKGNGNYKQMGKTSKTKTEGIIALGSYELEIDY
                     EIADKTTLNNSQDVGQENKVPSHHIPAPPRNQFKKVVPLGISNAQSTARVSTSNRNPL
                     YDPDAEHSLIMTRPPNKTREETIDVVVDPVLSRLLRPHQREAVSFVYECLMGFKNFKG
                     NGALLADEMGLGKTLTTITLIWTLLKQTPYSEDISPICKKVLITCPVTLIGNWKKEFK
                     KWLNINRIGVLTVNNKQNASKDKQEIKSFGKTRIYQVLIMSYEKVLSCQNELSTIDFD
                     MLVCDEGHRLKNSSNKVLKVLNDMNISKKVLLTGTPIQNDLVEFYNIINFINPSVLGS
                     FQSFQKDFIKPILRSREVNCINKDTIKRGEIKSNELIELTKEFTLRRTSSILSGYLTE
                     KTDIILFCPPTELQIALFKFVLDSKKFNALLREDNNSLTLITLFKKICNSPSLLFQDK
                     LFNSLIENEHDSTIDLTTLSKKTASSKVNILIPLLIEINQIGDKTVLISNYTQTLDLL
                     ETILHKLNISFSRLDGSTPNKLRDKLVNDFNKQPVSTNSVFLLSAKSGGVGLNLIGAS
                     RLILFDNDWNPSIDLQAMARIHRDGQTKPVFIYRIMTTGCIDEKIFQRQMMKNNLSDK
                     FLDNKTDSKSNLFDMNDLKDLFTVNEETLSNTHDLLQCDCSGIGEDINPLSIDIDSDD
                     ADEETNNPGGWITALDYKQEDQKPKRQQASMINALIDYKHYNPVNVSEQLDCGDMVTK
                     NIIQKSKERSMPIPITYMLTKVTNCTSV"
     gene            <570096..>574586
                     /locus_tag="DEHA2F06468g"
                     /db_xref="GeneID:2903150"
     mRNA            <570096..>574586
                     /locus_tag="DEHA2F06468g"
                     /product="DEHA2F06468p"
                     /transcript_id="XM_460639.1"
                     /db_xref="GeneID:2903150"
     CDS             570096..574586
                     /locus_tag="DEHA2F06468g"
                     /note="weakly similar to uniprot|Q03496 Saccharomyces
                     cerevisiae YMR259c"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06468p"
                     /protein_id="XP_460639.2"
                     /db_xref="GeneID:2903150"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019442"
                     /db_xref="UniProtKB/TrEMBL:Q6BMD2"
                     /translation="MLSEEDVKTVEQYLIVNKEVRPEELKKIFPSLYSTLINADSVDS
                     ARILCSDTLCIWMLRSIKMMRMQHAEQLCEVLTEDTSSRIFEYIMDFLESGTGPLVNS
                     LVSLLHRLIGFCKVLMPLHVDLFHRWVDQAMKLPCTSRNLYFLVDILSKEINKQYILT
                     EHERFTERCIGIMWSNPLANAASKAFVSIYQRLYEKGHDEEWMDKWQGLVMNGLNEKD
                     LSRNIQVYLLPLLFKISPKSYGIFIERNLSLHINDLSNSEIDIYLGLLKVGQDLALMP
                     ETLHKSNTIVPFDYITSLLTHEESKFRISSFALLVGSAKGSQPIQKQVYDVLIDKNIL
                     QIFFMDCDSVELRNDFASLLRQFLIRIRDSMYSLSRDLEKIRKKNYDLSKQDELQELI
                     TYGYDFLTWFLNFLKRNFIPGSSYAQLSLSMKSLQILVDLNLDNVPRSQAYDKLSTKT
                     KIKISNNKMVFPFSIEIFDGQLLRLIIDNITNNYEDIRDTSVNLLLGCSENILSENIL
                     SAEQDIIDKALITLTELKGKKSEGGAKVLQFLAQLYDHIDDVVRLKGLINTLKDKLDF
                     GLNHEFNNEKLPREQRVHGIFTALKLIFQNIDKKRYSVETPYWTGQFSHIFSQVTKIW
                     LQTKPLLSNATDDNEGNDSSEDKLVLNYSWKAIKESTALLSTILEISNPEKNALIDKI
                     TFLSGANLIMDQLASVKHRGAFSSVYPSFVSACEICFKSNDQELASKPSLWLKQNIKL
                     IKSKTQYISRRSGGLPYLITAILTAEKSYNKSKEYKDLIDYTFEELISIAKEEYIQNA
                     DEKMDIPQVHAFNCIKHIFIDSQLSSLCTPYVNQVLTLSLINFYNPTWAIRNCAVMLF
                     TALQNRLFGTSKLGELLPCISSRLFFAKYNGIEDILFQNLVDASAAVEQDTKFNVIFP
                     ILTILSRLENTSTFDPKLQKFETLLIKCSHHKYWKVREMAAKSLAAILLPDSLIPTIR
                     ILIDNCHHSHGDFNSIHGNLLSILEIIKRIETKLPDYRLTDREASNIFEHTIEFLTDS
                     DMFSWSTAKCFVDIVRCILMNNFEISLGNNNLNIIGNFIIRNLTTDIFDNTLNGARQL
                     LLSAMTELVFSQYLKIGRTEDIIDLIRLCLLSRDVYEVQLVAIRFCDSHINHIIEMDS
                     NNYYTAILEELWDLVKDDSCWSFVRSNALELIRKVTSRGEELEREELRSKIEILISFT
                     SKEYSEDSNSKALEALGPLIGQISGCANDDETSNLQRFLDLAYEFASDGRPAIARLSS
                     VNAIIAFVTTTMKKREHGPCVAKGVFMLYLALYDDDDDIRYESAKCLSHFFAFEFTMV
                     PTAITAVFGPNFLAKFGSVISEPIFVDNFVNSKPQLKWKLTQADAQTEDSLFDVESMN
                     LYRNDIQTRQTAIHLLMACNSMEPINNESVVKLTEKVNKDMYYIIDFVARKGHDGYIG
                     WCKDEFIFTSILEGTLNVKAVIKLTNDTELNERLEFLWKLFDKHQVHYMVKHTSDFFI
                     CT"
     gene            <575310..>576389
                     /locus_tag="DEHA2F06490g"
                     /db_xref="GeneID:2903151"
     mRNA            <575310..>576389
                     /locus_tag="DEHA2F06490g"
                     /product="DEHA2F06490p"
                     /transcript_id="XM_460640.1"
                     /db_xref="GeneID:2903151"
     CDS             575310..576389
                     /locus_tag="DEHA2F06490g"
                     /note="similar to uniprot|P38241 Saccharomyces cerevisiae
                     YBR065C ECM2 Pre-mRNA splicing factor facilitates the
                     cooperative formation of U2/U6 helix II in association
                     with stem II in the spliceosome function may be regulated
                     by Slu7p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06490p"
                     /protein_id="XP_460640.2"
                     /db_xref="GeneID:2903151"
                     /db_xref="GOA:Q6BMD1"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSDEFPAICDSCCGPDKHIKMMRQANGEECKVCTRPFTVFRWNP
                     NNGTNKSKKTIICMTCARARNCCQSCMLDITYGIPLEIRDTALKMAGLEHASQIKSSN
                     TSQNREVKAIMADKQEAKYNNEDNDVNKSNDRSEMARDILSKLSEKLNGNTNALIKKA
                     PKNSKTTKKNEIINVKNADISKILGKLPLGGSIVVPETTPELSSFFLFGFSDDIPQYI
                     ISDFCNKFGKIKSLSIVHRAKCGYVVFTTRKAAESFATTIMENGLNKNTATPGLLILN
                     NKYPVRVSWGKQKPLVTTNEECHKLSLVITKVMRQLAEKDKIFEDQKITKKAKNHKTS
                     SDANEHSSNTASTQHYKALRPDFEL"
     gene            <576534..>577232
                     /locus_tag="DEHA2F06512g"
                     /db_xref="GeneID:2903152"
     mRNA            <576534..>577232
                     /locus_tag="DEHA2F06512g"
                     /product="DEHA2F06512p"
                     /transcript_id="XM_460641.1"
                     /db_xref="GeneID:2903152"
     CDS             576534..577232
                     /locus_tag="DEHA2F06512g"
                     /note="weakly similar to uniprot|P38242 Saccharomyces
                     cerevisiae YBR070C ALG14 Essential protein required for
                     the second step of dolichyl-linked oligosaccharide
                     synthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06512p"
                     /protein_id="XP_460641.2"
                     /db_xref="GeneID:2903152"
                     /db_xref="GOA:Q6BMD0"
                     /db_xref="InterPro:IPR013969"
                     /translation="MDFESQLCIKVVLLLLPFFIIGIRLLWVLPAVNSPAMGSEKEKG
                     LSQIPSELRGSNIMIFLGSGGHTGEMMRILANVDLNNFNRTWVTSSGDSTSILKCKKY
                     EDERLTSGQNKSDYLVLHRARTVGESIISSVFSTVRSLISTIKHLYELPQFPSILLLN
                     GPGTSVPLAYIIFLLKFLGLCKTRIIYIESLARVKQLSVSGLLILPITDRFIVQWKQL
                     AVKYKRAEYYGILI"
     gene            <577370..>579721
                     /locus_tag="DEHA2F06534g"
                     /db_xref="GeneID:2903153"
     mRNA            <577370..>579721
                     /locus_tag="DEHA2F06534g"
                     /product="DEHA2F06534p"
                     /transcript_id="XM_460642.1"
                     /db_xref="GeneID:2903153"
     CDS             577370..579721
                     /locus_tag="DEHA2F06534g"
                     /note="some similarities with CA5514|IPF730 Candida
                     albicans IPF730 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06534p"
                     /protein_id="XP_460642.2"
                     /db_xref="GeneID:2903153"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC9"
                     /translation="MGIRPISNTGNTFNGLIKEFPGLGVDRFNTIANLYLLTHCHTDH
                     LCGLRNKSFDSIVYCSETTKKLVALDPSFRHVLPFIIPIETNVPFTITLNGEEITMTL
                     IPAYHCPGATMFLLEGATKNILYTGDIRAESWWVETLSKCPSLFPYTAGLKVLDNIYL
                     DTTFIYRGEPFIEIPSNNEGISVVTSLIKSYPRDDPDVQFYFVDSTSGFEEAWAQIAN
                     SLQGTLHTSEENKLRIESLDCNHLYTHYGHVLNHLINKQSNSRNLKFHACGKYLPSCM
                     SDVPKFPIRIKQCIDFNILDFTGVFCPILLSSISSSERTSGLKMLGKTLKGNIVYEFR
                     GRRWLCKKDGNELLPADIKLVFSRHSSYSECRNFVSKFKFRDVYPCTESKDTWQNGMI
                     MSRLFGDLVYKPYKGDITLLEYDKAKSLEYGPHHSSLLNRPVKIINRWNFSECVDEIR
                     WVKRFLSKIDNNSSDIVHQNSNQFNFEGQKFISKFDLSNYTEDERQFHEERHKDIQLQ
                     KIVIGRGEAWYRKIIENQQKLYCKYHNDIEGGVRSVLRNDPNSDVQFNDGMKLGGIDR
                     YNYDNGSISDESTDEQSHYDSPNISHKNIDDSSVKFGINSNERIHAEPQLEVCRNDEL
                     TDIEDESDSIMSEDPFNENAKFERALRRKTVPIKEDINEALPQQNNFKRPCLQRTNKY
                     NNKRSKKSDFSFIESSFNSFEISFRRHISETEDASITKNASSMMLANRQISSSKIYFK
                     SCASVNSSTIQNVSNDLNNDPANWFSLKLKSVDTQFNQVTKFT"
     gene            complement(<579948..>580283)
                     /locus_tag="DEHA2F06556g"
                     /db_xref="GeneID:2904111"
     mRNA            complement(<579948..>580283)
                     /locus_tag="DEHA2F06556g"
                     /product="DEHA2F06556p"
                     /transcript_id="XM_460643.1"
                     /db_xref="GeneID:2904111"
     CDS             complement(579948..580283)
                     /locus_tag="DEHA2F06556g"
                     /note="highly similar to uniprot|Q04307 Saccharomyces
                     cerevisiae YDR045C RPC11 RNA polymerase III subunit C11"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06556p"
                     /protein_id="XP_460643.2"
                     /db_xref="GeneID:2904111"
                     /db_xref="GOA:Q6BMC8"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC8"
                     /translation="MLSFCPYCANMLIMAQKDDGCNRFFCSTCPYEFKIDGFQMYDRK
                     KLSRKEVDDVLGGEGAWDNVDQTLAQCPIDSCGGDKAYFFQLQIRSADEPMTTFYKCV
                     KCSHQWREN"
     gene            <580491..>582863
                     /locus_tag="DEHA2F06578g"
                     /db_xref="GeneID:2904112"
     mRNA            <580491..>582863
                     /locus_tag="DEHA2F06578g"
                     /product="DEHA2F06578p"
                     /transcript_id="XM_460644.1"
                     /db_xref="GeneID:2904112"
     CDS             580491..582863
                     /locus_tag="DEHA2F06578g"
                     /note="weakly similar to uniprot|P32833 Saccharomyces
                     cerevisiae YBR060C ORC2 Subunit of the origin recognition
                     complex which directs DNA replication by binding to
                     replication origins and is also involved in
                     transcriptional silencing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06578p"
                     /protein_id="XP_460644.2"
                     /db_xref="GeneID:2904112"
                     /db_xref="GOA:Q6BMC7"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC7"
                     /translation="MTFEEKSSPENKGFNDSDIFLTPSKKHVSLSATPSHRQSPFDLT
                     LSPNKSPSKRGVIKLEKTADDIVLFSPVKTPNGRAGLPSPKKRTIAELDKSARKRAIS
                     TSGIYSKLMDDDLEENNNEYLDRQEVSLAEAIIKESRDNKQEDVDEYFRAYGSDVELE
                     EDLTVNKKPKRRGRKPKKEVKVEEDDEIDDEDIEIEDDGELEDDDDEEFKLPKKERKA
                     KNKRIIREVSDIDDISEEDEAEKEILPKRQKITASPFAVTSVDEAISPSKRKVGRPSK
                     ASKVIGKIKSIFQMDDEAFFTENKQATNRIKENADTSDVTKDSDSFFSMTLDNVTQSS
                     IVSVPTVSGIPNTKEGKRKVEVATVDSNKFIPLPIPNINEEGEIEDEEYVKKYLPNVN
                     IEEKYSGRLIDERAFFLDGTEGYFEQHMGRPKASANSLSQLAPPLEYDEFIPYVELSK
                     LIRSKEKNKLNDLHKSLYHQWCFELTCGFSLNFYGVGSKIKLIGDFVQNYLVDWYEQN
                     MQEDEEYPDILVVNGYNPAVKFKKVAHDILSVFISQEKKKQDNVKFPKHISETIPFLM
                     KYVEDRRVHRPGQFIKPKLILVIHNIDGKPFLNERTQSLLSQLCSIPEIWLISSTDNI
                     NVSLLWDSFKLKSFNFLWHDLTTYEPYTVEMSFRDVLSMGKSKKFVGNKGAKYVLSSL
                     TKNARNLYKILLTKQLEIMRNTTTTKAGRNGLKGSIKLGIEFKQLYNTCLEEFVTSNE
                     ISFRTMLGEFVEHKMCSAVKDEAGVEMVFVPFNFDEMEKLLAEEFASNEM"
     gene            <583031..>586042
                     /locus_tag="DEHA2F06600g"
                     /db_xref="GeneID:2904113"
     mRNA            <583031..>586042
                     /locus_tag="DEHA2F06600g"
                     /product="DEHA2F06600p"
                     /transcript_id="XM_460645.1"
                     /db_xref="GeneID:2904113"
     CDS             583031..586042
                     /locus_tag="DEHA2F06600g"
                     /note="weakly similar to uniprot|P38080 Saccharomyces
                     cerevisiae YBR059C AKL1 Serine-threonine protein kinase
                     member (with Ark1p and Prk1p) of the Ark kinase family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06600p"
                     /protein_id="XP_460645.2"
                     /db_xref="GeneID:2904113"
                     /db_xref="GOA:Q6BMC6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC6"
                     /translation="MGNFPKLPEGTQLPVGGHQVTILKYLSEGGFAHIYKVKIDPKEE
                     DTDIACLKRVIVPDKNGLDQLRKEVDVMKNLRYGRNIVKYYDSHAARLENGTYQVLVL
                     MELCPNKSLLDYMNVKIKTKLTEPEILKIMSDISIGIYEMHKMKLVHRDIKIENVLID
                     AKNDFKLCDFGSTSSPIMPPKDQQQFQLLSHDIMYQTTPQYRAPEMIDLYRGFPIDEK
                     ADIWALGCFLYKLCYYTTPFEANGDIAILHATFQFLPAPVFSGDLKNLIIIMLQENPL
                     FRPNIVQVLMLLCTMMKIEFKSLKLEDIYNTGPYNFHALHEYQRHKQNELLKQQQLYY
                     QQNAYANGGKATSEVNLAKHYGNQIRSQNQSPFIRSQGGTPSQAYGQLNASNTADLQH
                     QTQAELPAALSHDLEPQKNKQEAGVTSPNNEVNSETEDDNTSEIGLENLDNVEERYPS
                     LEDLLEDPTKRTKSIDSDRVSQKDNAPPNLPNQNIRQPNMQNYGPQVPTQPVILSNAD
                     LQKLTPDQFQQYHYQHQAYQYQLDQYQKQLYQQNEQQKHQQANALNPNSIDHNITTGK
                     SKEPSEFEKKEAWERHHSKIEKDAELLVDDIFATNSKSPALAPVQVQNTNQSAKGDIE
                     SLSKLKKSVSSEYPSTSSDGHSKQHGEICAEDSIEPSIGAHNAQDAAGVFNDDGKEIS
                     SRSRHSLDGHNLRPEGGHDQRDVFINDASNKVNDVDSFESFSGKYPDILSNMHIDAPF
                     NSSPQTKVSNNSNIPSINSSSTAAKYPFTYQQPSQQNVAYSNPKPDVNANKSDIRKHA
                     NPWGDYTKNANVAPVKRVSSHSGIVNSQPASISNEPAPIIPVHEQMNALSLKERPSSM
                     QQRGNSNEQSSEANLIDLEVGLESSSSSTNTPALNPKTKDLYKLNTESSLSGFDLDDE
                     KKPSESKHQFKKRLSSAQNPSSFSFQEEVIDFASDDENPENSSEMNRLSIRNSLSKKP
                     KSRKSSEHKRSDSANSEGKKRLSLFGSSQGN"
     gene            <586245..>589085
                     /locus_tag="DEHA2F06622g"
                     /db_xref="GeneID:8998898"
     mRNA            <586245..>589085
                     /locus_tag="DEHA2F06622g"
                     /product="DEHA2F06622p"
                     /transcript_id="XM_002770712.1"
                     /db_xref="GeneID:8998898"
     CDS             586245..589085
                     /locus_tag="DEHA2F06622g"
                     /note="similar to uniprot|P42842 Saccharomyces cerevisiae
                     YNL313C Protein required for cell viability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06622p"
                     /protein_id="XP_002770758.1"
                     /db_xref="GeneID:8998898"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:B5RUA7"
                     /translation="MSSEKYLRSVLSQLVLSISAEKVDVPSEISSDLQPVTNCILYIL
                     KGVSSKLIHEQDYYSLLFTDASKKILESFPSNDLYTVLNEYLHEVINNFEQRFQEETI
                     SKLHLQIIAIALLQTFIQLNFTGPGIEFNSQQLFFPGVDEKTVQLESIKLINIEGEQA
                     YELMVDPLFFIISCLLFEKLMQVDSRLSLVNKTLLAPLEEIIEATGNICSASPDDPVK
                     ASLQWWRARALQVHLSLISEPASVLSSVSSLLLNPSVANALAPAIDDNLELKKHIQLV
                     YFLECARSGIHSQTEHLAIPLLGKARQLSELNFVISGAKAKRTKFQTFHTSALIILAK
                     SKKSTLFDNENDNPETFGLESDLLLEKPQFESLDDLELQDEPNSKRIKIDEISTINDE
                     EGDEEKLLPIAMRQDDIPDELKALDPNEQPALNDLDSVQLLLRLTTLRQTTPSNNPLV
                     EEELLALASRILYASSKSVNWSIFSRALWERSILETTKARTIERGILQMTSLVEEIGI
                     KVKTRIIPQAMEEGDEEGSSAAASRLRFIHQLPLMPQWAMDMRLAEKYMSLGVLRSAV
                     EIYERLQLSCETALCYAAADEEKEAERIILERINSHPEDARAVSILGDIRQDPNLWIK
                     AWEIGKYSKAKASLSRYFYNPPQSSGLTKDLEQAIKHMNDCLTANPLSYEHWFFYGCC
                     GLESHQYEVAAEAFTRCVALDDTNSHAWSNLASALLRTDKTRPALNALKKAIRCAGES
                     NKSWRIYENYLIVAAKLNEWNDVLIAARELINIRGNSDGEGSIDIPIIEKLVEILVAT
                     EYPSAEDTRFTHYQKSCIDLVCNILPSVITKSARCWRIVARVELWRQKPWAALECHEK
                     AYRALSQRPELETDESAWNEAIDSCSDLVAAYESLGELPGKHDAGDLVCKDWKYKAKT
                     TVRSLMSKGKAMWEDSEGWYRLQDMKEQLLNN"
     gene            <589431..>590534
                     /locus_tag="DEHA2F06644g"
                     /db_xref="GeneID:2904116"
     mRNA            <589431..>590534
                     /locus_tag="DEHA2F06644g"
                     /product="DEHA2F06644p"
                     /transcript_id="XM_460648.1"
                     /db_xref="GeneID:2904116"
     CDS             589431..590534
                     /locus_tag="DEHA2F06644g"
                     /note="similar to CA5508|IPF745 Candida albicans IPF745
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06644p"
                     /protein_id="XP_460648.1"
                     /db_xref="GeneID:2904116"
                     /db_xref="GOA:Q6BMC3"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC3"
                     /translation="MVDDKYIGLALAMSSSLAIGTSFIITKKGLIDASARNGSSQVQG
                     HEYLQNPIWWAGMITMAIGEVANFAAYTFAPAILVTPLGALSVIIGAVLAAVFLKEEL
                     GTLGKMGCAICLMGSVIIVLHAPPDKEIETVDEILGYATKPGFLFYCFMVTLYSLFMI
                     YKIVPQYGHTNPMIYISICSSVGSISVMSIKAFGIALKLTLSGHNQFTYVSTYLFIGV
                     VVLCILTQMNYFNKALDQFDTSIVNPLYYVTFTTFTLAASFILFRGFNTTSAINIISL
                     LIGFLIIFSGVYLLNISRKNNDGKDNREIFGVHNGKEMAPLDNGVGGFSSMRRSLQVN
                     RQDYNEEETVGLRRFDSFELGSDEDSQDYHQRT"
     gene            complement(<590769..>591227)
                     /locus_tag="DEHA2F06666g"
                     /db_xref="GeneID:2904117"
     mRNA            complement(<590769..>591227)
                     /locus_tag="DEHA2F06666g"
                     /product="DEHA2F06666p"
                     /transcript_id="XM_460649.1"
                     /db_xref="GeneID:2904117"
     CDS             complement(590769..591227)
                     /locus_tag="DEHA2F06666g"
                     /note="highly similar to uniprot|P38912 Saccharomyces
                     cerevisiae YMR260C TIF11 Translation initiation factor
                     eIF1A"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06666p"
                     /protein_id="XP_460649.1"
                     /db_xref="GeneID:2904117"
                     /db_xref="GOA:Q6BMC2"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018104"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC2"
                     /translation="MGKTGKGKGGKNRRRGKNDNGGQKRELIYKDEGQEYAQITKMLG
                     NGRIEVSCFDGEKRMGHIRGKLRKKVWMSQGDIILVSLRDFQDDQCDVIHKYNSDEAR
                     TLKNVGELPENAKINETDTFGADEDEDVNFEFGAEDSDEEEGEDLDIDDI"
     gene            <591421..>592356
                     /locus_tag="DEHA2F06688g"
                     /db_xref="GeneID:8998899"
     mRNA            <591421..>592356
                     /locus_tag="DEHA2F06688g"
                     /product="DEHA2F06688p"
                     /transcript_id="XM_002770713.1"
                     /db_xref="GeneID:8998899"
     CDS             591421..592356
                     /locus_tag="DEHA2F06688g"
                     /note="weakly similar to uniprot|P46963 Saccharomyces
                     cerevisiae YML112W CTK3 Gamma subunit of C-terminal domain
                     kinase I (CTDK-I) which phosphorylates the C-terminal
                     repeated domain of the RNA polymerase II large subunit
                     (Rpo21p) to affect both transcription and pre-mRNA 3' end
                     processing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06688p"
                     /protein_id="XP_002770759.1"
                     /db_xref="GeneID:8998899"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="InterPro:IPR024638"
                     /db_xref="UniProtKB/TrEMBL:B5RUA8"
                     /translation="MDSFEASTQFTQILKGLTPSIQNLTRAAHFALKNSESEDYLFHT
                     IIDTLDDPNIELNTKSTIFQFIEVLMHESLVISSQPKSHYTYPYVHNLKNSLPKILLK
                     VLPGSNNSSLYNAYNSLKNISETCKVNYDEYNKKYSGISELFTDEDLENIDTNLPFPD
                     IKVEDEIEASDPLITTWDLLIKKKKQSQYERLRLLKHSRMIEESVEEEDMFSYKGGKS
                     QKDQNNGKANELLLSKKHILLRMEDDRETHKRSKENIWVVNRPKDASILTEDEFLVHY
                     WNKYRVMAEEEEKTFMDSLDELNGLVVESYKDKQF"
     gene            complement(<592448..>595874)
                     /locus_tag="DEHA2F06710g"
                     /db_xref="GeneID:2904119"
     mRNA            complement(join(<592448..595775,595852..>595874))
                     /locus_tag="DEHA2F06710g"
                     /product="DEHA2F06710p"
                     /transcript_id="XM_460651.1"
                     /db_xref="GeneID:2904119"
     CDS             complement(join(592448..595775,595852..595874))
                     /locus_tag="DEHA2F06710g"
                     /note="similar to uniprot|P38426 Saccharomyces cerevisiae
                     YMR261C TPS3 115 kD regulatory subunit of
                     trehalose-6-phosphate synthase/phosphatase complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06710p"
                     /protein_id="XP_460651.2"
                     /db_xref="GeneID:2904119"
                     /db_xref="GOA:Q6BMC0"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="UniProtKB/TrEMBL:Q6BMC0"
                     /translation="MTIIIGTLFLPYTVKFDVGGRVDYDIDITQKDATVPNIQNDARN
                     QQRKSVSAGMGTGISQSSILPSLSTSQQHTPRSGSPTFNDNASIMTGSDTDQVNSAQE
                     FFHSHKRTPHDSQNILTDNLYDKLGSKLIQPRSRYSNVAFQSSVVDPKKKSEDAGLPG
                     LKINRSSNNLTSLNNSSFSSYSNMIGLNPTTNSSTMSVPSTRQRTPISRQGFTLHSNS
                     SSNSIPTRIKEVEEEEARESDYASDKSVDEDHIENFNDLVHGRTESKLTPFGGFSKPD
                     LEDGILNQENIFEDAPWKVVLAGKGNVSLTKAVQIAVDAGGINDHKWVGTLAMPSDAV
                     PNSVINGISDSLSENYDCEAVFPNDITFQGHYKSFCKQILWPTLHYQIPDDPKSKAFE
                     DHSWGHYKLLNQLVADKIVDLYKKENGSSDPNDPNNMIWIHDYHLLLVPKMIREKLPE
                     AKIGLFLHVSFPSSEVFRCFAQRKAILSGMLGANCITFQTDEYVRHFWQTCNRLLLAD
                     ANEFGITYEGKFTMINTIPVGVDAKSLEGYLGSNEVNEWRNMIRERWSNKKLIVSRDK
                     LEKLRGIKQKLLAYEKFLHSNPEYVDTTVLIQICPGTTQDSSYESEIMSIVGRINALT
                     GDISFSQPVVLLQQDIGFEQYVALQCEAEVFVVASMREGLNLTCHEYIIATTEKKSPL
                     MLSEFTGSSPLLNCNGEGAILINPWDLKRFAELFKVSLDMGQDEKVKRWTNCYKTICN
                     HDSRNWVENCLQGINEGWDYDHSRNLNKLIPFTRDIFDSFYSRNDGGKRLFFLNLDTP
                     SAIASTNDPSSKFHKLTSKSAVAAAGKNGAFSESSRFASLLNELLSDPLNHVYLTSYL
                     KRSDLDTLYNRSPNLGLVAENGGYIKLTESDKWISIIDEVELEGWMPQVSQLIASKVE
                     RLPGSHMEVEDCTIRFHPGKSFENDRERSLSILGDCIQHVNELFSDQDGVHATLIRNV
                     LIVQKNKLSMKALKFIISYYNQKKQGIKSESLIEEYQVKQVPGSAPSTPISETASLPP
                     IKSPTSKIQKNLVTALFLSGGSTLIDEPGYEYANGLERSGEIPEVITVTVLGADSRTS
                     ATYCVSGKNELLGILSNPVSEPYKSHTA"
     gene            <596059..>597099
                     /locus_tag="DEHA2F06732g"
                     /db_xref="GeneID:2904120"
     mRNA            <596059..>597099
                     /locus_tag="DEHA2F06732g"
                     /product="DEHA2F06732p"
                     /transcript_id="XM_460652.1"
                     /db_xref="GeneID:2904120"
     CDS             596059..597099
                     /locus_tag="DEHA2F06732g"
                     /note="weakly similar to uniprot|P38430 Saccharomyces
                     cerevisiae YMR262W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06732p"
                     /protein_id="XP_460652.2"
                     /db_xref="GeneID:2904120"
                     /db_xref="GOA:Q6BMB9"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB9"
                     /translation="MNGYVQFLADSHCHLDVECSSQRAEELGNFLNTSESIIDRREFF
                     HIMSSNHVDIFHIDLILDKLENKTVLPYFGIHPWYSHLFTDLKLEEFENEQEWKQIHY
                     ESVLDPTPPSELLEVLPNPISFDSHVNEIRRLANKHQKKGFSVGIGEIGLDKLFRIPS
                     NGYFGNQKLPLNDNPNKLSACRVKMDHQAYIFARQLKLASSLKRPISLHCVKAHGLLY
                     DQVTSKKELDGISSVILHSYSGSLDQAGLWIRHFSKSNRLLYFSLSNWINGSAKKQDS
                     LKDLVKLLGNDQILLETDVGIDKYLLDPERREEYFNQLKEIFIKICSIKGWGEDLAKE
                     IIFDNWNKSIAQ"
     gene            complement(<597317..>598063)
                     /locus_tag="DEHA2F06754g"
                     /db_xref="GeneID:2904121"
     mRNA            complement(<597317..>598063)
                     /locus_tag="DEHA2F06754g"
                     /product="DEHA2F06754p"
                     /transcript_id="XM_460653.1"
                     /db_xref="GeneID:2904121"
     CDS             complement(597317..598063)
                     /locus_tag="DEHA2F06754g"
                     /note="similar to uniprot|P00942 Saccharomyces cerevisiae
                     YDR050C TPI1 induced under stress conditions"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06754p"
                     /protein_id="XP_460653.1"
                     /db_xref="GeneID:2904121"
                     /db_xref="GOA:Q6BMB8"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /translation="MARQFFVGGNFKMNGTRESVSKIVDGLNKAELPSNVEVVIAPPA
                     PYIALAVNENKQKTIEVSAQNCFDKASGAYTGEISPEQIKDLGATWTLTGHSERRTII
                     KESDDFIASKTKFALDQGLSVILCIGETLEERKANVTLDVCARQLDAVARVVSDWSKI
                     VVAYEPVWAIGTGLAATPEDAQETHKAIREHLSKSIGADAAEKTRILYGGSVNGKNAP
                     EFKDKADVDGFLVGGASLKPEFVDIIKSRL"
     gene            complement(<598422..>599509)
                     /locus_tag="DEHA2F06776g"
                     /db_xref="GeneID:2904122"
     mRNA            complement(join(<598422..599435,599495..>599509))
                     /locus_tag="DEHA2F06776g"
                     /product="DEHA2F06776p"
                     /transcript_id="XM_460654.2"
                     /db_xref="GeneID:2904122"
     CDS             complement(join(598422..599435,599495..599509))
                     /locus_tag="DEHA2F06776g"
                     /note="similar to uniprot|Q99288 Saccharomyces cerevisiae
                     YDR051C"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06776p"
                     /protein_id="XP_460654.2"
                     /db_xref="GeneID:2904122"
                     /db_xref="GOA:Q6BMB7"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB7"
                     /translation="MGKPKYILLVRHGESEGNCDKSVNRYTPNHKVALTDEGHSQAKS
                     AGLVLKEFLQHVSSEDEDRNKTRNPKSILFYTSPYLRARQTCNNIIDGIKYVPGVMYK
                     VHEEPRMREQDFGNFQSTSEQMEKIWQERAHYGHFFYRIPHGESAADVYDRIASFNET
                     LFRQFQQDNFPNILILVTHGIWARVFLMKWFRWSYEEFESLRNIPHCQYLIMKKQSEG
                     GKFRLKTPLKTWDDLPDSDIDEEVVKREFGDEVCFNTKNKLANPEDFDITSIIQAQRD
                     AIKSNRYKDRQIKDAFQKSMNTDQHEKDTYPSSPSTLASRFTLDDQSVANSVSNSKHN
                     SLENLQED"
     gene            complement(<599762..>600833)
                     /locus_tag="DEHA2F06798g"
                     /db_xref="GeneID:2904127"
     mRNA            complement(join(<599762..600746,600811..>600833))
                     /locus_tag="DEHA2F06798g"
                     /product="DEHA2F06798p"
                     /transcript_id="XM_460655.1"
                     /db_xref="GeneID:2904127"
     CDS             complement(join(599762..600746,600811..600833))
                     /locus_tag="DEHA2F06798g"
                     /note="highly similar to Candida albicans Q5ADU3 Potential
                     translation initiation factor eIF3-gamma-p40 subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06798p"
                     /protein_id="XP_460655.1"
                     /db_xref="GeneID:2904127"
                     /db_xref="GOA:Q6BMB6"
                     /db_xref="InterPro:IPR027524"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB6"
                     /translation="MNMATKQVKSYQAPTTTSIDVESSVVLSLIRHTSEHYPSLYSGA
                     LLGFESDSGALDITHAFAYPYPDQYEGGSLRSRSGAKYQQDILDSLKKLGYGIGFQGW
                     FQSTVSGNFVTTQLVDALVQQQLTNKNSFILIHNMASIGKELDLKAIRLSESFVRTYL
                     DGKWKSKDLENHKLSFLNIFDEIPIRIRNQHLVNLYLASSTNDTKSENEFDILNLSSN
                     QNVTAQLLESLYGQVDAYNYDQTNYNYYQRQHQKEQSKIMQWKQQRKLDNLERAKIGE
                     KELDTEEWQSLFKLPTEPSRYNNMLHSHAIDVLADDILKRCDEDLTKSFAIERKLTTD
                     K"
     gene            <601065..>602846
                     /locus_tag="DEHA2F06820g"
                     /db_xref="GeneID:2904128"
     mRNA            <601065..>602846
                     /locus_tag="DEHA2F06820g"
                     /product="DEHA2F06820p"
                     /transcript_id="XM_460656.1"
                     /db_xref="GeneID:2904128"
     CDS             601065..602846
                     /locus_tag="DEHA2F06820g"
                     /note="similar to uniprot|P15180 Saccharomyces cerevisiae
                     YDR037W KRS1 Lysyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06820p"
                     /protein_id="XP_460656.1"
                     /db_xref="GeneID:2904128"
                     /db_xref="GOA:Q6BMB5"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB5"
                     /translation="MSEEVAKVAEQLQKTYLDDVTGEQVSKTELKKRQKQRANDAKKA
                     EKAAKSAASAPKVAKKKDQLVDLNPNQYFEIRSRQIDELRQANLADGSAFNPYPHKFH
                     VSIQLPAFAEKYKDLKKGESLKDVEVKVSGRIMGKRESGSKLKFYVLKGDGVQIQIMA
                     QAQDVENAEEYEKMHEYLRRGDIIGVTGYPGRTSPAKGGEGEVSVFATSVQLLTPCLH
                     MLPTEHYGFKDQEARYRKRYLDLIMNESTRDRFKVRSQIISFIRKFLDTRDFTEVETP
                     MMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGI
                     DMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKKITGDYKVTYHPEGPEGKALTL
                     DFTRPWKRVNMIEELEKVFNVTFPAGDQLHTEETGKFLKQILIDHKLDCSPPLTNARM
                     LDKLVGELEDASINPTFIFGHPQMMSPLAKKDRDNVGLCERFEVFVATKEICNAYTEL
                     NDPFDQRQRFEEQARQKAQGDDEAQMVDETFCNALEYGLPPTAGWGCGIDRLAMFLTD
                     SNTIREVLLFPTLKPDALVKGEETSDN"
     gene            complement(<603005..>603910)
                     /locus_tag="DEHA2F06842g"
                     /db_xref="GeneID:2904129"
     mRNA            complement(<603005..>603910)
                     /locus_tag="DEHA2F06842g"
                     /product="DEHA2F06842p"
                     /transcript_id="XM_460657.1"
                     /db_xref="GeneID:2904129"
     CDS             complement(603005..603910)
                     /locus_tag="DEHA2F06842g"
                     /note="highly similar to uniprot|P38238 Saccharomyces
                     cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
                     methylates the 2'-O-ribose of nucleotides at positions 32
                     and 34 of the tRNA anticodon loop"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06842p"
                     /protein_id="XP_460657.1"
                     /db_xref="GeneID:2904129"
                     /db_xref="GOA:Q6BMB4"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB4"
                     /translation="MGKSSKDKRDLYYRRAKEEGWRARSAFKLLQLNEQFQLFKGVKR
                     VVDLCAAPGSWSQVLSRELFENQKQADAKIVSVDLQPMTPIEGVTTLQADITHPKTLQ
                     KILEIFGGEPADFVCSDGAPDVTGLHDLDEYIQAQLILSALQLTTCILKPGGAFVAKI
                     FRGRDIDLLYSQLSYLFERVICAKPRSSRGTSLEAFIVCLGYKPREGWNPILDLTKST
                     EEFFEGANIGRSDNLEHLDLPEDEERLIAKFVACGDLNDVDSDATYTLDTNFKKLALD
                     PVQMPTAPPYKKALEMKRRGDLVRR"
     gene            <604086..>604889
                     /locus_tag="DEHA2F06864g"
                     /db_xref="GeneID:2904130"
     mRNA            <604086..>604889
                     /locus_tag="DEHA2F06864g"
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /transcript_id="XM_460658.1"
                     /db_xref="GeneID:2904130"
     CDS             604086..604889
                     /locus_tag="DEHA2F06864g"
                     /note="weakly similar to uniprot|Q03201 Saccharomyces
                     cerevisiae YDR041W RSM10 Mitochondrial ribosomal protein
                     of the small subunit has similarity to E. coli S10
                     ribosomal protein"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /protein_id="XP_460658.1"
                     /db_xref="GeneID:2904130"
                     /db_xref="GOA:Q6BMB3"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /translation="MLSRILGVRNHSFRAFSTIGVCYNKSNTSPKKYLSPNEFASQKQ
                     VDEIEEQAYKQNLLNEEYKYDPKYLSENELNPISKRPIPLNVELLKYKPVQLPPTHGH
                     EVAKIEFKGYDKDDLIRASEFAARAAFYLGIPCSKVQSLKTEKRLYTVIKSPFAQAKS
                     KENFKRTTYGRKVYAYDATPEVVDLWLSFINKHAIEGVKYNALIHTRESLDFCEKLDA
                     LSADDMHMPDAYKGSDDPIANKVEELLKSDTFKKYFDEANIAESPKESK"
     gene            complement(<604955..>605636)
                     /locus_tag="DEHA2F06886g"
                     /db_xref="GeneID:2904131"
     mRNA            complement(join(<604955..605565,605621..>605636))
                     /locus_tag="DEHA2F06886g"
                     /product="DEHA2F06886p"
                     /transcript_id="XM_460659.2"
                     /db_xref="GeneID:2904131"
     CDS             complement(join(604955..605565,605621..605636))
                     /locus_tag="DEHA2F06886g"
                     /note="weakly similar to uniprot|P38239 Saccharomyces
                     cerevisiae YBR062C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06886p"
                     /protein_id="XP_460659.2"
                     /db_xref="GeneID:2904131"
                     /db_xref="GOA:Q6BMB2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB2"
                     /translation="MSTYEDDHNINTSTTPSNNDNRHGRQHQTLSTIIDSFLTQDTQQ
                     GSSENSHEAFTNALRVMNTEEGSTLALELMNSLENSELNLNDNKEKGVSQDFLDSLER
                     VSINDLPNKDTADCPICTNKFIDDKYPLLVKLPCSVQQINGKKAKGHIFDLECIGPWL
                     KMNSTCPLCRFDVLEVNKKRKEKLEEELRKAKEEDDEEEEEEYWDDYG"
     gene            complement(<605808..>607004)
                     /locus_tag="DEHA2F06908g"
                     /db_xref="GeneID:2904132"
     mRNA            complement(<605808..>607004)
                     /locus_tag="DEHA2F06908g"
                     /product="DEHA2F06908p"
                     /transcript_id="XM_460660.1"
                     /db_xref="GeneID:2904132"
     CDS             complement(605808..607004)
                     /locus_tag="DEHA2F06908g"
                     /note="weakly similar to CA5943|IPF3490 Candida albicans
                     IPF3490 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06908p"
                     /protein_id="XP_460660.2"
                     /db_xref="GeneID:2904132"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB1"
                     /translation="MSFNTEQLDTKLDGLTLGDSYKQEKFSENNRSNSENIPNVAQGT
                     DLTIPGKISYIDKPKTSLLSSSLAKDFPHAHANALSPTVGERDVNLYMNMDDRMDTET
                     NLTDDHPEPIILASSVGKEIDGRLIPSSSTISLLSLNGQNSGQGGCYDTTEVDGNGGS
                     SGYGTMTSPKNSNNHFAGNYNYSHITSNTTPQTAFMDRKSGHNNITSRNSLTHLNQIR
                     LQPYQRFSSPSSQQPFIQQETTSSTTCQSIPIENKSSIIVPDSPSLDPTSVGGSPSGL
                     WLSSQTPSKPSTGSFKNNSRSELFHMMQSQQQKQNYDSMQPAEPIHSIQPTSQSTNQL
                     IYNANASNNYTTTSTISYLKIDGSTSPILHPVQTPSEDPPMTPLYLNSNSLSQNDVGY
                     FGNLAE"
     gene            complement(<607307..>609001)
                     /locus_tag="DEHA2F06930g"
                     /db_xref="GeneID:2904133"
     mRNA            complement(<607307..>609001)
                     /locus_tag="DEHA2F06930g"
                     /product="DEHA2F06930p"
                     /transcript_id="XM_460661.1"
                     /db_xref="GeneID:2904133"
     CDS             complement(607307..609001)
                     /locus_tag="DEHA2F06930g"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
                     pyruvate transcription is heme-dependent repressed by
                     glucose and derepressed in ethanol or lactate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06930p"
                     /protein_id="XP_460661.1"
                     /db_xref="GeneID:2904133"
                     /db_xref="GOA:Q6BMB0"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:Q6BMB0"
                     /translation="MFTTRLALSHRSVLRKSIPTISRRFNSNRASNKRSNLVNGIFGS
                     IIIGSIGIAYKYGQDSIRHSPPSDVFPLESTTKLENISPPKYCSENELLQAVKELKEL
                     LGDENVFNSKVELEHHTKNEFTHHLPREHEKPRYVIYPLSTEDVSESMKILFKYNVPV
                     VPFSAGTSLEGHFFSTRQGISMNTSRMDKILRVHHDDLDAVVQAGVNWQKLNEELAPH
                     NLMFGTDCGPNGLISGMINTNASGINASRYGAMISNVISITVVLADGTIVKTKQRPRK
                     SSAGYNLTGLFIGSEGTLGIVTEATVKLHVKPHFETVVVGQFPSILDSTNTVAQIYRA
                     GIQPNAIELLDKEMMHCINYSGYFTRHWLECPTIFFKIGGINETVVTEYVNKLKQISM
                     QNNCEEFIFAQNEEEQEELFSARKNAFYAILNYGRNEIDEDVRLWVTDIAVPLSKLSP
                     VLTKVDELIKKSGLRSVILGHVGDANFHADVFYKPDEKKKCETLIHEMMLLGLENEGT
                     SSGEHGIGNGKRKYLELELGIDAVDLMRRLKFSLDPKRLLNPDKIFKIDPTDDREY"
     gene            609712..609784
                     /locus_tag="DEHA2F06952r"
                     /db_xref="GeneID:8998900"
     tRNA            609712..609784
                     /locus_tag="DEHA2F06952r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (TCT) cove score=75.37"
                     /db_xref="GeneID:8998900"
     gene            609792..609882
                     /locus_tag="DEHA2F06974r"
                     /db_xref="GeneID:8998901"
     tRNA            join(609792..609829,609846..609882)
                     /locus_tag="DEHA2F06974r"
                     /product="tRNA-Phe"
                     /note="tRNA Phe (GAA) cove"
                     /db_xref="GeneID:8998901"
     gene            complement(<609999..>610955)
                     /locus_tag="DEHA2F06996g"
                     /db_xref="GeneID:2904136"
     mRNA            complement(<609999..>610955)
                     /locus_tag="DEHA2F06996g"
                     /product="DEHA2F06996p"
                     /transcript_id="XM_460662.1"
                     /db_xref="GeneID:2904136"
     CDS             complement(609999..610955)
                     /locus_tag="DEHA2F06996g"
                     /note="weakly similar to CA4360|IPF6050 Candida albicans
                     IPF6050 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F06996p"
                     /protein_id="XP_460662.2"
                     /db_xref="GeneID:2904136"
                     /db_xref="UniProtKB/TrEMBL:Q6BMA9"
                     /translation="MLRSQSISNLNEQRKSKMGFLSSLRSRKSSSNDLHSKLISEPSN
                     MQKNKPRPLSSSVSSINLNQKFHEPTDHSSYSSNVSRQRQGSISTEDKENVSSIPRLK
                     SRRNLQNTTESRTLKTRSSAPNLNKSKRTSMFTNSVTATPVINIFPDSNDNIIDESSV
                     ETPELISPETITDMNDSLYASPIHLELIDDEFSDEDLQSRKLHRTTNLTNINDFIRLI
                     DDGEKYQSGNYLPINNRKSLDFEKFERNKIRKSLQTNLDKECSTNFISSLNLVENAVF
                     LSIEKYQNSQNDFVNFLEDDDYINAIKNDPYDNESDEYYLNF"
     gene            complement(<611132..>612913)
                     /locus_tag="DEHA2F07018g"
                     /db_xref="GeneID:2904137"
     mRNA            complement(<611132..>612913)
                     /locus_tag="DEHA2F07018g"
                     /product="DEHA2F07018p"
                     /transcript_id="XM_460663.1"
                     /db_xref="GeneID:2904137"
     CDS             complement(611132..612913)
                     /locus_tag="DEHA2F07018g"
                     /note="weakly similar to uniprot|Q08622 Saccharomyces
                     cerevisiae YOR205C FMP38 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07018p"
                     /protein_id="XP_460663.2"
                     /db_xref="GeneID:2904137"
                     /db_xref="GOA:Q6BMA8"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLGRIRPFVRYSVFRAGTYRTLFTSPYRMQISLIYNLFATCNSC
                     GIKLQNENPSKPGFYRPPSARPKLVKPEDESFNRLMDGLSVEDRKLLLNSSDATLPQP
                     VTASTAAATTTNTKKEGDIQCIRCREAMYKSNFSWDELPVESIDKIMSTIPPDGNVVY
                     IVNAVDFPLSLNRSIFKYRNPSQITFLVTKCDLLFPSAQLSNRYGATFFKDYLSRTHG
                     ADPEKVFVTSGMIDWNMKDIIKALPDNSYMVGGVNSGKSTVIKSLLYTMEKSKPNYLS
                     SKQQTKLEKQQDRMINSNAVNRHQHTKSQRKVEQKFKMTYGPGTSYMPGFTRGHIVHD
                     IDGKTIVDVPGFSANESHGIYGYLDPSTIKTLSKGVKVHKRGMYDSLYESVRNGQVLT
                     IGGLFYLATPQNAVYQIKNCINHKFHVFNSMDKAISILQTIEKNKALENVFLVNKQSL
                     DKLQKFIIPPFYGSIDLVIKNLGHLNITPTGKKIDNEPLVIYLPEGVEAIIRQPLTRY
                     ITRSLAGRDKNGNPLRKELWKSKSVTHLQRFNGTTPFASLLIPSTGSDNLQCISEYNS
                     KLNDTPITYDNNTHLDESNKYKYWVNI"
     gene            <615258..>617225
                     /locus_tag="DEHA2F07040g"
                     /db_xref="GeneID:8998902"
     mRNA            <615258..>617225
                     /locus_tag="DEHA2F07040g"
                     /product="DEHA2F07040p"
                     /transcript_id="XM_002770714.1"
                     /db_xref="GeneID:8998902"
     CDS             615258..617225
                     /locus_tag="DEHA2F07040g"
                     /note="weakly similar to uniprot|P14922 Saccharomyces
                     cerevisiae YBR112C CYC8 General transcriptional
                     co-repressor acts together with Tup1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07040p"
                     /protein_id="XP_002770760.1"
                     /db_xref="GeneID:8998902"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B5RUA9"
                     /translation="MSNMKRTCGFGDVEDGRYRDSAIETWVAVGDCSLALGMMKAAKH
                     SFEYAMKHDPSNSRALVGLAYSLRMKDGKVKDGQQTKNGSGSQEAADRLTMALEKYPH
                     VTHTGEVMQELGECYFSMGMVEQAHSAVQRGLQADESHTGLWLLNGKVLHRAGRNAQA
                     VDGLRRCLSLLPRSLETCTRDEINVARLAHAELAAIATTEGNSEGAVAELVAALSLPP
                     PSLDKVDEHIALWCGLATARERANDLVGALQTCDEAERVVGNSPRILLTHAYLLLSTD
                     DRYAHTAIDLLEMLVKSEGEHAQANDDGDFLPWYLTGKAYSKLDSPRAAYDSYQVAFR
                     RAPKSPIPWLAIGKLYLQLNQLPDTLAAYSQALRLQVDEKSPATATAWDGLSCVYERS
                     NGQLMDAADACNRAATCFKLMGDADSAQFFENRTRQLQMAASREGPVPPLRDAPDVPN
                     SLLRELVVLLPSERIAFVQGTETSYTHQPPQQNVNSPPAQRQRSQTPTNGSVQTPQPR
                     PSQPVVPQHYQVQQPYKQLHDNSPRQNLAPPHQMWSPNQQQHQQRQYTPNIPPPAMAN
                     PNQYPHYFYQQPPSNGLPPGAMPAHNQQVLQRSPLNNPQMIRNDLQQPMGPNMVPGPP
                     PPPPPPGYAYGQYMPMQGAMNFPSPANNWSK"
     gene            complement(<617457..>618299)
                     /locus_tag="DEHA2F07062g"
                     /db_xref="GeneID:2904140"
     mRNA            complement(<617457..>618299)
                     /locus_tag="DEHA2F07062g"
                     /product="DEHA2F07062p"
                     /transcript_id="XM_460664.1"
                     /db_xref="GeneID:2904140"
     CDS             complement(617457..618299)
                     /locus_tag="DEHA2F07062g"
                     /note="weakly similar to uniprot|P25616 Saccharomyces
                     cerevisiae YCR015C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07062p"
                     /protein_id="XP_460664.1"
                     /db_xref="GeneID:2904140"
                     /db_xref="GOA:Q6BMA7"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6BMA7"
                     /translation="MNKLTNSLKALKPKSTPKLFVIDWDETITNEDTIKLVAQAAYNK
                     KLEYEPKFDHFTDIYLKAFNEYNQDFTSKYGERDTIEKEIKFQTGMQNVEMKSINEIK
                     RLRLFEGIAEDEFQAQANHVTLKPHFTDFLGKCQELKIPVIILSVNWTKLIMEAVLQK
                     IGFKENENLKIMVNELEFVNGISTGNFNESISIRTGLDKLNIVNSLIKQYGKTCYIGD
                     SMTDLLSLIDSDIGIAIEEGSVIESVKKLNFPIKNLSEAEELHKEEVYVGNWSQVINL
                     LNKH"
     gene            <618493..>618912
                     /locus_tag="DEHA2F07084g"
                     /db_xref="GeneID:2903245"
     mRNA            <618493..>618912
                     /locus_tag="DEHA2F07084g"
                     /product="DEHA2F07084p"
                     /transcript_id="XM_460665.1"
                     /db_xref="GeneID:2903245"
     CDS             618493..618912
                     /locus_tag="DEHA2F07084g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07084p"
                     /protein_id="XP_460665.1"
                     /db_xref="GeneID:2903245"
                     /db_xref="UniProtKB/TrEMBL:Q6BMA6"
                     /translation="MSKQGNQELPPLGELGNIAREASDQNIDPKTPLKDAENKVREES
                     EGSAKFENQKAPGKFEGEHNKGKFEEGKNPDTSGKFEGKFESKDKGDLGKFESKDKDS
                     LGKFESADKKDLGKFEGKFESNEKDRLGKFEGSFEQK"
     gene            <619159..>619590
                     /locus_tag="DEHA2F07106g"
                     /db_xref="GeneID:8998903"
     mRNA            <619159..>619590
                     /locus_tag="DEHA2F07106g"
                     /product="DEHA2F07106p"
                     /transcript_id="XM_002770715.1"
                     /db_xref="GeneID:8998903"
     CDS             619159..619590
                     /locus_tag="DEHA2F07106g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07106p"
                     /protein_id="XP_002770761.1"
                     /db_xref="GeneID:8998903"
                     /db_xref="UniProtKB/TrEMBL:B5RUB0"
                     /translation="MSTNKSNKEASEQNSIPQSTAETNSQSDVESTSADNGAPSTEQQ
                     QSIMNLFRNALNPNGENPQVDEYLTSTFGYLQNVFNKMQTAEDKDATAEEIAQDLTDR
                     FDKWISERENKKKDSDKKEESDKQEESEKEGTEPLKIEEVD"
     gene            <619791..>620882
                     /locus_tag="DEHA2F07128g"
                     /db_xref="GeneID:2903249"
     mRNA            <619791..>620882
                     /locus_tag="DEHA2F07128g"
                     /product="DEHA2F07128p"
                     /transcript_id="XM_460669.1"
                     /db_xref="GeneID:2903249"
     CDS             619791..620882
                     /locus_tag="DEHA2F07128g"
                     /note="similar to uniprot|O74916 Schizosaccharomyces pombe
                     SPCC757 SPCC757.05c protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07128p"
                     /protein_id="XP_460669.2"
                     /db_xref="GeneID:2903249"
                     /db_xref="GOA:Q6BMA2"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q6BMA2"
                     /translation="MVADTERSSHEDLEDFKVGELSLLSLHKSLVDTPSVSKSELKIS
                     QLLKDSLEKAGLTVELQMVGSGPQRYNVYAYIGKTRDTKVLVTSHIDTVPPFLPYHVD
                     GTKIYGRGSCDAKGSVATQIMSYLSLFKSGDLKEGDAALLFVVDEESSGLGMRNVSKS
                     LNASWESGIFGEPTGLKLGVGHKGIYTFDIEVDGKASHSGYPELGISATEILIPVLDK
                     LLKMKLPESKLLGPSTLNIGMINAGVAPNVLPENATSSLSIRVADNLPKVREIVSETI
                     GNVEHLTLKPEVQVDAQYLDYKVPGFDSVILAYSTDIPRLTVKLKHRFLYGPGSIHVA
                     HAANEYIENSDLISAIDGYQKLIKHALQN"
     gene            <621308..>622399
                     /locus_tag="DEHA2F07150g"
                     /db_xref="GeneID:2903250"
     mRNA            <621308..>622399
                     /locus_tag="DEHA2F07150g"
                     /product="DEHA2F07150p"
                     /transcript_id="XM_460670.1"
                     /db_xref="GeneID:2903250"
     CDS             621308..622399
                     /locus_tag="DEHA2F07150g"
                     /note="weakly similar to uniprot|P25617 Saccharomyces
                     cerevisiae YCR016W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07150p"
                     /protein_id="XP_460670.2"
                     /db_xref="GeneID:2903250"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:Q6BMA1"
                     /translation="MSQNIPAWKKIGLKIKDDVQDDPIALTTHIEDVKVTNKQAKKLN
                     KQKRKLEESNNDDKREPKRVKLPKSERAPPPEKDQLAYLRQYENDKLNWKFSKQKQNW
                     ILKNIKNIPKDYEAALQSYLEGLQGGSRKRVVDDLMEVIKKWNKAAEEAEARVEREIQ
                     RQLSGETTKDDDEDEEKNEDKKAKRQTSESEETVPDYDYAKRCGVLVKILNDEDIELK
                     GIAITDDDIKIGGIGEDSEQSTEVTEEIKQTDGEEEEGNKESDNVQDNLTIDEVEVSG
                     LSKSDGHIDRIERNKEKSNDISREKESHETTSEEPASEQELQAKEEKKDKSKKKNKDK
                     VKDSSEGKITKSKKDKKEKKKDKKKKNKD"
     gene            <622549..>626403
                     /locus_tag="DEHA2F07172g"
                     /db_xref="GeneID:8998904"
     mRNA            <622549..>626403
                     /locus_tag="DEHA2F07172g"
                     /product="DEHA2F07172p"
                     /transcript_id="XM_002770716.1"
                     /db_xref="GeneID:8998904"
     CDS             622549..626403
                     /locus_tag="DEHA2F07172g"
                     /note="similar to CA4354|IPF3647 Candida albicans IPF3647
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07172p"
                     /protein_id="XP_002770762.1"
                     /db_xref="GeneID:8998904"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013932"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:B5RUB1"
                     /translation="MKSVDNHVYLILFQVLEKIIIRTMPEINFNSLKDKALDVDPDLR
                     FMALEDFKKYLNEPTTAASTKSIESFIPLLFRLLKDTNPNVQSQAVKSFAPVIRFISS
                     ESILKLLNQLHDEILKENTAGHKDYKKITTSIPNMTLRSIFNTNSKFSNRLSRSIVDS
                     FIPKLINNVITIDSIELLIDLIKNLGFVLTNEEITNLLHTTMNIAFEEENIIGKRSVI
                     AFDLLLNYLDNTESSCNILNDLVKQISSKFDSLPKSSHSINLRLSLFSVILKSVQTYD
                     GYDGSIFYGVTIKHIFQIAITYMKVEDLETELDVEDYDFDLMIQENLIREIALNTIND
                     LINALPLELFEAYLNDTVKLIQTFISYDPLNFDNDNDIDLDEESEIEFSDDEDDINNN
                     DDYENDCSWKLRNKSAILTRTLTSRYPTILPLVYSELIPCMTDAMNDRNEIVSNDSIK
                     TLITIINSTSADNEVITNSRKVGRSGSDVSMTLENSPISQLFRDVTPILENKIFNNLL
                     VSKKINRFPIFLKLIESLITTNHHLSTEFLDEIFNAIKGLNLKTSGNMEYLSLYKTIF
                     LNNDINEVSKNFVNYILSDLSMSIDNKTSYHNIIMESLNISIIIFQNFKRIDRLNFFE
                     SQIQKLFHSIIKICHDKQYSSELRQKSISALSELNVNIEINEDSFRKTTDILKESLNY
                     EVTVKVTIESLIKIFNKKCKNFWRYLKEIDFVNFLIAKSIAFISSTDDSLYYISLKLL
                     DIITKIQHIDNLEDDQANKLLSLLVNFSESTNDYTQLYLLFNIIGRILTNCQTDDKFL
                     QGMIKIMNEKLTDVDDFDLTSFEFLIQQLSRKLCNENLSEIFMTSLNLKLFISAKTLS
                     IITLENNLQDKIDEAEVELNHYINKDISISNDKILFDIQFLGSIGSQKELRSITLASF
                     LQLLKNSNESIRLASSRSIGLLIVKDINKDLPLLLDNYEDNQDERDLNLISMKQLLKN
                     DNLNNSILLKIWDRIWKTISRYDEKVISSTSELRLSGDVLSRMCLVNNEYISNLIDKV
                     DSASNESIIYTIIVILKQLMYKLESNNDILSTLLLHNLKFLTLSNIEIKQALIGTLLT
                     GLHNKSELLLPILPNRVLPLLYDELSAKDEFKKIIPMGPYKYVIDEGLEIRKLCYELL
                     YTIILFDDSLLKANNINIYEIGLNIVNKGLTDSETDIVILSSINLVNLVNKDFNFLIY
                     NNELLPKLIDVLKLNLNKKLKSKASTQETETFEESLRSVVKLSKVINNSLLINNYNNN
                     DWNLFYTEMKTNYILTFNSVDI"
     gene            <626856..>627092
                     /locus_tag="DEHA2F07194g"
                     /db_xref="GeneID:2903252"
     mRNA            <626856..>627092
                     /locus_tag="DEHA2F07194g"
                     /product="DEHA2F07194p"
                     /transcript_id="XM_460672.1"
                     /db_xref="GeneID:2903252"
     CDS             626856..627092
                     /locus_tag="DEHA2F07194g"
                     /note="some similarities with CA0264|IPF8434 Candida
                     albicans IPF8434 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07194p"
                     /protein_id="XP_460672.1"
                     /db_xref="GeneID:2903252"
                     /db_xref="UniProtKB/TrEMBL:Q6BM99"
                     /translation="MQESVHGNTSIASAVVDSTNNAIDQGFLLLDTLLYYIFNAVVLL
                     LNLTDVVGEFTEKVSFNYQIVYTSFKHKLYNNIN"
     gene            627450..627557
                     /locus_tag="DEHA2F07216r"
                     /db_xref="GeneID:8998905"
     tRNA            join(627450..627486,627521..627557)
                     /locus_tag="DEHA2F07216r"
                     /product="tRNA-Pro"
                     /note="tRNA Pro (TGG) cove"
                     /db_xref="GeneID:8998905"
     gene            complement(<627715..>629781)
                     /locus_tag="DEHA2F07238g"
                     /db_xref="GeneID:2903254"
     mRNA            complement(<627715..>629781)
                     /locus_tag="DEHA2F07238g"
                     /product="DEHA2F07238p"
                     /transcript_id="XM_460673.1"
                     /db_xref="GeneID:2903254"
     CDS             complement(627715..629781)
                     /locus_tag="DEHA2F07238g"
                     /note="highly similar to uniprot|P49367 Saccharomyces
                     cerevisiae YDR234W LYS4 Homoaconitase catalyzes the
                     conversion of homocitrate to homoisocitrate which is a
                     step in the lysine biosynthesis pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07238p"
                     /protein_id="XP_460673.1"
                     /db_xref="GeneID:2903254"
                     /db_xref="GOA:Q6BM98"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004418"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /translation="MALLYLSTRSSLKKTGARCLSSSSILYRGQNLTEKIVQKYAVGL
                     ADDKKVFSGDYVTIKPAHCMSHDNSWPVATKFMGLGATNVHDNRQIVCTLDHDVQNKS
                     EKNLEKYHNIENFAKEQGIDFYPAGRGIGHQIMIEEGYAYPLNLTVASDSHSNTYGGI
                     GSLGTPIVRTDAASIWATGQTWWQIPPVAKVELVGQLPKGATGKDIIVALCGIFNNDE
                     VLNHAIEFTGEGVKNLSVDYRLTIANMTTEWGALSGLFPVDETLVNFYDERVKKLPQP
                     HPRVNENTVKNLSENKVNSDNDAVYAKHLVVDLSSLSPYISGPNSVKVSTSLHDLSKQ
                     NIKINKAYLVSCTNSRLSDIKAAADIIKGHKVAEGVEFYVAAASSNVQKDAEAIGAWQ
                     DIIDAGAKPLPAGCGPCIGLGTGLLEDGEVGISATNRNFKGRMGSKDALAYLASPEVV
                     AASAVLGKIGGPEELQGNPVPTNPEIVRSITSNESTETVDPDASGSSVDVLDGFPQSI
                     EGELILCDADNINTDGIYPGKYTYQDDIPRSKMAEVCMENYDSEFKQKTKAGDIIISG
                     YNFGTGSSREQAATAILARDMKLVVAGSFGNIFSRNSINNALLTLEIPALINKLREKY
                     AQSNELTIRTGWFLKWDVTKNQVTVSDSEGNLILTQKVGELGTNLQDIIVKGGLEGWV
                     KAQLKN"
     gene            <630019..>630855
                     /locus_tag="DEHA2F07260g"
                     /db_xref="GeneID:2903255"
     mRNA            <630019..>630855
                     /locus_tag="DEHA2F07260g"
                     /product="DEHA2F07260p"
                     /transcript_id="XM_460674.1"
                     /db_xref="GeneID:2903255"
     CDS             630019..630855
                     /locus_tag="DEHA2F07260g"
                     /note="similar to uniprot|Q03530 Saccharomyces cerevisiae
                     YMR274C RCE1 Type II CAAX prenyl protease involved in the
                     proteolysis and maturation of Ras and the a-factor mating
                     pheromone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07260p"
                     /protein_id="XP_460674.2"
                     /db_xref="GeneID:2903255"
                     /db_xref="GOA:Q6BM97"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:Q6BM97"
                     /translation="MYTITKAFVLCIIVAISYVATIHVGVPEHIKGIERNNPDVIHHR
                     IVRITTLCSILILVLPMMLTYMGGYPSYISVIWSFGLVPGMTLSGHLATDIVNIFRSI
                     KLISILYMGPILDYPWEIQFDASIAQQDFYDCFYSIWGVRDHIFAPITEELIYRSVLL
                     TLLQPFESISDLQKILLTPLFFGVAHVHHGYDLYKNRNVDFSTAALTVVVQVMYTTVF
                     GVLSNYLFLETGNNLWCPIVVHCICNLMGFPNLSVDRPLFWTITYYLLLIVGICGFIK
                     LL"
     gene            <631326..>635162
                     /locus_tag="DEHA2F07282g"
                     /db_xref="GeneID:8998906"
     mRNA            <631326..>635162
                     /locus_tag="DEHA2F07282g"
                     /product="DEHA2F07282p"
                     /transcript_id="XM_002770717.1"
                     /db_xref="GeneID:8998906"
     CDS             631326..635162
                     /locus_tag="DEHA2F07282g"
                     /note="weakly similar to uniprot|P50111 Saccharomyces
                     cerevisiae YMR273C ZDS1 Protein that interacts with
                     silencing proteins at the telomere involved in
                     transcriptional silencing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07282p"
                     /protein_id="XP_002770763.1"
                     /db_xref="GeneID:8998906"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:B5RUB2"
                     /translation="MSEDEIVDQTRSYESAAKDIEQEKKMVAALKRLSISNMMSYDPD
                     LPIEDMEYQYQYQQQNDDSANKSPPKLSQVRRSSSLSHNSSLKGRPSPSEDAMLQIQG
                     TVEDNASDQPQQEQELDTETLLWVPANLHPEVDPEQFKIHVKTTVGEIMERKSSRKNS
                     LSRHSSLSSSFLADDREETNPSEPETPEKNIQNNNNLEAEQQSYQEKRFSNPSLRDLS
                     FELENLSRIAGMDSTDAVTIARTLSSSSLGYTDVEKQAFDELSSPPHVSPNNSTRRRE
                     TDTTQNKAFVDPESPTSRKTVNRLPQEYAYDHSSQHQQHTQQLPRQHQSYQMPKSQFS
                     PNDFSLKRSRRLDYRKLSNPSASGSSLQNNKAGKLAELRNNLNSPSQSPVTHQYHLPK
                     QPEHKSKSKQRNARDSQLLFSYRNPNVPPEAQSSNDSPYPNSASSSSPLEQQFNTHKF
                     SQHNLTAKRISHIKSHKDQYGLPQKQGYSRTSSRSSSGGSGNKSIQSFEKEKARPIQS
                     PPTQPFPSHTINKQKIPPPQNQYRSDNGKHHHRSHGRRNNNSAQQIPSQSNNYVFQLQ
                     IPKTRSEGKKLVSQTDLIKKESVPRIKISKEPSNNITENKSTQLNQNLDLLRSEINEF
                     KESLTKIDSPASSESRSISDSDLPESSDNNESDFSFEASYQNISYEDSLGIEKDVLKE
                     LNREKITNINDVESDLEYGKANPFVSSPKQKLIQEPVSEFIGREKNDNNEELLKATDF
                     DIDFDQNENKDAIELSAIDQEPLINEIADIPDEEFISRSNEPISQASPAGEVQNKKSF
                     GLLPNHSSSSFNSDTSESKKSLKKKKSWPWLKERSASFSTSDGNKLPSLPEAKSPSRS
                     FSTPETPTKKRQEQEQIVKEVPKAHDVKPSGSIGKENMISKFFKKKRSNSSTSVSSSS
                     DVTNMETKPGQDSGVTVDYESDSEAKKNLQGKLKGGIFKKMNRNKMHEKEKERLQSLK
                     STSVTSLVSSIDKGSSTEDLLEPEASRETKNLQDSGRDSQYSPNNVLDVGKQKEIERS
                     SELRTENDEETLMNYSKGKERETEKTKPKIKTNLLGSRKEKALRKSDHVKTEISKQDT
                     EGEPDQVDVDDSGRSTVKVKTDEEKEVSRSALDIQEKLKKSIKRTSKANQPIEFTDSA
                     FGFPLPPPSQSTLVMLDYRFPVHVERAIYRLSHLKLANPKRSLREQVLLSNFMYAYLN
                     LVDHTLHLEQLNNSSENTTEVVDDTKELNFATDDLMVSDDELEETKNELDSDQVSIDL
                     DIVDLSNTSATRAETE"
     gene            <635560..>636690
                     /locus_tag="DEHA2F07304g"
                     /db_xref="GeneID:2903259"
     mRNA            <635560..>636690
                     /locus_tag="DEHA2F07304g"
                     /product="DEHA2F07304p"
                     /transcript_id="XM_460675.1"
                     /db_xref="GeneID:2903259"
     CDS             635560..636690
                     /locus_tag="DEHA2F07304g"
                     /note="similar to uniprot|Q03529 Saccharomyces cerevisiae
                     YMR272C SCS7 Required for the hydroxylation of the very
                     long chain fatty acid (VLCFA) located in the endoplasmic
                     reticulum"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07304p"
                     /protein_id="XP_460675.1"
                     /db_xref="GeneID:2903259"
                     /db_xref="GOA:Q6BM96"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="InterPro:IPR014430"
                     /db_xref="UniProtKB/TrEMBL:Q6BM96"
                     /translation="MSRNLPLLASAEVVKHNTQNDCWVTLYNRKVYNVSGFIDQHPGG
                     GDIILPYAGKDVTAIMADTISHEHSESAYEMLDDEMLVGYLATDEEERELLNNKNNTP
                     VEVRLEDSSSVDLYEFHDSLPPAEKLAIQTDYEEDIKKHKFLDLNKPLIPQMLCSTFS
                     KEFYLDQVHRPRHYGKGSAPLFGNFLEPLSLTPWWVVPAVWLPPNFYIFYVGFVNQDK
                     LVALSFWVMGLFVWTLVEYCMHRFLFHLDGYLPEHPVALTLHFLLHGVHHYLPMDGYR
                     LVLPPTLFVLLAYPFYKLVFAIFPFYMACSGFAGGTLGYILYDVIHYVIHHTKLPQFL
                     QDIKTYHLEHHYKNYEMGFGVTSRFWDVIFETEITSTFQKRN"
     gene            complement(<636837..>638078)
                     /locus_tag="DEHA2F07326g"
                     /db_xref="GeneID:2903260"
     mRNA            complement(<636837..>638078)
                     /locus_tag="DEHA2F07326g"
                     /product="DEHA2F07326p"
                     /transcript_id="XM_460676.1"
                     /db_xref="GeneID:2903260"
     CDS             complement(636837..638078)
                     /locus_tag="DEHA2F07326g"
                     /note="similar to CA4851|IPF5818 Candida albicans IPF5818
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07326p"
                     /protein_id="XP_460676.2"
                     /db_xref="GeneID:2903260"
                     /db_xref="InterPro:IPR019622"
                     /db_xref="UniProtKB/TrEMBL:Q6BM95"
                     /translation="MSTKKEREVILNSIEDEYRHDLSLHLYSTFLFHQINPLFPRRNW
                     ASWPLPFDRVPDPRSSKTFVGSENCIEQFDDIDHETNVNRENELDMRESVSTDDEDES
                     EDTGDDDEVSVKDEVIHQNRHKRYTRIRSVATKETLSNSKVDIMIELHALLERKIHSK
                     LKNVADKQNLTMSADVSSAMTNEVCKKLANKVDHLVNNIINFQKQGKTRLSSSRPYPR
                     LLNWQDILLAGLDVDESHKKTLDSTSHANLYQKCERIFDNPKYTYEYDDNEEEGDDEN
                     QSNDVPDTYVINPEQGEEESTLDTSKQKFNYSEYLSKVEETHRGLINYKNFKQRMLKN
                     RNQEDKLRELKKAIFMRKLNLQTKYSNIDWSKTKKRPKIQGRKAPKKYRIQNEDKDSQ
                     KEDALAHGGISLTADDFTVNI"
     gene            <638425..>639087
                     /locus_tag="DEHA2F07348g"
                     /db_xref="GeneID:2903261"
     mRNA            <638425..>639087
                     /locus_tag="DEHA2F07348g"
                     /product="DEHA2F07348p"
                     /transcript_id="XM_460677.1"
                     /db_xref="GeneID:2903261"
     CDS             638425..639087
                     /locus_tag="DEHA2F07348g"
                     /note="similar to uniprot|P13298 Saccharomyces cerevisiae
                     YML106W URA5 Fifth step in pyrimidine biosynthesis
                     pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07348p"
                     /protein_id="XP_460677.2"
                     /db_xref="GeneID:2903261"
                     /db_xref="GOA:Q6BM94"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6BM94"
                     /translation="MENFQAQFLDLALESQALQFGTFTLKSGRQSPYFFNLGFFNTGK
                     LLSALATSYANAIIKSGLKFDIIFGPAYKGIPLTAITVAKLAELDPETYGNVGYSFNR
                     KEKKDHGEGGSIVGCQLSGKKVLIIDDVMTAGTAINEAFAIIKEGKGEVIGSIIALDR
                     QETTADSELSATQAVSKRYGLPVISIVSLSDIVRHLKDKITPEELSSIEFYRKQYAPK
                     DA"
     gene            complement(<639187..>639996)
                     /locus_tag="DEHA2F07370g"
                     /db_xref="GeneID:2903262"
     mRNA            complement(<639187..>639996)
                     /locus_tag="DEHA2F07370g"
                     /product="DEHA2F07370p"
                     /transcript_id="XM_460678.1"
                     /db_xref="GeneID:2903262"
     CDS             complement(639187..639996)
                     /locus_tag="DEHA2F07370g"
                     /note="similar to uniprot|P29478 Saccharomyces cerevisiae
                     YML105C SEC65 signal recognition particle subunit
                     homologue of mammalian SRP19"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07370p"
                     /protein_id="XP_460678.1"
                     /db_xref="GeneID:2903262"
                     /db_xref="GOA:Q6BM93"
                     /db_xref="InterPro:IPR002778"
                     /translation="MAKRPVLEDVLDDEIDNMDMDIAQFDPSLRTPIAPVQPGPQITR
                     SQDQEPPLFPNFPHPEQDKSVERKDIVDPNKFSAEERAELKKFQIIYPCYFDKSRSHK
                     DGRRVSESKAVSNPLAKTISDACRHYNLPVMLELDKTHPQDFGNPGRVRVLIKDNNKN
                     GMPVDSRFKTKRAVLNIIADYLKTHPTTLASIGPKSGIPLPSEYETGFEPGEIPKVKG
                     FKMNTIVPVHSELTIKHPMTKSIYDPEPEQPQVKAPQAPKQPKKKVMKIRG"
     gene            complement(<640248..>642473)
                     /locus_tag="DEHA2F07392g"
                     /db_xref="GeneID:2903263"
     mRNA            complement(<640248..>642473)
                     /locus_tag="DEHA2F07392g"
                     /product="DEHA2F07392p"
                     /transcript_id="XM_460679.1"
                     /db_xref="GeneID:2903263"
     CDS             complement(640248..642473)
                     /locus_tag="DEHA2F07392g"
                     /note="similar to uniprot|P07834 Saccharomyces cerevisiae
                     YFL009W CDC4 F-box protein required for G1/S and G2/M
                     transition associates with Skp1p and Cdc53p to form a
                     complex SCFCdc4 which acts as ubiquitin-protein ligase
                     directing ubiquitination of the phosphorylated CDK
                     inhibitor Sic1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07392p"
                     /protein_id="XP_460679.2"
                     /db_xref="GeneID:2903263"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6BM92"
                     /translation="MSANNQPSLYPLQDAIAKFDCKPVNPNGKLSDVWLQNEYQKLSI
                     ISDQSGRESRKRIRNREETAGEGDAYDREGTESCDDMIISDTDCNSQISGQSAIISGI
                     SSFRENGLVHPPKRRLMSVPSPTNTVTPAVTETNNSNETLLQTNQIIQEHIIVQPRTP
                     TAINSPTNTPISDIEEQSQQLPLPSPSASPVQSTGDKISNFDPIEHQLSNIPTTQSEL
                     MEMMVSLSGYLSEKNQNHFIFRLLQNTNRSSLSSFSGLIENSLKRDLISNLPLEITYN
                     ILSHLDYKALCSLARVCSNWYKIIDNSGIWAQLLKKDKLILSDGAIEREIADPQKLLK
                     EWSSKSDINEANVMQTLYKKRCTILNRWMDPTYEPKRISVPGHGSHVVTCLQHDDEKI
                     ITGVDDKLINIYSTKTGELLKVLKGHEGGVWALKYTGNTLVSGSTDRTVRVWNIKTGK
                     CTHVFRGHTSTVRCLDILHPVKIGKNDNGEDIIFPEVPLLVTGSRDHNLHVWKLPLMN
                     EGEEAEDDVVGQQTYDSNEIENPYLITVLLGHTQSVRSVSGYGNIIVSGSYDTTVRVW
                     DLLDNGNCKHVLAGHGDRIYSTALNFHTKRCYSGSMDSSINVWDIESGKLLHTLEGHS
                     SLVGLLELSEEYLVSAAADSTLRVWNPKSGDNICKLEGHSGAITCFQHDSLKIVSGSE
                     IMLKLWDINSGKFVRDLLDDITGCAWGLCFDNNICTAAVQRCRNDTDETFIEILDSSG
                     P"
     gene            complement(<642946..>646221)
                     /locus_tag="DEHA2F07414g"
                     /db_xref="GeneID:8998907"
     mRNA            complement(<642946..>646221)
                     /locus_tag="DEHA2F07414g"
                     /product="DEHA2F07414p"
                     /transcript_id="XM_002770718.1"
                     /db_xref="GeneID:8998907"
     CDS             complement(642946..646221)
                     /locus_tag="DEHA2F07414g"
                     /note="similar to uniprot|P26637 Saccharomyces cerevisiae
                     YPL160W CDC60 Cytosolic leucyl tRNA synthetase ligates
                     leucine to the appropriate tRNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07414p"
                     /protein_id="XP_002770764.1"
                     /db_xref="GeneID:8998907"
                     /db_xref="GOA:B5RUB3"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B5RUB3"
                     /translation="MSATIKLENTARRDALIDIEKKYQKVWADDKVFEVDAPTIEEEP
                     SIDDAEELRKKYPKYFATMAYPYMNGVLHAGHSFTLSKVEFSTGFERMNGKRALFPLG
                     FHCTGMPIKASADKIKREIEEFGEDFSGAPAEDVEEQPKEKVKRDDITKFSATKSKAA
                     AKQGRGKYQFEIMLQLGISKEEVVKFSDPDYWLKYFPPLVQKDVTAFGGRVDWRRSFV
                     TTDANPYYDAFVRWQINRLRDCGKIKFGERYTIYSEKDGQACLDHDRQSGEGVNPQEY
                     TGIKIEVTEFAEEAKKLFQENNFELEGKKVYLVAATLRPETMYGQTCCFVSPKIDYGI
                     FDAGNGNYYICTERAFKNMSYQNLTPKRGVYKSSVQVNGKALIGSKIHAPLAVHKELR
                     VLPMETVLASKGTGVVTCVPSDSPDDYITTKDLINKPEYYNIEKEWVCDDIIPIIRTQ
                     RYGDKCAEFLVKELKIQSPKDAVQLAEAKESAYKEGFYNGTMIFGKYVGLASSDAKSK
                     VRADLVASNDAFVYNEPEGSVISRSGDECIVSLEDQWYIDYGEESWKSQALECLADMQ
                     TFAKETRHGFEGVLDWLKNWAVTRNFGLGTRLPWDKKYLIESLSDSTIYMAYYTIARF
                     LHSDYYGAKAGKFDINPELMTDEVFDFIFNRREDINTNIPIDQLKEMRREFEYFYPLD
                     VRVSGKDLIPNHLTFFIYTHVALFPKRLWPKGIRSNGHLMLNHAKMSKSTGNFMTLEQ
                     IVEKFGADASRIALADAGDTVEDANFDESNANAAILRLTTLKEWCEEIIKNKDSLRTG
                     PTDSFFDVAFENEMNDLIGKTYAQFEITNFKAGLKYGLFDYQTARDYYRDSVTSNIGM
                     HKDLVIRYIETQALLLAPVAPHFSEYIYRDVLGNSGSIQSTKFPSATKPVEKSISDAL
                     EYVRDLSRSIREAEGNVLKKKKGKPSEVDPSKPAKLRLFVATSFPEWQDNYIEIVRQL
                     FESQSLDDNKIIREKVGKDMKRAMPFISLLKQRLANEDPQTVFNRELTFNETDVIKSV
                     LANVKKSSVSVDIQDVEIISFDSGAKKGTNVMTGEEVEITITGKIIDSAVPGEPGIMI
                     NNI"
     gene            complement(<646442..>649264)
                     /locus_tag="DEHA2F07436g"
                     /db_xref="GeneID:2903265"
     mRNA            complement(<646442..>649264)
                     /locus_tag="DEHA2F07436g"
                     /product="DEHA2F07436p"
                     /transcript_id="XM_460681.1"
                     /db_xref="GeneID:2903265"
     CDS             complement(646442..649264)
                     /locus_tag="DEHA2F07436g"
                     /note="similar to uniprot|P49960 Saccharomyces cerevisiae
                     YMR268C Prp24p U4/U6 splicing factor AND similar to
                     CA2062|IPF7858 Candida albicans IPF7858"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07436p"
                     /protein_id="XP_460681.2"
                     /db_xref="GeneID:2903265"
                     /db_xref="GOA:Q6BM90"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6BM90"
                     /translation="MNKDIDGEIHKLKEQLSKWPYTSNDHDKLIDILRVDRKGKTQDL
                     HEARQNKAQYFTLSTKDIVNWLQDLQAIEDNNLRIKSILEFYRIVIHDYPTAQYWGRC
                     LDFVLNNYNDTQNIISESIIKELFKEALNDTVHDFKNSKEIWETVLAFFNNALDISGN
                     EADFDTLLKLHLKRISYPHESIRESFSQLSGFISKYDSKKYEQHMLAANKVFSKTLKA
                     QRYYEEFEIGISKNPNDVKVWIDYMESVNKYAKGIDEVSVLFYRAITSDRKGSVDDPR
                     WVSIWLAYIYILYQEEIDVKSIVLEPVLFKFVRSYPGSAVSYAEYIRNCPIFENGVEL
                     FSNMKTRALQLDLMNSNSYDDWKVLALAILSYEFSLVHSGENIDMVADLYTDAADYVD
                     IALENNNDVFHSVEKLVVSIYETLDDPDMARKVLMKLLENFSDQCEIWLYSYEFERRN
                     HSSYELISKLLERAVDNSKTLDWPERIMQEWLSFEQIQGNIHSYERALIKVDKVIREM
                     SLKRMHIQEAFESESTDKIKRNIDDDEGEQDRSNKRQRRDSMNETTRNREEYSVKISN
                     LPQNISEEKLKKFFDDCGTPKEIKLFQEDGKAPEAIIEWTDSKEVFASLTKNIKLIDG
                     NEVSVIRMLGSTLWVSNFPPSFSHERVKNIFEQVGTVVSIRFPSLKSNQSRRFCYVEY
                     ASPELAHLAISNYQGKEFEDEISNKRYRLVVDMSKPNSKKTKTDTAITEREIYIQNLN
                     FKTTTESDLESLFQTIGTIDSVKVPLNEKMKNQGNINNGYAFVVFKSEVAAKNALQLN
                     GTTLHDRKISVSQSQAKKHNNKSEKDPAAISNQFEELSTISIFNVSDTINRDQMTAFL
                     TKRVGPVRHVEVFPNQEAALAEFEVPSDAGKASLILTSEEFEGKLLNVGSKSDLTRTL
                     NGTKNVPTKKPKLMVPPTLQRRVRKK"
     gene            <649424..>650191
                     /locus_tag="DEHA2F07458g"
                     /db_xref="GeneID:2903266"
     mRNA            <649424..>650191
                     /locus_tag="DEHA2F07458g"
                     /product="DEHA2F07458p"
                     /transcript_id="XM_460682.1"
                     /db_xref="GeneID:2903266"
     CDS             649424..650191
                     /locus_tag="DEHA2F07458g"
                     /note="similar to CA2063|IPF7859 Candida albicans IPF7859
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07458p"
                     /protein_id="XP_460682.1"
                     /db_xref="GeneID:2903266"
                     /db_xref="GOA:Q6BM89"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:Q6BM89"
                     /translation="MDAKIYLQSYGWKEGEALKQGGLRKPILVKHKKDTKGLGHDTND
                     AEAWWERLFDGQLKNLEVKNGSAGAVSFEQNNEAVEKDVRKATSPLYRMFVKGQGLAG
                     TVGKTKHTQVKSTKLDGSKVFEAVTENLKEDGPIKSSKSKSNKKDKDIKEKKVRDKKS
                     KKDKEEKKNKKKSKKNEKIELDKVDLETKKITKEKKEKKEKKEKKTKRIESDKKDKDE
                     KIRSSSTNKSEKKRKRDDKMEKDDSSSKKKKKSVTTA"
     gene            <650336..>653902
                     /locus_tag="DEHA2F07480g"
                     /db_xref="GeneID:2903267"
     mRNA            <650336..>653902
                     /locus_tag="DEHA2F07480g"
                     /product="DEHA2F07480p"
                     /transcript_id="XM_460683.1"
                     /db_xref="GeneID:2903267"
     CDS             650336..653902
                     /locus_tag="DEHA2F07480g"
                     /note="weakly similar to uniprot|Q01846 Saccharomyces
                     cerevisiae YML104C MDM1 Intermediate filament protein
                     required for nuclear and mitochondrial transmission to
                     daughter buds"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07480p"
                     /protein_id="XP_460683.2"
                     /db_xref="GeneID:2903267"
                     /db_xref="GOA:Q6BM88"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6BM88"
                     /translation="MSMNNDVQLSFQTKHGIIFRIGTWLATIFVITFITRYTLKYWIS
                     ILFGFLTCISIAFYLIIGDSSVKPIPNYSKKSTRFSFVDEEKWSHELHKLYKDTRMLN
                     EPVIEQSFLISETLEDFINLIIKEFIDSWFVQISNSTVFQDSIRQELKYVIRNLHERF
                     TQLDFAKLLVFRILPIIHDHFNHFVKIQHGIRLNGNTSKLPTGSMEYAIAAARQYDRG
                     KVHPGVTVSMNSNDVNEKKHLRNKVDSILPHLLSPEENTNKAGTSLVKEIISCTILSR
                     VIHLLGDGDFYNLLIVNLIGDNIKHREQVKQLRAALEEHTRSLKRQTSKGISMTASSE
                     YLQNYKRINKNSTIQKNMDNHSFNEALQCVSKVSSVAELKHLSSYTGFQLSRVKDENP
                     GSSKEINVLLSRLNLLKSKIDNKLAQLSITSEKKIHKDEDAANLTLLDILNNSVGLKF
                     FTEFMNDRSRSQLFQLWLAIDEIRAPLEDIDIEEDGEARLSLSLEFSNLGDIVEIYRE
                     FFQNSSLEIDRDVFNRVESFVNNKDPIYKLELYQKSRKALFKLQNNIYESISNDDFPP
                     FKKSELFLKLLETHIFDSKPDEINSPMSWSSSGKRKIKQISDPLEDSSESEADEVSPG
                     VIKAVEDAFTQIMNSSDDKKSEIISDSKNSNSRSSSADIAESTSNNPISTIHLKKDLF
                     GESSNLFTDDSVNFSNGNRNSKLFDDISDHSFSDSDSINFDSDSQNQNINLSNPSHSD
                     SQIFLAAPGNLRLAEEISKLSEEIDKLSEQQAVLSPLLKKAELTNNVGELKILRKSKV
                     SLDREINAKELQKQQFIVQENDNSLYGKSRVSIQSYISNNENGKNYILYIVEVQKLSS
                     ENQNNVTAGWIVARRFSQFFRLNEYLKSRYPLVVNIKFPKRTVSVLKFQQKQIVEQRK
                     ALLEEYLQQLLKIPEVCSNKVFRSFLSSENFTSRNSQSIDGNTNVNLSKLRNSVEIVA
                     NKLYNGISGKISSNSLSNADKSFPLPDQPMEKYMKDMQKELRQFDESEHTNSIEKPVF
                     VKPVCDLLISVFRLNTPKSWLRGRALLVILHQVFGNTLEKKAYEVIDFFLRTEENVLD
                     LLIWGKNIIFPMGRLMEPPEPRNSYQRSTTKQEAKALLEIFMQETCSKIFGLANTTYA
                     CNNIFELLQNGFLNKHLILQIFDEIINQLFPEASTDVSSVSV"
     gene            <654096..>654701
                     /locus_tag="DEHA2F07502g"
                     /db_xref="GeneID:2903268"
     mRNA            <654096..>654701
                     /locus_tag="DEHA2F07502g"
                     /product="DEHA2F07502p"
                     /transcript_id="XM_460684.1"
                     /db_xref="GeneID:2903268"
     CDS             654096..654701
                     /locus_tag="DEHA2F07502g"
                     /note="similar to uniprot|P43582 Saccharomyces cerevisiae
                     YFL010C WWM1 WW domain containing protein interacting with
                     Metacaspase (MCA1)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07502p"
                     /protein_id="XP_460684.1"
                     /db_xref="GeneID:2903268"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q6BM87"
                     /translation="MVTNDSKNTPNVPEGWLAKFDDKYNTFFYVNLKTKKSQWEAPSG
                     TSFEPKSADEVLPPPYSPTSSSGARAQYQTQDRPQAQPQVQSQPQPHVQQYPPQQGYP
                     QGYPPQGYGYPPQQGYPPQGYGYPPQQQYMQQKPQRSRMGGMGGLGMGLGGGMLGGML
                     LGNMMGNNEMEAYHDGFQDGGMSGGDDMGGDMGGDMGGGDF"
     gene            <655407..>655877
                     /locus_tag="DEHA2F07524g"
                     /db_xref="GeneID:2903269"
     mRNA            <655407..>655877
                     /locus_tag="DEHA2F07524g"
                     /product="DEHA2F07524p"
                     /transcript_id="XM_460685.1"
                     /db_xref="GeneID:2903269"
     CDS             655407..655877
                     /locus_tag="DEHA2F07524g"
                     /note="weakly similar to uniprot|P43582 Saccharomyces
                     cerevisiae YFL010C WWM1 WW domain containing protein
                     interacting with Metacaspase (MCA1)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07524p"
                     /protein_id="XP_460685.2"
                     /db_xref="GeneID:2903269"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q6BM86"
                     /translation="MVETDPKNPPNVPKGWLAKYDEKYKAFFYVDLRTKKSQWEAPSF
                     EHADKVSPPPYSPTTSNGAQFQSQNQPRPNPQQPHPQSQLPPQGYGQPSQQQQGFAPQ
                     QQYVQQMPQNTHIGGMGGMGGMGIGGGMLGGMLLGNMMGSRRHSRRMPRRSRRC"
     gene            <656206..>656610
                     /locus_tag="DEHA2F07546g"
                     /db_xref="GeneID:2903270"
     mRNA            <656206..>656610
                     /locus_tag="DEHA2F07546g"
                     /product="DEHA2F07546p"
                     /transcript_id="XM_460686.1"
                     /db_xref="GeneID:2903270"
     CDS             656206..656610
                     /locus_tag="DEHA2F07546g"
                     /note="highly similar to CA2680|CaMCI4 Candida albicans
                     CaMCI4 NADH dehydrogenase (ubiquinone)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07546p"
                     /protein_id="XP_460686.2"
                     /db_xref="GeneID:2903270"
                     /db_xref="GOA:Q6BM85"
                     /db_xref="InterPro:IPR006806"
                     /db_xref="UniProtKB/TrEMBL:Q6BM85"
                     /translation="MRFTRVLRQAEEVLVKAASGNPTGLTGIYQHPNPRPALIALYNH
                     TLTVLDTKFPKESVYKQSVEALTRNRLKVVQEEEITENIENKIGGGLIEEIIIQAHEE
                     LGLANDLSSLKCWEELEEKPLDDQWVYFGKKI"
     gene            complement(<657018..>657641)
                     /locus_tag="DEHA2F07568g"
                     /db_xref="GeneID:2903271"
     mRNA            complement(<657018..>657641)
                     /locus_tag="DEHA2F07568g"
                     /product="DEHA2F07568p"
                     /transcript_id="XM_460687.1"
                     /db_xref="GeneID:2903271"
     CDS             complement(657018..657641)
                     /locus_tag="DEHA2F07568g"
                     /note="similar to uniprot|P07560 Saccharomyces cerevisiae
                     YFL005W SEC4 Secretory vesicle-associated Rab GTPase
                     essential for exocytosis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07568p"
                     /protein_id="XP_460687.2"
                     /db_xref="GeneID:2903271"
                     /db_xref="GOA:Q6BM84"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM84"
                     /translation="MSGRAPSRSYDMIMKLLLVGDSGVGKSCLLLRFVEDKFNPSFIT
                     TIGIDFKIRTIESNGKKIKLQVWDTAGQERFRTITTAYYRGAMGIVLIYDVTDSRTFE
                     NVENWYSTVTQHANEDAQIFLVGNKCDDEENRQVSKEQGQELASKLNIPFLEASAKSN
                     ENVDPIFYELAGIIQEKHVNTEGAQTASSAGGVDVSQTPNTFKSNCC"
     gene            complement(<657965..>659737)
                     /locus_tag="DEHA2F07590g"
                     /db_xref="GeneID:2903272"
     mRNA            complement(<657965..>659737)
                     /locus_tag="DEHA2F07590g"
                     /product="DEHA2F07590p"
                     /transcript_id="XM_460688.1"
                     /db_xref="GeneID:2903272"
     CDS             complement(657965..659737)
                     /locus_tag="DEHA2F07590g"
                     /note="highly similar to uniprot|P15624 Saccharomyces
                     cerevisiae YLR060W FRS1 Beta subunit of cytoplasmic
                     phenylalanyl-tRNA synthetase forms a tetramer with Frs2p
                     to generate the active enzyme"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07590p"
                     /protein_id="XP_460688.2"
                     /db_xref="GeneID:2903272"
                     /db_xref="GOA:Q6BM83"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:Q6BM83"
                     /translation="MPTIPVDKQDLFDLLGRSYTTEEFDELCFEFGIELDEDTTEECK
                     GDERPQFKIEVPANRYDMLCIEGIAQALNEFLGKKSSPGFKYNPSKPEISLTIHKSTE
                     QVRPYAASAILRNVQLDERRYDSFLALQDKLHTNLCRNRTLVAIGTHDLDTLTPPFTY
                     EALPPSEINFIPLNQEKEMDGNQLMEFYEKDKHLGKYLHIIKDSPVYPVILDANRTVC
                     SLPPIINSNHSKISAQTRNIFIDVTGTDRTKTEIVINQLVAMFAGYCKVPFEIEPIEI
                     KSEHNKQDRITPDISARPFEAEIPYINSCLGLDLTGQEISDLLKRMSLHAKPSSKKDL
                     IDIGIPITRPDILHQCDIMEDAAIAYGYNNLTKTKAKGDSLVAAPLPVNKIGDILRIA
                     SAQAGYLEVLPLTLCSHDENFKFLRTKDDNTTAVKLENPKTIEYQVVRTTLVPGLLKT
                     IKENRKHSLPIKVFEAGDIVLKNPELERGAFNQRNWSAIYAGKTSGFEFVQGLLGKIM
                     QTMRTSWLENPKESTERGYWIEQDDENPTFFPGRGAKVFFRAGDGSKEQHIGAIGVLH
                     PEVMANFEIPYAASSVEINAEVFL"
     gene            complement(<659940..>662840)
                     /locus_tag="DEHA2F07612g"
                     /db_xref="GeneID:8998908"
     mRNA            complement(<659940..>662840)
                     /locus_tag="DEHA2F07612g"
                     /product="DEHA2F07612p"
                     /transcript_id="XM_002770719.1"
                     /db_xref="GeneID:8998908"
     CDS             complement(659940..662840)
                     /locus_tag="DEHA2F07612g"
                     /note="similar to uniprot|P43564 Saccharomyces cerevisiae
                     YFL034W Possible integral membrane protein that interacts
                     with Rpp0p which is a component of the ribosomal stalk"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07612p"
                     /protein_id="XP_002770765.1"
                     /db_xref="GeneID:8998908"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B5RUB4"
                     /translation="MDFKRTPSVDSLGTAHSVYSSKTPTRSRSNIGSRTSISVLPSLP
                     TNVSNESIEEDLHNHSNIDEKLEREATPETSYVEFDLSSMDQKNSRNDSNFLSEKIIS
                     PNTHRTDISDVEADKDEVSDVAKKPEDAENDFFDMKTSDWKSMKTITEQDYYNDKGEL
                     EYKHANEFDPSKIKFDAHGYTKIDTEEQVTKYAELDKKTDFLFQSRREINKKTEAAAY
                     RKEDLDYASDEDNSEYEDDDNLDSNETLQTMRNMLTDGQKFAYVGTTKLIAIDMATEL
                     AKIKQSTSNKVAKELSLGQRNFANWTMYITSKLYEHMNLSKDEQNMIENLSKHGVEVT
                     DLCSSLNQREIIKPSKQNQTQENETDDSMKEIKGKTDNNEVAVDLRWTIICDLLLLLL
                     SDGYYDSRSRSLLVQFAEKMSISHLEILQFERRLIESLEIDTNNKSIENKDEKLNDRE
                     FIDKYKKKNKKKRYVYIGLATLGGSLAIGLSAGLLAPVIGLGIAGGLTTVGISGTSGF
                     LAGVGGSAIITTGGIVTGAKVGSKAGARRLGDVNTFELKPLYNTKRTNLIITVSGWMN
                     GKMDDVRLPFSTVDPVMGDMFSLLWEPEMLQSMGQTIGILATEALSTSIQQILGATVL
                     SALMAAIQVPMVLSKLTYLLDNPWSVSLDRAWKGGKILADTLISGNMGVRPITLVGFS
                     LGARLIYSCLIELAKRGGYGLIENVIILGCPITIKNDQLGLARSVVSGRFVNGFSKRD
                     WILGYLFRATGGGISSVAGLSPIESVYGIENIDCTDIVEGHMAYRKAMPKILKAVNWE
                     ILSEEFAEIEEPDPEQHERERKLVDEFDEARAKMKEEMDTEANKKKTWKNFFKPNQKD
                     WWNVYSEGKSKGSDANEPYADPSAESNQPHTQTNNPIFDVTALLEEANNIERLADNDP
                     ETLKTMRKEVDTSAKHTKLNEEVEEEEKSTSIVNSLANKFGVKQDADPGTKD"
     gene            <663993..>664979
                     /locus_tag="DEHA2F07634g"
                     /db_xref="GeneID:8998909"
     mRNA            <663993..>664979
                     /locus_tag="DEHA2F07634g"
                     /product="DEHA2F07634p"
                     /transcript_id="XM_002770720.1"
                     /db_xref="GeneID:8998909"
     CDS             663993..664979
                     /locus_tag="DEHA2F07634g"
                     /note="similar to uniprot|Q12291 Saccharomyces cerevisiae
                     YLR063W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07634p"
                     /protein_id="XP_002770766.1"
                     /db_xref="GeneID:8998909"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:B5RUB5"
                     /translation="MSRRIARSQARKLEEAEERQEEEIIDVEGRSDSMPFQSKYSIEP
                     PKIIDLFEMSFKNILDSEDLQKHIQSVKGDLYNRNYMSAFGNDDKRFAYASRWTPARA
                     LCYSSLFATLEPIRLLLEKPEGDKRVLCVGGGAASELVGLAAVFCRLKEYCSKSNSSL
                     QLDIIDIADWSTIVGTLTSYVKENWIYNAAGFNTNFIHDDILTADVAKLDYPKLDLIT
                     LLFTTNELFCEKRAQTVQFLQSLNTHCRKGCYLLIAESAGSYSNITIGTKKFPVQFLI
                     DMILIGKPGENSGSWEIVQQSESCWYRVNKKEIDYKMKLENMRFFYRLYKKK"
     gene            complement(<665238..>666302)
                     /locus_tag="DEHA2F07656g"
                     /db_xref="GeneID:2903492"
     mRNA            complement(<665238..>666302)
                     /locus_tag="DEHA2F07656g"
                     /product="DEHA2F07656p"
                     /transcript_id="XM_460690.1"
                     /db_xref="GeneID:2903492"
     CDS             complement(665238..666302)
                     /locus_tag="DEHA2F07656g"
                     /note="similar to uniprot|P53686 Saccharomyces cerevisiae
                     YPL015C HST2 Cytoplasmic member of the silencing
                     information regulator 2 (Sir2) family of NAD(+)-dependent
                     protein deacetylases"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07656p"
                     /protein_id="XP_460690.2"
                     /db_xref="GeneID:2903492"
                     /db_xref="GOA:Q6BM81"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6BM81"
                     /translation="MNQLTKILEPIAKAIQAGDKKVTFFEGAGISTAAGIPDFRSPDT
                     GLYSNLAKLDLPYAEAVFDIDYFKENPKAFYTLAHELYPGKFMPTKFHYLLRLFQDKK
                     LLKRVYTQNIDTLERVAGIEDEYIVEAHGSFARNHCIECSLEMSTEELKKQMSDKSVN
                     DGIPICQECGGYVKPDIVFFGEALPVKFFDTWDEDADEVEIAIVAGTSLTVYPFASLP
                     SETTKKSLRLLINNEVVGDFKHGKRKTDILAISDCDEAAVTLAELLGWSEELDELINK
                     NKTLFESTYSIGEKTNDEEVSKKSLSKASERLAEEIRDVEAEKGTQKPEKTDKQTESK
                     EEKSKNDTDDLEKDISNLKI"
     gene            <666509..>669759
                     /locus_tag="DEHA2F07678g"
                     /db_xref="GeneID:8998910"
     mRNA            join(<666509..666514,666571..>669759)
                     /locus_tag="DEHA2F07678g"
                     /product="DEHA2F07678p"
                     /transcript_id="XM_002770721.1"
                     /db_xref="GeneID:8998910"
     CDS             join(666509..666514,666571..669759)
                     /locus_tag="DEHA2F07678g"
                     /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
                     YPL009C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07678p"
                     /protein_id="XP_002770767.1"
                     /db_xref="GeneID:8998910"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:B5RUB6"
                     /translation="MKQRITGLDLQIITAELSKEILNYRLQNIYNVSSSSRQFLLKFS
                     IPDSKKVVVLDCGNKLHLTEFDRPTTQTPSNFVTKLRKHLKTRRLSQIKQIGNDRVLV
                     LEFSDGLFYLALEFFSAGNILLLDQDRKILSLQRMVSDKGGNDRYAVNEIYKMFDESL
                     FKSDFNYERKTYSKEQVQGWIKSQRDKLDQRSQDGNKKKNKVFSIHKLLFVNSSHLSS
                     DLVQLNLIKNGISSSASCFDFENDDAKMDLIIKALEEAESDYINLLEKSEDAINGYIV
                     SKKNLSYNPDNDDSTNDLEYIMDEFYPYKPYKSDMDNYRFTEIQGYNRTMDSFFSTIE
                     STKYALRIDQQKQQATKRLDYAREERDKQIQSLLAQQESNIKKGDAIMYYADLVDQCK
                     DSVVKLIDQQMDWTNIESLIELEQSRGNKIARFINLPLNLKENKINLHLPDMDEENEE
                     NKTAFDSDSDSDSDSDSDSSSDESESESDSDSDSDSDSETTSEARPKQKKVKKSGKPA
                     KSKISVWIDISLSPFANARVYFESKKSAESKQIKVEKSTEFALKNAKKKIEQDLNNKL
                     KNENDSLKQIRPKYWFEKFLWFVSSEGYLCLAGRDNSQIDMIYYRHFNDNDYFISSDI
                     EGSLKVFIKNPFKGESIPPSTLMQAGIFAISASSAWNGKVTTSAWLLHGADISKKDFD
                     GTLISSGNFNYKAKKTYLPPCQLIMGFGFYWLGDEETTKKYTETRLSREEEHGLKIVM
                     DNKKQDLEHSSKSSNKIQSSLNEVDDEKVSAKEDTEPSKEDITSEPASESKEGKKRLS
                     AKERRMLRKGKDIKVSENEDTDEDVFDPIEQEMKNLKLEETKKKTAEPSSQKPPNVRG
                     KKSKMKKIAAKYADQDEEERKIRMEALGTLKQVEAEKQKQIDEEENKESKDKYVNEAL
                     NAERRKNQEEREYRKYIMEEANEDESSVVNYLEILDSFISKPQPDDCLVNLVPVFAPW
                     SALTKFKYKVKIQPGGGKKGKCINDTLNYFANRKSDPSHTDTELDWDNEREILKGAKP
                     NDLMGVFTVSKVKLMLPGGQDKTARKAPAKKGKR"
     gene            <670271..>671656
                     /locus_tag="DEHA2F07700g"
                     /db_xref="GeneID:8998911"
     mRNA            <670271..>671656
                     /locus_tag="DEHA2F07700g"
                     /product="DEHA2F07700p"
                     /transcript_id="XM_002770722.1"
                     /db_xref="GeneID:8998911"
     CDS             670271..671656
                     /locus_tag="DEHA2F07700g"
                     /note="similar to uniprot|P00635 Saccharomyces cerevisiae
                     YBR093C PHO5 One of three repressible acid phosphatases a
                     glycoprotein that is transported to the cell surface by
                     the secretory pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07700p"
                     /protein_id="XP_002770768.1"
                     /db_xref="GeneID:8998911"
                     /db_xref="GOA:B5RUB7"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B5RUB7"
                     /translation="MVSISKIVSSSLIFAANDQFRDVGSVDLAAKTQYNIVKYMYGNG
                     PYMQNPGYGISTDVPDQCTLEHVQVYMRHGERYPGISDGEKQKALVDKLQSYNSSLSG
                     PLSFLNDYEYYVKDDSLYELETTPSNAKGPFTGYETCNKAGSAFRAKYNDLYNENETL
                     PVFIAASKRVYDSADFFVNGFLGEDYDEDKIKRVVISEEKSSGFNSLTPRWACPSYYN
                     PNTTAPKFKSDYLEDIADRLKTDNDGLNLTSSDIPYLFQLCSFELNSKGYSQFCDIFT
                     QDELVTNDYAQGYNSYHSAGAGSETSKYAGSVQLNASLALLKEDDPKNKIVLSFTHDT
                     DIQVFYASLGLFDVSGEMPSDKVDVRNAFRRTEVVPMGGRLITEKYKCDGKSYVRFIA
                     NDAVIPLQNCSDGPGFSCSLTEFEDIVSKKQSFNLLDKCNTPDDIPHELTFYWDYDEK
                     NYNATAPRVTA"
     gene            <672143..>673534
                     /locus_tag="DEHA2F07722g"
                     /db_xref="GeneID:2903498"
     mRNA            <672143..>673534
                     /locus_tag="DEHA2F07722g"
                     /product="DEHA2F07722p"
                     /transcript_id="XM_460696.1"
                     /db_xref="GeneID:2903498"
     CDS             672143..673534
                     /locus_tag="DEHA2F07722g"
                     /note="similar to uniprot|P38693 Saccharomyces cerevisiae
                     YHR215W PHO12 One of three repressible acid phosphatases a
                     glycoprotein that is transported to the cell surface by
                     the secretory pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07722p"
                     /protein_id="XP_460696.1"
                     /db_xref="GeneID:2903498"
                     /db_xref="GOA:Q6BM75"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6BM75"
                     /translation="MVSISKLLNNGLILAGQSIYQSVATPQQASVEQYDILRYLGGKA
                     PYIQHPGFGIPTDVPDQCTIEQVQLLSRHGERYPSKNVGKALEKINEKFKGYNGTFKG
                     ELSFLNDYTYFVEDKDNYEKETTPSNSEGPFSGADNALRHGTTFRSKYNEIYNPDKPL
                     PVFAANYDRVALTAQYFARGFLGQDYDESNVEYVLIDEDGELGANSLTPRYGCKKFES
                     DPHTDYVDGFSDQYLKDALTRFQKSNPNLDLDTDDVNSLFDWCAYELNVKGYSPFCNL
                     FSNTEFIKNSYSLDLENYYSNGPGNNMTRTIGAPLIRASLALLKDNETEHKIFLSFSH
                     DTDLEITLEALGLLGIADGEQLPNDHIPFPHTYVHSTIVPQGARIYTEKIKCDGEIYV
                     RYVLNDAVYPLPTCSDGPGFSCKLTDFENYVNDRLDNLDYATQCGAEDIPNNVTFYWD
                     YTEKNYTNISGDN"
     gene            complement(<673957..>674883)
                     /locus_tag="DEHA2F07744g"
                     /db_xref="GeneID:2903499"
     mRNA            complement(<673957..>674883)
                     /locus_tag="DEHA2F07744g"
                     /product="DEHA2F07744p"
                     /transcript_id="XM_460697.1"
                     /db_xref="GeneID:2903499"
     CDS             complement(673957..674883)
                     /locus_tag="DEHA2F07744g"
                     /note="highly similar to uniprot|P23202 Saccharomyces
                     cerevisiae YNL229C URE2 Nitrogen catabolite repression
                     regulator that acts by inhibition of GLN3 transcription in
                     good nitrogen source"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07744p"
                     /protein_id="XP_460697.2"
                     /db_xref="GeneID:2903499"
                     /db_xref="GOA:Q6BM74"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017298"
                     /translation="MTNNNSNSNNNQTISNLSAGLKSVNLADQQQNEVNLNLLQQQLQ
                     NEATTQQSQSRISQFFQNQPTEGYTLFSHRSAPNGFKVAIILSELNLPFNTIFLDFNN
                     GEQRAPEFVTINPNARVPALIDHFNENTSIWESGAIILYLVSKYLKDNGECALWSDNL
                     IEQSQISSWLFFQTSGHAPMIGQALHFRYFHSCPVPSAVERYTDEVRRVYGVIEMALA
                     ERREALIMDLDVENAAAYSAGTTPLSQSRYFDYPVWLVGDRATVADLSFVPWNNVVDR
                     IGINLKVEFPEVYKWTKYMMRRPAVIRALRGD"
     gene            <675217..>676104
                     /locus_tag="DEHA2F07766g"
                     /db_xref="GeneID:2903500"
     mRNA            <675217..>676104
                     /locus_tag="DEHA2F07766g"
                     /product="DEHA2F07766p"
                     /transcript_id="XM_460698.1"
                     /db_xref="GeneID:2903500"
     CDS             675217..676104
                     /locus_tag="DEHA2F07766g"
                     /note="weakly similar to uniprot|Q12288 Saccharomyces
                     cerevisiae YLR126C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07766p"
                     /protein_id="XP_460698.1"
                     /db_xref="GeneID:2903500"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6BM73"
                     /translation="MAVEGDIRHVAVLVCDTPISGITEKFGDFGDNVVDLLQNAGNCQ
                     YPMVKYQVAFDSNEEASYQGDLRRVYERLTDQMMGGFVQGVIVSGSRSDSFAREVPWI
                     EKLDEFLKYVFTLERFPVVGICFGHQMIAKLLGCKVGRNSPENGWECGTTTINLNTDI
                     LAIKDSPFLNVLKTDDSGAVIDHLNVVEFHQDIVYGLPPPAVFEKRKTNIMSIGSSNK
                     CSIQGLITESGPLKILTFQGHPEFSTEEAKEFLKKNFEMGLLDKKLFEKCTYNTSILN
                     NQGFLLGKVIGNFINLFNK"
     gene            complement(<676207..>679980)
                     /locus_tag="DEHA2F07788g"
                     /db_xref="GeneID:2903501"
     mRNA            complement(<676207..>679980)
                     /locus_tag="DEHA2F07788g"
                     /product="DEHA2F07788p"
                     /transcript_id="XM_460699.1"
                     /db_xref="GeneID:2903501"
     CDS             complement(676207..679980)
                     /locus_tag="DEHA2F07788g"
                     /note="weakly similar to uniprot|P39523 Saccharomyces
                     cerevisiae YMR124W Protein of unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07788p"
                     /protein_id="XP_460699.2"
                     /db_xref="GeneID:2903501"
                     /db_xref="UniProtKB/TrEMBL:Q6BM72"
                     /translation="MDSEMASTATQKGKLRQRLLNSELDINVLNEQQQPKIPMQQQMA
                     MEQGGGVYQQQYPQAYPQAYVANGAQSQPSFLNSYESLTNQGANEGVRKASLTSQSNM
                     TMNKFFRRNKGDGGFDEETGADINDLTNGSNVSFDDISHIRDRGKYGVNGPHLDSTPF
                     IPTIGGGIGSASGKSLNNIQYRKQMNHQKKMAYASNARAMSLAGSNPMQQTSDPRAMS
                     LSSFGNGNGPRAMSLNSNGMMANGPRAMSLNNRMPMPPPGKGGYMPQNGPRTMSMRNN
                     GAPFGNGPYMQPTGGPRAMSLTNGPPGPRAMSLTNGNPMNQQYTPRPHPQQMQQMQQL
                     NPQQMQQMQHMQHMQQMQQMQQSNPQQYGGYQTMNPNARAMSLNGGNPMNDPRFNHAG
                     QFSNSQQRQNMPHPMPNGPNPNMAPEPNQNYAQKSNDSLMNVLEEEDENNTNSPKENQ
                     VVSSNRRENNGDNTIDDDDVVYKFDEHDDAGSLSRKSTLKKSNSMKLRKLNLFNSETR
                     EQPDIQETSFDESPNESRRLSHSSQTLHNTGNDVSPSFNLRKARGARESMLNDASNEE
                     DLAQLDERQEKFKSLGANAEYNGSIANSLNKDVFVTANDLISPSKVGKGDNNKKSPLL
                     KNTGYEDINENEENYMKNDNDMLKRRGSPEPISNSTLPNDAHSNMLSKQPSIRSLVTN
                     TAFDKFRESPRKSSKTLPELPASPTNSDYGTNATNTTNEDLNSEGSFSQPKQMLDETS
                     NYSSLSSLVQSQNNANPTSFERANINAEPLASQQASDQSISSTPRDNNENSTPPTTHN
                     SNISNTNYNDKAQTVDSNVAQVYPKTEGKDPSNERRMSAIRNMNTSDMLSSPIVDDNI
                     FAPESARKERRSSKTFSLSNKSKNIFKRFSKSGKKSADEDESFTNDEVSFNSNRNSIH
                     SYNQGGIQARKASSASIGQSRPEKPLKFTKEELGIMNCNSELLNDLQLVTTELASSIK
                     RELEFANRLKNNSSSPLESSDELRSQLLGKARVISDLQDKLNKERSLRFICEEHALLA
                     ENGTSPSPLKLNYEKTELYKQLLIKNDLVNQLQDKIEESQMKQNPGDSNLLIKYNELL
                     EENTDLKSKVIPDLENRIEASRNVSSLNNNKSLNLVNNCTDHDNANSRGDYDEDYYDD
                     EYDQSREHIEISTLKNQREELREVVSKLSSSYNYELKLAQEKIKNLELKVQDMNSINN
                     KLSQRLEPNRTISSGQNNHNNTSNSPLKILSNNKGGKLQGFAIVSPTKKLFDD"
     gene            <680715..>680885
                     /locus_tag="DEHA2F07810g"
                     /db_xref="GeneID:8998912"
     mRNA            <680715..>680885
                     /locus_tag="DEHA2F07810g"
                     /product="DEHA2F07810p"
                     /transcript_id="XM_002770723.1"
                     /db_xref="GeneID:8998912"
     CDS             680715..680885
                     /locus_tag="DEHA2F07810g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07810p"
                     /protein_id="XP_002770769.1"
                     /db_xref="GeneID:8998912"
                     /db_xref="UniProtKB/TrEMBL:W0TYT1"
                     /translation="MVSGHGHQGKLEQPNGCNIGQYLWKILEPYHLQVQLSLFSIHQL
                     YQWRECKMRTPQ"
     gene            complement(<680935..>681375)
                     /locus_tag="DEHA2F07832g"
                     /db_xref="GeneID:2903503"
     mRNA            complement(<680935..>681375)
                     /locus_tag="DEHA2F07832g"
                     /product="DEHA2F07832p"
                     /transcript_id="XM_460700.1"
                     /db_xref="GeneID:2903503"
     CDS             complement(680935..681375)
                     /locus_tag="DEHA2F07832g"
                     /note="weakly similar to uniprot|Q12091 Saccharomyces
                     cerevisiae YPL170W DAP1 Heme-binding protein involved in
                     regulation of cytochrome P450 protein Erg11p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07832p"
                     /protein_id="XP_460700.2"
                     /db_xref="GeneID:2903503"
                     /db_xref="GOA:Q6BM71"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q6BM71"
                     /translation="MSSLDTSHQHGVSEKTPNEFEKLNNGINIKMLPIYTRSQLSLYN
                     GIDKPEVYVAIKGYIYDVSNNVSNYGPGRPYHKLVGKDVSRLLGLNQLQLKRTGDPYA
                     PEKDNAWYTGDFTDKENSIVDKWVLFFRKRYTIVGVVVDHEVGT"
     gene            <681593..>682721
                     /locus_tag="DEHA2F07854g"
                     /db_xref="GeneID:2903504"
     mRNA            join(<681593..681595,681720..>682721)
                     /locus_tag="DEHA2F07854g"
                     /product="DEHA2F07854p"
                     /transcript_id="XM_460701.1"
                     /db_xref="GeneID:2903504"
     CDS             join(681593..681595,681720..682721)
                     /locus_tag="DEHA2F07854g"
                     /note="weakly similar to uniprot|Q00916 Saccharomyces
                     cerevisiae YIL061C SNP1 U1snRNP 70K protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07854p"
                     /protein_id="XP_460701.2"
                     /db_xref="GeneID:2903504"
                     /db_xref="GOA:Q6BM70"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="UniProtKB/TrEMBL:Q6BM70"
                     /translation="MANETEKYPINIQKLFAVKPPLVYKTPLDYPAESRCTNHITSVS
                     SFRNQWQQYVDDLVEAEKNQPPPIETIQQVQIREKGRKKQELQKSYQLQLNEWNDPEL
                     LQKNEQEFMKDPFKTVFISRLDYLLTELDISKNFSKYGVIESITIVRDKKSGKSRGYG
                     FVVFERDEDAKGCIKELAPTGLKIPVENKPFTRTILVDMERGRLVRNWKPRRLGGGLG
                     GRHYTRPSPTLSNNASAAASGRRLHLSSNPYQSTPSQPSHSSTRYAPRPSAPRPMVEN
                     RQPRPAAYGSYNSSVENNESVRDKYAKYSSNNDSNSSSYRSPRTSGQNRSIRSIRQRE
                     "
     gene            <682885..>684258
                     /locus_tag="DEHA2F07876g"
                     /db_xref="GeneID:2903505"
     mRNA            <682885..>684258
                     /locus_tag="DEHA2F07876g"
                     /product="DEHA2F07876p"
                     /transcript_id="XM_460702.1"
                     /db_xref="GeneID:2903505"
     CDS             682885..684258
                     /locus_tag="DEHA2F07876g"
                     /note="weakly similar to uniprot|P40517 Saccharomyces
                     cerevisiae YIL063C YRB2 Ran-GTPase-binding protein
                     involved in nuclear export"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07876p"
                     /protein_id="XP_460702.1"
                     /db_xref="GeneID:2903505"
                     /db_xref="GOA:Q6BM69"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6BM69"
                     /translation="MSNDTSNKRKLEEEDLSDNKKVRQESPDSVVDDLNYLKESIKQE
                     IFKTFEDRFNRLENEIIQLKSTSKDDSGTLSERTANEGSVDTPPDEASLKVSSGVPKL
                     HPLNPTVGELPKSNSNPFNEIKGFKSMESNEKSTDPKPSKHTFGGSSFKINTPMNSFV
                     SNANPADTPTAPNTAQSSPQHVFGATSSFGSASAFDVAKSKKNVFEALPSKTTNEISK
                     SPSAEISKSNSSSVTSSFGSGTFGGNTKFNNAFQNSLKKKSFLDDKANKDGKTEETAD
                     TGNTAKEKTPTTQQYKQVDLTPVGEIRTGEENEKSHFTSTAKIFELNLTKISDGWKER
                     GLGRLHLNQSLDDPQKVRLVMRSQGLLRVVLNMKVTSDTKLIKGLEASLSPGKFVRWN
                     SINDQGAPVQYLLKFPNQTIRDELIEKVENLKETFETESMSKGTESSSGVESKETKPN
                     ATGVKWL"
     gene            complement(<684325..>685143)
                     /locus_tag="DEHA2F07898g"
                     /db_xref="GeneID:2903506"
     mRNA            complement(join(<684325..685030,685094..>685143))
                     /locus_tag="DEHA2F07898g"
                     /product="DEHA2F07898p"
                     /transcript_id="XM_460703.1"
                     /db_xref="GeneID:2903506"
     CDS             complement(join(684325..685030,685094..685143))
                     /locus_tag="DEHA2F07898g"
                     /note="similar to uniprot|P40516 Saccharomyces cerevisiae
                     YIL064W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07898p"
                     /protein_id="XP_460703.2"
                     /db_xref="GeneID:2903506"
                     /db_xref="GOA:Q6BM68"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR026635"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6BM68"
                     /translation="MSNEIRLNSSKLGTKEYWNSFYKKEIANFQDNEEDTGECWFDDS
                     DAESKMIQFLIDKINGEELPFGKQENIKIVDLGTGNGHLLFQLHEDILEECDYQDQIK
                     FDFMGIDYSPDSVEFATKIAKQKYPQAAFQFEQVDLLTKENKFLSANTSQFDILLDKG
                     TLDAIALNQDPISELGDKIGMDVYASQVSQLMHQNSVLLITSCNFTESELIKIITQDK
                     TNSLSVWNKIDYPSFQFGGVKGSTICSIAFIKN"
     gene            <685319..>686737
                     /locus_tag="DEHA2F07920g"
                     /db_xref="GeneID:2903507"
     mRNA            <685319..>686737
                     /locus_tag="DEHA2F07920g"
                     /product="DEHA2F07920p"
                     /transcript_id="XM_460704.1"
                     /db_xref="GeneID:2903507"
     CDS             685319..686737
                     /locus_tag="DEHA2F07920g"
                     /note="weakly similar to uniprot|P13712 Saccharomyces
                     cerevisiae YBR195C MSI1 Subunit of chromatin assembly
                     factor I (CAF-I) regulates the RAS/cAMP pathway via
                     sequestration of Npr1p kinase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07920p"
                     /protein_id="XP_460704.2"
                     /db_xref="GeneID:2903507"
                     /db_xref="GOA:Q6BM67"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q6BM67"
                     /translation="MNGEELVLNDTVENSDVSNVDMQSDKPDDVTVVEHSPIDQQTEV
                     NYRIWKKNAPFLYDYITTHSLLWPSLTVQFFPDLEKPLSKDAMLDPFQDFKKADSNGS
                     KSENEASMQRILLGTFTLGQSTDSISILQLPYYTNLNKNLTIDKLDYNHEKEEFELTK
                     IAKKKINVLQKINHWGDVNKSRYMPQNPDVIASSNNLGNLVIYDRTKHASFKNSLIGE
                     DTEINKPQLHLINEWNPSDADIFAIDWNKQKEGVIISANMEGNINLYDIKSKFTSKDV
                     QTINESQHFGNSNIAINDIEWIPNHDSILTYVDDQGSIKLLDVRLPEHQSLVLQHQKS
                     NKGINSVSVNPGNQACLATGDIDGMIDVWDIRSFGSGNANSVYNIKKQHEGSITQLKW
                     HPKYHNILASSSSDKSVKIFDLNTIEEEEGLIFTHAGHMLGVNDLDWSLHDDWMMASV
                     ADDNSLHVWKPSSQIVKQYKSI"
     gene            complement(<686857..>687528)
                     /locus_tag="DEHA2F07942g"
                     /db_xref="GeneID:8998913"
     mRNA            complement(<686857..>687528)
                     /locus_tag="DEHA2F07942g"
                     /product="DEHA2F07942p"
                     /transcript_id="XM_002770724.1"
                     /db_xref="GeneID:8998913"
     CDS             complement(686857..687528)
                     /locus_tag="DEHA2F07942g"
                     /note="similar to uniprot|P05626 Saccharomyces cerevisiae
                     YPL078C ATP4 Subunit b of the stator stalk of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07942p"
                     /protein_id="XP_002770770.1"
                     /db_xref="GeneID:8998913"
                     /db_xref="GOA:B5RUB8"
                     /db_xref="InterPro:IPR008688"
                     /db_xref="InterPro:IPR013837"
                     /db_xref="UniProtKB/TrEMBL:B5RUB8"
                     /translation="MKTKFCSYILTISRIGLRYMSTPVEPKQKANSIVDAMPGNNYLS
                     KTGFLATSAAAAIYGISNEILVIHEETILVVTFTAFAALAAKFVAPLYTEWADGEIKK
                     VNDLLNTSRTKHVTAVKERIDSVSQLKDVVETTKQLFAISKETAQLEAESFELKQKLA
                     VSQEAKSTLDSWVRYEQQQRQLEQEQLIKSVLEKVNKEVENPKFQDKILAESVAEVEK
                     LFAKA"
     gene            complement(<688187..>688702)
                     /locus_tag="DEHA2F07964g"
                     /db_xref="GeneID:2903509"
     mRNA            complement(<688187..>688702)
                     /locus_tag="DEHA2F07964g"
                     /product="DEHA2F07964p"
                     /transcript_id="XM_460706.1"
                     /db_xref="GeneID:2903509"
     CDS             complement(688187..688702)
                     /locus_tag="DEHA2F07964g"
                     /note="similar to ca|CA3480|IPF3224 Candida albicans
                     IPF3224 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07964p"
                     /protein_id="XP_460706.2"
                     /db_xref="GeneID:2903509"
                     /db_xref="InterPro:IPR013169"
                     /db_xref="UniProtKB/TrEMBL:Q6BM65"
                     /translation="MSLSLNEQANSRKSRLSKLREDRKLEKESTGDVQTQSILDQNTN
                     GATPVNSTNEDIIHDTNNSSIRSRNFDLETRDAVSGIKNPPTLALSNNETVEVLASQI
                     QRDILQGIRHKADEASSGQDEGSPLEKHESAYHSKDLKADLAYYFNKADTKTNQAINR
                     ILQTKYQNSIH"
     gene            <689183..>692638
                     /locus_tag="DEHA2F07986g"
                     /db_xref="GeneID:2903510"
     mRNA            <689183..>692638
                     /locus_tag="DEHA2F07986g"
                     /product="DEHA2F07986p"
                     /transcript_id="XM_460707.2"
                     /db_xref="GeneID:2903510"
     CDS             689183..692638
                     /locus_tag="DEHA2F07986g"
                     /note="weakly similar to uniprot|P51979 Saccharomyces
                     cerevisiae YGL251C HFM1 Meiosis specific DNA helicase
                     involved in the conversion of double-stranded breaks to
                     later recombination intermediates and in crossover
                     control"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F07986p"
                     /protein_id="XP_460707.2"
                     /db_xref="GeneID:2903510"
                     /db_xref="GOA:Q6BM64"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM64"
                     /translation="MPFTPPRFMSNTGNSGIQEFALGLSTPLSGINSNNSALSGSRCH
                     TYRSGTLGIGRIREPVFNFDTSHIFGDHYSLNCPPVRRKPSIPIRSVKRFDLRKQADK
                     GINFSDFSSSSEGNETLDVSQKSTLMSTNQPVLSTSILPEKYRSIFSFSHFNKMQSES
                     FETIYNSDHNCVINAPTGSGKTVLFELAMLRLFYFSNTNNKVLYLAPSKALCAEKYND
                     WVGKFSFLSITIGVLTSETSLEEAEDVKRSNIIISTPEKLDLLTRRLSNYDKLLNDVK
                     LIVIDEIHILKDTRGSTLEVVTTRINKMCSKVRIIGASASAPNLYDMSIWLRKKDDLN
                     PAITLNFDDTYRSVQLDKIVLGYASQKDKDFHFDQFLHSKLVGVIRHYGKNKPTLIFC
                     PTRNSCIETAKYLNDNFDRNLCSQNSRIQFDEKELLVYAAHGIAFHHAGLSSDDRKKI
                     ELLFIEGKLNILCSTSTLSSGVNLPTYLVIIKGTKRWYSGSFHEYKETDVLQMIGRAG
                     RPQFETRGKAVIMTTENQKDKYQRLLKGILKDGSEKIESCLHLNLAQHLVAEISLGTI
                     GSIDDTLQWLKSTFFFIRFTSNPSYYKEISSFHASEPNKRLHHFCQKYLDSLVNERIV
                     SPISSGGFRCTEYGDVMTKYYILYPTMRNIIRSKAGNTLLDVLTIFSRSSEFSEFSIK
                     YNEKKLYKAINSSPYIRFPLHSTEFQDSDKVMLLLQYELCGLDFPNSPELMKLYYSFE
                     GDKCYVFKQASRIIRCMIDVFRYKKDCVSLLNTLRFSRCVAGRCWENSVTELKQLDGI
                     DEECIKKLRKNNISGFAEAKYLSQSQLEYFLGIEPGTGKNIAQSLQSLPKFKINATLA
                     SNKVRTDLETLEISLIVSIGIDNMERGNSKIKHNFINTIIGLSTGELLDFRRIAILEL
                     VEGNINSFRLTANVTDRQQKIHCHILSEDMVNIDARYVLSLDIIEEWKFDNLMNQKSR
                     YESEYNSTTIKEIDNVLTQYSKSDSESDLDSEDLILDPVKSIRSTVEVSKEKCNLRDK
                     PYRLNAIRKLRLDGNYECNHLCKDKTKCRHFCCRDGIPKVKKQRNTNKHVEIESNNCD
                     SRLTASCSSFDISQIARSQTSRPNGPSFQSQDYLSSPNHKRKKIRLGQRVGIFNSNNG
                     GLFDY"
     gene            complement(<692851..>693864)
                     /locus_tag="DEHA2F08008g"
                     /db_xref="GeneID:8998914"
     mRNA            complement(<692851..>693864)
                     /locus_tag="DEHA2F08008g"
                     /product="DEHA2F08008p"
                     /transcript_id="XM_002770725.1"
                     /db_xref="GeneID:8998914"
     CDS             complement(692851..693864)
                     /locus_tag="DEHA2F08008g"
                     /note="weakly similar to uniprot|Q7S897 Neurospora crassa
                     NCU06530 Hypothetical protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08008p"
                     /protein_id="XP_002770771.1"
                     /db_xref="GeneID:8998914"
                     /db_xref="GOA:B5RUB9"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B5RUB9"
                     /translation="MHIGHLLLKALSLQKFASEIVLENTTPGIPKVQTNLKYSPQYVE
                     VDLIPENEQEVYKINGRRPLVIWHGLGDNYNSSGMVDVVSIFNQRYPDMFIYPIFLDA
                     KPSKDQEKTLFGDANKEVEYVCEQLSAIPELKEGFDAIGFSQGGLFMRALVQRCSSVS
                     VNNLITFGSPHMGVSELPMCKPNDWLCKRKNAILKRQVWHENIQKSIIPAQYFRDPYE
                     YDNYVSHSNFLADVNNELAQKSNPAYAKNLNKLSKFVMVVFTKDTTLVPKESAGFNDW
                     DTIYDKTIPFDKTSLYENDLLGLRTMNENGKLAFLEIEEDHMVISDTFLVDIAENYVG
                     GSL"
     gene            <694025..>694885
                     /locus_tag="DEHA2F08030g"
                     /db_xref="GeneID:2903512"
     mRNA            <694025..>694885
                     /locus_tag="DEHA2F08030g"
                     /product="DEHA2F08030p"
                     /transcript_id="XM_460709.1"
                     /db_xref="GeneID:2903512"
     CDS             694025..694885
                     /locus_tag="DEHA2F08030g"
                     /note="similar to uniprot|P36144 Saccharomyces cerevisiae
                     YKR060W UTP30 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08030p"
                     /protein_id="XP_460709.1"
                     /db_xref="GeneID:2903512"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q6BM62"
                     /translation="MVSSFILGQSALADGTKSAKSLASHIGKENGPTHHEAVYLIINT
                     KIYLTKIKDYTPRIIPLSKGLDKLENKSVLLVTKDPSLPYRDALTKKDSPTEDVFNQI
                     YTLTKLKHISKDPKKLTKLFKEFDIIVADNRVHKFLPDILGARFYVKNKKIPFMVQMA
                     KPDKDARLSKGKKSTKLKDDRCEPEYVRYQMKSIVRNASYIPSATGTCISVKIGYSDW
                     KPEELLTNANDVIKYLVEPKFLPVGGLLRTPKNLVSVHIKTSESISLPIFKQKEDIKE
                     EDDDDSDLDF"
     gene            <695292..>697073
                     /locus_tag="DEHA2F08052g"
                     /db_xref="GeneID:2903513"
     mRNA            <695292..>697073
                     /locus_tag="DEHA2F08052g"
                     /product="DEHA2F08052p"
                     /transcript_id="XM_460710.1"
                     /db_xref="GeneID:2903513"
     CDS             695292..697073
                     /locus_tag="DEHA2F08052g"
                     /note="similar to uniprot|P36029 Saccharomyces cerevisiae
                     YKL174C TPO5 Protein involved in excretion of putrescine
                     and spermidine"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08052p"
                     /protein_id="XP_460710.2"
                     /db_xref="GeneID:2903513"
                     /db_xref="GOA:Q6BM61"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6BM61"
                     /translation="MENSQSLGSTSQNASSGGSKPIRTSISSFTNHFNLRKSAPGKLL
                     NSLMHDMEDQEVEIEHFKYKQELERKLSVTSVIGLGFGIVGVVFGLSSTIWISLIDGA
                     NVTILYGWVITAFFSTCVVLSLSEIVSKYPTSGGVYHFSALLSNEKYSSVCSWFTGWF
                     LIIGNWTYAVSIMFAGSQFILSIFGLKDAYYKEDAFLVLAVYFTLLTFCGFVNFKFAK
                     FLEKINKVCIIWSISTVLTIDFLLIFFAKKTNSIEEILTRFDNTRSGWPDPLAFMVGL
                     QSPSFTLSGYGMIYSMTDEVKNPERNMPKGTISAILLAGLTGIIFIIPILTILPELTL
                     LLDETPEIMPIDLIFKFATESYLISFLLVLLLVGTVFFQAIAALTTASRTTYAFARDG
                     GLPFKNYWVEVNSIEESIIPKNALFLSMSVCGALSLLSLFSSSAFNAFMGSSVISLAL
                     ANGIPILCLMLNKRKKIHGAAFRLKGFGWLVNGLSIFWVVLSFIILCLPPVIKDLTWF
                     TMNYAIVVILGFAGFASLGYRIWGVGSFEGPQIDHDYFELQDLVRKDFSVDDSYVQGI
                     DDQDDDDNAIAGSSDVQTDLDKPNEGP"
     gene            <697651..>698115
                     /locus_tag="DEHA2F08074g"
                     /db_xref="GeneID:2903514"
     mRNA            <697651..>698115
                     /locus_tag="DEHA2F08074g"
                     /product="DEHA2F08074p"
                     /transcript_id="XM_460711.1"
                     /db_xref="GeneID:2903514"
     CDS             697651..698115
                     /locus_tag="DEHA2F08074g"
                     /note="highly similar to uniprot|P39515 Saccharomyces
                     cerevisiae YJL143W TIM17 Mitochondrial inner membrane
                     protein involved in protein import"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08074p"
                     /protein_id="XP_460711.1"
                     /db_xref="GeneID:2903514"
                     /db_xref="GOA:Q6BM60"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:Q6BM60"
                     /translation="MSADHTRDPCPIVILNDFGGAFSMGVIGGCVWHGIKGFRNSPYG
                     ERGYGSISAIKSRAPVVGGNFGVWGGLFSTFDCSVKAVRKREDAWNAVIAGFFTGGAL
                     AIRGGWRHTRNSAITCACLLGVFEGVGMMMQRVMAQPTVAPAYPEEAAPLAA"
     gene            <698549..>700765
                     /locus_tag="DEHA2F08096g"
                     /db_xref="GeneID:8998915"
     mRNA            <698549..>700765
                     /locus_tag="DEHA2F08096g"
                     /product="DEHA2F08096p"
                     /transcript_id="XM_002770726.1"
                     /db_xref="GeneID:8998915"
     CDS             698549..700765
                     /locus_tag="DEHA2F08096g"
                     /note="similar to uniprot|P14680 Saccharomyces cerevisiae
                     YJL141C YAK1 Serine-threonine protein kinase that is part
                     of a glucose-sensing system involved in growth control in
                     response to glucose availability"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08096p"
                     /protein_id="XP_002770772.1"
                     /db_xref="GeneID:8998915"
                     /db_xref="GOA:B5RUC0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B5RUC0"
                     /translation="MSYNFNYNRHNSLGGNWQLPPPYGLNGSEQTPPLADNTPGVQDP
                     QRTAQSNQMPGFRNPWYTSNQAPSGMVTSPNMSQSPTKGQQTIPLLQQQSKRMSFANQ
                     LPTTYEYDGQRPSNAPPFIHPPTRVDNPFNQYYTNQEVNLGHVDRRMSAVADGAYYSA
                     NSYNAYPPESSDPEFQSQYMQNVPLYDQGLNRRSSVATGNYHQAPHNTHVNYHHQPAK
                     VGRSASIVQYQQYQQALQNQSQTSKRNAAPKARKIYNKYDLHPKVHHQPKYRRCSVNS
                     IHISPVNALSVYITESYRICQPKKFQYCKSTNPKRVLTKPSDAKYNNGFDNEDSDYIL
                     YVNDILGTDEGRKYIVLDLLGSGTFGQVVKCQNLTNQSVCAIKVIKSKPAYMNQSLTE
                     VKLLEYLNSNSNSKRFIRLLDTFMHKEHLCLVFELLASNLYELIKQNQFQGLNMKLVK
                     LLTRQLLEAMAELKGFQMIHCDLKPENILLFQPDKPDIKVIDFGSACFTRQTVYSYIQ
                     SRFYRSPEVILGLPYTESIDMWSLGCIVGELFLGLPMFPGTSEFNQIWKIVDMLGYPP
                     RHMIEVGRNSLNFFNKFPPSIPDGKPVFKVKTLEEYIQFLATTKGKEDQVKKEQPNKN
                     YFKHRLLKDIIMNYKLPSKKMTNSMIEKECQERLLLIDFLSKVLNLNPLERLTPQEAL
                     KHPFVSDVSLHHPSTSSTASSGDRSSNHSDLSDNLKDAGKAPTGGISDSSRAPIPS"
     gene            complement(<701221..>702315)
                     /locus_tag="DEHA2F08118g"
                     /db_xref="GeneID:8998916"
     mRNA            complement(<701221..>702315)
                     /locus_tag="DEHA2F08118g"
                     /product="DEHA2F08118p"
                     /transcript_id="XM_002770727.1"
                     /db_xref="GeneID:8998916"
     CDS             complement(701221..702315)
                     /locus_tag="DEHA2F08118g"
                     /note="similar to uniprot|Q7S4H9 Neurospora crassa
                     NCU08171 Hypothetical protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08118p"
                     /protein_id="XP_002770773.1"
                     /db_xref="GeneID:8998916"
                     /db_xref="UniProtKB/TrEMBL:B5RUC1"
                     /translation="MRLLSFVIILSWISWVVAESCTGEQKLNLEDFQFVEHSNENLDG
                     LSEKLKSREVSLTKVIEDGNHKLTKASPWEYSAVKDAIQWESKDGFDDLNTKKWVPQG
                     ISSSADAYDKGDWNGKEAWIVSWHNEDDTSVRVTFVDKETNKYRHVLLVYPTAKDDFG
                     PVQIHAGGIAWYGDKLYVVDTDIGLRMFDLSTIWEVDDGSKIGKDGTKYTAASYKYVI
                     PQISYYKLTPQRDFKFSYVALDRTSTPYSLIVGEYRTASSGKKTRLVKWNLDSENRKL
                     KSKTASFGYCIGQPRMQGAVSVGEKVYISVSNEKNPGDLYTWTAGSKPKRESSFFPPS
                     PEDLAYNKHGNELYGLTEGIGKRYILTYGL"
     gene            <703726..>704301
                     /locus_tag="DEHA2F08140g"
                     /db_xref="GeneID:2903331"
     mRNA            <703726..>704301
                     /locus_tag="DEHA2F08140g"
                     /product="DEHA2F08140p"
                     /transcript_id="XM_460714.1"
                     /db_xref="GeneID:2903331"
     CDS             703726..704301
                     /locus_tag="DEHA2F08140g"
                     /note="similar to uniprot|P20433 Saccharomyces cerevisiae
                     YJL140W RPB4 RNA polymerase II subunit B32"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08140p"
                     /protein_id="XP_460714.2"
                     /db_xref="GeneID:2903331"
                     /db_xref="GOA:Q6BM57"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:Q6BM57"
                     /translation="MNVSTSALGVRRRKPTTQNIDDEENAATLSLGPEFQLTQLTNSG
                     EEEQLIALNLSEARLLIRAALKERKNKNQANSEFDDEDEDNVKEDEISNMDLAGPNSN
                     EIMHKTLNYLSNFSRFKNSSSTETVEKLLNDFNFSTSEPLHPFELAQLGTLECEDAEE
                     AKSLIPSLTNKVSDVQLQTLLTELRKYQTLS"
     gene            <704515..>707472
                     /locus_tag="DEHA2F08162g"
                     /db_xref="GeneID:2903332"
     mRNA            <704515..>707472
                     /locus_tag="DEHA2F08162g"
                     /product="DEHA2F08162p"
                     /transcript_id="XM_460715.1"
                     /db_xref="GeneID:2903332"
     CDS             704515..707472
                     /locus_tag="DEHA2F08162g"
                     /note="similar to uniprot|P36048 Saccharomyces cerevisiae
                     YKL173W SNU114 involved in splicing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08162p"
                     /protein_id="XP_460715.2"
                     /db_xref="GeneID:2903332"
                     /db_xref="GOA:Q6BM56"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM56"
                     /translation="MDEDELYDEFGNLIGDPLDSDADSLDEIPEEQDVQSEKEAEDLI
                     VETGDEALVIHANNGNGLKLSEKFGPGVETIIAKPYEQAVDTPVIKPMNKKKLKVEFT
                     EAVTNNVDENDHRVKNLPELVYSRDYMISTMNSLPERVRNIAVIGNLHSGKTTFIDML
                     VLQTHSPSISLSSSLKNFQPLRFMDNHKLEIDRGISIEASPITLLLPDLNDKSFVFNI
                     IDTPGHSNFASESTSALQIVDGALLVIDVVEGLTPRDKSLISELMKNNKPITIVLNKI
                     DRLILELRLPVEDFYFKISYTLDDINNFINENEYVSTYKQQMVFSPTDGNVIFASSSL
                     EFVFTLDSFTKLYADNHKLQGVDSQEFSRRLWGDVFYNQDKAQFVNSSNNGKFSRSFN
                     FFISEPIYKIITQTLTYDGSSKNLAQLLWNNFKVSLHNAQYKQDSQMLLKEIFKSVFS
                     GSKGFVDSVVHNIPSPIETASDRLELLSGSDNLPSARLIAQANKLIASADGERFYTLV
                     RIYQGSIKAGSKVRVLGQNFDEDDDDYKIEVIDELFIPGGRYKIPVKEAFAGSIVIIS
                     GIDSIISKGATIYDNADFNSDSKIFRPLSYERQSIFKIAIEPANPSELPKLLEGLRKL
                     NKSYLACTIKVEESGEHVLFGPGEIYLDCMLHDLRNFFTDDLEIKVSDPMTRFSETCI
                     DTSVTKISAKSSSGNNSISIISEPVDDSRLSLAIENGKINLSQPLKTTSKILRKEYGW
                     DALSARSVWCFGPEDLHNPSILIDDTIEGETDKKLLYSLKDSISLGFKWSVNEGPLCD
                     EPIRNTKFKILDAVISGSEIQRSGTQIIPMTRKACYTGFLTSSPRLMEPIYTVYVTCS
                     YQAIVAVKKLLDRRRGMVTTENPVPGTQLFHIEGQVPVIESIGLESDLRLQTQGQAMC
                     FLVFERWDVVPGDPLDSDCYLPQLRPVPNASLARDFVMKTRKRKGLSGEPNLQKYIDI
                     ELYNKLRESGVIE"
     gene            complement(<707546..>709195)
                     /locus_tag="DEHA2F08184g"
                     /db_xref="GeneID:2903333"
     mRNA            complement(<707546..>709195)
                     /locus_tag="DEHA2F08184g"
                     /product="DEHA2F08184p"
                     /transcript_id="XM_460716.1"
                     /db_xref="GeneID:2903333"
     CDS             complement(707546..709195)
                     /locus_tag="DEHA2F08184g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08184p"
                     /protein_id="XP_460716.1"
                     /db_xref="GeneID:2903333"
                     /db_xref="InterPro:IPR018822"
                     /db_xref="UniProtKB/TrEMBL:Q6BM55"
                     /translation="MYKVSEYSNNNHEREDASTKEERTAIEIDTGDAFQDNDYNMSAD
                     EDIAEKPGDSINEGERIDEIEDKLLSSGDEDLGAEMHKIGTEVGGDSYRNSVVEFYSE
                     DEIENLEEDEQTSDKETENIIEDEKSDYLSNDSVVELDELNNFEDHDDVQEIPPPNNS
                     LHKREDSGYNNQETLEVREHEELVEDDQDEYDQDENGQDENGQDENADDKIKEIEVNA
                     GGANQEIFEELDNEGFDKSEHDEIKEGREENDVKHEKENDDERGDEQRKKEEEELEEK
                     EIEVQGEQQEDDDGKPVNEQVGYREVRKNENSIHGETVIEGIIEYGNDEKDEVRPDEE
                     NIPASSNINVQSKMPNSKLESTFPIIINIAETEFLLVPFDNHRNPEIDVSHLVSLYDD
                     NEILKLTIEEFFGLMRTNEDLNEIHQFTVNKELVLVIPELNLSITEDNIYSRDITIED
                     FIVSFENLNSNSINDGEELIHKSLSFLLTSQTRFITNFNNLTESIRRGKGFNCVSLEN
                     SVYEPIAIAPEARTEDSHKRQSLDSSDETDAQQTKRAKVSI"
     gene            complement(<709435..>711939)
                     /locus_tag="DEHA2F08206g"
                     /db_xref="GeneID:8998917"
     mRNA            complement(<709435..>711939)
                     /locus_tag="DEHA2F08206g"
                     /product="DEHA2F08206p"
                     /transcript_id="XM_002770728.1"
                     /db_xref="GeneID:8998917"
     CDS             complement(709435..711939)
                     /locus_tag="DEHA2F08206g"
                     /note="weakly similar to uniprot|P32591 Saccharomyces
                     cerevisiae YJL176C SWI3 transcription factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08206p"
                     /protein_id="XP_002770774.1"
                     /db_xref="GeneID:8998917"
                     /db_xref="GOA:B5RUC2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:B5RUC2"
                     /translation="MSSDEHLDHLQEDKDDDIVAGSPEGSQKQGSEAPEVAEEGAKPE
                     TGASEENSDVDMEGDNLSDAAKSNDDETGDKDTGNQDIKNSVEKNSEVKEEDESREEQ
                     NDSDAPSKNEPMDVDEVQDDKEPQEESDKEEIQNDESEKEKSEAVQDIEDNHTQDIEE
                     KVKDEADDEEEKKDEQDEEKKDEQYKEEDRDENVDDKDEDKDDEDKDDEGDDDEDDDD
                     KVKDAENQTPIDQTHAIILPSYCSWFNMSKIHKIEKESLPEFFDTTHPSKSPKIYINY
                     RNFMINSYRLNPNEYLTLTSCRRNLVGDVGTLMRVHRFLNKWGLINYQVNPNFKPGYA
                     LEKLPNGSQIGLPYTGNFHVTYDTPRGLFPFDTHKFNEDRVDVSKLKKLLNIEQVSDK
                     PINNKMSSDAKNVDDLDTDSSEPPQKKHKSSKDGWTDKEISKLILGVKDFPNDWYKIS
                     KSVSTKTPQECILKFLKLPIEDNFNDLTDQELGFLKYSSNFPISSIDNPVISNLAFMT
                     QLVDSDVAKAASERACKVMDIKALEKIREVYGEADQTKADSVKQNEKKPEESEINKDL
                     DDSSENKQENESKFSPKKDTDTEMSIDDEKESTIGDNKHDEEIKSNGTSEQNGNVDNI
                     SPKPQADVDLIDEYNDENTDPLQVIKDASSNTFGIVGARSHLFANYEERELNKLTNTI
                     VNNQISKLDLKLNKVDELEKVYEKERKHLAKQQEEVFIDRLALTKSTIHITKKLNDAI
                     SMIQQKTENISELGDVSSILSDVQSLLYKPNRHSLIQNAVEKQSSDSNDKSDNGSSKD
                     TENRNINSNSSAANKENNAVKPLSLDTPSSFKVWVP"
     gene            <713634..>714264
                     /locus_tag="DEHA2F08228g"
                     /db_xref="GeneID:2903335"
     mRNA            join(<713634..713942,714016..>714264)
                     /locus_tag="DEHA2F08228g"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_460718.1"
                     /db_xref="GeneID:2903335"
     CDS             join(713634..713942,714016..714264)
                     /locus_tag="DEHA2F08228g"
                     /note="highly similar to uniprot|P46990 Saccharomyces
                     cerevisiae YJL177W RPL17B Protein component of the large
                     (60S) ribosomal subunit nearly identical to Rpl17Ap and
                     has similarity to E. coli L22 and rat L17 ribosomal
                     proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_460718.1"
                     /db_xref="GeneID:2903335"
                     /db_xref="GOA:Q6BM53"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /translation="MVRYAATSANPAKSASARGSYLRVSYKNTRETAQAISGWKLERA
                     QKYLDQVLDHQRAIPFRRFNSSIGRTGQGKEFGVTKARWPAKSVNFIKDLLRNGQANA
                     ESKGLDASKLKVSHIQVNQAPKQRRRTYRAHGRINAYQSSPCHIELILTEENEAVEKA
                     DDSKKVRLNVRQRGRLATQKRVTAA"
     gene            <714722..>715006
                     /locus_tag="DEHA2F08250g"
                     /db_xref="GeneID:2903336"
     mRNA            <714722..>715006
                     /locus_tag="DEHA2F08250g"
                     /product="DEHA2F08250p"
                     /transcript_id="XM_460719.1"
                     /db_xref="GeneID:2903336"
     CDS             714722..715006
                     /locus_tag="DEHA2F08250g"
                     /note="similar to uniprot|P08525 Saccharomyces cerevisiae
                     YJL166W QCR8 Ubiquinol cytochrome-c reductase subunit 8
                     (11 kDa protein)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08250p"
                     /protein_id="XP_460719.1"
                     /db_xref="GeneID:2903336"
                     /db_xref="GOA:Q6BM52"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:Q6BM52"
                     /translation="MAGAGPKAYMGWWGNIGSPKQKYVTTYTVSPYATKPLKGALYNS
                     VFNVFRRVKNQTLFVVIPAVIVWNVWAQARDYNEYLYTKAGREDLEKANA"
     gene            complement(<715178..>716230)
                     /locus_tag="DEHA2F08272g"
                     /db_xref="GeneID:2903337"
     mRNA            complement(<715178..>716230)
                     /locus_tag="DEHA2F08272g"
                     /product="DEHA2F08272p"
                     /transcript_id="XM_460720.1"
                     /db_xref="GeneID:2903337"
     CDS             complement(715178..716230)
                     /locus_tag="DEHA2F08272g"
                     /note="highly similar to uniprot|P08524 Saccharomyces
                     cerevisiae YJL167W ERG20 Farnesyl pyrophosphate synthetase
                     has both dimethylallyltranstransferase and
                     geranyltranstransferase activities"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08272p"
                     /protein_id="XP_460720.1"
                     /db_xref="GeneID:2903337"
                     /db_xref="GOA:Q6BM51"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:Q6BM51"
                     /translation="MDKAAAKERFINEFDQLVEELKAILIGYKMPQDAIDWFVGNLNY
                     NTPGGKLNRGLSVIDTYCILNNTTANDLSSEEYSKVALLGWCIELLQAYFLVADDMMD
                     HSKTRRGQPCWYLNEGVGNIAINDSFMLEGALYILLKKHFRNEKYYVDLLDLFHEVTF
                     QTELGQLIDLITADEEIVDLDKFSLSKHSFIVIYKTAYYSFYLPVALAMFMSGINSEQ
                     DLKQVRDILIPLGEYFQIQDDFLDCFGTPEQIGKIGTDIKDNKCSWVVNQALLHANEE
                     QRKLLDENYGKKDDESEKRCKQLFKDLNIEKIYFDYEEDTGAKLRKQIEQIDESRGLK
                     KEVLTSFLNKVYKRSK"
     gene            complement(<716410..>717642)
                     /locus_tag="DEHA2F08294g"
                     /db_xref="GeneID:2903338"
     mRNA            complement(<716410..>717642)
                     /locus_tag="DEHA2F08294g"
                     /product="DEHA2F08294p"
                     /transcript_id="XM_460721.1"
                     /db_xref="GeneID:2903338"
     CDS             complement(716410..717642)
                     /locus_tag="DEHA2F08294g"
                     /note="similar to uniprot|P36049 Saccharomyces cerevisiae
                     YKL172W EBP2 Essential protein required for the maturation
                     of 25S rRNA and 60S ribosomal subunit assembly localizes
                     to the nucleolus"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08294p"
                     /protein_id="XP_460721.2"
                     /db_xref="GeneID:2903338"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:Q6BM50"
                     /translation="MAKGGKLRSSLKNQQLIESIDKSKSKPVVKKAEEIKEVEVQPLP
                     EQIKSSKPKKEKKEKKAKNQDDYQSEVLSKKEQRRLKKVQADESAPLVVEEEVEEELE
                     EGSDSEELDLEKLAASESESDINDDDSDEESDEEEEADEDEKDDEEEEEEEDIPLSDV
                     DIDDDADIVPHTKLTINNMAALKDSLARIELPWSKHSFQEHQSITSAEKTETEIKDIY
                     DDTERELAFYKQGLDAVKQGRAALTKLKVPFSRPMDYFAEMIKSDEHMDKLKSKLLTE
                     AANKKASEDAKKQRHLKKFGKQVQNSTLQERAKQKKETLDKIKSLKRKGASNELSNGD
                     DFQIALDEATSEDRGGDNKRRKPNSKRLGKDSKYGFGGKKRGSRTNDAESSADISGFS
                     SKKMKGKPRPGKSKRSKR"
     gene            complement(<717820..>719160)
                     /locus_tag="DEHA2F08316g"
                     /db_xref="GeneID:2903339"
     mRNA            complement(<717820..>719160)
                     /locus_tag="DEHA2F08316g"
                     /product="DEHA2F08316p"
                     /transcript_id="XM_460722.1"
                     /db_xref="GeneID:2903339"
     CDS             complement(717820..719160)
                     /locus_tag="DEHA2F08316g"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061W KTR2 Mannosyltransferase involved in N-linked
                     protein glycosylation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08316p"
                     /protein_id="XP_460722.1"
                     /db_xref="GeneID:2903339"
                     /db_xref="GOA:Q6BM49"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6BM49"
                     /translation="MHNRYYLIPILVCLWGVYYSIITHYISSNNHAYMFHNEDLNEIF
                     NPTKASWNISFPWIDRLPRFSGPNIKTVLQKKGSHKLSSNSYLPNDFPFRERSQIGQE
                     NATMVMLVRNRELRGALQSMRSLEDRFNRNYRYPWVFLNDEPFDTDFIEQTTLMASGK
                     TYYELIPSEDWQPPSFIDMDLMEKKLMKAHEDGVIYGGSWSYRNMCHFNSGFFYKQKR
                     LLDYEWYFRVEPDVKYMCDFQYDPFTVLRENNKIYGFVLTIHDYENTMPSLWPTVENF
                     MKDHKDLIHPNNSIDFITSNETSLNYDFELPESNTSYNLCHFWSNFEIGNLDFFRSEA
                     YETYFKYLDKTGGFFYERWGDAPVHSIGLNLLADKNRIHHFEDIGYFHVPYLACPTSI
                     DVLASKRCVCKTKGLENHDPETPHDIQPFSCLSRWWRYGSGKTFLNDIDYTFNN"
     gene            <719650..>721560
                     /locus_tag="DEHA2F08338g"
                     /db_xref="GeneID:2903340"
     mRNA            <719650..>721560
                     /locus_tag="DEHA2F08338g"
                     /product="DEHA2F08338p"
                     /transcript_id="XM_460723.2"
                     /db_xref="GeneID:2903340"
     CDS             719650..721560
                     /locus_tag="DEHA2F08338g"
                     /note="some similarities with uniprot|P38126 Saccharomyces
                     cerevisiae YBR186W PCH2 Nucleolar component of the
                     pachytene checkpoint which prevents chromosome segregation
                     when recombination and chromosome synapsis are defective"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08338p"
                     /protein_id="XP_460723.2"
                     /db_xref="GeneID:2903340"
                     /db_xref="GOA:Q6BM48"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM48"
                     /translation="MNSNNNLDIEVCLRPWVTLLPFYNFHTKAYEENETSVDFAKIIK
                     QLKVSLTFYLGKAIDLQLNTNVNIKPTKINGKAFQKYFNMDFLQEKEISSEKGACLLL
                     YTLDENNQFDSFQNRIIAEGCFKEISIGSDIQGRSYYRHMGKDYSNSIKGILFKGSHA
                     DTKEEVYFSVPPFLHQQKSSMNFKSLKPQSTETIKTNKNGVWKDCLFVDKTNSVSQKC
                     LLTDSVNPTYLFYQCPEEQVKELENKQLNSVWDIINVYNDYIEDKEIIDIECQFRNTC
                     FEKKDPERRNPRKIYEDSSLDEEVESEQTNNTSFGYSKIFQPKLANALLELNRSIPME
                     IISMRASDFVTITPLPDNKLIGSWEKLKMKGNLKQSIYTNVQVSLTLSNMFEHDNRFA
                     GELLTASDKLILLHGPPGTGKSSLAKAIFQKFSVKAISSMKEPIDLPPILLLELAPDR
                     IYSRYYGESPKKLSMLFSTIEATLKKEMHGGFIFMIIDEIESLATERSMLLANNETTD
                     GVRMVNILLTHLDKLRHYKNFFMIGTSNLIESVDRSFKDRANALYELPLPNEETIYSI
                     LEQQIIHFLDLGVLYQNSGPNSISCTTPTLSGSLLSQYSSRLLCQIAAYCSVSIPFCI
                     HEKCTKLTNDHF"
     gene            <721912..>723375
                     /locus_tag="DEHA2F08360g"
                     /db_xref="GeneID:2903341"
     mRNA            <721912..>723375
                     /locus_tag="DEHA2F08360g"
                     /product="DEHA2F08360p"
                     /transcript_id="XM_460724.1"
                     /db_xref="GeneID:2903341"
     CDS             721912..723375
                     /locus_tag="DEHA2F08360g"
                     /note="highly similar to uniprot|Q9UUU2 Yarrowia
                     lipolytica YALI0B20372g nubm NUBM protein precursor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08360p"
                     /protein_id="XP_460724.1"
                     /db_xref="GeneID:2903341"
                     /db_xref="GOA:Q6BM47"
                     /db_xref="InterPro:IPR001949"
                     /db_xref="InterPro:IPR011537"
                     /db_xref="InterPro:IPR011538"
                     /db_xref="InterPro:IPR019554"
                     /db_xref="InterPro:IPR019575"
                     /db_xref="UniProtKB/TrEMBL:Q6BM47"
                     /translation="MIHNLKTQQRSLRRGLATIADATNPNRVHGGLKDQDRIFQNVYN
                     KYGHDLKSAQKMGDWYKTKEIILKGDKWIIDEMKKSGLRGRGGAGFPSGLKWSFMNPP
                     GWEKNPGPRYLVVNADEGEPGTCKDREIIRKDPHKLVEGCLLAGRAMNATAAYIYIRG
                     EFYNEAVILQQAINEAYKEGLIGKNACGSGYDFDVYIHRGMGAYICGEETALIESLEG
                     KAGKPRLKPPFPAGVGLFGRPSTVTNVETVAVAPTILRRGGDWFASFGRKNNTGTKLF
                     CISGHVNEPCTVEEEMSIPLKELLEKHCGGVKGGWDNLLGVIPGGCSVPVMPKSVCDD
                     IAMDYDALRDVGSGLGTAAVIVMNKETDMIRAIQRFAAFYKHESCGQCTPCREGTTWL
                     QKMMDRFVKGQATEKEIDMIFELTKEIEGHTICALGDAAAWPIQGLIKSFRPLMVDRI
                     KQYEQESQCSVSYGGWVKGGKVKEGKVIDNPLPSAHH"
     gene            <723793..>724800
                     /locus_tag="DEHA2F08382g"
                     /db_xref="GeneID:2903342"
     mRNA            <723793..>724800
                     /locus_tag="DEHA2F08382g"
                     /product="DEHA2F08382p"
                     /transcript_id="XM_460725.1"
                     /db_xref="GeneID:2903342"
     CDS             723793..724800
                     /locus_tag="DEHA2F08382g"
                     /note="weakly similar to uniprot|P38301 Saccharomyces
                     cerevisiae YBR187W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08382p"
                     /protein_id="XP_460725.1"
                     /db_xref="GeneID:2903342"
                     /db_xref="GOA:Q6BM46"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="UniProtKB/TrEMBL:Q6BM46"
                     /translation="MKLGQLIILSSILLGTTVSLDNGGSQGSAAGLEKSSGLEISNLD
                     MKSGKGAANIGVKEIEENDNNPTPIDAKRPLDPPVGDEQEGTGEENPSYNSFLMSISM
                     IIVSEIGDKTFLIAALMAMRNSRFIVFSAAFSSLAVMTVLSGIVGHALPALISQRLTQ
                     FLASILFIVFGLKLLKEGLEMSKELGVEEELAEVEEEIASNNLNNEMENMEGGSSNKF
                     TAKSQNKKWYVEFGDQIRNLASFVLSPVWIQVFVMTFLGEWGDRSQIATIAMAAGSDY
                     WYVILGAIIGHGVCTAAACVGGKLLATRISMRNVTLGGAIAFFVFAILYFYDALYNTE
                     A"
     gene            complement(<724888..>725565)
                     /locus_tag="DEHA2F08404g"
                     /db_xref="GeneID:8998918"
     mRNA            complement(<724888..>725565)
                     /locus_tag="DEHA2F08404g"
                     /product="DEHA2F08404p"
                     /transcript_id="XM_002770729.1"
                     /db_xref="GeneID:8998918"
     CDS             complement(724888..725565)
                     /locus_tag="DEHA2F08404g"
                     /note="weakly similar to uniprot|P38304 Saccharomyces
                     cerevisiae YBR193C MED8 Member of RNA Polymerase II
                     transcriptional regulation mediator"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08404p"
                     /protein_id="XP_002770775.1"
                     /db_xref="GeneID:8998918"
                     /db_xref="GOA:Q6BM45"
                     /db_xref="InterPro:IPR019364"
                     /db_xref="InterPro:IPR020178"
                     /translation="MNSIHSANSNTVSTSEINTSQIPTDSLESIRNRLNQVHLSLRKL
                     SDQINHHNRHPNKVKLPNYAQFQNQFQVLLTQLHTITSDLENNDELLKNTNVYPLPSF
                     PTTQQEGLITTLLRKKPLPEVDEWIESAIDKRKNEYVNVQKDDEFAQWCLTKIEELRE
                     DFQFYGFNSVEELKYLDSEDEKKETEENKKIENQKYEEELKITAGGKSGLHPNRVLKF
                     MCQGVLT"
     gene            <725704..>726501
                     /locus_tag="DEHA2F08426g"
                     /db_xref="GeneID:8998919"
     mRNA            <725704..>726501
                     /locus_tag="DEHA2F08426g"
                     /product="DEHA2F08426p"
                     /transcript_id="XM_002770730.1"
                     /db_xref="GeneID:8998919"
     CDS             725704..726501
                     /locus_tag="DEHA2F08426g"
                     /note="similar to ca|CA2329|IPF4784 Candida albicans
                     IPF4784 unknown Function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08426p"
                     /protein_id="XP_002770776.1"
                     /db_xref="GeneID:8998919"
                     /db_xref="UniProtKB/TrEMBL:B5RUC4"
                     /translation="MIRQNYSLANELKDKERKQQSKVQQRQKRQFKTEKLSAADPIRI
                     FRQIERLESNNDKTERDLSYLKNLKNDWEFIKKNGLHKAKVESFLIQKEQEEKAKVKA
                     NSKLWGSKSIYFNPELNPLGKVPGENLSEKPIFQLPNHTKPLKSHVYTNYAKDPLIDT
                     LELVLPEGEPPKFYKMVQNTQRDNTTSNVPSSNTTNAPSAGEVISSSEKGINMLVPSA
                     LLKKPNKKESDHNSREDEYDNENDFAPEEEEYLIAIGKLPSKRSRIS"
     gene            complement(<726651..>727748)
                     /locus_tag="DEHA2F08448g"
                     /db_xref="GeneID:8998920"
     mRNA            complement(<726651..>727748)
                     /locus_tag="DEHA2F08448g"
                     /product="DEHA2F08448p"
                     /transcript_id="XM_002770731.1"
                     /db_xref="GeneID:8998920"
     CDS             complement(726651..727748)
                     /locus_tag="DEHA2F08448g"
                     /note="similar to uniprot|P38127 Saccharomyces cerevisiae
                     YBR192W RIM2 Protein of the mitochondrial carrier (MCF)
                     family that is required for respiration"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08448p"
                     /protein_id="XP_002770777.1"
                     /db_xref="GeneID:8998920"
                     /db_xref="GOA:B5RUC5"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B5RUC5"
                     /translation="MGSSRNEKLHNLEEDAKSSFPYLASDEKSSTIRNPEKLEYTKGT
                     IEPKSQTKPWVHFVAGGIGGMVGAVATCPLDVVKTRLQSDVYHSTYNKTPKSSNPVIK
                     AAQHFKETGTVIRGLYANEGTRALFKGLGPNLVGVIPARSINFFTYGATKDFISSNFN
                     NGQEETWIHLVSGINAGFVTSTATNPIWLIKTRLQLDKTKGKHYKNSWDCFKNVIKHE
                     GVKGLYKGLSASYLGGVESTLQWVLYEEMKSIINKRSIEAHGLRAENKTTKDYILEWS
                     ARSGAAGAAKFIASLITYPHEVVRTRLRQAPLESTGKPKYTGLIQCFKLVIKEEGLAS
                     IYGGLTPHLLRTVPNSIIMFGTWEIVVRLLS"
     gene            complement(<728006..>733777)
                     /locus_tag="DEHA2F08470g"
                     /db_xref="GeneID:8998921"
     mRNA            complement(<728006..>733777)
                     /locus_tag="DEHA2F08470g"
                     /product="DEHA2F08470p"
                     /transcript_id="XM_002770732.1"
                     /db_xref="GeneID:8998921"
     CDS             complement(728006..733777)
                     /locus_tag="DEHA2F08470g"
                     /note="similar to uniprot|P32333 Saccharomyces cerevisiae
                     YPL082C MOT1 Essential abundant protein involved in
                     regulation of transcription removes Spt15p (TBP) from DNA
                     via its C-terminal ATPase activity forms a complex with
                     TBP that binds TATA DNA with high affinity but with
                     altered specificity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08470p"
                     /protein_id="XP_002770778.1"
                     /db_xref="GeneID:8998921"
                     /db_xref="GOA:B5RUC6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022707"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B5RUC6"
                     /translation="MSRLDRLVVLLETGSTPFIRNTAADQLSDLAKGHPEETINLLGR
                     VYPYLKSTKWETRVTAARAFGGIVNHSELWDPNCSDTIKKEHEFEEKEETIVKIEELD
                     EASRIKLEQDEELKKIDDNLSNLVDFNSWNLHEILKSNVKLLACGTDEFEPSNGTGQH
                     PDDNSTFIGKLKKQKSNITPVEETEVKPDPEVKTEHIEAVSVSCDNSDSNSPRPDSSR
                     TASNARLKAMQKRRAKVNAKSGAIRVKPVDISQSSISRKLVENGEGTDEIMEDSAQYD
                     ITSQQGGEKLVFETKAPELSPLLSQHAKVAGLVWQFQGVYELLVADLFDEKWEIRHGS
                     ALGLRELIRKHGKGAGRVMNKSKEDNDRNNSATLEDLAVRLCTLFALDRFGDYVSDTV
                     VAPVRESSAQTLAALLIHLDDQVVLRTFDSLNKLVLQDHANDLGVPKCWEAKHGGMLG
                     VRYFVSVRTDVLLSRPESLDTVVNMVLHGLQESDDDVQSVAALTLTPIASQFVKTKQE
                     LIHTLLSVIWDCLTNLRDDLSASIGSVMDLLAKLCTHKEVIAIMQKDAIESNSNSFEY
                     LVPRLFPFFRHSITNVRKAVLRTILEFLSIGSDVTKKWINSKALRLIFQNLLVEQNKD
                     VLELSVLVYNKLLKEIDQNNELESMETIFGCHFQPLLTLLMTPIGIARHNYHMNTNLI
                     MRPSGHILGSLEDGSAVSTPIEDDTNLDPLEPNGVEKRGRKRKSPNETKVKSDFPFHE
                     DLKVNIDAPIFKGDVMLVGFETFIRTRSEAATAYGNSLSYITNEETLQNIFQLLLHYL
                     SSPHATPRLFSALVIQEFANSLKSRDMSPPETAIALFQESLMNVLSNPDNSTLPYYRE
                     LVPTLKSVRTSCLQMFDAFITSAKVSPTKIPQLPVVVQGENEAGPGAFGLEFAEKIVN
                     ETYQKLMKNLSPTYRMSANQTLEDSKHRITVAIQEANTARTHRTTGILSVYAAAVLAL
                     NGIPKKLNPIIRSLMDSVKQEESGILQQRSAIAVAHLIKELNIAGKKGAADKIVKNLC
                     AFLCVDTSEVPEFYHNIKFKDYILSLRKEEAKTDPADIAAHERAIIEARIKRNGALMT
                     LEALLSIYKSNLFEEVSKLKELMLEPLNLLKISSTNEVIEDVLKGQSIIDALGVLRAL
                     LPKLDSSLYPEIIERLPLLIPGLSSDFSVFRYSTAKCFATISSICPTKAFTFLVKSIL
                     PMLNNAGEVKERQGAIESIYHLSSTMGSDILPYIVFLIVPVLGRMSDTDQDVRILATT
                     TFASIIKLVPLEAGIPDPADMPQELLEGRDRERDFIQQMMDPTKVKSFDLPVSIKATL
                     RKYQQEGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIVASDHYMRAERFKETQSAEF
                     RRLPSIIICPPSLTGHWEQEYNQYAPFLKVIVYAGAPSIRSAIRSQIHDADIVVTSYD
                     VCRNDVEFLANHDFNYCVLDEGHIIKNAASKLTRSVKRIRGEHRLILSGTPIQNNVLE
                     LWSLFDFLMPGFLGTEKVFHEKFAKPIATSRSSKTSSKEQEAGALALESLHKQVLPFM
                     LRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYKDFAKKQKSTVVDEVQSEGDEAKEGK
                     THVFQALQYMRKLCNHPALVLSPDHPKFAEVSTYLQSHKSDIRSIEHSPKLMSLKNLL
                     LECGIGVNDNDYLSANYKQKQKQQQMITSEGVISEHRALIFCQLKDMLDIVENELLKK
                     YLPSVTYTRLDGSTDPRDRQSIVRKFNEDPSIDVLLLTTKVGGLGLNLTGADTVIFVE
                     HDWNPMNDLQAMDRAHRLGQKKVVNVYRLITKNTLEEKIMGLQKFKMNIASTIVNQQN
                     SGLASMDTNQLLDLFDVDENAAKLVEIGENNTDKKEENVPDDVAGGLTGKAAGAVGEL
                     ADLWDESQYEDEYNLDNFIKTLK"
     gene            complement(<734575..>735249)
                     /locus_tag="DEHA2F08492g"
                     /db_xref="GeneID:2903353"
     mRNA            complement(<734575..>735249)
                     /locus_tag="DEHA2F08492g"
                     /product="DEHA2F08492p"
                     /transcript_id="XM_460731.1"
                     /db_xref="GeneID:2903353"
     CDS             complement(734575..735249)
                     /locus_tag="DEHA2F08492g"
                     /note="highly similar to CA2332|IPF4792 Candida albicans
                     IPF4792 unknown Function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08492p"
                     /protein_id="XP_460731.1"
                     /db_xref="GeneID:2903353"
                     /db_xref="InterPro:IPR010422"
                     /db_xref="UniProtKB/TrEMBL:Q6BM40"
                     /translation="MAKKGVENTKKVAGNAKKAENANKKKQAQEAVLEEQEAGEWEQG
                     SKKANKKKEDEKFKKDEAARKKNEREALLKAEEASLPAKPLSAKQRGAAKVASRRTGK
                     IDDFLSDNKDTPELSASGIDDALSALALTGRDGGVQTKDIDKHPERRVKAAYAAYEEK
                     RLPEMRKEEPGLRLQQMKNLIFKEFQKSPENPMNQDTNIKYNATRDEVDQLKTNVKSK
                     RQEKFA"
     gene            complement(<735623..>736885)
                     /locus_tag="DEHA2F08514g"
                     /db_xref="GeneID:2903354"
     mRNA            complement(<735623..>736885)
                     /locus_tag="DEHA2F08514g"
                     /product="DEHA2F08514p"
                     /transcript_id="XM_460732.1"
                     /db_xref="GeneID:2903354"
     CDS             complement(735623..736885)
                     /locus_tag="DEHA2F08514g"
                     /note="highly similar to uniprot|Q12122 Saccharomyces
                     cerevisiae YDL131W LYS21 Homocitrate synthase isozyme
                     catalyzes the condensation of acetyl-CoA and
                     alpha-ketoglutarate to form homocitrate which is the first
                     step in the lysine biosynthesis pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08514p"
                     /protein_id="XP_460732.1"
                     /db_xref="GeneID:2903354"
                     /db_xref="GOA:Q6BM39"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6BM39"
                     /translation="MSIQSNPYGPNPSDFLSNVNKFEVIESTLREGEQFANAFFSTEK
                     KIEIAKALDDFGVDYIELTSPVASEQSRSDCEAICKLGLKAKILTHIRCHMDDARVAV
                     ETGVDGVDVVIGTSQFLRQYSHGKDMNYIAQSAIEVIEFVKSKGIEIRFSSEDSFRSD
                     IVDLLNIYRTVDKIGVNRVGIADTVGCANPRQVYELVKTLKSVVSCDIECHFHNDTGC
                     AIANAYTALEAGAKLIDVSVLGIGERNGITPLGALMARMITADRDYVLSKYKLHKLRD
                     LENLVADAVQVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPSDFGLTRYIH
                     FANRLTGWNAIKSRVDQLNLHLTDDQCKEVTTKIKIMGDVRQLNIDDVDSIIKDFHAD
                     LSTPLLKPQAEGDKDVTEEPVSKKQKSG"
     gene            complement(<737359..>738207)
                     /locus_tag="DEHA2F08536g"
                     /db_xref="GeneID:2903355"
     mRNA            complement(<737359..>738207)
                     /locus_tag="DEHA2F08536g"
                     /product="DEHA2F08536p"
                     /transcript_id="XM_460733.1"
                     /db_xref="GeneID:2903355"
     CDS             complement(737359..738207)
                     /locus_tag="DEHA2F08536g"
                     /note="some similarities with CA2913|IPF11205 Candida
                     albicans IPF11205 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08536p"
                     /protein_id="XP_460733.2"
                     /db_xref="GeneID:2903355"
                     /db_xref="UniProtKB/TrEMBL:Q6BM38"
                     /translation="MITIVDNDYSSKSTISTNTILKPYPMDDILQVNQYVENTSTTQK
                     LINNDDVEDVPLLVSDSEDVSDGEDCSTQSVNGHESDVNVKASIAAEQVKRDMKLSVQ
                     EPEVNSEKQELTKEQFRNERNQLMTIVVKYIATKITNSFPPQYPPVPNSSEVPLDRFL
                     LILTNRLQLSLPLFMKGIIYLFRYMDIIYLLRYLNQSNNFANYNEMDFCLKKLIVGCF
                     KLALSREKITKNWSAISGMSNGEINTIVKTIVTRMNGKLVVKNIDLLKLKSEIFRFVK
                     MVTNPI"
     gene            <739113..>740705
                     /locus_tag="DEHA2F08558g"
                     /db_xref="GeneID:2903356"
     mRNA            <739113..>740705
                     /locus_tag="DEHA2F08558g"
                     /product="DEHA2F08558p"
                     /transcript_id="XM_460734.1"
                     /db_xref="GeneID:2903356"
     CDS             739113..740705
                     /locus_tag="DEHA2F08558g"
                     /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
                     YOR241W MET7 Folylpolyglutamate synthetase catalyzes
                     extension of the glutamate chains of the folate coenzymes
                     required for methionine synthesis and for maintenance of
                     mitochondrial DNA present in both the cytoplasm and
                     mitochondria"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08558p"
                     /protein_id="XP_460734.2"
                     /db_xref="GeneID:2903356"
                     /db_xref="GOA:Q6BM37"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:Q6BM37"
                     /translation="MSESDNNKLTPTIINDMRVPTPSTASRTYKDAINALNTLQSNFA
                     SIEAIKKLGPDVNKNEMSIREVYEYTRRLGYQPKDFNRMNLIHVTGTKGKGSTCAFAE
                     SILSQYRSTNSGPINKIGLFTSPHLKTVRERIRIDGSPINELKFTKYFFEVWDKLSTT
                     ESSATEFPTLQPSNVVKPMYFKYLTILSFHVFMSEGVDTAIYEVGVGGQYDSTNIIDA
                     PTVVGISSLGIDHTFMLGNTIDSITWNKTGIFKKGCPAVVSDQLEYPESLDVIKERAT
                     ELGVSRLEIVDTNYLPPNVKLGLAGDFQRSNAALAIKLATIHLQKLGVPSNELPDFDN
                     SNTLPDKFLKGLSDTQWSGRCQLIEKEGINWYIDGAHTLESINVASSWFKYTVNTKHQ
                     PNKGLKILLFNQQNRENANDLLRKLYGNVSSSEFKFDHVIFTTNITWSDGNYNSDLVS
                     LNSSKEQVDKLIIQKELAEVWSKLDQKNGYNSRKHIFHDIETSVNFIKSLTHDSPVID
                     VFVCGSLHLVGGFLVVLDNERD"
     gene            complement(<740922..>742133)
                     /locus_tag="DEHA2F08580g"
                     /db_xref="GeneID:2903357"
     mRNA            complement(<740922..>742133)
                     /locus_tag="DEHA2F08580g"
                     /product="DEHA2F08580p"
                     /transcript_id="XM_460735.2"
                     /db_xref="GeneID:2903357"
     CDS             complement(740922..742133)
                     /locus_tag="DEHA2F08580g"
                     /note="similar to CA2910|IPF11421 Candida albicans
                     IPF11421 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08580p"
                     /protein_id="XP_460735.1"
                     /db_xref="GeneID:2903357"
                     /db_xref="UniProtKB/TrEMBL:Q6BM36"
                     /translation="MPAVIVVDNELKDSVKEYGQIIDSVNESVELSKTLQSFFNDQSK
                     EIIDKPGLIKKIYETSTASNLTKLSDREFEPTFNLITYILSQLEGSFEKVLNKDSQII
                     QNLIECNPTKQPLLRDRKSIKSTTILSILNTFFNFLPETSSNRIHILTTILSIVEASN
                     IDYSLIQGPIGNSLVLWLTQANATDEEIKSIFWKFINLDDKKSYKSLQLIKSFTSKHT
                     LNLNELHKLIKFALLSSTTDVSFLVNNTVASALKENSSDELVSLFTKYTRGELITSVP
                     SSSGLSSEDVEQKSRILALGKFFIDNDNKNVFNYNEIPTALASSAEGFEALLINSIKA
                     GVIEGKLNQLDQTFYLTRVHRFIIAGDEESISKNWENVKNALVDWKNSLANIDDIVNT
                     SRENIVNNNNN"
     gene            complement(<742352..>745285)
                     /locus_tag="DEHA2F08602g"
                     /db_xref="GeneID:2903751"
     mRNA            complement(<742352..>745285)
                     /locus_tag="DEHA2F08602g"
                     /product="DEHA2F08602p"
                     /transcript_id="XM_460736.1"
                     /db_xref="GeneID:2903751"
     CDS             complement(742352..745285)
                     /locus_tag="DEHA2F08602g"
                     /note="weakly similar to uniprot|Q12152 Saccharomyces
                     cerevisiae YPL150W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08602p"
                     /protein_id="XP_460736.2"
                     /db_xref="GeneID:2903751"
                     /db_xref="GOA:Q6BM35"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BM35"
                     /translation="MNGSRVSDQNTKARLAAQFNQFYLQITSPEVTQIGNYQIIKEIG
                     EGAFGKVYLANHVLLNVQVVLKCGLIDDPNIVREVYYHRQLQHKNIVKLYEVIKSERH
                     LWMALEYCEGSELFYYIYEKRRLEYHETQNLFNQIITGVKYVHSLNLAHRDLKLENIL
                     LADSKRSIVKLTDFGFVREFNPVKRQFLSTVCGTTVYMAPELIKNQPYSGFAIDIWSL
                     GVILFTMLYGEMPFDEDDDLKTKYKIINEEPLYRDSIPQDAIELLRKMLSKDPRARPG
                     LSDISNSSFLIDISNKTSEKNNRSSFYNDQESILSISQHYSSEMQPFQSKMDRNLMRK
                     LDKLNIDIIQLQQDVLNGEKNPLTAFYELSLVREFTKKKKHYREKKRKYNEAKKSLIN
                     SRKKVKSALSLSEQGSGSQPLERIISSLSLSSNRNSISRTNLSKIGSRKSIEFSDPYK
                     KPRGSESNRNSLTGQRMSKTVSNLDHDYTPNSILEGTDSNIEVPLSKIVTFNQSEMKR
                     RPSNATTTLSSTTGSENSKKKIKNAKILNRLQFWKKNKNNNGLETARENTTKPTEPQY
                     GNGEKIPLISNGSSPSPKTNLNEINRNIVPIIETQDTTLVNENSIPNNENEIEAKNDL
                     IQEMDNNMEDSVFESPNRQATPTSENYPMSSKYLKTRPSSVVSQASQLSHLSQLSTMM
                     SETDLLGETDTMDEEEYDEDGIYESSLDNFQQDFPQRHSSVMTPTSGSSVTKKRPSYR
                     RTLSSDISIMSTSTAATGSNSAPAKSHHQKRSLSRLSSNSSEESYSQSRKNATMNGHL
                     FASPVPTVPMTDLASDINSSLSPVPNRPSSPDGTPPPKKMTFVNSKLLRHSRNTASQN
                     SIPSINKINSVPQPYQFLNDNEATTRSHSPPIPNKFNKLKSKNKPINNIQEQPYSSKF
                     SVKTTWPSKANQQENNDVNYRNMQSIDDNSVWNKNNNTAIGPMNGKNMYQANFIINEE
                     EEDEN"
     gene            <745742..>747973
                     /locus_tag="DEHA2F08624g"
                     /db_xref="GeneID:2903752"
     mRNA            <745742..>747973
                     /locus_tag="DEHA2F08624g"
                     /product="DEHA2F08624p"
                     /transcript_id="XM_460737.1"
                     /db_xref="GeneID:2903752"
     CDS             745742..747973
                     /locus_tag="DEHA2F08624g"
                     /note="weakly similar to uniprot|P32580 Saccharomyces
                     cerevisiae YPL029W SUV3 ATP-dependent RNA helicase
                     component of the mitochondrial degradosome along with the
                     RNase Msu1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08624p"
                     /protein_id="XP_460737.2"
                     /db_xref="GeneID:2903752"
                     /db_xref="GOA:Q6BM34"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM34"
                     /translation="MSSRLATIRSIGIAPKILGRCIKQFSTSYLLKNANVSNNLNKSS
                     NAWENIFKQINQTKPPNTNITNDLEPFDQLKEVVKKPLWQIYWKLVNREFEPPFSNMN
                     NLDNDRVNSLIWTFTEKLMLQFEIYLHNPLNCRPIPDIKLVDYINPKICNITQIIYSI
                     NNDMMPSQLPRFYGYNTKIECLNNILSKLIYKEYVESSLTHIKQQDSLVDLSNPAEWF
                     PEARKMKRKFIMHVGPTNSGKTYNSLRKLAKAKSGYYAGPLRLLAREIYERFHDQGIK
                     CNLITGEEVIPSIDSFGKISEISSGTIEMIPSHKKMDICIIDEIQMIADPRRGEAWTN
                     AVLGVQAKEIHMCGEESAVPLILKLAKITGDEVEINKYNRLGKLTVSDKEVSNFKNLQ
                     KGDCVIAFSKRKILELKCEIERSTNLKVGVIYGALPPEIRSKEANGFNSGQYDVLVAS
                     DAVGMGLNLKIKRIVFFATKKFNGNETIPLTASETKQIAGRAGRFSKDEGESEGFVTA
                     MYKKDLIFLKKMMNEPIQNLSKACTWPTDKVWTYYMSKFPKYTSFYDILAQFEKETSS
                     LEMENFFLTALDSRYEILNLFLRNDLYKKTTIEDQLRLSLAPVNINMSSPLVVDTAFK
                     FFQNITKCETKNIFDFNFLHTEILKRRPKFTATTESTVQTLQSLEENHKLVLIFLWLS
                     QRWPTLFVDKESATETKTLIEKRISEELLNLRRLIKHSRSAGVEPRRSNPKGFKFRAN
                     QQK"
     gene            <748135..>748701
                     /locus_tag="DEHA2F08646g"
                     /db_xref="GeneID:2903753"
     mRNA            <748135..>748701
                     /locus_tag="DEHA2F08646g"
                     /product="DEHA2F08646p"
                     /transcript_id="XM_460738.1"
                     /db_xref="GeneID:2903753"
     CDS             748135..748701
                     /locus_tag="DEHA2F08646g"
                     /note="weakly similar to uniprot|Q03786 Saccharomyces
                     cerevisiae YDR248C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08646p"
                     /protein_id="XP_460738.2"
                     /db_xref="GeneID:2903753"
                     /db_xref="GOA:Q6BM33"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR006001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM33"
                     /translation="MTTTPNTVIVVGGPAGTGKTTIAELLATHFQCPFIEGDALHPPQ
                     NISKMSEGIPLTDEDRWDWLKELTRASVGQCIDSTNKSNIAIVSCSILKKIYREYIKQ
                     CSGESSAGEIQFKFVFLHTTLEHLFERVQNRPGHFMKSDMVSSQYSIMEIPCDDELLE
                     NGGEALPVDTTNKSPQEIYKEVVSSLKL"
     gene            <748984..>749994
                     /locus_tag="DEHA2F08668g"
                     /db_xref="GeneID:2903754"
     mRNA            <748984..>749994
                     /locus_tag="DEHA2F08668g"
                     /product="DEHA2F08668p"
                     /transcript_id="XM_460739.1"
                     /db_xref="GeneID:2903754"
     CDS             748984..749994
                     /locus_tag="DEHA2F08668g"
                     /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
                     YOR246C Protein with similarity to oxidoreductases found
                     in lipid particles"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08668p"
                     /protein_id="XP_460739.2"
                     /db_xref="GeneID:2903754"
                     /db_xref="GOA:Q6BM32"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6BM32"
                     /translation="MTSFDPESISYFNPNVDRRVALITGGNSGVGWYTVLHLYLHGYI
                     VYIAARSKTRVNTSINELKEEAMVIRSKYTSQQSSNERFLGELYFLDIDLLSLSSVLN
                     AVKTFKSREKHLNILINNASVMALPYSITKDGFEIQMQTNYISPFLLTTKLLPLLESS
                     SELFPKSGPPKIIYLSSIGHQLAFKYFNLNSTFNYRPNIVFTWFRYGLAKTCGIHFMK
                     MLALRNPKILCMSVHPGFVMNTNLFSYWTRLPIIGILFWCLFQIFGFLFGVSSEQGSY
                     ATVRCCLDPKLSLEEDNGKYFATNGAEAEPSKIARNMNFAARTWIWTVQELSERKISI
                     PN"
     gene            complement(<750055..>751668)
                     /locus_tag="DEHA2F08690g"
                     /db_xref="GeneID:2903755"
     mRNA            complement(<750055..>751668)
                     /locus_tag="DEHA2F08690g"
                     /product="DEHA2F08690p"
                     /transcript_id="XM_460740.1"
                     /db_xref="GeneID:2903755"
     CDS             complement(750055..751668)
                     /locus_tag="DEHA2F08690g"
                     /note="similar to CA0289|IPF13333 Candida albicans
                     IPF13333 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08690p"
                     /protein_id="XP_460740.2"
                     /db_xref="GeneID:2903755"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:Q6BM31"
                     /translation="MTSLDPSYIWDSYNLDELNNQLIFEKETLSFTLLNVNFDEIEKI
                     HAHLKEFLDPFVEYYPWFHSPPVFQQYKHKQISYIYGEFIYQECLNDEWLLTNLLWEF
                     STFYPDLYIHLWDSSDFEFILVESSDLIPTWLEPNNSLNRAWINDKTVLIINPNQELN
                     NLTLEEALEELLDGNFRKYPAVADHLKDKLSKINESFLIDTIYDLETSLPSQVIQIFA
                     DKPYLISQSINEFVKESLSPSQNLKSIQNDSFIPTKIGIPFLSLNLMKFKQLELQTTN
                     ASDYDFGLLVSKILTIGVDNIMRSSDCLPRQASKRSNLSRSVIQDILIECGRLADRVP
                     ENTEIFQQFENMNEADVSSDFNESALIDRFNEFFKDTTAGLDGIDNASSNEETADRGQ
                     DEPENSKINDIEIDEDDFFEFFLKDALKLSDKDIDGFRNTDLPTNTKRKFKDFKEYSN
                     DSDYQTDTSTEYDDGEENDEIDAEYGDEDGDVDDEEEKYIKQFLQKLNGNNNIDGLTN
                     LFKSINTDIGPGSVLLQQVISQQQNKRKE"
     gene            complement(<751782..>752987)
                     /locus_tag="DEHA2F08712g"
                     /db_xref="GeneID:2903756"
     mRNA            complement(<751782..>752987)
                     /locus_tag="DEHA2F08712g"
                     /product="DEHA2F08712p"
                     /transcript_id="XM_460741.1"
                     /db_xref="GeneID:2903756"
     CDS             complement(751782..752987)
                     /locus_tag="DEHA2F08712g"
                     /note="similar to uniprot|P41338 Saccharomyces cerevisiae
                     YPL028W ERG10 Acetyl-CoA C-acetyltransferase
                     (acetoacetyl-CoA thiolase) cytosolic enzyme that transfers
                     an acetyl group from one acetyl-CoA molecule to another
                     forming acetoacetyl-CoA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08712p"
                     /protein_id="XP_460741.1"
                     /db_xref="GeneID:2903756"
                     /db_xref="GOA:Q6BM30"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q6BM30"
                     /translation="MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQI
                     KAEDVEEIIFGGVLQANVGQAPARQVALKAGLPESIVATTVNKVCASGMKSIILGAQT
                     ILTGTADIVVAGGAESMSNTPYYVPSARGGARYGDAVMVDGVQKDGLLDVYENKLMGV
                     AAEKCAKDHSFTRDDQDNFAIGSYTKAADAQNAGKFDNEIAPVTIPGKRGKPDVVVAN
                     DEEIKNFDEPRLRSARAVFQKENGTVTAPNASSLNDGGAAVILVSEKKLKELNLKPLA
                     KISGWGEAARAPIDFTIAPSLAIPKALKHANLSMDDIDFFELNEAFSVVGLANAKICN
                     IPSKKLNVYGGAVALGHPLGCSGARIVVTLLSVLAQEGGKIGVAGVCNGGGGASSIII
                     ERFDHDSKL"
     gene            <753317..>753973
                     /locus_tag="DEHA2F08734g"
                     /db_xref="GeneID:2903757"
     mRNA            <753317..>753973
                     /locus_tag="DEHA2F08734g"
                     /product="DEHA2F08734p"
                     /transcript_id="XM_460742.2"
                     /db_xref="GeneID:2903757"
     CDS             753317..753973
                     /locus_tag="DEHA2F08734g"
                     /note="weakly similar to uniprot|Q6LE92 Saccharomyces
                     cerevisiae YPL041C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08734p"
                     /protein_id="XP_460742.2"
                     /db_xref="GeneID:2903757"
                     /db_xref="InterPro:IPR018811"
                     /db_xref="UniProtKB/TrEMBL:Q6BM29"
                     /translation="MHQSPVVSLFRKNKKVEKVISGGSSVGGGVGDGLSGSVSHNQVS
                     NGNENMSVEKHPILKRMPKFMLPYTKNFIHAPVSHVTAFLILHELSAIVPLVGIWYVF
                     HKYQWSIPLDLPSWAIDKGTHIIDKSMAQFDFRNFSFQEKANFIMEGAYAYVIVKGLF
                     PVRIIFSVLSMPWFAKYFVIPFTRMFSFRKKKQPKVPEVESKKEGSEITQKKVTKPRL
                     "
     gene            complement(<754259..>755488)
                     /locus_tag="DEHA2F08756g"
                     /db_xref="GeneID:2903758"
     mRNA            complement(<754259..>755488)
                     /locus_tag="DEHA2F08756g"
                     /product="DEHA2F08756p"
                     /transcript_id="XM_460743.1"
                     /db_xref="GeneID:2903758"
     CDS             complement(754259..755488)
                     /locus_tag="DEHA2F08756g"
                     /note="weakly similar to uniprot|P38615 Saccharomyces
                     cerevisiae YMR139W RIM11 Protein kinase required for
                     signal transduction during entry into meiosis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08756p"
                     /protein_id="XP_460743.2"
                     /db_xref="GeneID:2903758"
                     /db_xref="GOA:Q6BM28"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BM28"
                     /translation="MSKIEVITENVNNGHTGELQTIQYTQSQMVGHGSFGVVFETQIL
                     PSNEIAAIKRVLQDKRFKNRELQIMKLVHHRNIVDLKYYFYTNNDKSELYLNLILEFV
                     PETLYKASHYYVSKRLSMPSLEVKLYTYQMLRALNYIHSQGICHRDIKPQNLLINPET
                     GELKLCDFGSAKILNPAEPNVSYICSRYYRAPELIFGATNYTTKIDVWSAGCVMAELI
                     LGQPLFPGESGIDQLVEIIKILGTPSKDQIKNMNPNYMEHKFPQIKPIPLQKIFKKMS
                     NDCIQFLIKVLQYSPHERISCITALADPYFNELRNQTTKLPNYRKLFSKQYHQNSTGG
                     NLNHHNNANYQLFNNQPDIRDLPQLFDFDDRELSVDPSLNHILIPEFALDSLKLSSGD
                     LQSFRPLTSEELKVTLD"
     gene            <755829..>755933
                     /locus_tag="DEHA2F08778g"
                     /db_xref="GeneID:8998922"
     mRNA            <755829..>755933
                     /locus_tag="DEHA2F08778g"
                     /product="DEHA2F08778p"
                     /transcript_id="XM_002770733.1"
                     /db_xref="GeneID:8998922"
     CDS             755829..755933
                     /locus_tag="DEHA2F08778g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08778p"
                     /protein_id="XP_002770779.1"
                     /db_xref="GeneID:8998922"
                     /db_xref="UniProtKB/TrEMBL:W0TYT2"
                     /translation="MLLAIGHCSALHHQDRPPMCADSWTDGKSRFIPR"
     gene            complement(<756398..>757249)
                     /locus_tag="DEHA2F08800g"
                     /db_xref="GeneID:8998923"
     mRNA            complement(<756398..>757249)
                     /locus_tag="DEHA2F08800g"
                     /product="DEHA2F08800p"
                     /transcript_id="XM_002770734.1"
                     /db_xref="GeneID:8998923"
     CDS             complement(756398..757249)
                     /locus_tag="DEHA2F08800g"
                     /note="weakly similar to CA1466|IPF13324 Candida albicans
                     IPF13324 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08800p"
                     /protein_id="XP_002770780.1"
                     /db_xref="GeneID:8998923"
                     /db_xref="UniProtKB/TrEMBL:B5RUC7"
                     /translation="MTSTIISKGINKLSLNSLGPPTDEDFIRNIDYDELEKKFHVRKY
                     YPQFIHNELATPNLKEMIADKPIYAKANDHLTKEQKREQIKELKRAYMREQKQIREQE
                     NLQRKREPVANRWCNGAATQRRASRPEQGTEDTRRPRQMPYEDVGVMNGQGPHDTTQH
                     EYKSTIGNLKGYSRHHSKHDMGFRNPFDSNQSTLIENDPTTSAVKTHRQNSIAGKLMN
                     FIKGRSDDESSDDNNLTLSKSYDQTKSSMTTTRKKPKSHSFKTKINELTNKKYTDNLG
                     MYFLRIF"
     gene            complement(<757376..>758347)
                     /locus_tag="DEHA2F08822g"
                     /db_xref="GeneID:8998924"
     mRNA            complement(<757376..>758347)
                     /locus_tag="DEHA2F08822g"
                     /product="DEHA2F08822p"
                     /transcript_id="XM_002770735.1"
                     /db_xref="GeneID:8998924"
     CDS             complement(757376..758347)
                     /locus_tag="DEHA2F08822g"
                     /note="weakly similar to uniprot|P43568 Saccharomyces
                     cerevisiae YFL029C CAK1 Cyclin-dependent kinase-activating
                     kinase required for passage through the cell cycle
                     phosphorylates and activates Cdc28p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08822p"
                     /protein_id="XP_002770781.1"
                     /db_xref="GeneID:8998924"
                     /db_xref="GOA:B5RUC8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B5RUC8"
                     /translation="MNQYGTKETIYSGPNAIVYKAIDRESQNIVALKVVDVDLCMKPH
                     DIRREITTLQRIHNKGVLQFINSYTHGDDIVLVTPCYSFDLDQWIKMCTKKRVKFNLD
                     DPTNNIIHYRNEFPTSKVENIISTLASTLRYLHDDEGIIHRDIKPSNVYFESEDSPPV
                     LGDFGIIYNTRDPPSDEPMDSKYTDVSTGIFKAPELCFGMADYTQAIDIWSLGIMLTL
                     LYSATGKSCIDEEGNFHDLTLISSIFSNFGTPSTSDASDKRLYWPDANRPSSHFNSFK
                     FTEKPRVPSDKLLPRCDNPNMLRIFDRMMVYQGNERITAKEILTCIE"
     gene            complement(<758720..>760138)
                     /locus_tag="DEHA2F08844g"
                     /db_xref="GeneID:2903762"
     mRNA            complement(<758720..>760138)
                     /locus_tag="DEHA2F08844g"
                     /product="DEHA2F08844p"
                     /transcript_id="XM_460746.1"
                     /db_xref="GeneID:2903762"
     CDS             complement(758720..760138)
                     /locus_tag="DEHA2F08844g"
                     /note="similar to uniprot|P39073 Saccharomyces cerevisiae
                     YPL042C SSN3 Component of RNA polymerase II holoenzyme
                     involved in RNA pol II carboxy-terminal domain
                     phosphorylation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08844p"
                     /protein_id="XP_460746.2"
                     /db_xref="GeneID:2903762"
                     /db_xref="GOA:Q6BM25"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /translation="MNSGYNPGNANHITSHSNRTKNGVPTIPQPALMASNAILTIGPY
                     KHRKDLIRESVLTKYQIIGYIAAGTYGKVYKAKSKTNGNSNSNSALMNDNVISIGNGQ
                     KEAGLQKTNNESMEDKNQLFAIKKFKSDNHSNKNNHDINGNEVIHYTGISQSAIREMS
                     LCRELSNKNITKVVDILLENKSIYMVFEYCEHDLLQIIQYHSHPDVKPIPDFTIKSIT
                     WQILNGVTFLHKNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVV
                     VTIWYRAPELLLGARHYTPSIDLWAVGCILAELLSLRPIFKGEEAKIDMNNKKSVPFQ
                     KNQLQKIVEVLGTPTTKNWPTITKYPEYSAFQQHFSNTYPPNLISWYKLIGRTSKQCL
                     NLLRCLLEYDPTIRITADDALTHAFFLELPKMSENSFEGLSQKYPKRRIYTHENDIVS
                     NSQHVNNKRHGYDDNMTRKRQR"
     gene            complement(<760373..>761512)
                     /locus_tag="DEHA2F08866g"
                     /db_xref="GeneID:8998925"
     mRNA            complement(<760373..>761512)
                     /locus_tag="DEHA2F08866g"
                     /product="DEHA2F08866p"
                     /transcript_id="XM_002770736.1"
                     /db_xref="GeneID:8998925"
     CDS             complement(760373..761512)
                     /locus_tag="DEHA2F08866g"
                     /note="similar to uniprot|P32353 Saccharomyces cerevisiae
                     YLR056W ERG3 C-5 sterol desaturase catalyzes the
                     introduction of a C-5(6) double bond into episterol a
                     precursor in ergosterol biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08866p"
                     /protein_id="XP_002770782.1"
                     /db_xref="GeneID:8998925"
                     /db_xref="GOA:B5RUC9"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:B5RUC9"
                     /translation="MDIVLEIFDYYLLDKTYSSLLPKSLNTTISDSIGKLGVNELTSS
                     FYKNYNENHNSTLASASAASNLNVPLRALMNKLQTFQNTDEVYGEVPKLFPLNDYTND
                     SLLLRTNMFRQAFSIFIITAIFGWLLYFSVAYVSYLTVFDKKIFNHPRYLKNQIWLEI
                     HRASTAIPVMVLLTVPFFLMELQGFSKLYMEVNASTGGWKAILLQVPSFILFTDCGIY
                     FIHRWLHWPSVYKILHKPHHKWIVCTPFASHAFHPVDGWAQSLPYHIYPMIFPLHKVS
                     YLLLFTFVNFWTVMIHDGQYLSNDPIVNGTACHTIHHLYFNYNYGQFTTLWDRLGRSY
                     RRPDDNLFVRDNKKEEEVKVWNEQTQKMEEIRGKLEGKGDDRVYH"
     gene            complement(<761958..>763043)
                     /locus_tag="DEHA2F08888g"
                     /db_xref="GeneID:2903764"
     mRNA            complement(<761958..>763043)
                     /locus_tag="DEHA2F08888g"
                     /product="DEHA2F08888p"
                     /transcript_id="XM_460748.1"
                     /db_xref="GeneID:2903764"
     CDS             complement(761958..763043)
                     /locus_tag="DEHA2F08888g"
                     /note="similar to uniprot|P28789 Saccharomyces cerevisiae
                     YDL205C HEM3 Phorphobilinogen deaminase catalyzes the
                     conversion of 4-porphobilinogen to hydroxymethylbilane the
                     third step in the heme biosynthetic pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08888p"
                     /protein_id="XP_460748.1"
                     /db_xref="GeneID:2903764"
                     /db_xref="GOA:Q6BM23"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /translation="MPHNTKSMDNTLNIKDNHVQIGGRKSKLAVVQSEIVKECIVEKF
                     PELSCSVLALSTLGDKVQSKPLYSFGGKALWTKELEILLLEQVEEYPRLDLIVHSLKD
                     IPTNLPEEFELGCILNREDARDALVMKSGSSYKSLADLPDGSLVGTSSVRRSSQLLKN
                     HPKLRFDSVRGNLQTRLNKLDDENSPFECLLLASAGLIRIGLGDRITAHLDAPEMYYA
                     VGQGALGIEIRKGDEKMLQLLKTIEDLPTTYCCLAERSLMRHLEGGCSVPIGVQSHYN
                     ESTNELSLKAIIVSPDGIHFVEDEYKGVVNNKDDADAIGIKVGDLLSAKGGREILNSI
                     NFERINLPPSSNTPTPQPITPITTNNS"
     gene            complement(<763548..>766193)
                     /locus_tag="DEHA2F08910g"
                     /db_xref="GeneID:2903765"
     mRNA            complement(<763548..>766193)
                     /locus_tag="DEHA2F08910g"
                     /product="DEHA2F08910p"
                     /transcript_id="XM_460749.1"
                     /db_xref="GeneID:2903765"
     CDS             complement(763548..766193)
                     /locus_tag="DEHA2F08910g"
                     /note="similar to ca|CA5483|IPF817 Candida albicans IPF817
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08910p"
                     /protein_id="XP_460749.2"
                     /db_xref="GeneID:2903765"
                     /db_xref="GOA:Q6BM22"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="UniProtKB/TrEMBL:Q6BM22"
                     /translation="MRGRIPSTLAQNNAHPSLNQQNSTSTSKTKAKHLEFKYLYFKIQ
                     KLIHKRVVLSLKYEQLKSPGVHSTLMKPLASKIVEIASISNLSKKINRVINSLPTVSP
                     YQTPRFGPQTNANYNHDVNGDSKLSINLVCILLLLRFEFTIQAENNLIKYDILNTKAT
                     ICEILAIKMLREYKAYDRINLLFTNPMRDDHFQNKFPSRISSYNTLELAVLSKSKKFL
                     SQPVIEQILDRFYDGELIVKRNNDLINESIVQSLLDVNSMFKNLEEQTSLLNDKSDNA
                     VINYTFKKLSLHKITTRANIVPKYQSLVMNMKLIFFAALHFILILKQKHTKWYTDPSN
                     TFMKITELLYWLLAFNFNFELFIKLRNINFKFLRKIIWTYADLILILLIDSAFFLRIF
                     SLLNKVGTEDYHDAFSLISIVLLPRILSVFNNYEFFNMITQSLKKMLWKLIGLFFLFI
                     SLISGFYLTFISLAIDRNSYEIAFDMLKVFFGFTPAVWSNWDSYNNLGRAIQMGYLFL
                     SQFIIATILAIVLSQVFSKVSLSNKEEFAYFKSTNLVVYFQTSDIFYENGFYGKSNRF
                     TTVGILYMFMNLFKFPIILIIFIYELIVANINSKKGHNNLKQFTFLNKEQDYYQDQDL
                     VNMDSIDDDTDVSLMLVKTRNNSMFQAVPGRKISSVDNVNHATSHLFNNLAPTKSIGN
                     LRSASTDSFIIDEILSKKYGGTGNLIAQTPVHQGLELVKASNNEMSTKLSASQQSKWL
                     TDRRSLMSMNNPTSNANFKATSGKKIKKRKKNVNNEIMTKLNKLETLVDMLVNQQHDQ
                     DETVHAFPQQLYDDQSIIQEVEENDSSSVIRGDTQDTNFGEIYRINEVSLDDMDSINM
                     SHEEADAGEDDEVDTSTEVESDDTY"
     gene            complement(<766396..>769665)
                     /locus_tag="DEHA2F08932g"
                     /db_xref="GeneID:2903766"
     mRNA            complement(<766396..>769665)
                     /locus_tag="DEHA2F08932g"
                     /product="DEHA2F08932p"
                     /transcript_id="XM_460750.1"
                     /db_xref="GeneID:2903766"
     CDS             complement(766396..769665)
                     /locus_tag="DEHA2F08932g"
                     /note="similar to uniprot|P06777 Saccharomyces cerevisiae
                     YPL022W RAD1 Single-stranded DNA endonuclease (with
                     Rad10p) cleaves single-stranded DNA during nucleotide
                     excision repair and double-strand break repair"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08932p"
                     /protein_id="XP_460750.2"
                     /db_xref="GeneID:2903766"
                     /db_xref="GOA:Q6BM21"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR006167"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:Q6BM21"
                     /translation="MSSLFVGDEDGEEEYTSYDNRDESIIVQNPIVSEEENKDDSKSE
                     PSIPINVQEDSNTAIYQTREICCSLPLRFHQEIVEDMLSKDGLLILGRGLGWELVTAN
                     LLHALSAPTVVLQRNGQEKHTKKSLLILLNSREEEIFKLGEDLTELRWIDKRNEIANT
                     SGFDTPPLITIGGDSMTVDKRKRVYENGGIVSVTSRILVVDLLSGVVEPNDITGLFIL
                     HAEKVKETSNESFIINLYRDGNDWGFVKAVSDEPESFTGFTPLATKLKVLRVSNVFLW
                     PRFHVEVSSSLNFRGRNLPTRQKQELERRRFVTEINTKLSYKMNKIQSAILSCIQACL
                     SELKRHNPSLVTEYWDMENIHDSDFVPRIRLSLDSSWHRISWTSKQLVYDLTTLKDLL
                     NYLLTLDSLSFYQVVQEIIDSNIKTTGNDTMNVASMSPWLNLDEANTIISYAKERALG
                     KVMVSKSKITIGDESEVDEGNETDAHIHESEIQTEEYNLEELPKWDQLGILIDDIMYE
                     KSQNIANHGPIVIMCSDSKTVKQLSYLISNMKDITISSSRRKRFSGRKFMVTKLNDYL
                     EWKEFTSLTRKLNSELDMKKHEEVSEDNETERAATPEEELQTSKTFSRGKGHPLSKRR
                     RTRGASSVANVGRLYSGSTKGRNNEAVELDTAIVNKLKEDVNENQLEDNTESGDFNSD
                     DNAGGFLIDEEQDQGKPVDISDLDDLNNVFECRPSEVIFENIDKDDQIIIETYNDKTN
                     DSLLQEVSPAYIIMYEPNLSFIRRVEIYQAVNKESPAKTYFMYYGTSVEEQKHLMRIK
                     KEKDAFTKLIREKATLGKHFESAEDNNKFQLKRNQVANTRIAGGARFRTEEDEMRVVV
                     DVREFRSSLPNLLYRVGIKVVPCMITVGDYIVSPKICIERKAIPDLISSFKSGRLYSQ
                     CEQMFRHYELPTLLIEFDESKSFSFEPFSDLRNYKVNATNPIATKLQQQDIQSKLIML
                     LISFPKLKIIWSSSPYETAQIFLELKANQEEPDISAAVSKGVNQSIKISSGEPPLYND
                     NAIDLIQNIPGINNINYSQIIEKVQSIEQLVNLSEDELTDIIGIENGKKAYKFIHHWV
                     K"
     gene            <769783..>770382
                     /locus_tag="DEHA2F08954g"
                     /db_xref="GeneID:2903767"
     mRNA            <769783..>770382
                     /locus_tag="DEHA2F08954g"
                     /product="DEHA2F08954p"
                     /transcript_id="XM_460751.1"
                     /db_xref="GeneID:2903767"
     CDS             769783..770382
                     /locus_tag="DEHA2F08954g"
                     /note="weakly similar to uniprot|Q02685 Saccharomyces
                     cerevisiae YPL024W RMI1 Protein of unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08954p"
                     /protein_id="XP_460751.2"
                     /db_xref="GeneID:2903767"
                     /db_xref="UniProtKB/TrEMBL:Q6BM20"
                     /translation="MDNLQQATRNSFEPQQYLQAKATYTQHPILFHIIQVADISRSRL
                     NQLDEWQEYEDPNSVSVDRVSKFNNKKYSGNRIIREVDMNTDNGMNRDNSKHFGGIYK
                     LTLKDNFENYCFAYEYNDCLQFLRSNSSTGTPLGIPLGGRLLVKKGTLVMNGAIMLKK
                     IQCQYLGIDENDKTLSEKLNSGIVKKHIDLLNEELTSNP"
     gene            complement(<770497..>772425)
                     /locus_tag="DEHA2F08976g"
                     /db_xref="GeneID:2903768"
     mRNA            complement(<770497..>772425)
                     /locus_tag="DEHA2F08976g"
                     /product="DEHA2F08976p"
                     /transcript_id="XM_460752.1"
                     /db_xref="GeneID:2903768"
     CDS             complement(770497..772425)
                     /locus_tag="DEHA2F08976g"
                     /note="weakly similar to uniprot|P46151 Saccharomyces
                     cerevisiae YPL023C MET12 Isozyme of
                     methylenetetrahydrofolate reductase catalyzes the
                     reduction of 5 10-methylenetetrahydrofolate to
                     5-methyltetrahydrofolate in the methionine biosynthesis
                     pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08976p"
                     /protein_id="XP_460752.2"
                     /db_xref="GeneID:2903768"
                     /db_xref="GOA:Q6BM19"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q6BM19"
                     /translation="MPTVKDRVQALKPHERFVSFEFFPPKTDTGFRNLLARLNRMSAL
                     NPLFITVTWGAGGSTSEKSLDLAATCQKEIGLTTVLHLTCTNTNKEIIDNALEKAKEQ
                     GIRNILALRGDPPRTEEYWIPDCDFNNAVDLVKYIKQQYGDYFCIGVAGYPEGHVDGS
                     DSSNQDPRNDMPYLVEKVEAGADYIITQLFFDVDKFLNYEAMIRSYPQLKDIILIPGL
                     MPITTYKVFTRATKLSHASIPLEIQSSLHSSSYDDDLVKNIGIDVINNIINKIDSNTD
                     NRIKGYHFYCLNLEKAVASIINDSDVLKSVMDLPDETNNNEDAIASDSDEDLPAVTIS
                     NRRRKSSIINDNELADKSNAQKSLVGKALIGDKRTLVDISTGKGALGKDATWDDFPNG
                     RFGDSNSPAYGEIDGYGPTLKIYSPEEAIHKWGAPESVNEIIKVFVSYLSGKIDSLPW
                     VDAALSPETALIQEELFEVNNKGWFSLASQPAVNGCLSSDKIFGWGPGNGIIYQKAFI
                     EIFIPKDTWTNKLLPGLQKYLDDQTITYYCGDAEGRLTSNLNIDQEHYNSKNAITWGV
                     FPSKEVLQPTIIDLESFKAWNEEAFILWLEWARCYKKTSKTYELLNSIYKDYYLVSLI
                     SHDFKDEYALWNILLENK"
     gene            complement(<772680..>773528)
                     /locus_tag="DEHA2F08998g"
                     /db_xref="GeneID:2903769"
     mRNA            complement(<772680..>773528)
                     /locus_tag="DEHA2F08998g"
                     /product="DEHA2F08998p"
                     /transcript_id="XM_460753.1"
                     /db_xref="GeneID:2903769"
     CDS             complement(772680..773528)
                     /locus_tag="DEHA2F08998g"
                     /note="similar to CA5488|IPF810 Candida albicans IPF810
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F08998p"
                     /protein_id="XP_460753.2"
                     /db_xref="GeneID:2903769"
                     /db_xref="GOA:Q6BM18"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR018939"
                     /translation="MNYIYLISAALGLIGGVSGIDCGVKELKEYDFESIKGIHSVTTL
                     KDTPPTQTNVTWYIGICDTISEKIDHCPKNSDLCGITSINLEKNSNKDAVVSEIVGFN
                     TNLQKQYKPFTKDGDNNEDGITIVYKGANWGDNLVDAELRFVCASSSDKDKDLDKFQL
                     HQWDDKRLKVSVKTKAACITDKKDKKKPDNKKDNKKGNDKDDNGESWGWFTWIFIFLV
                     LFLSIYIVGGAWFQYSKGNAIDFQSALREVLENFVSLLKGLPSFVREIIEKFTGNSNR
                     GEYSAV"
     gene            <773828..>774868
                     /locus_tag="DEHA2F09020g"
                     /db_xref="GeneID:2903770"
     mRNA            <773828..>774868
                     /locus_tag="DEHA2F09020g"
                     /product="DEHA2F09020p"
                     /transcript_id="XM_460754.1"
                     /db_xref="GeneID:2903770"
     CDS             773828..774868
                     /locus_tag="DEHA2F09020g"
                     /note="highly similar to uniprot|P32419 Saccharomyces
                     cerevisiae YDL078C MDH3 Cytoplasmic malate dehydrogenase
                     catalyzes interconversion of malate and oxaloacetate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09020p"
                     /protein_id="XP_460754.2"
                     /db_xref="GeneID:2903770"
                     /db_xref="GOA:Q6BM17"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q6BM17"
                     /translation="MVKVTVCGAAGGIGQPLSLLLKLNPQVSELSLFDVVNANGVAAD
                     LSHICSPAKVTGYQPSSKEDRDTIQKALVNSDLVVIPAGVPRKPGMTRADLFNINASI
                     IRDIVGSIGKACPNAAILIISNPVNSTVPIAAEVLKKLGVFNPKKLFGVTTLDSVRAE
                     TFLGELIKETPTSLKGQISVIGGHSGDTIVPLVHATASVAKKVSGLSKSQYNEFIHRV
                     QFGGDEVVKAKNGAGSATLSMAYAGYRFAEKVIGSLNGQSESSSEIPDSSYIYLAGVP
                     NGKELSQKYLKNSEFFSVPVILEKGQIKAFVNPFDKLNVTSEESKLVDIALGGLQNSI
                     DQGTTFVTGSKL"
     gene            complement(774995..775086)
                     /locus_tag="DEHA2F09042r"
                     /db_xref="GeneID:8998926"
     tRNA            complement(join(774995..775031,775049..775086))
                     /locus_tag="DEHA2F09042r"
                     /product="tRNA-Val"
                     /note="tRNA Val (TAC) cove"
                     /db_xref="GeneID:8998926"
     gene            <775255..>776520
                     /locus_tag="DEHA2F09064g"
                     /db_xref="GeneID:2903772"
     mRNA            <775255..>776520
                     /locus_tag="DEHA2F09064g"
                     /product="DEHA2F09064p"
                     /transcript_id="XM_460755.1"
                     /db_xref="GeneID:2903772"
     CDS             775255..776520
                     /locus_tag="DEHA2F09064g"
                     /note="weakly similar to uniprot|Q9WXD6 Brevibacterium
                     linens BDA1 1 4-butanediol diacrylate esterase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09064p"
                     /protein_id="XP_460755.2"
                     /db_xref="GeneID:2903772"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:Q6BM16"
                     /translation="MSFTVHQKKELATELNDLIGELTTPEEDSKSAKINGVIAGVTDD
                     KETVYLNAKGVKNIETGEKMVIDNVVSFFSCTKSITCMGLLKLYEQGKVDLDAPVKNY
                     VPQISSIGVIDADSVDLESGTFIKPPRKPLTDVTLRHLLNHTAGFSYGFLDSQYVALS
                     MKRDPHINSISPTNALFTNDKMPLLHEPGKKWTYGHSTDWVGKVIEKVTGKRLGDYLK
                     VSIFEPIGMSSCTFHVNNTDNMVDTHIPDRNKNLKVMKKRPLNVDPEIDMGGQGCYGT
                     VSDYLKFIRVWLNEGMCVETNKQILKPETVNYATQNHLPPGVVVDVEDQFGVKIPSQY
                     EADGFTLAGCAYSMNNLPTGRPKGAIYWFGLANLYFWMDLENKIGGFWACQLLPVMNM
                     ASITGFMRMEFNVYEALNNSREESTKSKL"
     gene            complement(<776652..>779237)
                     /locus_tag="DEHA2F09086g"
                     /db_xref="GeneID:2903773"
     mRNA            complement(<776652..>779237)
                     /locus_tag="DEHA2F09086g"
                     /product="DEHA2F09086p"
                     /transcript_id="XM_460756.1"
                     /db_xref="GeneID:2903773"
     CDS             complement(776652..779237)
                     /locus_tag="DEHA2F09086g"
                     /note="similar to uniprot|P00815 Saccharomyces cerevisiae
                     YCL030C HIS4 Multifunctional enzyme containing
                     phosphoribosyl-ATP pyrophosphatase phosphoribosyl-AMP
                     cyclohydrolase and histidinol dehydrogenase activities"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09086p"
                     /protein_id="XP_460756.1"
                     /db_xref="GeneID:2903773"
                     /db_xref="GOA:Q6BM15"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016298"
                     /db_xref="InterPro:IPR021130"
                     /db_xref="UniProtKB/TrEMBL:Q6BM15"
                     /translation="MTFPILPIISSSNKEAIAEFSVVGQILLPLESVSISKHFLHQFP
                     NYIDVNVDTTSSKVDIDQIVELLNSGIKQVFIKESQIEEFILSGGLPSSRFAIKFDSS
                     KVSDTALETDSAFVFNCELAKDDAKKYSQSGNRGLYYENPSITQELANKLATEDIYPI
                     IASESLTTASSESGKISISSLFTAGLTTDRPDGLFTTLITTPAPSYTALGIVYSSVES
                     IHASIAEKQGVYQSRKRRDELWYKGKTSGATQKLVKLEKDCDSDVVKFIVEPREGYGF
                     CHLDKNFTCFHDGELKQKGESFGKGLARLDNTLQDRFQSAPEGSYTKRLFNDEPLLIA
                     KLKEELDELIEAGQSSSKDTNEVAWECADLFYFAMVWCIKNGVRLADVERNLDIKSGK
                     VTRRKGDAKPAYLKTDNEKSEQSNEEYKMETIYVNDKTTDPKDIAKALNRPVQKTADI
                     MKLVLPIIDKVKKDGDKALLELTSKFDGVKLKSPVLSAPFPADLMDISEEMKEAIDLS
                     MTNIEKFHAAQLPKEKIMTVETAPGVYCSRFAKAIENVGLYVPGGTAVLPSTAMMLGV
                     PAKVAGCSNIIVATPPSRSTGKLTPEVVYVAHKLGAKCIVMAGGAQAVTAMAYGTESV
                     LKCDKILGPGNQFVTAAKMHVQNDTQALCSIDMPAGPSEVLVIADSEADADFVASDLL
                     SQAEHGVDSQVILVGVGLTKEKLNEFESAVKKQAQVLPRKDIVAKCLSHSYTLLVDTY
                     DEAFKLSNKYAPEHLILQVENARSFVPDYIENAGSVFVGGLSPESCGDYSSGTNHTLP
                     TYGYARQYSGVNTATFQKFITSQDVTEEGLKSIGKAVMTLAEVEGLEAHRNAVHVRME
                     KLGLL"
     gene            complement(<779420..>781231)
                     /locus_tag="DEHA2F09108g"
                     /db_xref="GeneID:2903774"
     mRNA            complement(<779420..>781231)
                     /locus_tag="DEHA2F09108g"
                     /product="DEHA2F09108p"
                     /transcript_id="XM_460757.1"
                     /db_xref="GeneID:2903774"
     CDS             complement(779420..781231)
                     /locus_tag="DEHA2F09108g"
                     /note="similar to uniprot|P35056 Saccharomyces cerevisiae
                     YDR244W PEX5 Essential for import of proteins with
                     SKL-like import signal into peroxisomal matrix"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09108p"
                     /protein_id="XP_460757.2"
                     /db_xref="GeneID:2903774"
                     /db_xref="GOA:Q6BM14"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR024111"
                     /translation="MSFVGGGADCSANSNAIAQFNKHTQQDRSLQRQAANQQGIVQNG
                     QGFKKDSMMNERERQNMDQFMNNGPSQSNFQFQPMRHELNMIQQNHKQPNVQNNWTNE
                     FQTNSPSPVQRNTPLAKTGSPANAQWATEFQQPMDQTFNQSNQQQFNNMPNMRMGGYR
                     PMMGMSMMGGGMHQQQNQMQHQEQNQDHQVDWDNQFKEIEQLTNETKDAEAEQVKGEE
                     EPEIVIDDKYQATFQEVWDSLNSEEVENDFINQQYEEFKNTQRDSMPADMAQWEKDFA
                     KYASTRAHFGDYQFEDNQHNQFLDLPKESDPYEIGLQLMENGAKLSEAALAFEAAIQR
                     NEGHINAWLKLGEVQTQNEKEIAGISALEKCLELHPENSEALMTLAISYINEGYDNAA
                     FATLERWISTKYPQVADQARQQNPAIDDEDRFSLNKRVTELFLNAAQLSPNSANMDPD
                     VQMGLGVLFYANEDFDKTIDCFKAALSIKPDDAVLWNRLGASLANSNRSEEAVDAYFK
                     ALELKPTFVRARYNLGVSCINIGCYKEAAEHLLSGLSMHQVEGVQTDASSTLNHNQST
                     SLTETLKRAFIALDRRDLLEKVKPDMDINQFRGEFSF"
     gene            complement(<781879..>785787)
                     /locus_tag="DEHA2F09130g"
                     /db_xref="GeneID:2903775"
     mRNA            complement(<781879..>785787)
                     /locus_tag="DEHA2F09130g"
                     /product="DEHA2F09130p"
                     /transcript_id="XM_460758.1"
                     /db_xref="GeneID:2903775"
     CDS             complement(781879..785787)
                     /locus_tag="DEHA2F09130g"
                     /note="weakly similar to uniprot|P09547 Saccharomyces
                     cerevisiae YPL016W SWI1 Global transcription activator
                     that acts in complex with Snf2p Snf5p Snf6p and Swi3p to
                     assist gene-specific activators"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09130p"
                     /protein_id="XP_460758.2"
                     /db_xref="GeneID:2903775"
                     /db_xref="GOA:Q6BM13"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="UniProtKB/TrEMBL:Q6BM13"
                     /translation="MSDNFWFNDDAFSGSNQNDNSNASNNDDFLNNIFDQNAEQQQAQ
                     QNVRPAANQSSSNNTPSAPQDISPAAILGQQQSINPQMFMRQQQQQQQQQLQEQQRSQ
                     QLQQTRQSQQPQQFQQPQQSQQPQQSQQPQQTQQPGQNSQQALNQGRKEQLLRMRQQI
                     MQQQMLHAQQKQQQFQQPQSLAGSANNNNSNLTTQAQGAMRLKNMELQETSSPKTFSR
                     SQIPNVSQPAPSMSNIGQPQGRPQPQMTQPQSVSNSYSNSPVNNMVSPQVQSNMPQSQ
                     QQTPRFSNPQISQPSIPPQGQQGNKPPPAQIAQLQIELFLTTLNDFMNRRGSPISQPP
                     VVNNKRVNLFFLYILSHKLGGPQALIKALQQPSQQPSPWSTICQKLGLYDGVNIQQDI
                     ASKTRIEKEVGNCYVQYLLPYEQYNSTPDGQKDIQQKRLHFQKQLLSRFQQQQQQQQQ
                     SQQQQQSQSHQGSPAPNIAQAPQPPHQVSPPQASNIASPVVNMHSNMMQSAQSPVISQ
                     APTPQQQRKLSRVSSNQNSPNVQSPYMQQSISRSGSIVQQAQMNSQHQAQMQQQQQTQ
                     MQQQQQPQQAQMNSQQQAQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQ
                     QHQQQAQMQQQQQAQMQQQQLQRQQQVPSARSSNVDILGQGSASEPPRITDQKSLQSV
                     ARPAATTSEHNVKSKPQEPNVVKNYVPIRKVIESHAGYDIKSLSTVAGEIEITKPVYL
                     FAPELGSINIHALIMALKNYSYSNRGEVFSALNTLLVTTSDSNYAFKISDCPELLDSL
                     ATLGLTVLDQLIEDKVNRRKEEEYTEKFSSNNNIENVFNRYVNNKDTNDMVEEDITYV
                     VDSLTGQLVEDEDSDMEIDEVFSPSEWNSTSCTSESNSPSVNRPDDETEFYISDYMST
                     LLNFRKENKYHFSKIQTKNAMDNQIMLVDQLITITMILRNISFSEANRTKMSKNEIFK
                     NLIFKIVKAIATTSKSFVFHRKRLCLLKDCLLMLDNIAFTVELTSLEEAFLAFVLVSS
                     FGPKLEDGFDIPKVNLDVYSYLPFGIDALTKLLVREPHNRSLMQAVLTGSLNISPSTY
                     SSNTLNITPEDQSETKRLMLAFLDGDEEGLKSGKLLTKSFQLFLCLIPYESSTYEFSK
                     FIFTRSSTVSQALFGAKLIIDMIPVEDSTSPLSNISVLWILHNKELILSNLSRMSMSL
                     IVEASKLHPTTNEYKTLSLVLVRSFIMVNSLVNDAINTYELLSHDDKLKGAIKDLAKL
                     SRVIPDPSSALDCLLSPAVDAGLSKEVIRLLALLRRLSKD"
     gene            complement(<786006..>787106)
                     /locus_tag="DEHA2F09152g"
                     /db_xref="GeneID:2903776"
     mRNA            complement(<786006..>787106)
                     /locus_tag="DEHA2F09152g"
                     /product="DEHA2F09152p"
                     /transcript_id="XM_460759.1"
                     /db_xref="GeneID:2903776"
     CDS             complement(786006..787106)
                     /locus_tag="DEHA2F09152g"
                     /note="similar to uniprot|P50108 Saccharomyces cerevisiae
                     YDR245W MNN10 Subunit of a Golgi mannosyltransferase
                     complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
                     mediates elongation of the polysaccharide mannan backbone"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09152p"
                     /protein_id="XP_460759.2"
                     /db_xref="GeneID:2903776"
                     /db_xref="GOA:Q6BM12"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:Q6BM12"
                     /translation="MSSNQRHTSPKGSVDEDYLEKLESNIHDNNHDNYHKSFKPNKHK
                     SLYSRTESLFRSTLKVIQEVCVRHKKIVIVLITLICLSLFTSTPFIPHLRSKDPKVVI
                     ILAANEGGGVLKWKGPQEWSVERSSIANKKHYAKVHGYGLTIKDMTLKKRYSHEWRES
                     WEKVDIMKQVMRQYPETEWFWWLDLHTYIMEPETSLEQHFLDNLENATYRSLEAFNPL
                     NLPVDLPYVDYNSPIDMVITQDCGGFNLGSFMLRRSAWSEMLLDFWWDPAMYEQMHMA
                     WEHNEQDALETLYTTQSWIRERIGFLPLRKINAFPPGACSEFSNDPRYFYKERDFVIN
                     MAGCEWGRDCWGEMEHYKALSKRLHKRWWKFW"
     gene            complement(<787337..>788428)
                     /locus_tag="DEHA2F09174g"
                     /db_xref="GeneID:2903777"
     mRNA            complement(join(<787337..788286,788377..>788428))
                     /locus_tag="DEHA2F09174g"
                     /product="DEHA2F09174p"
                     /transcript_id="XM_460760.1"
                     /db_xref="GeneID:2903777"
     CDS             complement(join(787337..788286,788377..788428))
                     /locus_tag="DEHA2F09174g"
                     /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
                     YDR265W PEX10 RING finger peroxisomal membrane peroxin"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09174p"
                     /protein_id="XP_460760.2"
                     /db_xref="GeneID:2903777"
                     /db_xref="GOA:Q6BM11"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR025654"
                     /db_xref="UniProtKB/TrEMBL:Q6BM11"
                     /translation="MSKVNDNALPFADASTIVRAHQKDTYFESSYRSQVQDVLHLFKG
                     QRFINTHPEEITVAAKSLYLMLTTLIGARTLGEEYVDLIYVNRSGKRFPQLLSKLGFI
                     LSYALLPYLFTRLVRKYKPKDGDESSKPKDGTKDWLVQFFSSYPKVLDTLMNLHIAIF
                     YFKGEFYSLSKRIFGLRYAFGHNKDPKKLRLARGDYSLLGGIILLQFFVKSLIKFKSY
                     IDDKNKVNQPENEENEKNVNAIFKISQLENFRDKVTTNNKLYKQINVDLSNPDHLPYL
                     PENSRACMLCLSPMTNPSAASCGHLFCWECIVDWVRDHPECPLCRQQCLEQNLLPLK"
     gene            complement(<788595..>790907)
                     /locus_tag="DEHA2F09196g"
                     /db_xref="GeneID:2903778"
     mRNA            complement(<788595..>790907)
                     /locus_tag="DEHA2F09196g"
                     /product="DEHA2F09196p"
                     /transcript_id="XM_460761.1"
                     /db_xref="GeneID:2903778"
     CDS             complement(788595..790907)
                     /locus_tag="DEHA2F09196g"
                     /note="similar to uniprot|Q04049 Saccharomyces cerevisiae
                     YDR419W RAD30 DNA polymerase eta involved in the
                     predominantly error-free bypass replication of DNA lesions
                     catalyzes the efficient and accurate synthesis of DNA
                     opposite cyclobutane pyrimidine dimers"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09196p"
                     /protein_id="XP_460761.2"
                     /db_xref="GeneID:2903778"
                     /db_xref="GOA:Q6BM10"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q6BM10"
                     /translation="MSVKRDEFENKSLTTFPNHASTFTYKDLKLLENPIVAYQSPLAV
                     VAHVDLNAFFAQVEQVRLNLTADDPVVCAQWQSLIAVSYAARKFGIGRMDTIQSARQK
                     CPNIIIAHAAVFKKGDSYWSYIRGLPDRSVHKVSLDPYRRESRKIMNIFREYCDLVEK
                     ASVDECFLDFGRMIYYTLLQLFPDLGDEVENINSNLPSIPSTLPDSLYWVGEIIKSED
                     EVPRNSDNDQDLKANDPRIRDWDDVCMLIGSQLLYEVRQQVFEELGYTTSGGLGKNKI
                     IAKIAGGFLKPDNQTIIRTCSMNNFLKNFQLIDFNGMGGKTGDVIMQRLEVPPDVNSI
                     SFIRNNFSLEDIQKEFANDPPLAQKTYQMVRGNYRQELSLRTEIKSMMSRKNFLSKNP
                     VNNIHDAYDWIKVFAGDLYGRLIELDDESLNLSMSQESRRGKGYIRRPKTISIQISST
                     SYVKHSKQMQLTIVRSLEKLKENMEVTGLRLLMDILDNSTNVHKLNNGISLKELDKKI
                     DKDYSKINIIPLANMSLVISNFVKNTDSSLIDSYTDNKSDISTQENIRRMFDEVNQET
                     RIKREKLEDVTPKPEASKSKSRSISKEEVEYVNKLFTDFNSEQTLASNTRNPSKSTRG
                     PRDLKTNNSQEDKKYIRSLFDKFESDSNVMNVPSKSQPERKEEKKYNILKDLKAKSSS
                     HSVKSSKAVANDQTFFDDLVSNNYCSHCNLEVKDVFEHRDFHVALELSSKINGREITP
                     ETTNKRSGSPYSEREPKSSKVDKGQSKLPF"
     gene            791049..791120
                     /locus_tag="DEHA2F09218r"
                     /db_xref="GeneID:8998927"
     tRNA            791049..791120
                     /locus_tag="DEHA2F09218r"
                     /product="tRNA-Cys"
                     /note="tRNA Cys (GCA) cove score=75.04"
                     /db_xref="GeneID:8998927"
     gene            complement(<791199..>792737)
                     /locus_tag="DEHA2F09240g"
                     /db_xref="GeneID:2903598"
     mRNA            complement(<791199..>792737)
                     /locus_tag="DEHA2F09240g"
                     /product="DEHA2F09240p"
                     /transcript_id="XM_460762.1"
                     /db_xref="GeneID:2903598"
     CDS             complement(791199..792737)
                     /locus_tag="DEHA2F09240g"
                     /note="weakly similar to uniprot|P53109 Saccharomyces
                     cerevisiae YGL160W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09240p"
                     /protein_id="XP_460762.2"
                     /db_xref="GeneID:2903598"
                     /db_xref="GOA:Q6BM09"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /translation="MNELESFSPRHEGHHHAANIKYGYIVLGFSVVHIIGILICKSVF
                     KLRWTTSTKGIDFVKSPLFISIIAWTLILIGLGVFHVQLPENYVTSIKRFGRMSYALL
                     PFDIFLVLRPNSIGLRYLELMDLHKWMSRVIIAGAIIHGVGYFIKWILEGSLFTKSVR
                     LWNFLGIVVFMLNLILIIISLRYFRRRIYQYFYVVHNITVWLFVGLICLHARPGVGKY
                     AIACASLLGLQIFERYAKSHSISDLKVISYEGSNLIVVRIQRDSKIADWPSGSHIRLT
                     YPLTNYRSWIFPTHPYTIASLESDEMLDLIISKSNRFILHPQMPYSWTGPFTSFSKEL
                     LQTIDNVDIICGGSGISFALPVFRNLKQKASHVKLIWCVRSNNDLHVLRTLNFNEEII
                     IHITGNLQDSTSNTIFDEEDYGLLDYDNNENFELESLPSSETPSRTVNDDSLSQDTRP
                     KKESKFIIVQGRPDFGNTFESLVQVNSSNKWIIACGPRSLVNSAQEWASENKVNFVSE
                     IYEM"
     gene            <795459..>797096
                     /locus_tag="DEHA2F09262g"
                     /db_xref="GeneID:2903599"
     mRNA            <795459..>797096
                     /locus_tag="DEHA2F09262g"
                     /product="DEHA2F09262p"
                     /transcript_id="XM_460763.2"
                     /db_xref="GeneID:2903599"
     CDS             795459..797096
                     /locus_tag="DEHA2F09262g"
                     /note="similar to CA1203|IPF3937 Candida albicans IPF3937
                     Unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09262p"
                     /protein_id="XP_460763.2"
                     /db_xref="GeneID:2903599"
                     /db_xref="GOA:Q6BM08"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q6BM08"
                     /translation="MTNLDMSYSSEGTKWKAYQFSDPFAAKSFFVCNKINKFFCRPDC
                     DARPITNLKSEIKFVNSVSDAINYGYVACNSCDPLSLPPIDVDLLVDCVASINKQIGF
                     LPPLLDEDEDRNNEKIKENIIESKKTNEEQIMQAIGGRRSSVPVINFEGKYSKDFENT
                     SLSKNDFDHYRLVDLACRHLALAAATNIFQPQSSKGSRSVESSPSSSSSNSKKRRRRG
                     GVLGFKELAAKSKLSAWHFHRVFKSVTGLTPKTYGDKCWEYIKNYLNSSEYSSNKQQE
                     TQQSQLCEYQTPVTNSSESASSIPTSPNDLVSNKRIKLEPTQEVKFEISSPPQNEETL
                     LKELVLPNQVPSDNSNTRMPTMNMIPSPMEGDDNFNKMNPMKYSVPQQATFDITVNQP
                     ITDNNFNMFNDAQGLNQDFSSTTRAFSAPDLSHYNTRPTTLFSHLRSNERTPEESYSS
                     NRSSQSPVLNDGIPTIDEVVPANQYMKGPEGAQDVLNDVPELNTLLYDSGVNSLNPLN
                     DEGNLDLNLNNSYFDQNQNAFNLGFASDLLSTNNDNF"
     gene            complement(<798665..>799975)
                     /locus_tag="DEHA2F09284g"
                     /db_xref="GeneID:2903600"
     mRNA            complement(<798665..>799975)
                     /locus_tag="DEHA2F09284g"
                     /product="DEHA2F09284p"
                     /transcript_id="XM_460764.1"
                     /db_xref="GeneID:2903600"
     CDS             complement(798665..799975)
                     /locus_tag="DEHA2F09284g"
                     /note="similar to uniprot|P27466 Saccharomyces cerevisiae
                     YFR014C CMK1 Calmodulin-dependent protein kinase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09284p"
                     /protein_id="XP_460764.2"
                     /db_xref="GeneID:2903600"
                     /db_xref="GOA:Q6BM07"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6BM07"
                     /translation="MAQQQSESNNLKKIFNKLSGQPSSYSRKSLYTFGKTLGAGSFGI
                     VRYARNNETNEEVAVKIILKKALKGKVETITDELNLLQELSHPNIVGFRDWFESKDKF
                     YIVTQLATGGELFDRIIEKGRFTEFDASLVIVAMLEAIKYLHNKNIVHRDLKPENILY
                     LTPADNSNVVLADFGIAKRLESPDEKLTSSAGSFGYAAPEVILGTGHGKPCDIWSLGV
                     ITYTLLCGYSPFRSENVSDFIEEVKHNNAVIFHADYWKDVSKDARRFIIKALQFDPNN
                     RPDAETLLNDKWLVSIASEHKELDLLPNLKENFNAKQKFKQAIEMVKLNNKIKKLKEL
                     QGDDDDDPNEINLFGDEGALISSDVSSKQGAGSEGGLGSWKALSSALNSIDDRSSAAS
                     VSSTSAPKKKSDLASDAFVQLVHAATNNKERVANYKEGDNSSAN"
     gene            <800609..>802108
                     /locus_tag="DEHA2F09306g"
                     /db_xref="GeneID:2903607"
     mRNA            <800609..>802108
                     /locus_tag="DEHA2F09306g"
                     /product="DEHA2F09306p"
                     /transcript_id="XM_460765.1"
                     /db_xref="GeneID:2903607"
     CDS             800609..802108
                     /locus_tag="DEHA2F09306g"
                     /note="similar to uniprot|P17649 Saccharomyces cerevisiae
                     YGR019W UGA1 Gamma-aminobutyrate (GABA) transaminase
                     (4-aminobutyrate aminotransferase) involved in the
                     4-aminobutyrate and glutamate degradation pathways"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09306p"
                     /protein_id="XP_460765.2"
                     /db_xref="GeneID:2903607"
                     /db_xref="GOA:Q6BM06"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6BM06"
                     /translation="MLRVSRLYPKSRVGRALATTKRYQSSVCGAYFPDEPSRPELITE
                     RIPGPSGIKLNEDLGKVFDNRASNFVTDYFNSIGNYISDADGNKLLDVYCQISSIALG
                     YNNPALIEMAKSDSMINALVNRPALACFPSIDYGKILNEGILAAAPPGMDKVWTALSG
                     SCANETAYKAAFMYQEAKRRGSIDFTSEELTSVMENKAPGASEKVILSFDKGFHGRLF
                     GSLSTTRSKAIHKLDIPAFPWPKAPFPQLKYPLDEFVNENHSEEERCLAILEDIITKK
                     HPPHNIAAIVVEPVQSEGGDVHATPFFFQGLRDLTKKHEILMIVDEVQTGIGATGKFW
                     AHEHWNLSEPPDMVSFSKKFQAAGFYFTDPELQPNKPFRQFNTWCGDPSKALIAKSIY
                     QEISKNNLVQKTAQVGDYLYKSLSSVFSKYPDRIKNLRGENMGTFIAWDCVSPEERNK
                     LLLACRTKGVNIGGCGEVTVRLRPTLVFENKHADVLANILEDSLKDLYK"
     gene            <802607..>805984
                     /locus_tag="DEHA2F09328g"
                     /db_xref="GeneID:2903608"
     mRNA            <802607..>805984
                     /locus_tag="DEHA2F09328g"
                     /product="DEHA2F09328p"
                     /transcript_id="XM_460766.1"
                     /db_xref="GeneID:2903608"
     CDS             802607..805984
                     /locus_tag="DEHA2F09328g"
                     /note="similar to CA4694|IPF3950 Candida albicans IPF3950
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09328p"
                     /protein_id="XP_460766.2"
                     /db_xref="GeneID:2903608"
                     /db_xref="UniProtKB/TrEMBL:Q6BM05"
                     /translation="MLGRLFKQNQSGPNVPNSNGNGNYINPNGNGNSYTNSYGANHQP
                     KNGPIINPNTNPYQNVNTFEDSYSREILYGTSDTLQLKPYQLNNKFFRIIISQDGGNL
                     RSKQVLYDSAAQNNDNPGVIARPPPMSRNNSSNNVNSKNILTSKIYHNASELNDYMFG
                     CGLPSNETYSTTKIHILPTLNNSTYGSNQSILITRLFSISDNNDSQIFNESFQSHWMP
                     RPALPIKETSIKNDAFNIAHAKANNPDTGSTSKSSNSINSRFSIGLIIPLESVNDHLN
                     DVIFNNWDVISHYILVLQKLIIKKLILTLNNSVNDLSLSNLSLQNNSPNHTHIYCPYI
                     VNKRIQFPSYILQNELDLNNQLIKLIKLMHYNSNVPKLINSNSLMRYSMSDSSKVNPM
                     LLSWISEVVNWLQFKDGRSMSNDINSQTHSSFNNNSQFQYNNTTNISSSLSVQSSPNI
                     NNLNFSPNTDTAVTKTFLASLLALLIPLRKSLTMKPFSISNDCDNTREITRVVVMTGN
                     PVVAKKLIFIINGLIPDNEMLSILDDYEDEKSDISESSNDTKPMKHSIGKIPENKSCE
                     ELLDNNSFSNDSVSTPSSIQHKLFGSTGDMNNVNTLGAAKPVPTRPIPIKSSTASSYS
                     SSDNSPTHNTSVKGWEIPHKSSASTTTTPLKSRVEVGTSVIPIAEKTPTRSSLSKSSS
                     MAYLSSSLTSSLSSSASNYSLSKLGGSFMEKWKNSFSNTQHTNPNMNPANNQTNSSLG
                     FNTENHDLLPPSLGNLSKRNSVHSLRTPSPAVEIDESSPYHNNSSNVGNIPHNSSSST
                     KMARANSVFDLYNNNSSYKRNAIGIIQEEGKCPGMKRSNTSIYTPALRDTYKLKNIND
                     FNRNIIKSKCSLIMKARISVGDSVDKTLNINSIIEKNEDESDSCYGDESTITSSTKIN
                     EIAPLIKHRPLFPNVAFAEEFRPEFILQSCPINSKLESQVMTSMKNDLLFYQNNCQFE
                     KVTSRSVFVSLRAREIKVIEMNVGESVSGQVETSPNSQASSNSGTPVGSLQESQKPSL
                     QSALTKGIRNNKSDQSEHTSRNSMPSNSTSSYKTMIKKIFSPTRNSGDKEVIFAIENT
                     LDEIAKLFQSNSNCQKSSTTNQDFNEKLTMLMSNILD"
     gene            <806287..>808482
                     /locus_tag="DEHA2F09350g"
                     /db_xref="GeneID:2903609"
     mRNA            <806287..>808482
                     /locus_tag="DEHA2F09350g"
                     /product="DEHA2F09350p"
                     /transcript_id="XM_460767.1"
                     /db_xref="GeneID:2903609"
     CDS             806287..808482
                     /locus_tag="DEHA2F09350g"
                     /note="similar to uniprot|P46995 Saccharomyces cerevisiae
                     YJL168C SET2 Histone methyltransferase with a role in
                     transcriptional elongation methylates a lysine residue of
                     histone H3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09350p"
                     /protein_id="XP_460767.2"
                     /db_xref="GeneID:2903609"
                     /db_xref="GOA:Q6BM04"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="InterPro:IPR025788"
                     /translation="MSDMEELDVKAKQYTPQLFLESEDKTDEARSTFNELQECTYSSK
                     STGSSGQHEHMTCDCYEDWDSDKQQNMACGEDSDCINRVTSVECSNKFCTCGNDCQNQ
                     RFQKKQYANVTVIQTELKGYGLRANEDISESSFIYEYIGEVIDEESFRKRMIDYDTKK
                     LIHFYFMMLKKDSFIDATMKGSLARFCNHSCNPNAYVDKWVVGEKLRMGIFSKRNIQK
                     GEEITFDYNVDRYGAQSQPCYCGEPNCIKWMGGKTQTDAALLLPDGISEALGVTHKQE
                     RQWLKENKHLRSKQQSDESIINEAFVKSIEVSALTESDVSKVMGALMRVQDLNITQKL
                     IERIYLTSDDSINSSIIRVHGYKTLSQTIKAFKDEDKELISKILIILAKWPKVTRNKI
                     SSSQIEDVVKDINTNSNDDNLKKLSSDLLAEWGKLQMAYRIPKNIGNDKESNSPALYG
                     RNARSRSRSRSPDRGKSAEPQHVETDEALPDGWQTAFDPNTQTNYYYHAELGISKWER
                     PIKEVPKGPKGPKALPVSEPIQRPNSNSNGRSYNEEELTRREEERLKREKEEQFKEIQ
                     QKERLLQELILQSQKELEEKKSFEEKMKLEKLEKEKERQALKRKKLKKSKSSIPPAPP
                     VPIDGQWTKTFAKHVPNFLKKYEAEIGRDNIKGCAKELVKTLVAKEMKKNPDTKPPKE
                     LDNAKLKKIKEYSKMFMDKFLIKYRSKHDKKRSHNEENGGTKRVKPDVE"
     gene            complement(<808686..>809855)
                     /locus_tag="DEHA2F09372g"
                     /db_xref="GeneID:2903610"
     mRNA            complement(<808686..>809855)
                     /locus_tag="DEHA2F09372g"
                     /product="DEHA2F09372p"
                     /transcript_id="XM_460768.1"
                     /db_xref="GeneID:2903610"
     CDS             complement(808686..809855)
                     /locus_tag="DEHA2F09372g"
                     /note="similar to uniprot|Q00055 Saccharomyces cerevisiae
                     YDL022W GPD1 NAD-dependent glycerol-3-phosphate
                     dehydrogenase key enzyme of glycerol synthesis essential
                     for growth under osmotic stress"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09372p"
                     /protein_id="XP_460768.1"
                     /db_xref="GeneID:2903610"
                     /db_xref="GOA:Q6BM03"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:Q6BM03"
                     /translation="MSQYRANQRLQQLSNILRPNQLSAEKSLKPETPFKVAVIGSGNW
                     GTTIAKVLAENTAEKPDTFAKQVDMWVFQEKIDGTNLTEIINNKHENVKYLPGVKLPE
                     NLHAEPDIVKAAQGADLLVFNLPHQFLPKICKQLKGTLKPTTRAISCLKGLEVTPDGC
                     KLLSTYITENLGIECGALSGANLAPEVARCKWSETTVAYNIPADFKGPGKDIDSAVLK
                     EAFHRPYFHVNVIEDVAGVSVAGALKNIVAIAVGFVEGLGWGDNAKSAIMRVGLIETI
                     NFSNMFFPNSKPTTFTHESAGVADLITTCSGGRNVKVGRHMSKTGESAEEAEKKLLNG
                     QSSQGIITAKEVHELLSNVGKTDQFPLFEATYQIIYGDESIQNLPNLLEDHSLFK"
     gene            complement(<810828..>811964)
                     /locus_tag="DEHA2F09394g"
                     /db_xref="GeneID:2903611"
     mRNA            complement(<810828..>811964)
                     /locus_tag="DEHA2F09394g"
                     /product="DEHA2F09394p"
                     /transcript_id="XM_460769.1"
                     /db_xref="GeneID:2903611"
     CDS             complement(810828..811964)
                     /locus_tag="DEHA2F09394g"
                     /note="weakly similar to CA2262|IPF6857 Candida albicans
                     IPF6857 putative transcriptional regulator (unknown
                     function)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09394p"
                     /protein_id="XP_460769.2"
                     /db_xref="GeneID:2903611"
                     /db_xref="GOA:Q6BM02"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6BM02"
                     /translation="MDQYRYRRSKSTQSLQNASGRTTSTLPDPVNGNSQSEGYNSDMS
                     YSMYAQQPSAHIVGASPPTKKLKNSNLESQLYMPGSRSSSGAVEQNLSYTRSYSVSND
                     RQLGSKNDNPISMSRSHSHNESDEDERFLRLAREALVATATAAKNHSDSLLVDPTIQN
                     LLTRLQYVSSPHGNPIRRSDKIRANENGQLMIQDFYQDFPNLSNDIFSENRFGGNNSL
                     DHDQQRPENQSTRSEDWNFLIGEPQHLESKESRSTHDQGHTMSHPMNENTTTVLSDNS
                     QSDKSGKEDEDRKFLCSKCTMSFRRSSDLKRHEKQHLSIPPNICELCGKGFARKDALK
                     RHSGTLTCKRNADRKLYIENLDYLHRPNNSSMPIQPNYNSGSDW"
     gene            <812758..>813798
                     /locus_tag="DEHA2F09416g"
                     /db_xref="GeneID:2903612"
     mRNA            <812758..>813798
                     /locus_tag="DEHA2F09416g"
                     /product="DEHA2F09416p"
                     /transcript_id="XM_460770.1"
                     /db_xref="GeneID:2903612"
     CDS             812758..813798
                     /locus_tag="DEHA2F09416g"
                     /note="similar to uniprot|P50947 Saccharomyces cerevisiae
                     YNL097C PHO23 Probable component of the Rpd3 histone
                     deacetylase complex involved in transcriptional regulation
                     of PHO5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09416p"
                     /protein_id="XP_460770.2"
                     /db_xref="GeneID:2903612"
                     /db_xref="GOA:Q6BM01"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:Q6BM01"
                     /translation="MRSQQQQFQQYKQKAKNISNANELLPGLNDISDAFEALPLDLIK
                     YFTLLKEIDAKYINTVPVINRNIKSYIDRLHITKNSPPGMKEMNKPTKIDKLTVIRDK
                     IHEIIPCLEEKMHVTSVATDLLHKHLYRINADYKLIVNNNEIPESIRIGPLNHPAMIM
                     DSAGPVDANGNLSAQSQRSESRREALAAKKAHKDHYDDDEPKKRKAMGNKEVSPSSDV
                     PSASKSASNSKKRSRKDPEEMSSRSDTPSMSTVLNGPNKKRNTTKPKKDDKDVSNDVV
                     HPGPSHTSANSSEPTYCYCNQVSFGEMVGCDGDDCKREWFHLPCIGFKNPPKGKWYCD
                     DCLMKMKKLRKV"
     gene            <814492..>815259
                     /locus_tag="DEHA2F09438g"
                     /db_xref="GeneID:2903613"
     mRNA            <814492..>815259
                     /locus_tag="DEHA2F09438g"
                     /product="DEHA2F09438p"
                     /transcript_id="XM_460771.1"
                     /db_xref="GeneID:2903613"
     CDS             814492..815259
                     /locus_tag="DEHA2F09438g"
                     /note="similar to uniprot|P01119 Saccharomyces cerevisiae
                     YOR101W RAS1 GTPase involved in G-protein signaling in the
                     adenylate cyclase activating pathway plays a role in cell
                     proliferation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09438p"
                     /protein_id="XP_460771.2"
                     /db_xref="GeneID:2903613"
                     /db_xref="GOA:Q6BM00"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BM00"
                     /translation="MLKEYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIENSYRKQ
                     CTLDGESVLLDILDTAGQEEYSAMREQYMRTGEGFLLVYSINSRTSLEELQSFYEQIQ
                     RVKDSDFVPVLVVGNKCDLEIERQVSYEEGLSLAKSFNCPFLETSAKQRINVEEAFYG
                     LVRSIRDGENGAKKLETGNNDAAGVAGGSAGAGNTANQTDVAAQDNAAAAGASNKQKQ
                     ASNNVSSVANSGKRQQQQSSAAGGKEEKEKSGCCVIV"
     gene            complement(<815455..>815964)
                     /locus_tag="DEHA2F09460g"
                     /db_xref="GeneID:2903614"
     mRNA            complement(<815455..>815964)
                     /locus_tag="DEHA2F09460g"
                     /product="DEHA2F09460p"
                     /transcript_id="XM_460772.1"
                     /db_xref="GeneID:2903614"
     CDS             complement(815455..815964)
                     /locus_tag="DEHA2F09460g"
                     /note="weakly similar to uniprot|P46964 Saccharomyces
                     cerevisiae YOR103C OST2 Epsilon subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09460p"
                     /protein_id="XP_460772.1"
                     /db_xref="GeneID:2903614"
                     /db_xref="GOA:Q6BLZ9"
                     /db_xref="InterPro:IPR003038"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ9"
                     /translation="MAKKDSIKKSVTHTTSNKIGHPINELISAVTTTYKDYINSLTPR
                     LKLIDIFLTFLVLLGILQFAYVLLVGNFPFNAFLGGFISCVGQFVLTVSLRLQYNYEN
                     NSNNTRENIDQEIKEKNIEDVNETKVDIETAEASDMKPFKFVTPERAFGDFIFASLIL
                     HFVVFHFIN"
     gene            <816165..>816755
                     /locus_tag="DEHA2F09482g"
                     /db_xref="GeneID:2903615"
     mRNA            <816165..>816755
                     /locus_tag="DEHA2F09482g"
                     /product="DEHA2F09482p"
                     /transcript_id="XM_460773.1"
                     /db_xref="GeneID:2903615"
     CDS             816165..816755
                     /locus_tag="DEHA2F09482g"
                     /note="similar to uniprot|P50946 Saccharomyces cerevisiae
                     YNL099C OCA1 Putative protein tyrosine phosphatase
                     required for cell cycle arrest in response to oxidative
                     damage of DNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09482p"
                     /protein_id="XP_460773.1"
                     /db_xref="GeneID:2903615"
                     /db_xref="GOA:Q6BLZ8"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /translation="MSESQSEIEHNNNNSKLTKISQPPTVRIIPPLNFCPVEKQLYRS
                     GQPSIINQSFLQDLNLKTILWLASEEPQEDFLDYCSMNNIAVEFVGLMNEYSYQNVNP
                     WDALSEDTIKKALELICNKENYPLLVCCGMGRHRTGTVIGCLRRLQGWNLASVSEEYR
                     RFTGSRGGRIMVELLIESFDINSVQIDPTKMPGWLT"
     gene            <817433..>818167
                     /locus_tag="DEHA2F09504g"
                     /db_xref="GeneID:2903616"
     mRNA            <817433..>818167
                     /locus_tag="DEHA2F09504g"
                     /product="DEHA2F09504p"
                     /transcript_id="XM_460774.1"
                     /db_xref="GeneID:2903616"
     CDS             817433..818167
                     /locus_tag="DEHA2F09504g"
                     /note="weakly similar to uniprot|P32564 Saccharomyces
                     cerevisiae YGR049W SCM4 Suppressor of CDC4 mutation 4"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09504p"
                     /protein_id="XP_460774.2"
                     /db_xref="GeneID:2903616"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ7"
                     /translation="MAGTCIATVKIVGVSSLGLLTSSLTYQTIQGIPALINELNTKVN
                     GLSKSNALASIRNLINFSRIGYISLSGLATAMLTMAFIYSPPSEKHPYLIYSAVGAPL
                     ALISMYYRGFGLETKLLRKADHLHTHNANETTKNTENVNDSENVKSDEDSQLGKSYIH
                     VSDEESSSTTSTPTSTIPNSPQTKTVDSLQEELSLEEEVDIALTKKEIVNDLNKVKSN
                     YVVGSSIVGLSFFIATIGLIGDYYIL"
     gene            <818927..>819409
                     /locus_tag="DEHA2F09526g"
                     /db_xref="GeneID:2903617"
     mRNA            <818927..>819409
                     /locus_tag="DEHA2F09526g"
                     /product="DEHA2F09526p"
                     /transcript_id="XM_460775.1"
                     /db_xref="GeneID:2903617"
     CDS             818927..819409
                     /locus_tag="DEHA2F09526g"
                     /note="similar to uniprot|P40581 Saccharomyces cerevisiae
                     YIR037W HYR1 Thiol peroxidase that functions as a
                     hydroperoxide receptor to sense intracellular
                     hydroperoxide levels and transduce a redox signal to the
                     Yap1p transcription factor"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09526p"
                     /protein_id="XP_460775.2"
                     /db_xref="GeneID:2903617"
                     /db_xref="GOA:Q6BLZ6"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ6"
                     /translation="MSFYDLSPLDTNDKPFPFEELKGKVVLVVNVASKCGFTPQYKEL
                     EELNKKYQDKGLQIIGFPCNQFGGQEPGSSEEIASFCSLNYGVSFPVLKKVDVNGDKT
                     DPVYKYLKGEKSGLLGLNRIKWNFEKFLIDKNGKVIERYSSLTKPASLSSTIEELLKK
                     "
     gene            <820967..>822394
                     /locus_tag="DEHA2F09548g"
                     /db_xref="GeneID:2903618"
     mRNA            <820967..>822394
                     /locus_tag="DEHA2F09548g"
                     /product="DEHA2F09548p"
                     /transcript_id="XM_460776.1"
                     /db_xref="GeneID:2903618"
     CDS             820967..822394
                     /locus_tag="DEHA2F09548g"
                     /note="some similarities with uniprot|P38691 Saccharomyces
                     cerevisiae YHR082C KSP1 Nonessential putative
                     serine/threonine protein kinase of unknown cellular role"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09548p"
                     /protein_id="XP_460776.2"
                     /db_xref="GeneID:2903618"
                     /db_xref="GOA:Q6BLZ5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ5"
                     /translation="MTMTNTATISANSTASVRGNEAFNEYGAYEKKQYLLKDKYKFIT
                     PIQEGAFGKVTLAVNVQTKEKVAMKAMYKSHENTRRIANHEIDVLSKIGRNNDNICQL
                     LDHFETSEFIILILEYCSNGDLYDLIHSSINISAVDIWNIAKELANALKYAHSLGIYH
                     RDIKPENVLFNCFGRVKLCDWGLATTKRMNREFSVGTEKYMAPEVFIEKPELTEYDCK
                     YVDYWSFGITLITAIFGTCPFKPVGESSNIHSDYNFKKFVYYGNSQILYDIYPTMNET
                     CFNIFMNLLRIGGNEDNLLEFNDKINSRNLDNFIQDLQDNWKFGLTIDEEYELEQFDD
                     DAESDNSNDLFNMDHDDLSSESQDEQLSFDTSVESESDSDEYLTNYDTSMKIRMNQES
                     DHHNVIPSLIESSIQSSSSKSWCDLDDDEEFNQIFNAMSLNRTKKPQLDIVKDDFTKS
                     NLGNDDIDILKVEWNLYNNNHQAYN"
     gene            <823183..>824382
                     /locus_tag="DEHA2F09570g"
                     /db_xref="GeneID:2903619"
     mRNA            <823183..>824382
                     /locus_tag="DEHA2F09570g"
                     /product="DEHA2F09570p"
                     /transcript_id="XM_460777.1"
                     /db_xref="GeneID:2903619"
     CDS             823183..824382
                     /locus_tag="DEHA2F09570g"
                     /note="similar to uniprot|P06168 Saccharomyces cerevisiae
                     YLR355C ILV5 Acetohydroxyacid reductoisomerase
                     mitochondrial protein involved in branched-chain amino
                     acid biosynthesis also required for maintenance of wild-
                     type mitochondrial DNA"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09570p"
                     /protein_id="XP_460777.1"
                     /db_xref="GeneID:2903619"
                     /db_xref="GOA:Q6BLZ4"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016207"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ4"
                     /translation="MSIRNASIRMARMASNNAAKQVASKRALSALANAARPVVARKSI
                     APAAARGVKTINFGGMDEIVHERADWPREKLLEYFKNDTLALIGYGSQGYGQGLNLRD
                     NGLNVIIGVRKDGASWKAAIEDGWVPGENLFDVNEAIGKGTYIMNLLSDAAQSETWES
                     IKPQLTEGKTLYFSHGFSPVFKELTHVEPPTNIDVILAAPKGSGRTVRTLFKEGRGIN
                     SSYAVWNDVTGKAEEKAIALAVAIGSGYVYQTTFEREVNSDLYGERGCLMGGIHGMFL
                     AQYEVLRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPR
                     FKDALKPVFNDLYESVKNGTETQRSLDFNSQSDYRARLEEELETIRSMEIWRVGKEVR
                     KLRPENQ"
     gene            <825133..>827319
                     /locus_tag="DEHA2F09592g"
                     /db_xref="GeneID:2903620"
     mRNA            <825133..>827319
                     /locus_tag="DEHA2F09592g"
                     /product="DEHA2F09592p"
                     /transcript_id="XM_460778.1"
                     /db_xref="GeneID:2903620"
     CDS             825133..827319
                     /locus_tag="DEHA2F09592g"
                     /note="weakly similar to uniprot|P35995 Saccharomyces
                     cerevisiae YKL222C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09592p"
                     /protein_id="XP_460778.2"
                     /db_xref="GeneID:2903620"
                     /db_xref="GOA:Q6BLZ3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ3"
                     /translation="MELFTKDDFNQIGGIQKKRRRPIKSCSRCRERKSKCDMKKPICT
                     SCLVKGLESCKYEESSSYSVKIDSNEVDLLKKENERLLSTIKQLRGQINTVYPSPIPD
                     SSNEIEADKYRIVFSKPNRTMFCGPTSFRIVFQNQLVWNYYMSIKNSLKSQRNDWKLK
                     NRPKPVIFDNLYSTSNGLLADLQRFLPQYSVLLEYLLQFFDGFWYKYLPIVDRDDILQ
                     IFKVQFKQSDNDSNIEILSPQNSVEFANIAVIITILKYSVNSEACSPGMVSNKFKDEH
                     DILLKFATKLLAKADYLEKASLPSLQAVFMLRIFKKFNFKDGDGGDGSNGNILFAICL
                     EMGFTLGLNQNVDTLYNRESAKYRTVLKNLWKYLLYFDTINSFDLGVPLHISDNNVRK
                     DLLDLDDIFIKTILKKREIMDVFLSPKMSHDGIGNVINEIRNFINQNFKTVFELIKDF
                     ENSSNLEDSYKIIHQFVLSISLIGMIQHGCLLLYNELRDSSSKLGTRSHNLAMKYTIL
                     MIISTVELTKRIYLSSMELLSIPSTNQIHFFIAGMQNQWFSRAFLFYFFSLLTYVKSS
                     KNQGTRNITDSHIVLRLSELADLYNDVDNIHDDGFTETKTLVSLNIIVSRYMNMRIFL
                     ETNGGEREQKKLVTKIHNYGLFIMNASLCHFKQLIAQDNDFKSIVRFNEDNLDIVYDS
                     IQDSFPSQLYVTQNFSSVPNLDIFDEIELNGTVENFNKDIYDFLSI"
     gene            <828016..>828786
                     /locus_tag="DEHA2F09614g"
                     /db_xref="GeneID:2903621"
     mRNA            <828016..>828786
                     /locus_tag="DEHA2F09614g"
                     /product="40S ribosomal protein S1"
                     /transcript_id="XM_460779.1"
                     /db_xref="GeneID:2903621"
     CDS             828016..828786
                     /locus_tag="DEHA2F09614g"
                     /note="highly similar to uniprot|P23248 Saccharomyces
                     cerevisiae YML063W RPS1B Ribosomal protein 10 (rp10) of
                     the small (40S) subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S1"
                     /protein_id="XP_460779.1"
                     /db_xref="GeneID:2903621"
                     /db_xref="GOA:Q6BLZ2"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTKKEWFDIKAPSTFENRAVG
                     KTLINRSTGLKNAADGLKGRVVEVCLADLQGSEDHSSRKVKLRVDEVQGKNLLTNFHG
                     IDFTTDKLRSLVRKWQSLVEANVTVKTSDDYVLRIFAIAFTKRQANQIRKTTYAQSSK
                     LREVRKKMIEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTILPLQNIHIRKVKLL
                     KQPKFDLGSLLALHGEGSTEEKGKKVSAGFKDVVLEAV"
     gene            <829139..>831817
                     /locus_tag="DEHA2F09636g"
                     /db_xref="GeneID:2903622"
     mRNA            <829139..>831817
                     /locus_tag="DEHA2F09636g"
                     /product="DEHA2F09636p"
                     /transcript_id="XM_460780.1"
                     /db_xref="GeneID:2903622"
     CDS             829139..831817
                     /locus_tag="DEHA2F09636g"
                     /note="similar to CA1984|IPF9592 Candida albicans IPF9592
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09636p"
                     /protein_id="XP_460780.2"
                     /db_xref="GeneID:2903622"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ1"
                     /translation="MSDNSFDDNDDAWSYSFPPSTESLTLSKKNDDNSKLDKELKSAT
                     QRGDKDKDVFIDSDDSRNHTIAQNRSNINALSNKSASKKGRLSRTSSTSSVGRSEEPK
                     EDKKDHVQTNGNGSHASSLTSLSLQSPYFVKSTPANPHTTKEDANSIISREGAQASGF
                     SLDSNFNSQSTPITSSARSNLSNNVAHDMGELPSSYGSRDENSDIDKSKSAKFDNEGS
                     LDSSSPKIIAYRKSKRTISEGNFQNILDQSVKATPKEKYDPKLYVEEKFSDTDYRFAT
                     TRRTAEFHQLFRSLDLTDRLLDDFSCALSREILLQGRIYISENNVCFSSNLLGWVTSL
                     IIPQEEIIRIEKKTTAGLFPNGISIETASGKHNFASFISRDATFDFMKAVWQGTTGRK
                     MEIIEEKPMEKPGYSLDSDGIVSVENECLDSPAKLESYILSIDGDEERHGDNEYASDH
                     SDSEDTSDDAVSLKKTNSNKSNKRKKIDTVDLKVLKFKPDSKYINMGPEFHPPTKVKD
                     YAKENNETELCNEVINAPLGIVFDLLFGSSNTTFHRSFLESHNASEISDYDKFHPKKD
                     DPSKLERKISYRRALGYSIGPKSTRCEVKETIENLNFAENVVLISSTVTPDVPSGNSF
                     SVKTRYCLSWGANNSTILKMSYNIKWTGSSWIKSVIEKQTLAGQQEATKDLIEALKKG
                     IDENTYYAEGPSVPKNVAEFVAENKPTSEMAEEAITLNREESEKKITLSLSSRFIKNN
                     IVPIVYFFFSFLVILSILQMKIISGVNEANEIARSQLVVNSYLVFTVQALANDKSISK
                     AGYRERIKAMENDNSPLWKWVNDKYDTKLNNLEKIEYLTYQLNSLYQKQIDPENNEFV
                     AAIEENLLDLKRSVKDFNYQELLNADNLRNMLGDLI"
     gene            complement(<831973..>832965)
                     /locus_tag="DEHA2F09658g"
                     /db_xref="GeneID:2903623"
     mRNA            complement(<831973..>832965)
                     /locus_tag="DEHA2F09658g"
                     /product="DEHA2F09658p"
                     /transcript_id="XM_460781.1"
                     /db_xref="GeneID:2903623"
     CDS             complement(831973..832965)
                     /locus_tag="DEHA2F09658g"
                     /note="weakly similar to uniprot|P53234 Saccharomyces
                     cerevisiae YGR053C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09658p"
                     /protein_id="XP_460781.1"
                     /db_xref="GeneID:2903623"
                     /db_xref="UniProtKB/TrEMBL:Q6BLZ0"
                     /translation="MIYRRGSKVLLRHSRLKYSSCKKQYVSSLRNIKLESPVPSLIAP
                     PLFYNRTILSPNNVKNLDNFKFSDSVPTRSDLSSEDLKPNPKDQLRKANLGTMTDELR
                     ALIPNILNKSLPKKIVSNNVHLRICPTHFQEFNAYFPTLKGHVSYYTTCKTLQFILTS
                     IVLNPKVKLHIQSIKTNAAKGDLGPEIQSVYSGSTKIYIRWNTCLEGCDHLSPNEIME
                     GQHSGNISNYHSTSDAKLGSHKWSKLDTKKLVNNSNGQPIKSSPSVTTTLSHLTSGLI
                     GLTKEHNKLERVISGIFIFELNENNDKIIVHTVEDVNVIEKTETQDIDGELRVC"
     gene            complement(<833251..>833931)
                     /locus_tag="DEHA2F09680g"
                     /db_xref="GeneID:2903624"
     mRNA            complement(<833251..>833931)
                     /locus_tag="DEHA2F09680g"
                     /product="DEHA2F09680p"
                     /transcript_id="XM_460782.1"
                     /db_xref="GeneID:2903624"
     CDS             complement(833251..833931)
                     /locus_tag="DEHA2F09680g"
                     /note="similar to uniprot|P34227 Saccharomyces cerevisiae
                     YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with
                     thioredoxin peroxidase activity has a role in reduction of
                     hydroperoxides"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09680p"
                     /protein_id="XP_460782.1"
                     /db_xref="GeneID:2903624"
                     /db_xref="GOA:Q6BLY9"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q6BLY9"
                     /translation="MASQEHTTLRLGSTAPNFEAETSNGKISFHDFIGDSWAVLFSHP
                     DDFTPVCTTELGAFAKLEPEFTKRNVKLIGLSANGTESHKAWIKDIDEVTGSKLTFPI
                     IADSERKVAHLYDMIDYQDATNVDDKGLQFTIRSVFVIDPAKKIRLILAYPASTGRNT
                     AEVLRVVDSLQTGDKYKVTTPINWVPGDDVIVHPTISNEDAKTLFPKFRIIKPYLRLT
                     PLDVKEEK"
     gene            complement(<834319..>835467)
                     /locus_tag="DEHA2F09702g"
                     /db_xref="GeneID:8998928"
     mRNA            complement(<834319..>835467)
                     /locus_tag="DEHA2F09702g"
                     /product="DEHA2F09702p"
                     /transcript_id="XM_002770737.1"
                     /db_xref="GeneID:8998928"
     CDS             complement(834319..835467)
                     /locus_tag="DEHA2F09702g"
                     /note="similar to uniprot|Q12006 Saccharomyces cerevisiae
                     YOL003C DHHC-CRD protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09702p"
                     /protein_id="XP_002770783.1"
                     /db_xref="GeneID:8998928"
                     /db_xref="GOA:Q6BLY8"
                     /db_xref="InterPro:IPR001594"
                     /translation="MVAYGSHYFVFRTNLSRTEQILYEVYVCIVWLSYYLAIVVDPGS
                     PPKNFTPKAGEWRRWCKKCQNYKPERSHHCKTCNKCVLKMDHHCPWTYNCVGHNNLPH
                     FLRFVFFLIVGMTYVLFQLGKQVLHYYDSSKLPSYLIDKKEMCAVIFLLPVTFFVFVS
                     IIILFVRCMINLLFRGMTQIEVWEMERIGSQFHTERLWLQIRKNYFKLHGKEMPHLVS
                     WNRTTRYYEVDENSNNDNSNENNIVPKDFTSDDIVFPYDLGVSSNMINACDYPWMWLL
                     PWGGPRENGYHFQKNEFMEDDQLGLPWPPDGGHQEPMAPVDDDFDISDSELQDMPSLR
                     RRLDPRNNMTRSEWMNDLGETLDDFGVDLDAEDIEHDDLVSKDEISNN"
     gene            <835802..>836726
                     /locus_tag="DEHA2F09724g"
                     /db_xref="GeneID:2903626"
     mRNA            join(<835802..835804,835868..835916,835999..>836726)
                     /locus_tag="DEHA2F09724g"
                     /product="DEHA2F09724p"
                     /transcript_id="XM_460784.2"
                     /db_xref="GeneID:2903626"
     CDS             join(835802..835804,835868..835916,835999..836726)
                     /locus_tag="DEHA2F09724g"
                     /note="highly similar to uniprot|P21242 Saccharomyces
                     cerevisiae YOR362C PRE10 20S proteasome alpha-type
                     subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09724p"
                     /protein_id="XP_460784.2"
                     /db_xref="GeneID:2903626"
                     /db_xref="GOA:Q6BLY7"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6BLY7"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAMKAVENGGTSIGIKCKD
                     GIVLAVEKIINSKLLVPGKNKRIQTIDRHIGVAYSGLLPDGRHFVNRGRDEAQNFKNI
                     YKTPISVPHLMDRLGIYIQNYTCYNSVRPFGIVSIVGGVDENGPHLYMIEPSGTCWGY
                     TGAATGKGRQTAKSELEKLNFEELTVKEAVKVAAKIIHQAHEDNKDKDYELEISWCSK
                     EETSCRHESVPDALLQEAIKLAQEEDEEEEDDDEEDAEMES"
     gene            <836997..>839627
                     /locus_tag="DEHA2F09746g"
                     /db_xref="GeneID:2904197"
     mRNA            <836997..>839627
                     /locus_tag="DEHA2F09746g"
                     /product="DEHA2F09746p"
                     /transcript_id="XM_460785.1"
                     /db_xref="GeneID:2904197"
     CDS             836997..839627
                     /locus_tag="DEHA2F09746g"
                     /note="similar to CA4891|IPF1627 Candida albicans IPF1627
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09746p"
                     /protein_id="XP_460785.2"
                     /db_xref="GeneID:2904197"
                     /db_xref="InterPro:IPR024545"
                     /db_xref="UniProtKB/TrEMBL:Q6BLY6"
                     /translation="MSSEFEGSNSSYVSDGSDSSVVVALSQNINNDSNSGFEHDDRND
                     IDADSTRSSSPFLSNPELSYKEKFSPVASSFDDEEDISRRVQDMDTSIASLRETLGDL
                     NVGDKDKNNQSIIVDESFHNSTMDTTRYNETQAQFDRDLDFDQNSNDGKTESPRHKKA
                     ISPWKQLRSTSTAAPGHMGEIPKLHFNQSNFFNNDTKQSLTHDTTAVAKINELNKQVT
                     GYRIQIKLFKQFLQHLIDKTRYSNTDNVFDISELNHFQNNLNGLSPSRSTGIRSGSIN
                     TNAEIEDNLSQNYDELLKLNEDLYLNLEDFQNQLHDKEVQLNNANVYMNDCSRIINEI
                     LELLINDPSTDDPSRQALVKCLDGAASDAKLSKSLETKLYVVRLELRKKMERKDHSYP
                     SPPPSNPEKEQIELSGYITIIQGLIASLDKVQKEFLAHKQDTSKIQEDLKKEVESTQT
                     IRANYESLYNKFNQLCASLERSRSDDADSEMQKLRIENQKLRTINNTVDNKFNEYQKV
                     IDKLQSEVNDLQKHYSNSSIGETSEWLKSSNDGFHHNDLLLSHKEVNQLQEQLNNLTE
                     RYRKLQDDSSNTISTLTNQLNNKKQESLSLGANQRITDQLKNDLELAVEKQRVLKAEK
                     IRLSYSLESLAKDKVSLQTTIRSLTEKITSLTVEAPHYKKDEMNEGLKKLNVLEYQLS
                     ELLSRDVHEFQKFLKSFIKIADDSSLKEPKRKIDTLAKKISQERNSDRTDEMTSWDIS
                     ELNTIREYHKSVFDYFARAVDIIVNDHVKLLLKEGENTSQTNEYVNKLHKRIDELNNV
                     NDNLTRQLDSYYTDDSHNDTTQNTSITSTGSKMRITELTNRWKAEREARVYENQEAKK
                     RLKELDRENARLRQELDQVS"
     gene            <839775..>841934
                     /locus_tag="DEHA2F09768g"
                     /db_xref="GeneID:2904198"
     mRNA            <839775..>841934
                     /locus_tag="DEHA2F09768g"
                     /product="DEHA2F09768p"
                     /transcript_id="XM_460786.1"
                     /db_xref="GeneID:2904198"
     CDS             839775..841934
                     /locus_tag="DEHA2F09768g"
                     /note="weakly similar to uniprot|P06103 Saccharomyces
                     cerevisiae YOR361C PRT1 Subunit of the core complex of
                     translation initiation factor 3(eIF3) essential for
                     translation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09768p"
                     /protein_id="XP_460786.2"
                     /db_xref="GeneID:2904198"
                     /db_xref="GOA:Q6BLY5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /translation="MNDNMSEQEYRSLEKEVQLDDLDFSDLEAKYAVNSDFGMDNYVV
                     VDGAPIAPEAKVPILIKVLKKLFNTVGEVVEGDEGIHMPLQDGKSKGYLFVQFKTPQM
                     AEAAIQQLHGKKLDQKHRLLVNKLSDIEKFGAEGNVEIDFHEPEIPPFKSHGYLRSWL
                     QDEQGRDQMALHFSETVGVYYNKKKNDPEPVIEPRKGFTSKYAKFSPLGTYLFSVHPQ
                     GVQSWGGDGFQSITKFIHNQVRLIDFSPNEKYMVTLSPLPIALPDDPAERSIFPFGPE
                     SNGHKLVIWDMATGEPARTFALPPHLEGQKDMPWPLVKWSHDDKYCARQGPGALAIYE
                     TPSFQLLDKKLVKVDDVVDFEWAPAAVHLSDSKVKEGEYILSYWTPESSNQTARVALM
                     QIPSRKVIRTINLFQVSDCKMHWHGEGKFLCVKVDRHTKSRKTFFSNLEFFKVTEKDI
                     PVEKLELKDVVFNFAWEPRSERFITISRLDDGNQNPSIAKNTISFYAPQVSSKGRVTS
                     SKYTCFKEIHDKHSNTVCWSPKGRFVVVATISKSSGELEFYDCSYEEDKPANSKVNGN
                     VKLLKAEKYSGMTNLAWDPSGRFVAAWSSSWAHSIENGYRLFEFTGNMLKDNSIDHFK
                     EFIWRPRPASLLNAADRKKVRKNLREYSAQFDEADAMEADAASREAILLRRKLLEQWR
                     SYRAKHAANGSKKNEVQAEIIEEIKEEIIEEKEEVVE"
     gene            complement(<842075..>842425)
                     /locus_tag="DEHA2F09790g"
                     /db_xref="GeneID:2904199"
     mRNA            complement(<842075..>842425)
                     /locus_tag="DEHA2F09790g"
                     /product="DEHA2F09790p"
                     /transcript_id="XM_460787.1"
                     /db_xref="GeneID:2904199"
     CDS             complement(842075..842425)
                     /locus_tag="DEHA2F09790g"
                     /note="similar to YALI0F16071g Yarrowia lipolytica"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09790p"
                     /protein_id="XP_460787.1"
                     /db_xref="GeneID:2904199"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q6BLY4"
                     /translation="MLRNVISKQAYLAKPYAGIRLPITKAQTGLRLMSTVEEQLMDDY
                     EKKIFGILKDNFQPKTLQVKDVSGGCGSMFAILVESEKFKGIPMIKQHRLVNEVLKDE
                     ISKWHGIQLKTKSA"
     gene            <842590..>844650
                     /locus_tag="DEHA2F09812g"
                     /db_xref="GeneID:8998929"
     mRNA            <842590..>844650
                     /locus_tag="DEHA2F09812g"
                     /product="DEHA2F09812p"
                     /transcript_id="XM_002770738.1"
                     /db_xref="GeneID:8998929"
     CDS             842590..844650
                     /locus_tag="DEHA2F09812g"
                     /note="similar to uniprot|P39722 Saccharomyces cerevisiae
                     YAL048C GEM1 Evolutionarily-conserved tail-anchored outer
                     mitochondrial membrane GTPase which regulates
                     mitochondrial morphology"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09812p"
                     /protein_id="XP_002770784.1"
                     /db_xref="GeneID:8998929"
                     /db_xref="GOA:B5RUD1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B5RUD1"
                     /translation="MSQDTIRIVVCGDEFVGKSSLIASLIKEKFVSNIQRVIPPVTIS
                     RDDYTNSLSEYVSKAGNSNKADVNRSEGKYTKNGFKDNDNGNQKVSKYVPRTTTIIDT
                     TSSDKTILQKELKRADVIWLVYSDHYTYERISLHWMTMFRSMGVNLPIVLCANKSDLL
                     TQDSSISIKTQNSDEFVSLINEFKEIEACVRCSAKENYNVVEAFYLCQRAITHPISPI
                     FDSKEGNLRPAAVAALKRVFFLCDKDQDGYLSFSEFSILHQKCFNHASSEQEYQNILS
                     AINRIIYPDVNSKGETIGISVDGFIILNKMYAERGRHETIWGILRTFHYTNSLSLNDK
                     FLFPQLNVNPISSVELGPIGYKFLVDLFLKFDKDNDGGLNEEELANLFLPTPGIPRLW
                     KESQFPSSIVCNEEGYVSLQGWLAQWNLTTFLDYKTTLEYLAYLGFDDNSLVSAVKVT
                     KPRKRRQKQGKFYRQPVNDRNVFNCFILGAPKSGKTSLLESFLRGSYSDVYSPTIKPR
                     LCVKDIELRGGKQCYLILEELGELEPAILENKRRLDQCDVICYTYDSSDPESFQYLVD
                     LREKYSALLDEVPSVFVALKADLDKQEQRSDVQPENYTRDLFLSSPLHISSTWTTSLH
                     ELFIQLVDAAKMPSSFTPGLEREPENPNNENVKHIVMAGGAISLMAIVSIWIWKSSLQ
                     SSRA"
     gene            <844784..>845386
                     /locus_tag="DEHA2F09834g"
                     /db_xref="GeneID:2904202"
     mRNA            <844784..>845386
                     /locus_tag="DEHA2F09834g"
                     /product="DEHA2F09834p"
                     /transcript_id="XM_460790.1"
                     /db_xref="GeneID:2904202"
     CDS             844784..845386
                     /locus_tag="DEHA2F09834g"
                     /note="similar to uniprot|Q08746 Saccharomyces cerevisiae
                     YOR294W RRS1 Essential protein that binds ribosomal
                     protein L11 and is required for nuclear export of the 60S
                     pre-ribosomal subunit during ribosome biogenesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09834p"
                     /protein_id="XP_460790.1"
                     /db_xref="GeneID:2904202"
                     /db_xref="GOA:Q6BLY1"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:Q6BLY1"
                     /translation="MSEQQFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKE
                     EYLTSVTRDNVQLLINQILSLPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAI
                     PKTKAPTKWEQFAARKGIKAKAKDGKMVFDEATGEWVPKWGYKGKNKELDDQWLVEVD
                     DKVKGTEDELIDPRTLNRAERKRLVKKNELQHKRNLKNQS"
     gene            <845781..>846803
                     /locus_tag="DEHA2F09856g"
                     /db_xref="GeneID:8998930"
     mRNA            join(<845781..845825,845900..845995,846077..846479,
                     846604..>846803)
                     /locus_tag="DEHA2F09856g"
                     /product="DEHA2F09856p"
                     /transcript_id="XM_002770739.1"
                     /db_xref="GeneID:8998930"
     CDS             join(845781..845825,845900..845995,846077..846479,
                     846604..846803)
                     /locus_tag="DEHA2F09856g"
                     /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
                     YMR233W"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09856p"
                     /protein_id="XP_002770785.1"
                     /db_xref="GeneID:8998930"
                     /db_xref="GOA:B5RUD2"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014876"
                     /db_xref="InterPro:IPR019835"
                     /db_xref="UniProtKB/TrEMBL:B5RUD2"
                     /translation="MSDGYKPDEYLSTIDAILSVANLEQVTVKKIRNALQELFGVNLK
                     PHKKEINEVILERYYDLVNKRKEDTRTEEERKKEVEKQDALMAVRLSKSNLKTPVKRQ
                     KKASPKKTKEKDPAKNRNSAFFQEQHLSNELADVLGVEKCSRPQVVKQLWTYIKDNNL
                     QNPDDKRQIICDTKLQALFKKKSVGAFEMNKFLSHHIFKPEEVHQPTNEPDQNSDSSV
                     NNEKPKPVKSKTTKSESKAQDSSPESEEQ"
     gene            <847079..>851083
                     /locus_tag="DEHA2F09878g"
                     /db_xref="GeneID:2904205"
     mRNA            <847079..>851083
                     /locus_tag="DEHA2F09878g"
                     /product="DEHA2F09878p"
                     /transcript_id="XM_460793.1"
                     /db_xref="GeneID:2904205"
     CDS             847079..851083
                     /locus_tag="DEHA2F09878g"
                     /note="similar to uniprot|Q08748 Saccharomyces cerevisiae
                     YOR296W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09878p"
                     /protein_id="XP_460793.2"
                     /db_xref="GeneID:2904205"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR014772"
                     /db_xref="InterPro:IPR019558"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX8"
                     /translation="MSTRSKEPSSRSQSIASSMLMAEDKAYDNVDITKLYEAVLKITI
                     LEYCNEARFRTPIIEAPQPNSSNVSVNSSSTNSKLSKSSKSSEISDPKLPTYLLASLE
                     TRLNLIAMKKSGTHLDEMTRRSLLRLYSELLDPKFKADVASVNKPEYLVMKFVSCANK
                     ELVKVGTIPSSEMSSVIFKQAGSFVQILISLIQKDKNSDVIIAKLQEHKESLKPSNKS
                     KPTQSTASSSTAGSIVKYPQPSFRITDIDQGYINLLTELFSIDQVKLQQDIFKFKDLS
                     QPKALHKDINQILFYLDKDLGQFTSKSFSNEKAYDEWKEREKYGCEQLMSKYHIPSNM
                     KLLPVPPLPSGEDFYVFPTSSSTKPFFVILAKLCLEYEYKTNSAELSSFDKPFFSKQV
                     QNLVGICARFWRIDYPTRAVSLYTASHLSGILKDPFFESSNAKELGPIDIEMSTKMFF
                     ACKRIIEEQGKLDWDEKANWSFKDQDEWIKNSSYSYNETLFGIKESLVQIFNKSSKPK
                     FGPYLAFLGDFLESDVLFPSVEDMGLHRKWEKKLSKTLLRTSEIRYAELLSNLPRDNT
                     LDIIHILDISDSIVNDIRMLQKRYKNPLLGFLNVSRTVAAVITGMFAADAKNILKHID
                     AYAKTKNQVLPYGDILEAYKSLYEIRDIHNQVSSTGSIFKFNLEGFFYPFLQDWITES
                     GEKISSIIHRAMTNDDFQPIDLNRDDKKFSSSVLDIFTLIKEFLKILNSLNWSNEFQL
                     AKMYTTLLKSISDGVLYYANTTSDKIIKDLDEEEQAKLAAEANNDSLEKRKSANWFDE
                     VKNVVSNIQNNTNKFEIAESYNFKPELCIALNNLDAMMQQLTKLEDMLDPEMISNTVA
                     AFDPSLQKNYTSHIFSLRIIKAENLKSATSSSSVHPYITMIDTKVRKTIGKTRTISNN
                     CNPEWDEEFELTIPANSSLTISTTVWDERFGTHSICGRALLQLDPRRFKHDGIPQEVY
                     LDLDSQGRVLIEIAVESERVDAIFVMGRAHRCLKRCQERCIKLIVEKFSRFIHYCFSR
                     ANLKSICGSNGNIKPTQEQMDNAMMPLYNYLNSNLQVLAEYLSKHLLMKVMLATWAVV
                     VSSADELLLPKLASATTFHLSNIGSKLKPNNATNSNSGWQSAVSSAMANVTNSIGISG
                     FGKSLTNTELETVFGWLHFLCFDFFHNDGNGPPVKDLKNEQYQALLLVPVYYDGDVNY
                     LTSEVDRLSPAFVMMLRGRNNFDDSPSSETKKTKNGQRSMSRAGTIVRNKTIVANATA
                     KARAKADKEAQEAKSDPIAAQTLTEDIILRLLLIKDEKAFVARRLEQREKMAHSIATE
                     RLAKAAAEGRFARP"
     gene            complement(<851273..>855926)
                     /locus_tag="DEHA2F09900g"
                     /db_xref="GeneID:2904206"
     mRNA            complement(join(<851273..855376,855445..855572,
                     855672..855718,855868..>855926))
                     /locus_tag="DEHA2F09900g"
                     /product="DEHA2F09900p"
                     /transcript_id="XM_460794.2"
                     /db_xref="GeneID:2904206"
     CDS             complement(join(851273..855376,855445..855572,
                     855672..855718,855868..855926))
                     /locus_tag="DEHA2F09900g"
                     /note="similar to uniprot|P22579 Saccharomyces cerevisiae
                     YOL004W SIN3 DNA binding protein involved in
                     transcriptional regulation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09900p"
                     /protein_id="XP_460794.2"
                     /db_xref="GeneID:2904206"
                     /db_xref="GOA:Q6BLX7"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX7"
                     /translation="MTNQQDPWNNQQRPLSQPFNRQQPPVLPPPATLETGGQPFYPLP
                     SLPSLGNGAGHPQPGHGFSIPSINPGHEGIPFNQPPPEQPKPPQELRRPSNAALNNPP
                     SQLPPPATIAAGNEQHVNNGPPNMPQGVPNRSTTSSVYRPLNVKDALSYLDQVKIQFY
                     NQADVYNNFLDIMKDFKSQSIDTPGVIDRVSTLFRGHPNLIQGFNTFLPPGYRIECSL
                     DPSDPNPIRVTTPTGTTTRPNIGYGQSWNNDANQEQSGQMQHANQPPIPGSSPGRFIP
                     SHEQQQQQQQQQQQQNGGQIEFNHAISYVNKIKTRFANQPDIYKQFLEILQTYQREQK
                     PIGEVYEQVTVLFSNSPDLLDDFKQFLPDTSNQGYLQQQQENLFYGANNGTSQLPPVG
                     NFQPPTGSTGLSPNGSQGQFQQHGYPMVPGAPGKQDVAAILEANEDPSMMRRKKSSVS
                     EAYPYDYNYNSESQYSSLRSGAQPSKSNRIGSTINKSGAVVTNPTLVPGIPEPVPPSA
                     AAKSSMSEEISFFDKVKKAIGNKQTYNEFLKILNLFSQDIIDKETLVERVDSFIGDNH
                     PDLLNWFKMFVGYEVKPQNIESITFKKHQLELSLCRAYGPSYRQLPKAETYMPCSGRD
                     EMCWEVLNDEWVGHPTWASEDSGFIAHRKNQYEEILFKIEEERHEFDFIMESNLRTIQ
                     TLETIANRIANMTPEQKASFKLPPGLGHTSMTIYKKVLRKIYDKDRGFEVIDALHENP
                     AIAVPIVLKRLKQKDEEWKRSQREWNKVWREMEQKVFYKSLDHLGLTFKQADKKLLTT
                     RQLVSEISTVKVEQQNKRLHPLTPKPQEQLNYKFEDYEILVDILKLADVFINRSSNYS
                     ANDREKLSQFFQFFLSRFFNISTEQIKESLSEREKVDKPEEKNNVDGSVSDSSEGQID
                     NTSAKKRHRENDLLRDVLKKQSKSRKDDRAESPSQVSSESEDQEGAEDVNKLSELWIK
                     ATSSQPDLANNTTNNEEKRDKYNLFCNTIIYVFFRHLRTLYERLKEIKAMNATVGKEI
                     RSRKSPQFAKDLNLLSHQLEDMGIQISGSKDCYVQVLNLSEKLIEDEIEHQWFEETLR
                     QGYRNRAYKIYTIDKVVQAMVKHMHTIVTDSKTSEMMVLFEADRGNPISTAKDQILYR
                     MQVRSLMTTDENMFKITLKEGDNSVNIQFVSLDDLTINDHENAEEKYNYYVTSYVMSH
                     PTEGVSASKINMPFSKPFIESVDEDQCDGRVNTGLKVSVCENSYRLFFEADTHDEFTS
                     NFVYNKQSEDSKDKSDKVEKLKSLINNEETGWKSTVSEENTDICEEKVKLLFEKGANT
                     YTKFVKEKEAKNDAKEEEQGVGETGDEKKGENYEADNMDIESSNKDEKENSVPTKLLP
                     PPTISGKANHDNDADTTVIQENNDTTIQQDGNDTTTDETTVNQDDASMLVEGQQSEQT
                     STSGNDKQG"
     gene            complement(<856435..>857649)
                     /locus_tag="DEHA2F09922g"
                     /db_xref="GeneID:2904208"
     mRNA            complement(<856435..>857649)
                     /locus_tag="DEHA2F09922g"
                     /product="DEHA2F09922p"
                     /transcript_id="XM_460796.1"
                     /db_xref="GeneID:2904208"
     CDS             complement(856435..857649)
                     /locus_tag="DEHA2F09922g"
                     /note="weakly similar to uniprot|Q12405 Saccharomyces
                     cerevisiae YOR084W Putative lipase of the peroxisomal
                     matrix"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09922p"
                     /protein_id="XP_460796.2"
                     /db_xref="GeneID:2904208"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX5"
                     /translation="MQPSCSDLYESKLITVPAAFPRYPGSVILSQPSNNPEDYRLDVC
                     YRKYKTKSYVSDQPKINIVFLHGNGMNKGIWHYHIDKLYNHFKNKEKSEYQLNSVLAI
                     DVATHGDSAAINKDKLGYVYSWIDGSKDIIDIVKNQESKDFFSKNTINILVGHSMGGF
                     QALYTCYLDPELFDCCIPINPVCYMDNETAELHLFVLNMWHESGKIKSHFDIPEGSNW
                     KDVVEHHYKKESFFKKFDSTVMANMLEDEFTDELKNNTNGKYKTIDSNTPSNQEYICY
                     YNAQLFIPQGMKVLDKITTPVYHIVGDNDTAGEKAVKSTRTALQSVLKPIDIVDSTHI
                     VIGENPDLVVNELIKVIDDNIETHKKNGDTRYKEPKLLEKHGKDYRNSILDKEFDVYM
                     SASKNGTKLYKL"
     gene            <858158..>858607
                     /locus_tag="DEHA2F09944g"
                     /db_xref="GeneID:2904209"
     mRNA            join(<858158..858210,858292..>858607)
                     /locus_tag="DEHA2F09944g"
                     /product="DEHA2F09944p"
                     /transcript_id="XM_460797.1"
                     /db_xref="GeneID:2904209"
     CDS             join(858158..858210,858292..858607)
                     /locus_tag="DEHA2F09944g"
                     /note="similar to uniprot|P38902 Saccharomyces cerevisiae
                     YOL005C RPB11 RNA polymerase II subunit B12.5"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09944p"
                     /protein_id="XP_460797.1"
                     /db_xref="GeneID:2904209"
                     /db_xref="GOA:Q6BLX4"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX4"
                     /translation="MNAPDRFELFILPDGVDKIKITPDTKVPNAALIKIEREDHTLGN
                     LIRAQLLKDERVLFAAYKVEHPLFANFVLRIQTEDDYSPREALRNACSGLIGELDVIK
                     TRFKDEWALKSLLNSNDDDF"
     gene            complement(<858949..>860901)
                     /locus_tag="DEHA2F09966g"
                     /db_xref="GeneID:2904210"
     mRNA            complement(<858949..>860901)
                     /locus_tag="DEHA2F09966g"
                     /product="DEHA2F09966p"
                     /transcript_id="XM_460798.1"
                     /db_xref="GeneID:2904210"
     CDS             complement(858949..860901)
                     /locus_tag="DEHA2F09966g"
                     /note="similar to uniprot|P32562 Saccharomyces cerevisiae
                     YMR001C CDC5 Polo-like kinase with similarity to Xenopus
                     Plx1 and S. pombe Plo1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09966p"
                     /protein_id="XP_460798.1"
                     /db_xref="GeneID:2904210"
                     /db_xref="GOA:Q6BLX3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX3"
                     /translation="MSSVRTQPLQPLNNGQLNSRANNITPIKPVRHNKENQEEVKTKK
                     KKEKLSALCKTPPSIVRTRNGRDYRRGTFLGEGGFARCFQMKDSSGKIYAAKTVAKAS
                     IKNEKTKTKLLSEIKIHKSLKHSNIVNFIDCFEDDVNVYILLEICPNQSLMELLKTRK
                     RVSEPEVRYFMVQMVGAIKYLHSRRVIHRDLKLGNVFFDPDMNLKIGDFGLASILPSL
                     ESRKYTICGTPNYIAPEVLGGKNVGHSFEVDIWALGIMLYALLVGKPPFQAKDVQVIY
                     ERIKKTEYSFPVDKPISEEAKVLIKDLLSLNPLHRPNINEILNYDWFKGSFPDKTHEI
                     SLNGTPEGIDNISKAQSAINFTNTKASCGIYTPKTKNPVEILRSDLHSEQPRAMLPKS
                     LSPGDTRNKYQEVDPAQLGKPRRVNFNSTYSTTIKRLNQICFETYQNMRRLEYSKHDR
                     IDTMELPSCENPTLISKWVDYSNKYGFSYQLTNDDIGVLFNDENTFLKLHSSGRFLEL
                     IYHEGEGWTCIENSSSHPPSQVKRQLEIVDFFAKYMNSNLSKVSENEERKETVFLRRY
                     TRTSEYIMFEMTNGNFQFNFKDHHKVCISKSGLAITHISPNRITQTHPLIFILKHGDF
                     PSTEVPNCLEKIAIIKEAIKRKAFKE"
     gene            <862319..>864688
                     /locus_tag="DEHA2F09988g"
                     /db_xref="GeneID:2904211"
     mRNA            <862319..>864688
                     /locus_tag="DEHA2F09988g"
                     /product="DEHA2F09988p"
                     /transcript_id="XM_460799.1"
                     /db_xref="GeneID:2904211"
     CDS             862319..864688
                     /locus_tag="DEHA2F09988g"
                     /note="similar to uniprot|P04786 Saccharomyces cerevisiae
                     YOL006C TOP1 topoisomerase I"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F09988p"
                     /protein_id="XP_460799.2"
                     /db_xref="GeneID:2904211"
                     /db_xref="GOA:Q6BLX2"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX2"
                     /translation="MMSSSDDNVALSMIDGNIDQDDDMPLSQISSKSTDTTSVDSNST
                     EGQKSGSKRKASSPTGHKAKKVKRSKNTVKSESDEENTPLASTTAPPPKKTSKKKSES
                     GTAKPRNGTKKSKGAKSTGSNKTDAVKKEDEVAKTEKDPSSTREDEEDEEKYKWWEAE
                     DVDGEQKWESLEHNGVIFPPDYEPLPSHVKLYYDGKPVDLPLEAEEVAGFFGAMAETD
                     HAKNPTFQKNFFEDFCKVLKDAGGCNVNIIDFHRMDFSKMHAHFEMLRDQKKLLSKDE
                     KKAIKAEKDKFEEPYKTCLLNGHKEQVGNFRIEPPGLFRGRGAHPKTGKLKRRVMPED
                     VTLNLSEGCKIPEPPQGHKWAEVRHDNTVSWLAMWKENIADSFKYVRFAANSSIKGLS
                     DFKKFETSRKLRYHIDEIRKDYTKMLKDPLMQNRQMATACYLIDIFALRAGGEKGDDE
                     ADTVGCCSLRYEHITLKPPNKVIFDFLGKDSIRFYQEVEVEKQVFKNLRIFKKPPKQP
                     GDDLFDRISPPLLNKQFQNYMKGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKVVKF
                     NAANRTVAILCNHQRTVSKTHGSSVQKIHDKLKELEWHKIRTKKMILQLEPNLKTKDP
                     DYFEELDDLSKEDTEHIHRALIERAREAARKRFQRENDKLKIEDKPLLTEKDLEEKME
                     KVNELEKEYAEELKTGKPQIKKSVTVEKLKSQVDTLTNRILNTTFQLKDKEDNSEVSL
                     GTSKMNYIDPRLTVMFSKKFNVPIEKLFTKTLRDKFNWAIESADENWKF"
     gene            complement(<864962..>866206)
                     /locus_tag="DEHA2F10010g"
                     /db_xref="GeneID:2904212"
     mRNA            complement(<864962..>866206)
                     /locus_tag="DEHA2F10010g"
                     /product="DEHA2F10010p"
                     /transcript_id="XM_460800.1"
                     /db_xref="GeneID:2904212"
     CDS             complement(864962..866206)
                     /locus_tag="DEHA2F10010g"
                     /note="similar to uniprot|O59832 Schizosaccharomyces pombe
                     SPCC965 SPCC965.12 protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10010p"
                     /protein_id="XP_460800.2"
                     /db_xref="GeneID:2904212"
                     /db_xref="GOA:Q6BLX1"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX1"
                     /translation="MVGKHIDEDLIKRFETLSSETPIVDTHNDFPYLLRVQLHNEFET
                     VNRFKFDDKLQSHTDLGKFRRGRVGLQFFSCFIECKDDDYLYQDFNNPNSAVRDTMEQ
                     IDVVTRLVSSYSEDLEMVSMSSQVMDVYSNGKIAISMGVEGLHQVDSSLSVLRKYYEL
                     GVRYITLTHNCDNPFATAASSVVAGLPDNGLSDFGRSCVLEMNRIGMMVDLSHVSYKT
                     MLDALEITKAPVMFSHSSAYTMTPNERNVRDDVLLRLKENNGVICINFFPSFISPHSD
                     ENAIIDDAVNHIKHVVELIGWEHVGLGSDFDGIPEGPKGLEDVSKYPDLIIKVMGNLN
                     ASDSQIRLLMGDNVLRVWNENEKVAKSLQIAGTQLVNENWQKRDWSFFDYARSFRELY
                     PGAYEEKTNTYKDASLDLTKEK"
     gene            <867577..>868551
                     /locus_tag="DEHA2F10032g"
                     /db_xref="GeneID:2904213"
     mRNA            <867577..>868551
                     /locus_tag="DEHA2F10032g"
                     /product="DEHA2F10032p"
                     /transcript_id="XM_460801.1"
                     /db_xref="GeneID:2904213"
     CDS             867577..868551
                     /locus_tag="DEHA2F10032g"
                     /note="weakly similar to uniprot|Q08054 Saccharomyces
                     cerevisiae YOL007C Appears to be a structural component of
                     the chitin synthase 3 complex"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10032p"
                     /protein_id="XP_460801.2"
                     /db_xref="GeneID:2904213"
                     /db_xref="UniProtKB/TrEMBL:Q6BLX0"
                     /translation="MRVFNFILPVVTILTILKGVDADTNVVATTSRKPTNRVHAHHMH
                     RASHTPDGATQVTKGPQTTSVTVVKRADMPSLSESETKSYSYSLAIPNASKTSSSRKD
                     PYIYRSNLPENLVFIVVGAIIGFILLSFLGYRITAYILSNQRAKTDREVYTNFGHNSG
                     SGFAFGSESSNSSMLEKSSLGSVSSLHMLSRHNSLLQLQHDNDTSTLSNSQQGRSYRN
                     AISDNKSNRGSMFISPVLELMNTKSNSQLELPLYHKNASQTFNSSSASLIQNPAMMDS
                     PINDFQPTRDHTNGSSPDMSSVQTQLHPQQPQSKLKRPPSMVLDNLIN"
     gene            <868862..>869563
                     /locus_tag="DEHA2F10054g"
                     /db_xref="GeneID:2904214"
     mRNA            <868862..>869563
                     /locus_tag="DEHA2F10054g"
                     /product="DEHA2F10054p"
                     /transcript_id="XM_460802.1"
                     /db_xref="GeneID:2904214"
     CDS             868862..869563
                     /locus_tag="DEHA2F10054g"
                     /note="similar to CA1988|IPF19749 Candida albicans
                     IPF19749 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10054p"
                     /protein_id="XP_460802.2"
                     /db_xref="GeneID:2904214"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW9"
                     /translation="MLTRTINRTVASYSTKRLLHSSLPRFVKNDDSTIDNYRMPSQTS
                     INEWEFKYDFIPKVAEPKIPPVSREAIKQDIANEKKVQVEKEMLNSEVVSVKAEANDA
                     PVLHGGEAVKAEPEFLQDRGSTPVDASYATPRESAKPSKPANRGKYLQTSINPQINQS
                     EVVNMGANEVDHKSSDVKQERVVDDVEHDNLHTSGQENANKSSTSFGVPLALLGVGAG
                     GYYYYKSSDSDSQKK"
     gene            complement(<869675..>870109)
                     /locus_tag="DEHA2F10076g"
                     /db_xref="GeneID:2904215"
     mRNA            complement(<869675..>870109)
                     /locus_tag="DEHA2F10076g"
                     /product="DEHA2F10076p"
                     /transcript_id="XM_460803.1"
                     /db_xref="GeneID:2904215"
     CDS             complement(869675..870109)
                     /locus_tag="DEHA2F10076g"
                     /note="similar to uniprot|Q03667 Saccharomyces cerevisiae
                     YMR002W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10076p"
                     /protein_id="XP_460803.2"
                     /db_xref="GeneID:2904215"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW8"
                     /translation="MARQRRSAPTQRSQSRSAHTASAAPYQSAPAASRPVQQSQQGPG
                     LFGQMASTAAGVAVGSTIGHTLGAGITSMFGGSSSAAPVEHDQQQLAQAGQQSQYQEQ
                     ARHCDADARNFTRCLEENSGNMQTCEYYLQQLKACQEAARPY"
     gene            <870444..>871313
                     /locus_tag="DEHA2F10098g"
                     /db_xref="GeneID:2904220"
     mRNA            <870444..>871313
                     /locus_tag="DEHA2F10098g"
                     /product="DEHA2F10098p"
                     /transcript_id="XM_460804.1"
                     /db_xref="GeneID:2904220"
     CDS             870444..871313
                     /locus_tag="DEHA2F10098g"
                     /note="similar to CA4948|IPF5149 Candida albicans IPF5149
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10098p"
                     /protein_id="XP_460804.2"
                     /db_xref="GeneID:2904220"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW7"
                     /translation="MKCGFSTSGLRLQNVQPNYYEVLELPHSASIREIKTQFKKLSKK
                     YHPDLNTHLTNDDKKANSDKFVTIVNAYDTLKDMKKKKNYDLSLKSSGQLHNKNGSAT
                     RRNQEWHNKYYGEAKYYSKSNAYSKSSYSASGLNTKRHKVRHDNDFQNNSSFSGEHRN
                     YGDKHGVPHFNYNEHLLKHLKFEQRIINRQLTDDDREAIMRQLSKSGDLKNMSEELIT
                     KHLMRQVHHTKNRANSAGSGQWGTPGSSTNTQSRNPYMYHGPQDDSEGLKITILCLGA
                     GGSLYLLYQAFFS"
     gene            complement(<871604..>873052)
                     /locus_tag="DEHA2F10120g"
                     /db_xref="GeneID:2904221"
     mRNA            complement(<871604..>873052)
                     /locus_tag="DEHA2F10120g"
                     /product="DEHA2F10120p"
                     /transcript_id="XM_460805.1"
                     /db_xref="GeneID:2904221"
     CDS             complement(871604..873052)
                     /locus_tag="DEHA2F10120g"
                     /note="highly similar to uniprot|Q9UUU1 Yarrowia
                     lipolytica YALI0F17248g nucm NUCM protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10120p"
                     /protein_id="XP_460805.1"
                     /db_xref="GeneID:2904221"
                     /db_xref="GOA:Q6BLW6"
                     /db_xref="InterPro:IPR001135"
                     /db_xref="InterPro:IPR014029"
                     /db_xref="InterPro:IPR022885"
                     /db_xref="InterPro:IPR029014"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW6"
                     /translation="MLRVKNISNSVRLASRARHGSLSSRAFSNFSRLNAAVNDESNVK
                     PFKHALGRDAQRYSDEPGTFGKTTFTESMDEVDMTWGRDDDPKHVEKQNTKIRHFTIN
                     FGPQHPAAHGVLRLILELHGEEIVRADPHVGLLHRGTEKLIESKTYMQAIPYFDRLDY
                     VSMMTNELVFALAVEKLLNIEVPLRAKYIRTLFGEITRILNHCMSVLSHIMDVGGLTP
                     FLWGFEEREKLMEFYERVSGARLHSNYVRPGGVSQDMPVGLLDDIYMWATQFGDRIDE
                     TEELITDNRIWAARTKDVGVVTAEDALNYSLSGVMLRGSGIPYDIRKAQPYDAYELVD
                     FDVAVGMNGDCYDRYLIRMAEFRQSLRIIYQCINDMPNGPIKTEDFKVSAPPRSMMKE
                     DMEALIHHFLLYTKGYAVPQGETYTAIEAPKGEMAVYVVSDGSERPYRCKIRAPGFAH
                     LGAFDHISRGNLLADAVAIIGTMDLVFGEVDR"
     gene            <873748..>874257
                     /locus_tag="DEHA2F10142g"
                     /db_xref="GeneID:2904222"
     mRNA            <873748..>874257
                     /locus_tag="DEHA2F10142g"
                     /product="DEHA2F10142p"
                     /transcript_id="XM_460806.1"
                     /db_xref="GeneID:2904222"
     CDS             873748..874257
                     /locus_tag="DEHA2F10142g"
                     /note="similar to CA4888|IPF1631 Candida albicans IPF1631
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10142p"
                     /protein_id="XP_460806.2"
                     /db_xref="GeneID:2904222"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW5"
                     /translation="MNFASKRKREEVEPDTKKVKNFINEKERQEFSSSNEWPVYNHPD
                     GGIVKITPWGSVRQYMDASGNTVTKFEDMNFQDISFANSHQTANVYEMPSTPVSMNQN
                     SNNYSSPSMYDVDGIKLSPSDEAENYVINGYGRSQGNGAQQQQFQQEHENYFGMEDHD
                     LEYDEMVKI"
     gene            complement(<875027..>876475)
                     /locus_tag="DEHA2F10164g"
                     /db_xref="GeneID:2904223"
     mRNA            complement(<875027..>876475)
                     /locus_tag="DEHA2F10164g"
                     /product="DEHA2F10164p"
                     /transcript_id="XM_460807.1"
                     /db_xref="GeneID:2904223"
     CDS             complement(875027..876475)
                     /locus_tag="DEHA2F10164g"
                     /note="similar to CA4970|IPF4696 Candida albicans IPF4696
                     unknown Function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10164p"
                     /protein_id="XP_460807.2"
                     /db_xref="GeneID:2904223"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW4"
                     /translation="MTSEVPGYYDQENSEGLPIYTAPSEPLPQYEPSLEYFGLSLIKT
                     EFSSPYHYNNGNRSWKPVLLEINSTQLNIYDLKVEKKVLELIVALYNDSNQLNDVMQI
                     VQNEKMNNDGDDDLDEMWNDAYQGEVDDLKQSTSTKWKSSWHKSKYSKVLNKSISQYY
                     ELIKENRMLFEPTRSATEYSIFKTKFQGNQIASYTLNNMYVGEAPSLNHLVSSMYKED
                     KSHINKHNISTLVKYKNTLRVRIELKQMLLQFWSFYGMLHWFRALSIAKDLSSPLENR
                     SVTKLKSIPSRNSRNNNLLAATEAAAMLGMASEDHDLTYFTDPFNSHSPKHIISENSD
                     YADVSTVSSGSNTPYSVFSNERRESVGSTSTDISTIPNNRYNKNINKFSLVSYDKVFA
                     TTVEKQYISNCIPDLNSFDKWCGLDVTVSNYKQYLSPSQQNASSKNIFISSSALDNAS
                     WGISKVLKKQPQQSNCSKNFVIDSKGLVSLAH"
     gene            877778..877850
                     /locus_tag="DEHA2F10186r"
                     /db_xref="GeneID:8998931"
     tRNA            877778..877850
                     /locus_tag="DEHA2F10186r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (TGC) cove score=80.01"
                     /db_xref="GeneID:8998931"
     gene            complement(<877992..>880208)
                     /locus_tag="DEHA2F10208g"
                     /db_xref="GeneID:2904225"
     mRNA            complement(<877992..>880208)
                     /locus_tag="DEHA2F10208g"
                     /product="DEHA2F10208p"
                     /transcript_id="XM_460808.1"
                     /db_xref="GeneID:2904225"
     CDS             complement(877992..880208)
                     /locus_tag="DEHA2F10208g"
                     /note="weakly similar to uniprot|P32807 Saccharomyces
                     cerevisiae YMR284W YKU70 Forms heterodimer with Yku80p
                     known as Ku binds chromosome ends and is involved in
                     maintaining normal telomere length and structure in
                     addition to participating in the formation of silent
                     chromatin at telomere-proximal genes"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10208p"
                     /protein_id="XP_460808.2"
                     /db_xref="GeneID:2904225"
                     /db_xref="GOA:Q6BLW3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW3"
                     /translation="MSFSDDENESYKQFEIHEGIAFLIELTPDIFLPLKELDNKSQFI
                     EILSSINELVSELIITLPNTGIGIYFYNCQKTNKKFTKDCGLNRLFKLNDLNSFNMKI
                     LNDAVNDDANGISLLKDKFPYIEHGYNEDNLPAVLNTMLNEFHNKKNYNNKKLIWFTN
                     NDKPFNNDKSKHNLWKIINDYDEFRIQITPFFLDSYTDEKQSKKKVFDPSLYQDIFLN
                     TNYLNNRKSNDKNDDDEERIDIKSEFDPDRLNDIVFDGISKSTPRFKETTLSTQIKSM
                     IFRLKEVKRILFSCDLILGDGEGVSGNFGCSVKGYTIYNHEKLKKFNKIYNSGEELKI
                     VHTRSKILNDRTGEKVEVETKGNQSVTERNEDANIRKGFPIGNDHVLYLNSKQINFLK
                     NYAFDHNSDNRAGGNSEDEDDDEFDNQNEDLDDHGFSKPPYLKLLGFRSLSTYQPHYN
                     SSAPIFVTPDMNDGLKTASAEGGYKNSFKTFSSLYQSCIKLQKYGVLFGCLKKNSMPN
                     LYALYPTKATNSNKSGLNFPEGFFLIRLPWLDDVRSLPEYSFLNNVNLNELSGESVPP
                     EILLNFKHIISQFFLREYRPSDFPNPSINYFYKIINNELLQEELSPESKTVANNDTTT
                     QKLIELRGYLQQEELQTMLKTLNVRLNKLSNESLKREMESSDGADNKKRKKEVPELNE
                     EAVLTAWKSNEWNHFNVSQLKQFVSKYKGLIKSGTKKQDIINNIISFLNKKYETEK"
     gene            <880434..>880871
                     /locus_tag="DEHA2F10230g"
                     /db_xref="GeneID:2904321"
     mRNA            <880434..>880871
                     /locus_tag="DEHA2F10230g"
                     /product="DEHA2F10230p"
                     /transcript_id="XM_460809.1"
                     /db_xref="GeneID:2904321"
     CDS             880434..880871
                     /locus_tag="DEHA2F10230g"
                     /note="similar to uniprot|Q00381 Saccharomyces cerevisiae
                     YJR058C APS2 Small subunit of the clathrin-associated
                     adaptor complex AP-2 which is involved in protein sorting
                     at the plasma membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10230p"
                     /protein_id="XP_460809.2"
                     /db_xref="GeneID:2904321"
                     /db_xref="GOA:Q6BLW2"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW2"
                     /translation="MAIHFILVLNRQGKTRLAKWFDNNYTTQDKQRYTTEIHRLISSR
                     DSKYQSNFIEYQQNKLVYRRYAGLYFISSIDLIDSELDSLESLHFLVEVLDVYFDNVC
                     ELDLIFNFYKLYSILDEIFLGGEFQEISKDKILERLAYLDKLD"
     gene            complement(<880906..>881562)
                     /locus_tag="DEHA2F10252g"
                     /db_xref="GeneID:2904322"
     mRNA            complement(<880906..>881562)
                     /locus_tag="DEHA2F10252g"
                     /product="DEHA2F10252p"
                     /transcript_id="XM_460810.1"
                     /db_xref="GeneID:2904322"
     CDS             complement(880906..881562)
                     /locus_tag="DEHA2F10252g"
                     /note="similar to uniprot|P00572 Saccharomyces cerevisiae
                     YJR057W CDC8 Thymidylate and uridylate kinase functions in
                     de novo biosynthesis of pyrimidine deoxyribonucleotides"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10252p"
                     /protein_id="XP_460810.2"
                     /db_xref="GeneID:2904322"
                     /db_xref="GOA:Q6BLW1"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW1"
                     /translation="MGRGQLILIEGLDRSGKSTQSGILSERLPGGKLIKFPDRSTKVG
                     SIINEYLTNSELNLSDQTAHLLFSANRWELADSIVNDLNKGHFIVMDRYIYSGIAYSL
                     AKSRFSNDSSPEMASIDWLYSPDKGLPKPDLTIFLTLSLEELSNRKGWGEERYEKENF
                     QKSVKNCFLEVLNADNDASVHIIDVNNLNIDQVTAKIWDLIEQKNLNKQTENSIERFT
                     "
     gene            <882909..>885944
                     /locus_tag="DEHA2F10274g"
                     /db_xref="GeneID:2904323"
     mRNA            join(<882909..882933,883057..>885944)
                     /locus_tag="DEHA2F10274g"
                     /product="DEHA2F10274p"
                     /transcript_id="XM_460811.2"
                     /db_xref="GeneID:2904323"
     CDS             join(882909..882933,883057..885944)
                     /locus_tag="DEHA2F10274g"
                     /note="similar to Candida albicans Q59TV6 Hypothetical
                     protein SVL3"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10274p"
                     /protein_id="XP_460811.2"
                     /db_xref="GeneID:2904323"
                     /db_xref="GOA:Q6BLW0"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:Q6BLW0"
                     /translation="MSSIEILTVGSNPNVAFYAWRLHETQSCNVSVVNSRIKGDSINW
                     RSPVLGTSTFKPYEIYQDLSQISPGSNKYDIVFISCTSLQDFQTVCADLVPFLHKKSA
                     IVVESTGYVNLEPFVQLSFPSMKDITICCIMNESDVRQIDGDNFTHILRNNDNRIYLG
                     TSLTNSNISSTSNPSFQKVYKLMQLVQQDSSNSISLLKSIVPKEFMTYQWKLALPRIV
                     FNPLSVIFEAEVPANLSNQILCKPLITGMINEIFKIIKKMDCKLVKGSENENNLFKNW
                     CSSFPEAPKNQNYLNSPPLFYEFYRQYDLNIDLLLLQPILLADDHGIRTPYLENIYST
                     MCQYIKINDADTNSIFFTRKSNSNMNKGKVNQINADHEFKLNQLNIISSDLARMESNK
                     NQLDSYLREKEILKGQVGEDINKQELNLRKLNINVDHQQQKLSQIEQRLEQLQLQEQK
                     IGNNQMKSIQPSELEERTLPQSETNRTFRDSVAPNDNLEDLADIALYGAALGSPVPNQ
                     NASHNGEADMNGSSVPNRALNMNGGNDQVHSNGNAHSNGNIQLLNGDLPQHLHEKELE
                     LQKRERVLINRELSLPNDNQMNGYYDNEQHRQPQHPQQQPHQQTPPALHLDTQQKNMN
                     MPPNQQQYYNQRQYNNNHGYMPSPMDQQLPHGLPSNGLPPNALPPNLRVNSMNSNMNR
                     YNMPPPQMVNGNPHQANGYGGKTQRLSSFPSSSHNYQDLHQQQYMQNPPQQQYYNNTY
                     QNGPPVDPGVESRFKAQPRKSNRRSAFPQMNGDLSGLDMGGRGGMPMPGGTNPAATKA
                     NKHRSAMPMNANGNRTSPPQHKKSASNYAIPQGQGQGQGQGQGQGQGQGQGQAQAQAQ
                     AQAQAQAQGHAQGHAQAQGTRINVLGQGQPSSEPQQYNHAQPQQQYLQLPNGSNASSN
                     SSNSVNTNDTPQTNDEGVQIHVPIADPNTNAKPLGGISNPNKEVETKKKRGLFRKH"
     gene            <886228..>886866
                     /locus_tag="DEHA2F10296g"
                     /db_xref="GeneID:2904324"
     mRNA            <886228..>886866
                     /locus_tag="DEHA2F10296g"
                     /product="DEHA2F10296p"
                     /transcript_id="XM_460812.1"
                     /db_xref="GeneID:2904324"
     CDS             886228..886866
                     /locus_tag="DEHA2F10296g"
                     /note="similar to CA0955|IPF13160 Candida albicans
                     IPF13160 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10296p"
                     /protein_id="XP_460812.1"
                     /db_xref="GeneID:2904324"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:Q6BLV9"
                     /translation="MAPKRLFYEDDEVIITKPGFNVEISDDLKEQESSHGNISFIKGM
                     GIRTAPVLEEYVNKTRLILHEKLSYYGAELGTQQSALCNEYRTIKNEVQSSIKEPVLP
                     NLIYILTSSLTGSILVNKRSLPLRFITPVIFGGVAFNYFMPRSYNVVQEKFTTYEKEN
                     LPDAYKNQITLAEKYQDFKKGLFEGLDNTSTQIENSVHDARLYLADIFSDKK"
     gene            complement(<886941..>888929)
                     /locus_tag="DEHA2F10318g"
                     /db_xref="GeneID:8998932"
     mRNA            complement(<886941..>888929)
                     /locus_tag="DEHA2F10318g"
                     /product="DEHA2F10318p"
                     /transcript_id="XM_002770740.1"
                     /db_xref="GeneID:8998932"
     CDS             complement(886941..888929)
                     /locus_tag="DEHA2F10318g"
                     /note="similar to uniprot|P50944 Saccharomyces cerevisiae
                     YNL101W AVT4 Vacuolar transporter exports large neutral
                     amino acids from the vacuole"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10318p"
                     /protein_id="XP_002770786.1"
                     /db_xref="GeneID:8998932"
                     /db_xref="GOA:B5RUD3"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:B5RUD3"
                     /translation="MSGPRKIQESTGSSSRRLSIAKLARSPISESPITSPSIRNGIHS
                     HSFTANSPFLKEDSSRNYNECIESSSSKSSSKYNGSEVFHSGNEVADIPTSNGVETDF
                     STGMDDPKIIKQVHKHLKDQKVNALQMEGGDITRDLYKIADQEYRPKAPKRSRSLSSS
                     EMETRRRGSTASSLNVPGGFRRQFIMNNTLRTRNPNFLTKNFVEFLSIYGHFAGEDLE
                     DQNDLIACHYKAHIPNFDDSIDEESLLLPNQESVKINAKGTATDKKAYFLLLKAFIGT
                     GVLFLPKAFSNGGLMFSSLVLAFFGLLSFWCYLILIHAKLATKVSSFGDIGLKLYGKW
                     LQQLILTSIIISQIGFVAAYIVFTSENLKAFVGSVTSINTSDIHIMYFILIQLIIFLP
                     LSLIRDITKLSLSALLANIFILIGLVTILYYSFYELLFLNHGAFGKDIEFFFNKESFS
                     LFIGVSIFAFEGIGLIIPIQESMIYPNNFPRVLFSVIATISTIFIGIGSLGYLTFGKY
                     VKTVIILNLPQDSPFVIMVQLLYAFAILLSTPLQLFPAIRLVESKLFTKTGKYSLRVK
                     WLKNFFRFGFVLLTAVVALVGGQNLDRFVSFVGCFACIPLVYMYPPILHLKSCCKYSD
                     TFNQAENRKRFWLGCLDCILVVIGGVAMIYTTYQIVVG"
     gene            complement(<889092..>892670)
                     /locus_tag="DEHA2F10340g"
                     /db_xref="GeneID:8998933"
     mRNA            complement(<889092..>892670)
                     /locus_tag="DEHA2F10340g"
                     /product="DEHA2F10340p"
                     /transcript_id="XM_002770741.1"
                     /db_xref="GeneID:8998933"
     CDS             complement(889092..892670)
                     /locus_tag="DEHA2F10340g"
                     /note="some similarities with ca|CA0953|IPF13166.3eoc
                     Candida albicans IPF13166.3eoc unknown function 3-prime
                     end"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10340p"
                     /protein_id="XP_002770787.1"
                     /db_xref="GeneID:8998933"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:B5RUD4"
                     /translation="MGISSKLSPEKHPYFNKPKTHRTNLSENSSFSLTGSEFSSTGSH
                     TSNSSDETSGIPMNKANNGAPRRVKNMPIALTPNIGGEKFNFATGPPTNKEASSREGA
                     RRSNERKPPTPPEKEPRSVSKVQRHPYTAQIRNRDHDAHIRMQQPDQAGNAYFRPRSN
                     EQYSQSPVSPQQVNQANNDYFKPSSNEKYSHSHASPQQINQSSRKEIPIVQHQNQQME
                     EHSPLPTEQMYSEKRQARKTQEHSSQAQPPTNNKPSMEHNTTNMLMNDGMIQAPQNMS
                     NILSQHEYDKNESTGVNESEDNSDDYSEEDLEADSEEYTDTSEESIRNDNVNASYSTP
                     YVNGAQQHPYYEQWMQYYASLAAQQQQQQMTPNRSSMYGYPMNPHQYSNINTANGQIS
                     SASQQEPYYSYGSNHLNRESHSRNSIASYSDNNNNDFLTHYKRRSGQNSISDTSNELI
                     SNSRRSTIKSNRYPSVPSSILESESKVPEKSKAARVSSLDLNFKPKEYQNYNDDYNED
                     QQGQTSLRNNEDAYEPTQSQDSTMSVAFGLSDMALDDKTEKRHISDYSKFLFEGDSQV
                     EEEEEEEEQEEEEKEYGTGNENKLLYQQPSHEMSRHESLESNNSLGSIRSEASNNFKV
                     KSPPPAKKLQERNSNIEEKNRQNKGKRKERHERKSSSFNPNSSISSQNDLLNMNNTAQ
                     AYQQQANMMPYLGHSQLPSMESMPFNQNAIPFNQPMMAYNTEYQGVVPPMAHSRRQSI
                     ATAESKRQSMMFAGNGMPPYGPQPMNNNRMSMPVMGMHTSNKPAQIRTNDSKIKKKVE
                     EFVELRKVIASGNKSLEYRLKWIKMLINATNYRLYAFVNIKGEPAPQEFSQHNKALFL
                     KSSINHLLKLIKEYEVGKKNDNIHSQVCYIYGCLLKHDYAASYNQDFGIEKDIQESIS
                     YFEKSLELNPNNFKSLYKLGEIFEYEFPDQFDQALRRYKEAAKLGYNQAIYKMALLYL
                     NVPSIRSTKFFNYFVELSNIDLSSKDVELTGEDRDELEEIIGLTFYQLGKIYEGIYPG
                     DLHAEDEFISKSLERAPVNYAKALTYCNKSAKLDCLLAQVKLGSVYEKGELNRQQNPS
                     KSIQWYMKAVSSPLSFKRHPDAMLGLSRWNLKGSDGLSKYIPSPDPEKAVMWCDRAIK
                     EFNSPDAYFAMAQLNEIGLGDRNPQHWYFKAHELGHHEASFKLGYA"
     gene            <893492..>894628
                     /locus_tag="DEHA2F10362g"
                     /db_xref="GeneID:8998934"
     mRNA            <893492..>894628
                     /locus_tag="DEHA2F10362g"
                     /product="DEHA2F10362p"
                     /transcript_id="XM_002770742.1"
                     /db_xref="GeneID:8998934"
     CDS             893492..894628
                     /locus_tag="DEHA2F10362g"
                     /note="similar to uniprot|P38071 Saccharomyces cerevisiae
                     YBR026C ETR1 2-enoyl thioester reductase member of the
                     medium chain dehydrogenase/reductase family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10362p"
                     /protein_id="XP_002770788.1"
                     /db_xref="GeneID:8998934"
                     /db_xref="GOA:Q6BLV6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /translation="MVKINASAITYTKGGEISKILSGTGFSIDTETLGPKQVVIQALA
                     TPINPSDLNQLAGTYASKPNFTSELDTPVPVAIGGNEGLYKVIEVGSDVTSYKNGDWV
                     IPKMPSFGTWRTHALVTLDKPENPDPFIKVSSEDDKSIDLTQAATVSINPSTAYQLID
                     QFIKDWDPKGNDWIIQNGGNSQVGKFVVQIAKIRNIKTISVIRDGKPDQDQIVKELLD
                     LGATKVITDKEAESEEYINKIVPGWVNEGKVILALNCVCGKSGSALVSHLTGNHLADY
                     RSPHLVTYGGMSGQPLMYSSSESLFKNVTSKAYWLTANTKRNPQSKVDTVKKVLALYK
                     SGDIKPVPFNGKEFNIKSTSDDYIKLFLKGIAESKTGKQVIVYN"
     gene            complement(<894717..>896144)
                     /locus_tag="DEHA2F10384g"
                     /db_xref="GeneID:8998935"
     mRNA            complement(<894717..>896144)
                     /locus_tag="DEHA2F10384g"
                     /product="DEHA2F10384p"
                     /transcript_id="XM_002770743.1"
                     /db_xref="GeneID:8998935"
     CDS             complement(894717..896144)
                     /locus_tag="DEHA2F10384g"
                     /note="weakly similar to ca|CA1332|IPF11716 Candida
                     albicans IPF11716 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10384p"
                     /protein_id="XP_002770789.1"
                     /db_xref="GeneID:8998935"
                     /db_xref="GOA:B5RUD6"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:B5RUD6"
                     /translation="MGPISHTPTLSKIPNIYNRRSSLGSVNDANKPVSHVQPQKRKIL
                     YKAKNEKPLNVAELIEDNDDSSLDVFKMYQHKYYLPHNKRISNIAWRIQNKKILALDR
                     QKKREDRDIQDKKQDQKSSNDKSDEFDYISQIRKMSQEQEGEGGMATLFENKKHSPYT
                     NSLTSDSSLFSGNRSASASTANPSTGDKSNENLLTSYINSLESTFKDDYKLPEKLSKS
                     TKNTKFLQCTNCNTKTTPLWRKSNKGDLLCNACGLFYKLHGVLRPLSQPDRKSSVSND
                     TLTSTNKTESSKPNSNMGGNSKYDLSPSMISHHHHHHYVDPAEDESRRQANQDQNDDM
                     NIDQFLEMDPPGRHTSMSNDNHSGLEMNPPQNRNSTSNNIDEIDMLLNMNLFQSESFV
                     IGNGKSKTGVNEQENRNNNSNTNDNSVTNDGYNFDAQGMFYDMQHVGEVGIGDEILAD
                     QPSEQGPNWNWLDFVSNGDNEMNSS"
     gene            <896686..>896943
                     /locus_tag="DEHA2F10406g"
                     /db_xref="GeneID:2904329"
     mRNA            <896686..>896943
                     /locus_tag="DEHA2F10406g"
                     /product="DEHA2F10406p"
                     /transcript_id="XM_460817.1"
                     /db_xref="GeneID:2904329"
     CDS             896686..896943
                     /locus_tag="DEHA2F10406g"
                     /note="similar to uniprot|Q6MVW1 Neurospora crassa B15B3
                     Hypothetical protein B15B3.030"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10406p"
                     /protein_id="XP_460817.1"
                     /db_xref="GeneID:2904329"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="InterPro:IPR017089"
                     /db_xref="UniProtKB/TrEMBL:Q6BLV4"
                     /translation="MADKVKDINQYNQLKSKYIGLGNADITREEFMTNVNRDIYSSLA
                     QHDNILYYNSVIINEPMELLRQKMIKKMASPIQNNAKKPEN"
     gene            complement(<897253..>898083)
                     /locus_tag="DEHA2F10428g"
                     /db_xref="GeneID:2904330"
     mRNA            complement(<897253..>898083)
                     /locus_tag="DEHA2F10428g"
                     /product="DEHA2F10428p"
                     /transcript_id="XM_460818.1"
                     /db_xref="GeneID:2904330"
     CDS             complement(897253..898083)
                     /locus_tag="DEHA2F10428g"
                     /note="similar to uniprot|Q7SAH3 Neurospora crassa
                     NCU06977 Predicted protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10428p"
                     /protein_id="XP_460818.2"
                     /db_xref="GeneID:2904330"
                     /db_xref="InterPro:IPR013920"
                     /db_xref="UniProtKB/TrEMBL:Q6BLV3"
                     /translation="MAINQPEQLITHKVTTIVSLVLSIYGNLRYLVGRSPFDSDSPFN
                     VSNTPFSSNILVTLIYWGILYLLQIIFVSQIFIPAQESARARVEYSQLVGWHFTIFNF
                     AQFIWSMLFARRHFILSEIVLLINFFNILSLYYSHKTYSIKPLSNWILIHLPTTALPL
                     SWLFYAIFWNGAVMFHIHKFVGRVVCNVLIWDFLIVPAMFILFYNDYGVGLSSSVLMF
                     GLGLGQLLTKAFALQWIFAFVIASILLVLSLTAAVAGSYYVKQDTRITDSEAAPLLSN
                     "
     gene            complement(<898315..>900024)
                     /locus_tag="DEHA2F10450g"
                     /db_xref="GeneID:8998936"
     mRNA            complement(<898315..>900024)
                     /locus_tag="DEHA2F10450g"
                     /product="DEHA2F10450p"
                     /transcript_id="XM_002770744.1"
                     /db_xref="GeneID:8998936"
     CDS             complement(898315..900024)
                     /locus_tag="DEHA2F10450g"
                     /note="similar to uniprot|Q04792 Saccharomyces cerevisiae
                     YMR250W GAD1 Glutamate decarboxylase converts glutamate
                     into gamma-aminobutyric acid (GABA) during glutamate
                     catabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10450p"
                     /protein_id="XP_002770790.1"
                     /db_xref="GeneID:8998936"
                     /db_xref="GOA:B5RUD7"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR010107"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B5RUD7"
                     /translation="MTLSKHINAEDLESKLLKQTKKTVLDNHEEYIFKYSANATVPKY
                     EIPEKSSNSELVYKYISEELSLDGIPTLNLASFVNTNIDDIPLRLASENITKNLADND
                     EYPSLIDIQGRCVTILSNLWNAPSTTDKESGKKVINSIGSATTGSSEAIMMAGLAMKK
                     SWQARQKANGKSIAEPNILMASCAQVALEKFARYFDVENRIIHINEKSGHLIDTTKIK
                     ENIDENTIGIFVILGSTFTGAFEPVEEISKLLDEVEKERGIDVKIHVDGASGGFVAPF
                     VYPHLKWDFSIDRVISINTSGHKFGLTSAGLGWIIWKDNKYLPDDVRFKLDYLGGVEE
                     TFTFNFSRPGFPVLFQYYNFLTLGREGYTKIFNSCIQNARLLSNFLEESGYFECLSVI
                     HKGIDKERQAKIFTREHNDSSKHSKKAVVNEEYEPGLPVVAFRFSKEIREKYPDIPQS
                     ILSLLLRNKGYIIPNYKLSPDEQDIEILRVVVRDTLGLNLLDKLMNEIVSTIELLINA
                     TDTITNLSTKEQSSEKNEMIYSMLLSIASNGGEDLKEIKQQILKDNNEQHRKHAKSYR
                     GTC"
     gene            <901293..>901619
                     /locus_tag="DEHA2F10472g"
                     /db_xref="GeneID:2904333"
     mRNA            <901293..>901619
                     /locus_tag="DEHA2F10472g"
                     /product="DEHA2F10472p"
                     /transcript_id="XM_460819.1"
                     /db_xref="GeneID:2904333"
     CDS             901293..901619
                     /locus_tag="DEHA2F10472g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10472p"
                     /protein_id="XP_460819.2"
                     /db_xref="GeneID:2904333"
                     /db_xref="UniProtKB/TrEMBL:Q6BLV2"
                     /translation="MHSKHPNKAQSLSVIEIALTSVNEINVGCGFTFKLFKVNKKGVE
                     ALFKKPINGHDQLIVKVFDPVKAKRDHKNYRAERTDMFNTCRKAYLCEKSAYEILSSS
                     GLLNNV"
     gene            complement(<902448..>902912)
                     /locus_tag="DEHA2F10494g"
                     /db_xref="GeneID:2904334"
     mRNA            complement(<902448..>902912)
                     /locus_tag="DEHA2F10494g"
                     /product="DEHA2F10494p"
                     /transcript_id="XM_460820.1"
                     /db_xref="GeneID:2904334"
     CDS             complement(902448..902912)
                     /locus_tag="DEHA2F10494g"
                     /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
                     YPL037C EGD1 Subunit beta1 of the nascent
                     polypeptide-associated complex (NAC) involved in protein
                     targeting associated with cytoplasmic ribosomes"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10494p"
                     /protein_id="XP_460820.1"
                     /db_xref="GeneID:2904334"
                     /db_xref="GOA:Q6BLV1"
                     /db_xref="InterPro:IPR002715"
                     /translation="MPVDPEKLAKLQKASVAKKVGGSRVKAKKNVKTEQDDTKLIEAL
                     GKLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQI
                     LPQLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEEDIPDLIEGQKFDDVE"
     gene            <903170..>904648
                     /locus_tag="DEHA2F10516g"
                     /db_xref="GeneID:2904335"
     mRNA            <903170..>904648
                     /locus_tag="DEHA2F10516g"
                     /product="DEHA2F10516p"
                     /transcript_id="XM_460821.1"
                     /db_xref="GeneID:2904335"
     CDS             903170..904648
                     /locus_tag="DEHA2F10516g"
                     /note="similar to uniprot|Q03795 Saccharomyces cerevisiae
                     YMR155W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10516p"
                     /protein_id="XP_460821.2"
                     /db_xref="GeneID:2904335"
                     /db_xref="GOA:Q6BLV0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6BLV0"
                     /translation="MYIIHRGIKKVNEFLPVTNHWLILFASIPVALSTGTIFVYSVYS
                     TELAQRCQLDASQTGSLNISATIGTAFGGLLGGLITDTYGTQLPILVSCVSISLGYKW
                     LYDSYRSGPNSNMVLLLFSMFLVGVGSVSGYFSAIKAVTLNFPNYKSSAQSVTIASFA
                     ISSLLFSFISSRVLKGDIGAFLYFMHVACGLLIMLGFLFIRVDGHFDDKKQYHEGQVE
                     CDEMTGLLISNQSECEDNSDYLEDNKDLKSMSLKKSLVHPIFWYHYFILSLIQGFGQM
                     YIYSIGFILKAIHYYYDNEVSQKSGTSSLQSHQALHVSLIAISSFIGRLSSGPQSDFL
                     VRKLHCQRHWILILGLSLMFAGHSINCIDLTYLCSDLRRANKILSLASCIIGYAYGFS
                     FTCYPAIISDLFNMRNYSFLWGTMYTSTTFGLALMTTIFGYYYDLNSTEWDHHVEKYV
                     CDKGSGCYKSTFQITSGLCVFTAILVLGYIYTKRSNKPPITL"
     gene            <904776..>906518
                     /locus_tag="DEHA2F10538g"
                     /db_xref="GeneID:2904336"
     mRNA            <904776..>906518
                     /locus_tag="DEHA2F10538g"
                     /product="DEHA2F10538p"
                     /transcript_id="XM_460822.1"
                     /db_xref="GeneID:2904336"
     CDS             904776..906518
                     /locus_tag="DEHA2F10538g"
                     /note="similar to uniprot|P23394 Saccharomyces cerevisiae
                     YDR243C PRP28 RNA helicase in the DEAD-box family involved
                     in RNA isomerization at the 5' splice site"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10538p"
                     /protein_id="XP_460822.2"
                     /db_xref="GeneID:2904336"
                     /db_xref="GOA:Q6BLU9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSKRPISVEELIGKSQSAEVISKPKFLSKSERQKLSLQRNQEIQ
                     DKKRQQSTVNNGAKKRYNNSIEDNPEPKKINKKLKKGRNFNFDWDEEEDTSNNYQPLV
                     RYDNRTNPPDLGLSDMHWSEKQIDDMTTRDWRIFKEDYNITSKGGDIENPLRCWAESK
                     LPAKLLNILIKNLGYDSPTPIQRASIPLALNGRDIVGIAETGSGKTLAFLLPLFSYIL
                     SVDSNYLLYEHQQESNFNKPLGLILAPTRELALQITKEAKLFGDKLNLNVVTIIGGHQ
                     YEETVHSVRNGVHIVVATPGRLIDSLERGIINLSNCYFFTMDEADKMIDMGFEKSLQS
                     ILNYLPASEKLETTIDGKIFNIKKRITLMFTATISPPIEKITKNYLMKPGYLFIGNVG
                     EAVDNINQQFEYFGARQSSDEILDPKKLDKLFSILRFHKDENRNYSIIIFANFKKACE
                     ELAYELSRKGFSDNTVIHGSKSQEARERAIDSFREGKDKILIATDVAARGIDIPNVSL
                     VVNYQMTKKFDEYIHRIGRTGRAGNKGTSCTFIDDGDSEVFLDLKKFLNKGKKKCPEW
                     LLKHSSTQSQILRD"
     gene            complement(<906543..>907562)
                     /locus_tag="DEHA2F10560g"
                     /db_xref="GeneID:2904337"
     mRNA            complement(<906543..>907562)
                     /locus_tag="DEHA2F10560g"
                     /product="DEHA2F10560p"
                     /transcript_id="XM_460823.1"
                     /db_xref="GeneID:2904337"
     CDS             complement(906543..907562)
                     /locus_tag="DEHA2F10560g"
                     /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
                     YDL209C CWC2 Protein involved in pre-mRNA splicing
                     component of a complex containing Cef1p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10560p"
                     /protein_id="XP_460823.2"
                     /db_xref="GeneID:2904337"
                     /db_xref="GOA:Q6BLU8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSYREPLGEYDCHIDNTRNMPPDTTIVSKSKKGKPARLQVDPES
                     IPDDDRPPQTGNVFNIWFLKWSGGDSSTKNYTKSKFRVNIKKDSGYTKAPSNAPLCLF
                     FARGCCYLGKKCSYYHRLPSDTDYFIPTQDCFGRDKTSDYKDDMNGVGSFSKSNRTLY
                     IGGLHMDDKMENTLTKHFQEFGSIDKIRVLHSKACAFVTFRTENEAQFAKEAMQNQSL
                     DGNEVLNIRWANEDPNPEAQRQEKRRLEEVTVNTVKNLLDSVSQTERKTKKVTVEVPD
                     EIEETESSSEIKALPSSETSSGLFNNSSLNALKQFQSKKRKIDKPQPKENLPTMLGYS
                     SSDEE"
     gene            complement(<911192..>912649)
                     /locus_tag="DEHA2F10582g"
                     /db_xref="GeneID:2904338"
     mRNA            complement(<911192..>912649)
                     /locus_tag="DEHA2F10582g"
                     /product="DEHA2F10582p"
                     /transcript_id="XM_460824.1"
                     /db_xref="GeneID:2904338"
     CDS             complement(911192..912649)
                     /locus_tag="DEHA2F10582g"
                     /note="similar to uniprot|P15202 Saccharomyces cerevisiae
                     YDR256C CTA1 Catalase A breaks down hydrogen peroxide in
                     the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p)
                     during fatty acid beta-oxidation"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10582p"
                     /protein_id="XP_460824.1"
                     /db_xref="GeneID:2904338"
                     /db_xref="GOA:Q6BLU7"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU7"
                     /translation="MAPVYTNSNGCPIPEPFATQRVGQHGPLLLQDFNLIDSLAHFDR
                     ERIPERVVHAKGSGAYGYFEVTDDISDVCSAAFLDTIGKKTKVLTRFSTVGGESGSAD
                     SARDPRGFSTKLYTEEGNLDLVYNNTPVFFIRDPSKFPHFIHTQKRNPETHLKDPTMF
                     WDYLTSNQESIHQVMTLFSDRGTPASYREMNGYSGHTYKWSNKKGEWYYVQVHFISDQ
                     GVKTLTNEEAGELAGSNPDFAQEDLFKEIAKGNAPSWTCYIQTMTQEQAKKAPFSVFD
                     LTKVWPHKDYPMRRFGKLVLNENPKNYFAEIEQAAFAPAHTVPYMEASADPVLQSRLF
                     SYADTHRHRLGTNYTQIPVNCPITGRVFNPHMRDGGMNVNGNLGSHPNYLATSKPVEF
                     KNFSIQEEQEVWEGAACPFHWKCTDKDYSQATALYNVLAKYPNQQKNLAHNVAVHVSG
                     AETHIQDKVFDMFAKVHPELSANIKKEALQLSPRK"
     gene            <912939..>913037
                     /locus_tag="DEHA2F10604g"
                     /db_xref="GeneID:8998937"
     mRNA            <912939..>913037
                     /locus_tag="DEHA2F10604g"
                     /product="DEHA2F10604p"
                     /transcript_id="XM_002770745.1"
                     /db_xref="GeneID:8998937"
     CDS             912939..913037
                     /locus_tag="DEHA2F10604g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10604p"
                     /protein_id="XP_002770791.1"
                     /db_xref="GeneID:8998937"
                     /db_xref="UniProtKB/TrEMBL:B5RUD8"
                     /translation="MRGALEHHQSRSRRIIEQTLKCGLSSSKTSVS"
     gene            complement(<913723..>914880)
                     /locus_tag="DEHA2F10626g"
                     /db_xref="GeneID:8998938"
     mRNA            complement(<913723..>914880)
                     /locus_tag="DEHA2F10626g"
                     /product="DEHA2F10626p"
                     /transcript_id="XM_002770746.1"
                     /db_xref="GeneID:8998938"
     CDS             complement(913723..914880)
                     /locus_tag="DEHA2F10626g"
                     /note="similar to uniprot|P53063 Saccharomyces cerevisiae
                     YGL246C RAI1 Nuclear protein that binds to and stabilizes
                     the exoribonuclease Rat1p required for pre-rRNA
                     processing"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10626p"
                     /protein_id="XP_002770792.1"
                     /db_xref="GeneID:8998938"
                     /db_xref="GOA:Q6BLU6"
                     /db_xref="InterPro:IPR013961"
                     /translation="MIKTFPLNSRAKTTALKQPKELFSFARDIDGEYIFDSTKVQDEN
                     LSYYYLPDASVDKQIDLGAGYSNFKKIPEEENLGDFPALLKGVMNYEQSTGTKINSDI
                     ITFRGLMTKILTLPYNLKDPLDLHVIVYDGQLFIKNNDEIELKRRQQNNQHEDPSKQE
                     MMKKFEYSGYKFEAVSTLPKPWGDCSRQLIEKRNKKVVNNYEQYISVVKTGIGKVKLL
                     LAGEVDCLWDYIPEDGKDILPHYVELKTSKVIEAPGQVVNFEKKLFRTWAQSFLIGIR
                     KIVYGFRDDNLILRNVEVYNTEEIPIMLKDTINVNTKIVCMNALKWYGAVIEWINNEI
                     PKDADKSWSLTYDPGSKSFSIVELMQDSELRNSVITEDFKEWRISLHKTES"
     gene            <915047..>917050
                     /locus_tag="DEHA2F10648g"
                     /db_xref="GeneID:2904340"
     mRNA            <915047..>917050
                     /locus_tag="DEHA2F10648g"
                     /product="DEHA2F10648p"
                     /transcript_id="XM_460826.1"
                     /db_xref="GeneID:2904340"
     CDS             915047..917050
                     /locus_tag="DEHA2F10648g"
                     /note="some similarities with uniprot|Q12232 Saccharomyces
                     cerevisiae YOR154W Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10648p"
                     /protein_id="XP_460826.1"
                     /db_xref="GeneID:2904340"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU5"
                     /translation="MIINDNRLTFLAIHLFITFQITRAELLQTSQSSCLTKSVCNVDS
                     CLLDAGNIFKPQTSLSKIDSLNYTTPSAPKSTQISTSTPPSTSISTSISTVLSTLTSI
                     ISTTSAEVISSLPENSVVSSSEDLFTEISKSDSGIITDDLNNAHFEVTSDVNSTNSTN
                     TTEPFIPVQNYTNKNIQLNQSNETIDECHFLSFEEWKRQKAVDNKQINDSQPQAETIA
                     NELVPTTSGIDNSTQIPVSLDEDQGKIYKDRFNYASVGCAATIVKTNSHAKGASAILV
                     ENKDSYLLNQCSSSQKFVVIELCQDILVDTVVIGNFEFFSSNFRKIRISVSDRFPVGS
                     SGMKVLGEFEAENIRDVQSFNIENPLIWARYLKLEILSHYGDEFYCPISLIRVYGKTM
                     MEEFKMAEGHESFIGGEPEIKNEELVINNSMKDISNFTGINIQNEECRVALPHLGLTE
                     FLKDINSTASDYCDAMYPLINEPETTQTIETKTTQESIYKNIMKRLSLLESNASLSLL
                     YIEEQSKLLSQAFTNLEKRQSSNFESLINSFNDTMHNQISYFKNAYFSIQVEASKLFK
                     AQENNHQSLLEESHHKMTILGNQLKFQKRLSILNTMIIICILSYVVLTRDVYIEDHMY
                     DHFQQPLRTSQNTSGYSNLLDKYKRKNSKRNNRSKRRKPKSTN"
     gene            complement(<917129..>919147)
                     /locus_tag="DEHA2F10670g"
                     /db_xref="GeneID:8998939"
     mRNA            complement(<917129..>919147)
                     /locus_tag="DEHA2F10670g"
                     /product="DEHA2F10670p"
                     /transcript_id="XM_002770747.1"
                     /db_xref="GeneID:8998939"
     CDS             complement(917129..919147)
                     /locus_tag="DEHA2F10670g"
                     /note="similar to uniprot|P15424 Saccharomyces cerevisiae
                     YDR194C MSS116 DEAD-box protein required for efficient
                     splicing of mitochondrial Group I and II introns"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10670p"
                     /protein_id="XP_002770793.1"
                     /db_xref="GeneID:8998939"
                     /db_xref="GOA:B5RUE0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B5RUE0"
                     /translation="MFKLRPVARFLVFRTTSVSRGFTRGFTYSKVQYNEFAKLDNANE
                     HANQVKKVADEVKIENKTESISTQDLAEDGPATFDGLAKTGHVHKDILKAIKLAKFTT
                     LTPVQEKSLVPILEENGVVCRAKTGTGKTLAFVIPTLQCALENYDATRGARGKVHALV
                     IAPTRDLALQIESEYKKIIQNMPNQAKNKIHMEVHMGGRKTRTGNVAPAIVIATPGRL
                     NDNLRHSRFANMFTDLKYRVYDEADRLLDEGFSVTLDDIDDQLKQARSMATNPSASFK
                     SVLFSATVDKSVSKFAKSVMGEDYKFINCVDENEPEAHENIEQTLVKTNNIGESFNGA
                     LAYIINNMNNAGFKAMVFLPTVTATDWFYSMLMNAKDKEMYDTQQTRKYGSKLLRLHG
                     KMSQAARDRTVRDYRRLSHGILVCTDVAARGLDFSDVSDVVQMGPSSEVADYIHKIGR
                     TARAGASGRSILFLSSSEKNYSKALQSKRGVKFEHEIQYETAEEDKKLVKEIGADVEN
                     VESFIPTFLGFYKQVGSAYKIAQHDSLSQIIDYYRFLINDPEAKLSVGKGFLRNVISV
                     PPREASLYFDVPGGFNFSATNNRSSKRTFMDTSGDKRKNFKRGGFNKNYDDHGSRGYS
                     DKGNYSRQSFGTSRNTRNDYSKNNSRDFKKTNNKRDNRWSSGNDEGGW"
     gene            <919702..>920445
                     /locus_tag="DEHA2F10692g"
                     /db_xref="GeneID:2904344"
     mRNA            <919702..>920445
                     /locus_tag="DEHA2F10692g"
                     /product="DEHA2F10692p"
                     /transcript_id="XM_460828.1"
                     /db_xref="GeneID:2904344"
     CDS             919702..920445
                     /locus_tag="DEHA2F10692g"
                     /note="similar to CA4999|IPF2024 Candida albicans IPF2024
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10692p"
                     /protein_id="XP_460828.1"
                     /db_xref="GeneID:2904344"
                     /db_xref="InterPro:IPR028095"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU3"
                     /translation="MNPNQQENESGIQKNFLSKIKQNYSNKFSNISLSSSIQNMSIHS
                     DHDGNSEDDTLIHNAFVKYFDSKGEPYPEWLGVKTKEQNSRPSNSNSNSHYRSEYQPV
                     YSSYNSGGQGASQNQQNQNSGTRSQAPSYFQPQHTPHNASQNTSQHAPQHVPEAEPQR
                     PTYTPRSSSRLQDMYNKSRQQSIPGSGYNTQSYPSGPLRTNSSTTGSRLRERMLNTSP
                     SMNGLNQATKNNNPNTDSSGNSKATWGRR"
     gene            complement(<920477..>921949)
                     /locus_tag="DEHA2F10714g"
                     /db_xref="GeneID:2904345"
     mRNA            complement(<920477..>921949)
                     /locus_tag="DEHA2F10714g"
                     /product="DEHA2F10714p"
                     /transcript_id="XM_460829.1"
                     /db_xref="GeneID:2904345"
     CDS             complement(920477..921949)
                     /locus_tag="DEHA2F10714g"
                     /note="some similarities with uniprot|P25366 Saccharomyces
                     cerevisiae YCR095C Cytoplasmic protein required for
                     replication of Brome mosaic virus in S. cerevisiae which
                     is a model system for studying replication of positive-
                     strand RNA viruses in their natural hosts AND similar to
                     CA5000|IPF2023 Candida albicans IPF2023 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10714p"
                     /protein_id="XP_460829.2"
                     /db_xref="GeneID:2904345"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU2"
                     /translation="MLVPPDNFGLVEPGIYRCSKLEPEHFPFLETLQLKSLVVLDAEK
                     PPRLLKNFIEANNIEIHNLGGLKISNHNHTGANSSSNKDDNEDDANTETSSVSSKTET
                     GVYNLGKSEIETVKLTSKSKNDQWMLIERNIIAGAFELLLNKSKHNILLIDSTSTLVG
                     ILRKIQKWNFNSIINEYRIYSGNSNKSNYYAENFLELLQTELIPFEIDRLNALLKQQE
                     QREEQYQQEQRTQAPPYQYGSSKARSIFRSPDFQISGSRKNSIDSSQLEHQFDDENDN
                     ESIDDEDIDDELLSASPQIPANLLKLAEMRKQDNPRKESIDSTGSDDDKFTPGTSPKY
                     VRSNRNNSLNNDMIQYASRGSYERRYSLADHKFSRPGSFSNGNHKFRNQSISSSSPSI
                     RCSFEGSSSLVKRLREREDIEKLKDSKHSKSIDIIPEEARLLRENYDYKFYKKLDKYP
                     ISFENVSIIKLKLPPDNKLPDWFIKNRDCWEENFRILNKV"
     gene            complement(<922151..>924700)
                     /locus_tag="DEHA2F10736g"
                     /db_xref="GeneID:2904346"
     mRNA            complement(<922151..>924700)
                     /locus_tag="DEHA2F10736g"
                     /product="DEHA2F10736p"
                     /transcript_id="XM_460830.1"
                     /db_xref="GeneID:2904346"
     CDS             complement(922151..924700)
                     /locus_tag="DEHA2F10736g"
                     /note="similar to uniprot|Q01217 Saccharomyces cerevisiae
                     YER069W ARG5 6 Bifunctional enzyme with acetylglutamate
                     kinase and N-acetyl-gamma-glutamyl-phosphate reductase
                     activities catalyzes the second and third steps in the
                     biosynthesis of the arginine precursor ornithine"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10736p"
                     /protein_id="XP_460830.2"
                     /db_xref="GeneID:2904346"
                     /db_xref="GOA:Q6BLU1"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU1"
                     /translation="MLRQVVGRSVVKRLSSVANKEIVGSVSLSNRLRSTKTTTRFYST
                     RSTVVQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIITQQLPELASCLAFLYH
                     VGLYPIVLHGTGPQINELLENEGVEPEYSDGIRITNPKTMEVVRKCFLEQNLRLVTAL
                     EKMGVHARPITAGVFGADYLDKDKYQLVGKVNSVNKSPVESAIEAGYLPILTSLAETP
                     SGQLLNVNADVAAGELAREFEPLKIVYLNEKGGIINGNTGEKVSMINLDEEYDDLMKE
                     SWVKYGTKLKIKEIHDLLQHLPRSSSVAIIDVDDLQKELFTDSGAGTLIRRGYKLISR
                     NSLKEFGNPDLLRAALLRDPEIKSGKLSVASYLKHLESIEFKSYGDEPLEVLAIVTKN
                     GSRFPKLDKFLSSRTGWLNNVTDNIFNSIKKDYKSLYWIVSENDSNLSWYFSKSDGSF
                     SKNGEILFWYGLNTEEVSQLINQFDSSSIGSALSSSSESGIFSSPTQKKGLHTMARRS
                     YSSNPNPPIREGKNTQKAKVALIGARGYTGQNLINMIDSHPFLELSHVSSRELKGQKL
                     KGYNKDNIVYSNLQVEDIKELEKNNEVDVWVMALPNGVCKPFVEAIESIPNNKSKIID
                     LSADYRFDTTGEWVYGLPELNDRNAIASAKKISNPGCYATAAQCAIAPLVSYINGTPS
                     IFGVSGYSGAGTKPSPKNDVKFLANNIIPYSLTDHIHEKEISSQLGLDVAFTPHVAQW
                     FQGISHTISIPIKPKSLSSREIRNIYQDRYQGEQLITISGEAPLVKDISGKHGVVVGG
                     FAVNSKQDRVVIVATIDNLLKGASTQCLQNINLTMGYGEFEGIPDDLVIRG"
     gene            complement(<924904..>927702)
                     /locus_tag="DEHA2F10758g"
                     /db_xref="GeneID:2904347"
     mRNA            complement(<924904..>927702)
                     /locus_tag="DEHA2F10758g"
                     /product="DEHA2F10758p"
                     /transcript_id="XM_460831.1"
                     /db_xref="GeneID:2904347"
     CDS             complement(924904..927702)
                     /locus_tag="DEHA2F10758g"
                     /note="weakly similar to CA2838|IPF8339 Candida albicans
                     IPF8339 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10758p"
                     /protein_id="XP_460831.2"
                     /db_xref="GeneID:2904347"
                     /db_xref="UniProtKB/TrEMBL:Q6BLU0"
                     /translation="MQESSEEANDSISTSSTSTSLELPEYILRNLTPTKRSNSKDKNH
                     RIRKSQIIQSKTLKLKKRSQTIHQKIQNLKLHQEIISNKIAEDLSDNLYRANERRMAF
                     LAKRRERARKLQLTSLKLPIVLPLSEEPIACPKNGGNRKEFVVGDIQSIIIIQKRIKK
                     HILLRNINHFKAFQVSTRLTQMTYNETLSLLKPSTEFTKTTVAILRNLNLPDILPQQK
                     YKSFLYSLIMIADYKDSLIYHTHSGFNTNISDRNINNLANSVSLLLFKSAETVIHKFS
                     EFIYSDLNEIEDPWSLPKLKLCKSWKVYHFLFQIFRSLHFNNCMVIINDALEIVQKQL
                     LASQAIEIEMQREKYADNHKYLYKLSQVFKFSGTEWAYFGEDPRSFVNNIKLQVFDKA
                     LPERPKVKASIEVLEGLDNITESPSNHSIIFERLIFNVPPKIPINKWRKYWVQQYRAE
                     KRMNINNRYGIPNTLKSGFFNLNYQNTSSNIYVENVFRDLDMASTHSKYESLRGEKDL
                     HLFSTDFDFIVSDIFLILYEYCIKFENINNSEGFDIAITQFRTLKNSYQVAKSSTHKE
                     LLQYFKLHFFCLSHLASIGPFVLDFVPNACSGFIDILNHLQQVSPNEFEVFINFYEEL
                     EILGMNLWVNKCKNDSIKKTKSFENVCLFISRKNFKIENGTNSPHLRFPLFYNFLSRY
                     DNDFDRHFLSYSSIIDSTFEYPDFESFSVNALSLRYFRHIYINSILGNLWNRNSKYDP
                     DYLTNEFNVFFKEEMKVLSIKCRVLLISDCVLHLILNFYSKAEISLNGQHYMKFKGVS
                     IQKMADIIIRYFSENINPPDIGVFISNLIGAHTEEDSNLNIDHLISYVYKEYNTLIEQ
                     DGYSLLKRTLTDKFVKLINTGPISTEFECLLKGNFTYFTIPTRQIIDEINEILEEIYD
                     LYSPLLNWIYKDIGEPTI"
     gene            complement(<927958..>929253)
                     /locus_tag="DEHA2F10780g"
                     /db_xref="GeneID:2904348"
     mRNA            complement(<927958..>929253)
                     /locus_tag="DEHA2F10780g"
                     /product="DEHA2F10780p"
                     /transcript_id="XM_460832.1"
                     /db_xref="GeneID:2904348"
     CDS             complement(927958..929253)
                     /locus_tag="DEHA2F10780g"
                     /note="similar to CA2839|IPF8336 Candida albicans IPF8336
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10780p"
                     /protein_id="XP_460832.2"
                     /db_xref="GeneID:2904348"
                     /db_xref="GOA:Q6BLT9"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6BLT9"
                     /translation="MSSTGRYQGPIPTKVSNLNSQYGCACVTKVAPLEELVDDCFKHS
                     IDQLNDPHKVYVVKSFARYIVEAHCHENLSFLIEIFKYEYYFDKIINRKENSKTGMRE
                     KENCYLNSSLGRSIGDLPYPTKRIEPMFVRKKSSAGVSVRSEDHEPMSVFVSTIDDLD
                     EAPEGNEMYNVWDNLMEKNVGDSDTENDSDDEVEEQKSVDQGDAQSEEDLIADQWDLV
                     MGRYVHHNSPEQINLSNLSYKKIVEEDRIPNIFHSPQVLLPAKNEVLRLLEENVYHSF
                     VNSYKEKDSTTASPLIQPRRAQESPSSLSIDDCDKSRSITKSESNNVSPILTPTNSNV
                     PKLFHKMNKSRLLHLSSSTNNLPVDSGSNSSSSSASSLSNILDHLRLNTNHVSSPLNA
                     SPIQTPNHSQPHSLSTSPLYLKEDKLSKFGKIWRSKKST"
     gene            <930343..>930471
                     /locus_tag="DEHA2F10802g"
                     /db_xref="GeneID:2904349"
     mRNA            <930343..>930471
                     /locus_tag="DEHA2F10802g"
                     /product="DEHA2F10802p"
                     /transcript_id="XM_460833.1"
                     /db_xref="GeneID:2904349"
     CDS             930343..930471
                     /locus_tag="DEHA2F10802g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10802p"
                     /protein_id="XP_460833.1"
                     /db_xref="GeneID:2904349"
                     /db_xref="UniProtKB/TrEMBL:Q6BLT8"
                     /translation="MVSSSVTFSDMYFTIRVHAQVAGVGFSGFGCEHTILRSYRIS"
     gene            <930802..>935136
                     /locus_tag="DEHA2F10824g"
                     /db_xref="GeneID:8998940"
     mRNA            <930802..>935136
                     /locus_tag="DEHA2F10824g"
                     /product="DEHA2F10824p"
                     /transcript_id="XM_002770748.1"
                     /db_xref="GeneID:8998940"
     CDS             930802..935136
                     /locus_tag="DEHA2F10824g"
                     /note="some similarities with CA0501|IPF16501 Candida
                     albicans IPF16501 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10824p"
                     /protein_id="XP_002770794.1"
                     /db_xref="GeneID:8998940"
                     /db_xref="UniProtKB/TrEMBL:B5RUE1"
                     /translation="MLSRYFIKPSVPLRYQSCCIRSFACSFATSTTFERAIEYEIDLI
                     SLKKTTGGKRDPSCAKFKFNPFNLTRLESKLINPDIVTRCVNDVRKDPLDYKNYPSND
                     SKGHLEFIERYNVELRKFLQFVQQTCEREIKTFDQLTSQEIFSSLNVFRGHCQKGKIE
                     GVNKYNYTSYSYMFERLSKYLRYDSSFPTFLQSNLFNDFENNKIIMDLYKFGIGNFMN
                     ELESLSKEFSLEKMTKAEISSAIESTIKQYDDFIQLSEASNDYSETFFKGCIQIQRYR
                     HLKSILDSLPIESSHLLYVLNNENSKLIIGKIKDLSGEKESFKKIIKRHQAELNFIRF
                     LSKGSFESFARLASFLYKLSISTDDELTQTISLTLLEKLTPFFTNGTLQDSDLRIIEL
                     EGIPPATISSGLRENYEFSVLAKIELFNFVDELKLLRAFSYKKFGDLVVADTFEELDK
                     LIGTFKGSSVILDNLQVLELELCTLSRYITWDLSVLDKLVDNPSWVSYLTEVYEAEFE
                     NSGIQFDFTKRVPTVPQYTQIPDDLFLHEFVNELKTLRTDLLGGFNFKLFSPSGVLSI
                     LEHAIEEAQTGYILSPSLTSDTVDDFIKLNSKLWKLFQINGGNTGILDTLIHSQSIFE
                     SVAKKSKSVQRKEDYTQIPEDIELHKYCKELDILRYELGCPYKDCTVSQIKSFLNDKI
                     DGVLNNSKIQSSISKENIENFIELEERLNKLFRISNYPAILDTLLHSQSVFEGFEKKK
                     KQPNIYTQIPDDLDLHKFSNELEIFREDELKGSYSEYSADQIESLMNKRMAEINNGTE
                     NFNVTSRMNKANLHEFMRLGRRLARLFDINGGNTEILDTLIQSQSIFDKFEKSKTTSN
                     KFTSPYKQIPDTFILEEYMLELIQLRTELGGSDFKSFDCKIILETLKKMLTNKKKFNL
                     DKRITYSKLYRNISYLFKHNGNRSFILDNVLVSGEVFAKFEADKAFNKSQNPENLIIS
                     QITKFVNEFDVSLNQLFNQLRLNGASDFIGIDESGFDKYISEFLLSNKDNYQYSVYLD
                     MIDKIKFFNSKINNYPFFLYNLVQKRNAGEIINDRLVKSVHEESERVMHNEVNLNESK
                     RKISVPISEAANRFDIHDFTEENTKPRQEYTNSASLLASLSKQKSAANLESNGMPKAK
                     NSTDDLLESELEIKDAVAFALNNNQNENRDENAQLQDLTTEKVRETFKHYRPPSPSPI
                     PTSQIDKSSIESFLNNAKKEKDLAKERKFRESKAYEWSKSMYNTRRSLESHNFFDPIV
                     PISKMSKESKELFFPILNNGEAEYLLLTIGGQTISSKENPLGKNSSPQNMFTILNKFS
                     EEDLGRFIKNVNKLQKNNWRLIGGGSGSENEKMLVLTRNKTAKKDVYLARIKTIFATT
                     GAVFLVLVSLNLWLDDGSANPIDVSTPMESHTPNNDVAKETDNKLDIRNTSQEDPSTW
                     KKLLWCIK"
     gene            complement(<935356..>935895)
                     /locus_tag="DEHA2F10846g"
                     /db_xref="GeneID:2903570"
     mRNA            complement(<935356..>935895)
                     /locus_tag="DEHA2F10846g"
                     /product="DEHA2F10846p"
                     /transcript_id="XM_460835.1"
                     /db_xref="GeneID:2903570"
     CDS             complement(935356..935895)
                     /locus_tag="DEHA2F10846g"
                     /note="weakly similar to uniprot|Q7S484 Neurospora crassa
                     NCU06088 Predicted protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10846p"
                     /protein_id="XP_460835.2"
                     /db_xref="GeneID:2903570"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:Q6BLT6"
                     /translation="MPLAHNLNKVTKNLSKSTGQMHVKGRKFKQLNRATLRDQKITTK
                     KLKYQEQKDRELAGIQFMKDRVYEYSDQEVFSLEQMKSFIEDYIGRNDEELKQLKDER
                     RPGRPATSRQSHLEVVIGDEKQVYSTGFKIPDLSNKETVERVKLWNGTSGGTTVMKFI
                     HVSKDMKELPVKEEVMKDN"
     gene            <936199..>936714
                     /locus_tag="DEHA2F10868g"
                     /db_xref="GeneID:2903571"
     mRNA            <936199..>936714
                     /locus_tag="DEHA2F10868g"
                     /product="DEHA2F10868p"
                     /transcript_id="XM_460836.1"
                     /db_xref="GeneID:2903571"
     CDS             936199..936714
                     /locus_tag="DEHA2F10868g"
                     /note="weakly similar to uniprot|P12962 Saccharomyces
                     cerevisiae YOR276W CAF20 Phosphoprotein of the mRNA
                     cap-binding complex involved in translational control
                     repressor of cap-dependent translation initiation competes
                     with eIF4G for binding to eIF4E"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10868p"
                     /protein_id="XP_460836.1"
                     /db_xref="GeneID:2903571"
                     /db_xref="GOA:Q6BLT5"
                     /translation="MAKYTEEQLYEIKEEAYTPQPDVLDAFNKMVDHVKEHAAAEFEK
                     HKNLKWSNGDTYIDENGNERPYHHMNKRRGSRSGNKPNLRKKSTDGIKVDDDGWATLT
                     KPKKSFGAEDGVEERNKFRESVKDIKVKPNNKNLGSSKAVDPRDAIAEKHTNTFNAFE
                     ALGDGDDSDDE"
     gene            complement(<936927..>939593)
                     /locus_tag="DEHA2F10890g"
                     /db_xref="GeneID:8998941"
     mRNA            complement(<936927..>939593)
                     /locus_tag="DEHA2F10890g"
                     /product="DEHA2F10890p"
                     /transcript_id="XM_002770749.1"
                     /db_xref="GeneID:8998941"
     CDS             complement(936927..939593)
                     /locus_tag="DEHA2F10890g"
                     /note="weakly similar to uniprot|Q7SHX8 Neurospora crassa
                     NCU00675 Hypothetical protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10890p"
                     /protein_id="XP_002770795.1"
                     /db_xref="GeneID:8998941"
                     /db_xref="InterPro:IPR011989"
                     /translation="MPIFRPKHQKLILQCYPPGKGVDKKPNPSELSYLLYYASTRRVK
                     LEKVVTFLDRKTTSDAKHNRAGNLQVTLTIISSLIEECSENLNVFASFVCSILKSVLQ
                     SKDLSLCKHAIQTYGVLCSKLDGGLFSGDKVFVDSFGSLSQNLINIGSENSKKRGPNN
                     LEWQMISLMTCRYISNCLGYNSKFSKKFIEICIPILTETVHANNKQSNLLTILKSNVN
                     IEDENHHLGRIASTKTNQTSRKAQQDLDNDAVKDSDLNEEALRGLKALFSTSLTSQIS
                     EATRAIVKNNYATTIDPIWGCTFLEMCTTWIPVQLRFITLSTVLSSLTSLSNKSTKKT
                     SNYPIQLLYANYCLGLVSSDVNMIGLSISDVIQQILFLQANLLLSQSHYFQEEDVKKL
                     SMIYSNCICNLSTHIYYFDQVPDSIREILIKVVSILENSVISGNANSSGVYRFIITLL
                     EDISIIFDLLQTKPSNISRNHVSLEDWDLSLILLSSEIGLNPTKDQKPLFSYEQITDI
                     QFKYLRVFGYFLNNELVTRNENMETGAINSIESFNVGGDHLQPDYNNYISDPGNFIAH
                     FLGYVDKFFSGQSLINIDNASLLQKVLKNMILILGINFINNFVPFFFYWQLPLNPNLV
                     DDNTRIKDTLGYTLIYHSLIKMDKIYELNYVRESEFFNSLLGDINYRKLNKLWVNGLQ
                     SKEEDAVLDNHHALGHRDENGTLRFNPTKKNLEDFVIGNAFTLSWINPHRPLILDIVN
                     NYIPKKENNQNVLSDMSDESSIIENSSYHTSARQNGFGLGLGNANDISSIHSGLLFHQ
                     SQNVNMKNAFSNGNETSNGSIYTSDRQYNTPRVSDLKDSVLMKKKPGVAFNEHYNSDT
                     TPGSILSKQMVTSDIDSILEGLDIDDDSEIIV"
     gene            <941905..>944205
                     /locus_tag="DEHA2F10912g"
                     /db_xref="GeneID:2903574"
     mRNA            <941905..>944205
                     /locus_tag="DEHA2F10912g"
                     /product="DEHA2F10912p"
                     /transcript_id="XM_460839.1"
                     /db_xref="GeneID:2903574"
     CDS             941905..944205
                     /locus_tag="DEHA2F10912g"
                     /note="weakly similar to uniprot|Q12033 Saccharomyces
                     cerevisiae YOR275C RIM20 Protein involved in proteolytic
                     activation of Rim101p in response to alkaline pH"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10912p"
                     /protein_id="XP_460839.2"
                     /db_xref="GeneID:2903574"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /translation="MNTNLLYIPYRETDIIDLGNELRNIIKMEYFQPSSNFDRDLQAV
                     RNLRNNISNLKNEQVNNNDETVCVQYYHQLSNVIKKFPDECVEFSWYGTLGYGRSGPT
                     RSRSLRIEQLNILYQLGSYFSQAALMESRYSDEGLKKSCSYLQAAAGCFNSMILQIQK
                     ENEKETGMIRIPRDLQPETLQFLKSLMIAQAQETIWQKSLASGMKDSVIARLSIQTSE
                     YYSTAAKYGNSSEFIKLEWINHVTVKQFHFKAAAHYRVSILNHEGFKYGEQVASLQVA
                     LSSCDSAFRKKKYVNDFVIEDLQGLTETIKSTLRVAEKDNDLVYLKPVPKENDLAPIP
                     GASLVKPILPPAIESFDDSSVLFKELLPYLIVQVGQAYRERQDSFIRDSFIDPIQSLN
                     KIMYKFITERNLPASIDTIQKPENLPESIIQHSQEIISYGGTKLIEDSLNEIAKLTLE
                     SRHILEGCQERLKIEADEDDIMRERQGSQRWARPKSSEASSEFINKINKMEQYLDQAK
                     EGDQFIISQYHEIEPYLQLYCGGYKELIQFIPNSTYVKLDTKINEIIIKLRELINEVS
                     RIENQRKQFLTRIEIKARNNNILPSIIDSFKKKQRKLYEENAAIDERSFEDVYAKHIT
                     MFNSDLRFLEDSKHAQIALEGNIDDLNQEFESEYQHTNNESQYKRQEVLQTLENVYTK
                     YLELISNLNEGSKFYSDFIIKSNSVLKECDEYVYHRRVEGRELEMFLNNQAVPVESVG
                     SQQSAPDFPPQPMGGTWNPNNGIKFG"
     gene            <944309..>945793
                     /locus_tag="DEHA2F10934g"
                     /db_xref="GeneID:2903575"
     mRNA            join(<944309..944410,944468..>945793)
                     /locus_tag="DEHA2F10934g"
                     /product="DEHA2F10934p"
                     /transcript_id="XM_460840.1"
                     /db_xref="GeneID:2903575"
     CDS             join(944309..944410,944468..945793)
                     /locus_tag="DEHA2F10934g"
                     /note="similar to uniprot|P07884 Saccharomyces cerevisiae
                     YOR274W MOD5 Delta 2-isopentenyl pyrophosphate:tRNA
                     isopentenyl transferase"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10934p"
                     /protein_id="XP_460840.2"
                     /db_xref="GeneID:2903575"
                     /db_xref="GOA:Q6BLT1"
                     /db_xref="InterPro:IPR001177"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6BLT1"
                     /translation="MIIRYLRYFKNLMMTTPKKNIVTIVGTTGVGKSQFSIELAKAIN
                     GEIINADSMQVYKRLDIITNKHPVEEREGITHHVMDHVNWNEEYFIHRFSKEANNAIE
                     DIHNRGKIPIIIGGTHYYLQNLLFKNKTVGESSSSSKLTKELTNEDIELLDGPVNEIF
                     NKLQQIDPIIAEKFHPEDKRKLRRALEIYITTGQKPSEIYHEQKLDELEDTSLKYNTL
                     LFWVYSDPDILKDRLDKRVDRMMEIGALNEINELYGVYKSQVQVPDCTTGIWQVIGFK
                     EFLPWLEFAGSSNKQEASRLFNEGIDRMKIRTRQYAKYQVKWIKKLLAVELNKETRFN
                     FKYGGKLYLLDATDLGSWDEKVREVGLNIASQFLTTGPTSVTHPEAPAHLQDIFPSNS
                     FLDNFNSNKKLGSEKNWKHYECSVCKDKQGKNLIAVGEESWQIHLKSRRHKRQLGSGE
                     RKRKHEQMINQYKQKTPTEEDNSSI"
     gene            <946306..>946485
                     /locus_tag="DEHA2F10956g"
                     /db_xref="GeneID:2903581"
     mRNA            <946306..>946485
                     /locus_tag="DEHA2F10956g"
                     /product="DEHA2F10956p"
                     /transcript_id="XM_460841.1"
                     /db_xref="GeneID:2903581"
     CDS             946306..946485
                     /locus_tag="DEHA2F10956g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10956p"
                     /protein_id="XP_460841.2"
                     /db_xref="GeneID:2903581"
                     /db_xref="UniProtKB/TrEMBL:Q6BLT0"
                     /translation="MLKFLYPELRSLEQPSASGIIPELITQEKPRNFVLNNCMAKKIC
                     RCSSRCLRLQFTYSL"
     gene            complement(<946787..>947920)
                     /locus_tag="DEHA2F10978g"
                     /db_xref="GeneID:2903582"
     mRNA            complement(<946787..>947920)
                     /locus_tag="DEHA2F10978g"
                     /product="DEHA2F10978p"
                     /transcript_id="XM_460842.1"
                     /db_xref="GeneID:2903582"
     CDS             complement(946787..947920)
                     /locus_tag="DEHA2F10978g"
                     /note="similar to CA1081|IPF14797.3 Candida albicans
                     IPF14797.3 unknown function 3-prime end"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F10978p"
                     /protein_id="XP_460842.2"
                     /db_xref="GeneID:2903582"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS9"
                     /translation="MANVETKKNSYSEMAPMPMVTPESESEILLPPLPNDETGTVPSS
                     IMSDHKASVATSMSNESCVSLELDTTGKESSFNEFVQNPKYELNSPSLNIDPLFANLA
                     LNEAPQMADQTTTQSNNTSPLKRLKNLKKGIRKLSLSKMNAPSLNVSVSNTSSSVRPG
                     VSPLTTTEDTIDSFSSASTIDSLHSAAKVRKSSLITPMTTPIGSPVGSPIITLSENLS
                     GSSKNIDDFERNFFRNLNSNDSTTEVSSMADLTKLEDLINYSNFLNHSKVQVIDAFEL
                     TKERLIKFGWCSDDDLNNLQFQKDSSLSQIDTRILQLEKKLNKQYNTSILLCSNNKVQ
                     KKTNSISSSISSIDNLNYASENSKASSISLKNLESRCFSYPDF"
     gene            <948550..>948870
                     /locus_tag="DEHA2F11000g"
                     /db_xref="GeneID:2903583"
     mRNA            <948550..>948870
                     /locus_tag="DEHA2F11000g"
                     /product="DEHA2F11000p"
                     /transcript_id="XM_460843.1"
                     /db_xref="GeneID:2903583"
     CDS             948550..948870
                     /locus_tag="DEHA2F11000g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11000p"
                     /protein_id="XP_460843.2"
                     /db_xref="GeneID:2903583"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS8"
                     /translation="MYCLAGFTEDPIRRSTGRGTQKYNSDERATGWQVERRSPSVVEP
                     GSPQIVSATVDEIDSVGDYRCLGHYRWYSRRSQYVAMLTLIKFKMVSADRETAASLEY
                     RLEA"
     gene            complement(<950024..>950965)
                     /locus_tag="DEHA2F11022g"
                     /db_xref="GeneID:2903584"
     mRNA            complement(<950024..>950965)
                     /locus_tag="DEHA2F11022g"
                     /product="DEHA2F11022p"
                     /transcript_id="XM_460844.1"
                     /db_xref="GeneID:2903584"
     CDS             complement(950024..950965)
                     /locus_tag="DEHA2F11022g"
                     /note="similar to uniprot|P29703 Saccharomyces cerevisiae
                     YKL019W RAM2 CAAX farnesyltransferase alpha subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11022p"
                     /protein_id="XP_460844.1"
                     /db_xref="GeneID:2903584"
                     /db_xref="GOA:Q6BLS7"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS7"
                     /translation="MVEFDFDDITPVKLNEEEPQLCQILYDDEYKETMGLMLALMQKD
                     EHSERALWVTEKGIELLASHYTIWNYRYTILTRLNKDFYEELDWCEQIALENEKNYQI
                     WNYRQLIIEKIISDGGDKKFNPHREFPIMNAMLQEDTKNHHVWSYRKWLVERFELYHD
                     EKELQFDDQSIENDLRNNSAWTHRFFLKFSPESGSNNDIAYRAMVDKEIEFTKRKICQ
                     CPQNPSTWNYLFGIYRRLDKDVNELYEFCLTFANVQESQDVEMVITSTYALEMLATIY
                     QRRKEPVLAAKVYDLLSTTYDPIRANYWNYEKGRIAV"
     gene            <951147..>952550
                     /locus_tag="DEHA2F11044g"
                     /db_xref="GeneID:2903585"
     mRNA            <951147..>952550
                     /locus_tag="DEHA2F11044g"
                     /product="DEHA2F11044p"
                     /transcript_id="XM_460845.2"
                     /db_xref="GeneID:2903585"
     CDS             951147..952550
                     /locus_tag="DEHA2F11044g"
                     /note="weakly similar to uniprot|Q03648 Saccharomyces
                     cerevisiae YMR209C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11044p"
                     /protein_id="XP_460845.2"
                     /db_xref="GeneID:2903585"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR016853"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS6"
                     /translation="MATPRINSASRTPSNSVLILSTAFTCALVYITLSIVLGSSQIPI
                     LVVVFICTNMLSRTGVFKNFISKLDVSKAIGHHSIPRIPSVENPIGHDLFQSISEHSR
                     IEILSAIKSLQAYSDNTKNVNDRRRRLFKMMTWRQQKLCEDVGYLKKLTKIDQSIAYN
                     QKILSAIADGAVKSFGISYKDFNLLRGSNNSNTSSTNYRVIEALGHYIRDWSPDGDAE
                     LKPMMDYITEQLNRVIPVQERSKTCVIIPGSGLGRIAHEIASIGTDIGSSFGAVHAIE
                     YSGLMHLCNQFIYSSENEVKNYDIFPYVHSCSNFIDSSSQFRSSVVHSGQSKPENLEL
                     NHEDFRYFEIPNKSQYENFVVVSAFFIDTAENLVSYLDTIQELTTPNRRNGIKKGYWI
                     NIGPLKYGTAAQVELNSDELKEIRKAMGWKDLSSLNSLNSSDNQLVGYMTDKQSMWQG
                     YYGLTMWNTERKENSRK"
     gene            complement(<952604..>954004)
                     /locus_tag="DEHA2F11066g"
                     /db_xref="GeneID:2903586"
     mRNA            complement(<952604..>954004)
                     /locus_tag="DEHA2F11066g"
                     /product="DEHA2F11066p"
                     /transcript_id="XM_460846.1"
                     /db_xref="GeneID:2903586"
     CDS             complement(952604..954004)
                     /locus_tag="DEHA2F11066g"
                     /note="similar to uniprot|Q12024 Saccharomyces cerevisiae
                     YOR272W YTM1 microtubule-associated protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11066p"
                     /protein_id="XP_460846.2"
                     /db_xref="GeneID:2903586"
                     /db_xref="GOA:Q6BLS5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /translation="MADDKSQIKINFFTNEEDESLHTSDAPLYVPVSLKRYGLSEIVN
                     HLLKKDGETDETKPVPFDFLIDGVLLRTSLEDYLVKNGLSSEASLNLEYTRAVLPPSF
                     LASFNNDDWISSLDTINPLSASVKASNMSISQPKILSGSYDGIVRTYNMSGKVEKQYV
                     GHSGPIRSVKWISPTRIVSSGNDRQVRLWKTSIDSNIEDDEEIEDGRTLAILEGHKAP
                     VVSLAVEYQNNRILSAGYDKAIGFWSTNYREMTTIQPLEYDSNVISTSSKKRRKMALQ
                     DSTIRRRSPLSFLEGHSQPVEDVIFDFNDATVGYSVSQDHTIKTWDLVTSRCVDTRTT
                     GYSLLSLLQLPSLNLLVCGSSARHINLFDPRVSSTTTEQTNNQKLIGHTNFVVGLSKC
                     PTNDNMFASCSHDGTVKVWDVRSEKSLYTITREQNNAAKGQDKVFSVIWDNDIGIISG
                     GQDKKIQINKGSDITK"
     gene            complement(<954261..>954602)
                     /locus_tag="DEHA2F11088g"
                     /db_xref="GeneID:2903587"
     mRNA            complement(<954261..>954602)
                     /locus_tag="DEHA2F11088g"
                     /product="DEHA2F11088p"
                     /transcript_id="XM_460847.2"
                     /db_xref="GeneID:2903587"
     CDS             complement(954261..954602)
                     /locus_tag="DEHA2F11088g"
                     /note="similar to gb|EAL04802.1| Candida albicans
                     hypothetical protein CaO19.4814"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11088p"
                     /protein_id="XP_460847.2"
                     /db_xref="GeneID:2903587"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS4"
                     /translation="MRSLPPPRVTRKRRWMRIKRAIRSFFSKGYVSDPGAFISTSASN
                     RRSISTIRKSRFSPRFRKTRANRSDIGIREGANAGIATASFVGRMASRASMPVLRRHS
                     PKKSMNLTVKF"
     gene            <955202..>956791
                     /locus_tag="DEHA2F11110g"
                     /db_xref="GeneID:2903588"
     mRNA            <955202..>956791
                     /locus_tag="DEHA2F11110g"
                     /product="DEHA2F11110p"
                     /transcript_id="XM_460848.1"
                     /db_xref="GeneID:2903588"
     CDS             955202..956791
                     /locus_tag="DEHA2F11110g"
                     /note="similar to uniprot|P38625 Saccharomyces cerevisiae
                     YMR217W GUA1 GMP synthase an enzyme that catalyzes the
                     second step in the biosynthesis of GMP from inosine
                     5'-phosphate (IMP)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11110p"
                     /protein_id="XP_460848.1"
                     /db_xref="GeneID:2903588"
                     /db_xref="GOA:Q6BLS3"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /translation="MVNPADVPIEVSKVFDTILVLDFGSQYSHLITRRLREFNVYAEM
                     LPCTQKISELTWKPKGIILSGGPYSVYEDGSPHVDHDIFKLNVPILGICYGMQELAWI
                     NGKGVARGDKREYGPATLNVEDSSCSLFKGVDHSQVWMSHGDKLHALPTGFKVVATSD
                     NSPFAAISNEKENIFGIQFHPEVTHTKQGKVLLRNFAIDICQASNNWTMENFIDTEIA
                     RIQKLVGPTAEVIGAVSGGVDSTVGAKIMKEAIGDRFHAIYVDNGLMRLNETEQVYKT
                     LTEGLGINLTVVDATDLFLGKLQGVTDPEKKRKIIGNNFIHVFEAEAAKIKPASGQEI
                     EYLLQGTLYPDVIESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRHLG
                     EIMGVPHDLVWRHPFPGPGLAIRVLGEVTREQLKIAREADNIFIEEIRKAGLYKDISQ
                     AFAALLPVKSVGVMGDQRTYEQVIALRAIETTDFMTADWFVFEAAFLKKTASRIVNEV
                     DGVARVTYDITSKPPATVEWE"
     gene            complement(<956859..>957305)
                     /locus_tag="DEHA2F11132g"
                     /db_xref="GeneID:8998943"
     mRNA            complement(<956859..>957305)
                     /locus_tag="DEHA2F11132g"
                     /product="DEHA2F11132p"
                     /transcript_id="XM_002770750.1"
                     /db_xref="GeneID:8998943"
     CDS             complement(956859..957305)
                     /locus_tag="DEHA2F11132g"
                     /note="similar to uniprot|Q5L3G7 Geobacillus kaustophilus
                     acpS Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7)
                     (Holo- ACP synthase)"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11132p"
                     /protein_id="XP_002770796.1"
                     /db_xref="GeneID:8998943"
                     /db_xref="GOA:B5RUE3"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:B5RUE3"
                     /translation="MVRKLGITLGIGVDIIKTNRFKELLLSKGKLNSRFTSRISSRIL
                     HPEFELPKFNEFKDNNKLNECISLISGSWASKEAVYKTLDDEYQRQFQFKNWYRYYNE
                     QGKPFIRSDFYKKENEEFQLSVSHDDGLLVATVLRQEIYELTNEDL"
     gene            <957433..>958419
                     /locus_tag="DEHA2F11154g"
                     /db_xref="GeneID:2903590"
     mRNA            <957433..>958419
                     /locus_tag="DEHA2F11154g"
                     /product="DEHA2F11154p"
                     /transcript_id="XM_460850.1"
                     /db_xref="GeneID:2903590"
     CDS             957433..958419
                     /locus_tag="DEHA2F11154g"
                     /note="highly similar to uniprot|Q12029 Saccharomyces
                     cerevisiae YOR271C Hypothetical ORF"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11154p"
                     /protein_id="XP_460850.1"
                     /db_xref="GeneID:2903590"
                     /db_xref="GOA:Q6BLS1"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS1"
                     /translation="MASSISGPVPLPESKYDLSSYWGRVKHCAEISDPTMLLNSTKDI
                     QTAKIMIWEYRNGVRPTMTPELWRAKRVLDSTLHPDTGETVFLPFRMSSCVLSNLVVT
                     AGMLTPNLGPAGTIFWQVANQSLNVAINTANANKSHPLSTQQIITNYTMAVTASCSVA
                     LGLNAIVPRLKSLRPNTRMILGRLVPFAAVVSAGVVNVFLMRSEEIKKGINVYDKEGK
                     EVGISQTAAVYAVSETAASRVINATPVMVIPPLILVKLQKSGFLKGKSKKWEIATNMG
                     LIFTTALAALPFALAIFPQRRQLLATQLEEKFHGLKDKNGNEVEYLEFNRGI"
     gene            complement(<958500..>959801)
                     /locus_tag="DEHA2F11176g"
                     /db_xref="GeneID:2903591"
     mRNA            complement(<958500..>959801)
                     /locus_tag="DEHA2F11176g"
                     /product="DEHA2F11176p"
                     /transcript_id="XM_460851.1"
                     /db_xref="GeneID:2903591"
     CDS             complement(958500..959801)
                     /locus_tag="DEHA2F11176g"
                     /note="similar to uniprot|P07277 Saccharomyces cerevisiae
                     YMR208W ERG12 Mevalonate kinase acts in the biosynthesis
                     of isoprenoids and sterols including ergosterol from
                     mevalonate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11176p"
                     /protein_id="XP_460851.1"
                     /db_xref="GeneID:2903591"
                     /db_xref="GOA:Q6BLS0"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6BLS0"
                     /translation="MSVSPFLVSAPGKVIIYGEHSAVYGKPAIAAALSLRAYLLVTPC
                     EDVNDIRLDFPDIGLSHSWNKENIPWEDIRKFVTFKDEKPVVTEELVPEIVDLLSTVL
                     ADVESKLHYTACLCFLYLYANLSNKDVPGMRFIVKSTLPIGAGLGSSACTAVCLASAL
                     ARLGKHVSAACHTSTEKVYKKENSDLDFIDSWSLMGEKCFHGNPSGIDNAVATYGGAV
                     MFQRTTIPSKPSVRTTMRNFPPIKLILINTKVPRSTAALVGNVAQVNRTYPKCAGSIL
                     DAMEHLVFEAYQIMIRPSFGKEEKDQLRELVNINHGLLVALGVSHPALEKIKIIGDTH
                     GIGSTKLTGAGGGGCAISLVHDDVEEEVIQKAIKEFENEGYETFETSLGGKGVGSLSL
                     EDVDKDKRDTVFSAEVFSSYKDRDEVEKALKSDIYESWRFW"
     gene            complement(<959952..>964877)
                     /locus_tag="DEHA2F11198g"
                     /db_xref="GeneID:2903592"
     mRNA            complement(<959952..>964877)
                     /locus_tag="DEHA2F11198g"
                     /product="DEHA2F11198p"
                     /transcript_id="XM_460852.1"
                     /db_xref="GeneID:2903592"
     CDS             complement(959952..964877)
                     /locus_tag="DEHA2F11198g"
                     /note="weakly similar to uniprot|P52593 Saccharomyces
                     cerevisiae YML103C NUP188 Subunit of the nuclear pore
                     complex (NPC) involved in the structural organization of
                     the complex and of the nuclear envelope also involved in
                     nuclear envelope permeability interacts with Pom152p and
                     Nic96p"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11198p"
                     /protein_id="XP_460852.2"
                     /db_xref="GeneID:2903592"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR9"
                     /translation="MPVSTVELKAAKEVKPLKPIQPTQLWGFDNALSLLKSYQDPYIL
                     DALDEFLLLNSKLLLNPLPFKRVTKSPNKEAKELSLRNILYSDITPNNIKDAETISNV
                     LNLDYNDVLRVISQTCKRIPERKVYNYEKLKSKLPDDREKYLEEERILLYSSRVLRER
                     RIVLRLVIELLNNKSNSETSSTIQNLGKEIYLSKTYTNDLINSLEELIKSVANRSFIT
                     GVSDSLDEIINTESLLLIIDQMKILTELLVQNPNIQQDTVNHWFKFMKSNNFIQSLGP
                     CVSHNESFMLMQALVTVISILFLDLENNYGSESDSDKFMNNAEVLKSINDSITNPSNL
                     NSVVMYSWSIILLRKSLLLEEYKDLPSSVAFTKEFSIQQMDDSINNLNMRCVQLGVFE
                     DLAKLNNLLKFDNIYPAILTSVILSAMPLISFTPEIASSIQSILKTAPNSVLEKFFDN
                     EATANAIILSRTKFPVSLTPYLKLASINGNFAFNELEELKSYISVFKKQEFNNLYEID
                     DENTELVKLTQWIDVYPPYEVNKKLSLLLNVGTKAKILPSANEDEVLVTFLYKYNGWA
                     FLGRVLQNVSKVFDSSDPEKVEFVINILNLLTKAVMDNSSDDAQTILKYMSAYTDDSD
                     IVEVILRLFEQALHARKVDILESVINFLTTSMPFLSFRIWPYLSKSSLLSNGGKEGLA
                     SIIFGAIEMVNGEYSFTVSLIKLADSLVQNCLTLQDDYPEKSKSAILDRIINHMILIF
                     ESFIHCRFNETYQKMEIGVLILDILSNILATVHGIDNENKSSNRIARIFSESSSRIID
                     SFLIAGTEFSRSALPILSMIESLSANMSLYEVSDISGFWYDNWIRCSLAFSQLIISIR
                     SVLNLPPSAFERSLFNKLTSLVNTYSQYETLRKDILDLITTLTNGKWLNEPTPSLLSH
                     LGRDHAQVLLHSLASDLENSFDDYKMKISLYDFICAVMDGNQEGLSVLFISGRDVFGD
                     FTKSSNINPDDQKPISLLSILKKNVRDIKYYPNSVSLHLADAISLAFNSWTTARENDN
                     DVEFVDELILKIQSPINKSPGTTEEYIAACYELKLVSKIAEILSSFLFTTKNEVCKKN
                     IVKLLTSDDFIATMEKSFRINNYQPTLHSNLQIDFENTFTGFELSQFTCSLLKRNRFG
                     VSTVYSLVLMDRLFNNSPAWDQLREQVVASSINLQYLSAQASVAKSFGALLTAFCRRF
                     PSALNSKFLNLVSHLLKINVSEGVPADFFADVFQGRIELAFFIEYTIYTTPDIKKDLN
                     IVLEIIKGCSELLSASSMNFLKNLNEDSGNYRPLLRILYCSLNIVKDDSGMLIEYLSI
                     FRDLFELIITKATKNLFIEIQNDVYLSRTEKNHVPNKMNGRLDDLMLILSILKVFVNM
                     KSSPSLNYEMASLIDDNGTIKALLNLYSLSHLIEVNDEHIFAQLSLMFIQELMTIEVM
                     AERLISSGMFLVIVQSKISSPIESGGVNTLISPHYHRIWTNGILPIFLTALSRLGPSI
                     IPEVSLALQAFGKQIESCIESWSKDSSTIRITSSMISETSQILLLFKMLQSLNINDYL
                     NQAAIARNIETASHTIDMQLLPGLETESKRDDFVECINNLLKHPKFLSSRILPCSPEE
                     QRMVEGGDVTYRKFINNSIDEIRELKAFFNQ"
     gene            complement(<965095..>966051)
                     /locus_tag="DEHA2F11220g"
                     /db_xref="GeneID:2903593"
     mRNA            complement(<965095..>966051)
                     /locus_tag="DEHA2F11220g"
                     /product="DEHA2F11220p"
                     /transcript_id="XM_460853.2"
                     /db_xref="GeneID:2903593"
     CDS             complement(965095..966051)
                     /locus_tag="DEHA2F11220g"
                     /note="similar to uniprot|P28239 Saccharomyces cerevisiae
                     YMR267W PPA2 Mitochondrial inorganic pyrophosphatase
                     required for mitochondrial function and possibly involved
                     in energy generation from inorganic pyrophosphate"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11220p"
                     /protein_id="XP_460853.2"
                     /db_xref="GeneID:2903593"
                     /db_xref="GOA:Q6BLR8"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR8"
                     /translation="MNNTAISRLLITKQHLKPTRCNSVLHKPQSSISNVDQGTKYTTD
                     FKNYAVNKENGQILSYFHDVPLDFDIETKTANIVVEIPRWSNGKFEINTELPGNPITQ
                     DVKKGKVRFVKNLFPYHGYIHNYGAFPQTWEDPNTKNEELGLYGDNDPLDVCEIGSNV
                     CQIGDIKRVKILGSLALIDDGELDWKVIVIDTNDTLAQEIRDIHDVFVKCPGLLESTK
                     QWFRDYKLPDGKPKNEFAFNGVYKNQQETIEIIKECNLSWQKLINGDVTSGKIPKIEN
                     VSFASTPGHITEFDSKRLLDNASKPPAKIPSEVDKIYFNGQD"
     gene            complement(<966379..>968976)
                     /locus_tag="DEHA2F11242g"
                     /db_xref="GeneID:2903594"
     mRNA            complement(<966379..>968976)
                     /locus_tag="DEHA2F11242g"
                     /product="DEHA2F11242p"
                     /transcript_id="XM_460854.1"
                     /db_xref="GeneID:2903594"
     CDS             complement(966379..968976)
                     /locus_tag="DEHA2F11242g"
                     /note="similar to uniprot|Q03516 Saccharomyces cerevisiae
                     YMR266W RSN1 Overexpression rescues sro7/sop1 in NaCl.
                     Encodes a membrane protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11242p"
                     /protein_id="XP_460854.2"
                     /db_xref="GeneID:2903594"
                     /db_xref="GOA:Q6BLR7"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR7"
                     /translation="MAEATPTSTSAVITTLVANLTLFGVFIGCFLILRIKFKRTYSPK
                     VSYDLVPEEKKPDPLPRDPLRWIYILLMKPDSFIIQQAGLDGYFFLRYLFVFGIIFLF
                     GIAMFAILLPVNATNGGSAKTGFDQLAISNILDKNRYFAHVFMGWIFYGAVIYMIHRE
                     LFFYNSVRCAALSSPKYAKKLSSRTLLIQCVPDTMLDEKQFLKIFNGVKRIYVTRNAR
                     KLEYKDRLRQNMVTKLEKAENKLLKSAVKAKLKADKKGTPIDSNADIYTYVPEEKRPR
                     HRSAGLFSKKIDTINYCREEIPKLDKEVKSLQKKYRTYQPKNSIFVEFEDQYTAQLAL
                     QSVTHHNPLRMGPVHTGIEPSDVYWNNLRLFWWEKFFRRLFACADVVLLIIFWAVPVA
                     LVGVISNITYITKVLPWLDWINNMPDQLLGIITGLLPTAMLSLLNTFLPIFIRYMAKV
                     AGCPTLQSIEFYTQDAYFAYLMVNAFLVVALASSAVSVVEKIIDNPTSAMKILATNLP
                     KSSNFFISYIALQGLTVSSGALLQIVGLFLYYILGALLDSTVRKKWNRFSGLGTMLWG
                     TTFPVYTNLACIVLAYSIIAPMILIFACIAFFLLYIAYCYNLTYVFVESPDSRGMHYP
                     RALMQTFVGLYLGQVCLLGIFVVGKGWGPIVLQAISLGFTIMTHIYLRDAFHHLLRVI
                     PIDCMKPLDGVSHTPSFQGKSDYEEKILQRKKRSKSNHFEKEIARDKMAQKEVKNDIL
                     NIDMELNENETMQTLVPLLADRDFKSTKSSNAFVRFFRPDVFLNFRHVKALLPATFNV
                     EPEEVDDKHAYDSPVIAAPLPAVWIPRDPMGLSTREVEEHSKYINISDENSGFNEKGR
                     IIFLGEAPN"
     gene            969456..969547
                     /locus_tag="DEHA2F11264r"
                     /db_xref="GeneID:8998944"
     tRNA            join(969456..969493,969503..969547)
                     /locus_tag="DEHA2F11264r"
                     /product="tRNA-Ser"
                     /note="tRNA Ser (CGA) cove"
                     /db_xref="GeneID:8998944"
     gene            <969673..>970128
                     /locus_tag="DEHA2F11286g"
                     /db_xref="GeneID:2903596"
     mRNA            <969673..>970128
                     /locus_tag="DEHA2F11286g"
                     /product="DEHA2F11286p"
                     /transcript_id="XM_460855.1"
                     /db_xref="GeneID:2903596"
     CDS             969673..970128
                     /locus_tag="DEHA2F11286g"
                     /note="similar to uniprot|P25337 Saccharomyces cerevisiae
                     YCR063W BUD31 Protein involved in bud-site selection"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11286p"
                     /protein_id="XP_460855.2"
                     /db_xref="GeneID:2903596"
                     /db_xref="GOA:Q6BLR6"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR6"
                     /translation="MAKISSSKKNKQPPEGYSKIEPTLSKLLVKSREAQTKSIKTENK
                     NQSLWPIIQINHQINRYIYSLYYERESISQELYNWLLQQKYANKNLIAKWKKQGYEKL
                     CCLNCIMTNEKNHGTTCICRVPKTTLVKNDRSERVECITCGCRGCASTD"
     gene            complement(<970378..>972156)
                     /locus_tag="DEHA2F11308g"
                     /db_xref="GeneID:2903597"
     mRNA            complement(<970378..>972156)
                     /locus_tag="DEHA2F11308g"
                     /product="DEHA2F11308p"
                     /transcript_id="XM_460856.1"
                     /db_xref="GeneID:2903597"
     CDS             complement(970378..972156)
                     /locus_tag="DEHA2F11308g"
                     /note="weakly similar to uniprot|P25364 Saccharomyces
                     cerevisiae YCR065W HCM1 Forkhead transcription factor
                     involved in cell cycle specific transcription of SPC110
                     encoding a spindle pole body (SPB) calmodulin binding
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11308p"
                     /protein_id="XP_460856.2"
                     /db_xref="GeneID:2903597"
                     /db_xref="GOA:Q6BLR5"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR5"
                     /translation="MSTAGRYMDRVPLREKNAGNIAASSSREKTRLTETPNTHKSRKI
                     TTPPESVSVSRKKSLILETPISKHFNDDGVNGTSNGETDNTKSALLSPAFSSPQQQSQ
                     RRMKDSFDIPPKPSFVQSSSASVDSDDEKYKSKKKKKTKKDLKDTTFQLGSHDKPPYS
                     YATLIGMSILSNPEKRLTLSQIYQWISDTFKYYRREEVGWQNSIRHNLSLNKAFIKGE
                     KSKDGKGHFWCIQPGCEEQFLRSKNSKKHSYQEIIDQIYASINPSKSSINSIPSSPNV
                     SNEDLKRKASDTDDAASYEGYGDDEDQEDDEEYTRSILNPPIKKQRLLSATTGNGTLE
                     TIPNLEPPFSQWQATPGGFKISNSPNTSNSNNPPQFVISESPGKPLLAGKNLTFTSSF
                     SCNSNLELSPIRPSETGPLLEPLTPANNVYRNGSLLNHQLSAFHYQSHHPHLSSSTTS
                     TLLQQSIQQPHNVKTPKSCSRTPLRNLRTPQTASIMKKLWNSPSYLEEFYYSPLVSSS
                     QAALNSYDDDDMIMRAFESPSNNAHGHNKRPSISSTSTNSSRNLFNDLKKIDHSSRNS
                     STSSNNDKERTRLRSVSASSTDKDDN"
     gene            <972880..>974073
                     /locus_tag="DEHA2F11330g"
                     /db_xref="GeneID:2903458"
     mRNA            <972880..>974073
                     /locus_tag="DEHA2F11330g"
                     /product="DEHA2F11330p"
                     /transcript_id="XM_460857.1"
                     /db_xref="GeneID:2903458"
     CDS             972880..974073
                     /locus_tag="DEHA2F11330g"
                     /note="similar to uniprot|P36100 Saccharomyces cerevisiae
                     YKL028W TFA1 TFIIE large subunit involved in recruitment
                     of RNA polymerase II to the promoter activation of TFIIH
                     and promoter opening"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11330p"
                     /protein_id="XP_460857.2"
                     /db_xref="GeneID:2903458"
                     /db_xref="GOA:Q6BLR4"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR4"
                     /translation="MDDTIRSLIRFVARGFYSKPYVLILDAVLLHSVLSEDDLIYLLS
                     IHRKELRSLCNKLVEDRLLVNHIQKEENAQQRLITRTYFYIHTTEAIDSIKWKVHSIV
                     NIIKEEMTHYGNPQGYVCPRCGKKVSQLDAISLLSDDKTNFECDNCGGVLIEDDSSKQ
                     ASLRQAKLEKLMNQVDPVISYLKKIDDAYIEDNTFESSLVKSIPAQSSTSASYSVSNR
                     ISSRSRSNLSSLQNDASKSQATLHVSITANDENYEREQQEKEERRQKLQQNALPSWHS
                     EGTVGKSSLGKLDDDNDELSTPNEGTPVPGIKSENEIQSDAADSGSATMDISSTNTPM
                     ANTDEGVDNSTPNVAPVNVSELKDKESQDALAAYYAQLAEREAEDDDDDDDDDEDDFD
                     DFEDV"
     gene            <974293..>975252
                     /locus_tag="DEHA2F11352g"
                     /db_xref="GeneID:2903459"
     mRNA            join(<974293..974316,974386..>975252)
                     /locus_tag="DEHA2F11352g"
                     /product="DEHA2F11352p"
                     /transcript_id="XM_460858.1"
                     /db_xref="GeneID:2903459"
     CDS             join(974293..974316,974386..975252)
                     /locus_tag="DEHA2F11352g"
                     /note="similar to uniprot|P38152 Saccharomyces cerevisiae
                     YBR291C CTP1 Mitochondrial inner membrane citrate
                     transporter member of the mitochondrial carrier family"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11352p"
                     /protein_id="XP_460858.1"
                     /db_xref="GeneID:2903459"
                     /db_xref="GOA:Q6BLR3"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR3"
                     /translation="MSKSNDQVKIDPFKSFIAGGTAGAIEGVVTYPFEFAKTRLQLVD
                     KSSKASRNPLVLIYNVAKTQGVSSLYVGCPAFVVGNTVKASVRFLGFDSIKALLVDTD
                     GKLSGPRGVLAGLGAGLLESVIAVTPFEAIKTALIDDKQTAKPKYQNGLISGSVKLCR
                     DMGFRGIYAGIVPVSLRQASNQAVRLGSYNSIKTMIQQASGTNPNEPLSSVSTFLVGA
                     FAGITTVYTTMPIDTVKTRMQALGADKLYTSTLNCFVKIFKEEGLLTFWRGATPRLGR
                     LVLSGGIVFTIYEKMLVIMN"
     gene            complement(<975319..>976476)
                     /locus_tag="DEHA2F11374g"
                     /db_xref="GeneID:2903460"
     mRNA            complement(<975319..>976476)
                     /locus_tag="DEHA2F11374g"
                     /product="DEHA2F11374p"
                     /transcript_id="XM_460859.1"
                     /db_xref="GeneID:2903460"
     CDS             complement(975319..976476)
                     /locus_tag="DEHA2F11374g"
                     /note="weakly similar to uniprot|P38356 Saccharomyces
                     cerevisiae YBR290W BSD2 Heavy metal ion homeostasis
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11374p"
                     /protein_id="XP_460859.2"
                     /db_xref="GeneID:2903460"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR2"
                     /translation="MSEYKENDENQILLDSFDASELEDADKDKIGWQGSFNDNGSEVS
                     SEREEDTRLEDGRDGDGLLGAAEEIDRNIHEAMITEGNSSNSNSREGNINDNERMEGD
                     TDNDLESQLPAGHLTPKERVVNVLNSVFPFKQTYERINNGLTTGRMQANVPGRFIGQG
                     TDGVFRNLMAKPDREANRTEETHPPSYEEAAADATPEYWESTVVSPLYEDEVFVEGLP
                     VGNVANLVWNILVSSAFQFVGFVLCYLLHTSHAAKQGSRAGLGVTFIYYGLGMIPSNF
                     GSAEKVPDRYEPNNPNQIDIDQSASVNDGKLDNYQSGIFQQHTDSPDKKLNQTPYFAY
                     GIIAFGIFIIVKAFIDYYRVKQMERVILSPPSNETVVTNSVTEITRNAGEV"
     gene            complement(<976842..>977732)
                     /locus_tag="DEHA2F11396g"
                     /db_xref="GeneID:2903461"
     mRNA            complement(<976842..>977732)
                     /locus_tag="DEHA2F11396g"
                     /product="DEHA2F11396p"
                     /transcript_id="XM_460860.1"
                     /db_xref="GeneID:2903461"
     CDS             complement(976842..977732)
                     /locus_tag="DEHA2F11396g"
                     /note="similar to uniprot|P40471 Saccharomyces cerevisiae
                     YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
                     phosphate reductase found in lipid particles and ER"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11396p"
                     /protein_id="XP_460860.2"
                     /db_xref="GeneID:2903461"
                     /db_xref="GOA:Q6BLR1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR1"
                     /translation="MPQQKYALITGASSGIGYQLAIAFSKKGYKVFGCAPESVLFEMK
                     PLTEEYGVVAFGCDITNIDDVKKAAKLVGEQTGGRLDILYNNAGISFGGPAVEMPDEE
                     LVKIFNVNTIGHITMTKYMIDYVIAAKGTIVFTSSVAARIPLSWAGPYCATKAAIDMY
                     AMVLHGEMKPFGVSVHSVITGGVDTSLLDTIDLNRNASDSRFNVDGLYDSMWSSRNMS
                     RNKYTTLSPEKYANRIVRKISSIWGIGFNIYEGAFAYSLHLASRYAPFFLVEWGTAFH
                     FNQLKVFRNIRRKLSSKKDK"
     gene            complement(<977921..>980032)
                     /locus_tag="DEHA2F11418g"
                     /db_xref="GeneID:2903462"
     mRNA            complement(<977921..>980032)
                     /locus_tag="DEHA2F11418g"
                     /product="DEHA2F11418p"
                     /transcript_id="XM_460861.2"
                     /db_xref="GeneID:2903462"
     CDS             complement(977921..980032)
                     /locus_tag="DEHA2F11418g"
                     /note="some similarities with uniprot|P18480 Saccharomyces
                     cerevisiae YBR289W SNF5 Involved in global regulation of
                     transcription"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11418p"
                     /protein_id="XP_460861.2"
                     /db_xref="GeneID:2903462"
                     /db_xref="GOA:Q6BLR0"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:Q6BLR0"
                     /translation="MNFNHQQNKGGQQQQPNPQQQAQRNAFPALPPQLANLTPQQLQQ
                     LRNQPQFQTLMKNYMQRQQMMNQQEQAQMQGQTPTSTFMNSQNVHPSQQFNQQTPLMN
                     QQTQQTQQAPGMQGNIAIPPRQPSMTIPTPQVQGMSIPQQIPSHIPQQMMQQQGRSGI
                     SPSSGMGPASVSPHVIAQQMIGSTAQGDPTGDRGASSQAPNELINKIPLKELSSTHEW
                     SEKLKNEGKDIPTDLKVYESIIGKDSDFLKKKMEQVGDSKKMLDMLVKDIKTYSEIKQ
                     LRMNAITLSSKGQFNNSIWGEGYQGYGNGITNTATRLLLPHHNKRYSAVPDVMFTERE
                     INDRVLKRLRPSETQQLVPIRLEFDQERDKFKLRDTFLWDLNEDVLPLENFVALLIED
                     YKFIPPHHAQTILASIREQIRDFHRKPDKVMGELRVPIKIDVTINNTQLVDQFEWDIL
                     NFGESDPEDFARIMCDEMNLPGEFTTAIAHTIREQTQLFHKSLFLVGYSFDGSPVYED
                     EIRSHVLPSLRLSSHDNTAGFDSMVDDFFSILRNPATVPDFTPSLVKLTQLELERLDK
                     EIERDSRRKRRHNLNDLTDASATSGSGLTSGRGTSSRRSALHMGRGGPVLPDLSDAPK
                     TFRTPAPSSILPGGIDLGVPDIYGYNEVIVHRSQIKNPDYKPPPPTSEAELDTDNINN
                     RVRYTNDRIMGRFLVSIKLPR"
     gene            complement(<980196..>984608)
                     /locus_tag="DEHA2F11440g"
                     /db_xref="GeneID:2903463"
     mRNA            complement(<980196..>984608)
                     /locus_tag="DEHA2F11440g"
                     /product="DEHA2F11440p"
                     /transcript_id="XM_460862.1"
                     /db_xref="GeneID:2903463"
     CDS             complement(980196..984608)
                     /locus_tag="DEHA2F11440g"
                     /note="similar to uniprot|P13382 Saccharomyces cerevisiae
                     YNL102W POL1 Catalytic subunit of the DNA polymerase
                     alpha-primase complex required for the initiation of DNA
                     replication during mitotic DNA synthesis and premeiotic
                     DNA synthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11440p"
                     /protein_id="XP_460862.2"
                     /db_xref="GeneID:2903463"
                     /db_xref="GOA:Q6BLQ9"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR024647"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:Q6BLQ9"
                     /translation="MSSRASRRDKLKELKEARQAGSSLITYSDGEDDQGIYDEVDEET
                     YRERKRNQMMNDDFIVDDNGEGYVDNGVDEWDDSTRPKYYSDEEEEGTGKKRKKNQKK
                     PVKVAKTSEINNFFKSGGFTSSKVTAPKKIDANIDDILEDFSEVKNGNKKSTTTSNSF
                     GVQRKTANKKKSKQNAFSFSTMSKRDKPKRIDELSSHDDYSMDIDASEQPSSPIKRES
                     TNLKEEINVNGMEKENVDPQVKKEDTPENINGDVQDEDDEEIDDDSEDEVIVTRRPRA
                     AAANKHKAANFSAVKASNVPSPSPSRPTAHSLVSHTEKLDESKILQDSGEAGNESFKM
                     FWLDYCEVDNSLLLFGKIQTRDGNLVSGVVKVNGLCRELYFLPRKHRISNDEEDTEDE
                     VSALDVHEEVTPLLLEKYGLESIKAKPETMKYAFELPGIPKEGEYLKVLLPYKTPRNR
                     SLIIPSNLEGETFSHVFGTNANIFEALVSQQNIMGPCWLEISNGNFTEIQNTSHCQVE
                     VAVSSPSFVRPIVDLKLAPPNLTVTSISVQTIMNTKQNKQEVASVSIATYRELPQDSP
                     IDENIKPDDLVVLVRPIGAVAVPPGLAQLAQKQGLPLRTFPNEKALLNCLAALVKNLD
                     PDVFIGHRLENISLDVLVHRMYDLKVTTWSTFGRRNRKAWPDRFGRNNSGFNNNLQIR
                     EIFQGRLLCDIANEMGQSLTPKCQSWDLNEMYDVVCHKKQIPLEINFHNPRYAEDASF
                     LLMALKENASNVRITAEVAFSIQILSLSKQLTNLAGNAWSHTLSGTRAGRNEFILLHE
                     FKRNNYIVPDKEDKYHKNTNHQQQAKLESNEEDATTATSNKKPKYQGGLVFEPEKGLH
                     KNYILVMDFNSLYPSIIQEYNICFTTVNRDNYNAAKIDEGDLPDIPDREAAQGVLPRL
                     LNALVSRRREVKKLLKDPKNTAIERAQYDIKQQALKLTANSMYGCLGYVNSRFYAKPL
                     AMLVTNKGREILMDTRQLAESIGLRVVYGDTDSVMIDTGVDDFKEAIKIGEEFKIQVN
                     ERYKLLEIDIDNVFKRLLLHAKKKYAAMTTSIDRKTGQEIVKLEVKGLDMRRREYCQL
                     SKDMSTFVLEKILSDADPEQALSDVYEYLEDMTRKIKDNEIQVDKFKINTRLSKDPNS
                     YPNGKTMPPVQVALRLRASGKVIKAGSVITYIITAPASEDDKAPPAERARAIQEVLNK
                     QANLKPDADFYLEKQIFAPVERLVDRIEGVDMMRIASSLGIDTKKYVLRVKNSDATNG
                     EILPLESNISDSERFRQSSYLVLECKCGSKFRFGGIMASDDYKVTFNGICCSKCDYTF
                     PVLRITAQVEYTLRNHISLYYAGWLVCDDSACGITTRQISVYGRRCIGTSGKAHGCKG
                     VMRYKYSDKALYNQLLYLHSLFDVDKAKKNQLRPIYDVKAPQPLASGQVDALAEQNRE
                     LFSSCQNVVQKYLSECGRRYVNMGSIFDFMNSSK"
     gene            complement(<984920..>985852)
                     /locus_tag="DEHA2F11462g"
                     /db_xref="GeneID:2903464"
     mRNA            complement(<984920..>985852)
                     /locus_tag="DEHA2F11462g"
                     /product="DEHA2F11462p"
                     /transcript_id="XM_460863.1"
                     /db_xref="GeneID:2903464"
     CDS             complement(984920..985852)
                     /locus_tag="DEHA2F11462g"
                     /note="weakly similar to CA2974|IPF12540 Candida albicans
                     IPF12540 unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11462p"
                     /protein_id="XP_460863.2"
                     /db_xref="GeneID:2903464"
                     /db_xref="UniProtKB/TrEMBL:Q6BLQ8"
                     /translation="MKLTRPAAAIILTYVALTSAAPATVGPKNQSSPSPIAPKVTAAI
                     APKETAAIHSLVSSLNQYNAAHKVPGYTKREDILVREAHELIARSKLPILDKILMALK
                     DSGLANVVIDFVLLSPELLDLTADATIFILKSGLINLADLLIALQKSGLVNQILLLAL
                     DDPEILPGLLRIGKELLKQNGIDIFSKRSIDTTELETAAVFEETSIDKRESQLLNELF
                     ASLKDSGLGVSIIQNLLTNPDLSAPAATFLTKILKSHAVTLKELLDALKESHFIFNVL
                     KDILHDKALLEKFGEVIFERISKGLISRTMYDNA"
     gene            complement(<985936..>986103)
                     /locus_tag="DEHA2F11484g"
                     /db_xref="GeneID:2903465"
     mRNA            complement(<985936..>986103)
                     /locus_tag="DEHA2F11484g"
                     /product="DEHA2F11484p"
                     /transcript_id="XM_460864.1"
                     /db_xref="GeneID:2903465"
     CDS             complement(985936..986103)
                     /locus_tag="DEHA2F11484g"
                     /note="no similarity"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11484p"
                     /protein_id="XP_460864.1"
                     /db_xref="GeneID:2903465"
                     /db_xref="UniProtKB/TrEMBL:Q6BLQ7"
                     /translation="MNTLAKFTNYDLFNLSVRRSKSVRLPSKTARLGVPLNEKGSDNP
                     KQIIGNAGQTV"
     gene            <986777..>987682
                     /locus_tag="DEHA2F11506g"
                     /db_xref="GeneID:2903466"
     mRNA            <986777..>987682
                     /locus_tag="DEHA2F11506g"
                     /product="DEHA2F11506p"
                     /transcript_id="XM_460865.1"
                     /db_xref="GeneID:2903466"
     CDS             986777..987682
                     /locus_tag="DEHA2F11506g"
                     /note="similar to uniprot|Q12241 Saccharomyces cerevisiae
                     YOR106W VAM3 Syntaxin-related protein"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11506p"
                     /protein_id="XP_460865.2"
                     /db_xref="GeneID:2903466"
                     /db_xref="GOA:Q6BLQ6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6BLQ6"
                     /translation="MSFANFDIESQRSVSKGNNEHIERHQSQSQNELDTIIDKASDQL
                     QLFSNLISQFDAKKKLIGSKRDYMQLRDNANALISKISDMDSAIQILIENLSHLINKK
                     SGHKRQGTNDDQEGSSSKLEITQKQMVIKERLVSEFNELHKQFQRSARQYTEKTRAYP
                     VKDDIPRQETSDERTPLMHSDHRETGQQVAVQEPSQDQIDETELQYHLMLTEERNQNI
                     NQINEGILEINSIFKDLGELVNQQGEQLDTVEDNILQLSGNTQQAERELMKAHEYQKK
                     KSKWSCILLFALCIFVLVIVLAVLS"
     gene            complement(<987819..>988315)
                     /locus_tag="DEHA2F11528g"
                     /db_xref="GeneID:8998945"
     mRNA            complement(join(<987819..988168,988303..>988315))
                     /locus_tag="DEHA2F11528g"
                     /product="DEHA2F11528p"
                     /transcript_id="XM_002770751.1"
                     /db_xref="GeneID:8998945"
     CDS             complement(join(987819..988168,988303..988315))
                     /locus_tag="DEHA2F11528g"
                     /note="similar to CA6160|IPF1835 Candida albicans IPF1835
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11528p"
                     /protein_id="XP_002770797.1"
                     /db_xref="GeneID:8998945"
                     /db_xref="UniProtKB/TrEMBL:B5RUE4"
                     /translation="MPFIVPMSIKIAVTAGALAGATLAVVNNKENVLRGAEYVLQKGA
                     DFCKQRLEKAQEMNMHFAESHEDSAFASGYAYSENGESTGNDTPDDMDSDRDYATTPD
                     VSDMSDSSDEEIDMISLD"
     gene            <988716..>990197
                     /locus_tag="DEHA2F11550g"
                     /db_xref="GeneID:8998946"
     mRNA            <988716..>990197
                     /locus_tag="DEHA2F11550g"
                     /product="DEHA2F11550p"
                     /transcript_id="XM_002770752.1"
                     /db_xref="GeneID:8998946"
     CDS             988716..990197
                     /locus_tag="DEHA2F11550g"
                     /note="similar to CA6159|IPF1837 Candida albicans IPF1837
                     unknown function"
                     /codon_start=1
                     /transl_table=12
                     /product="DEHA2F11550p"
                     /protein_id="XP_002770798.1"
                     /db_xref="GeneID:8998946"
                     /db_xref="GOA:B5RUE5"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:B5RUE5"
                     /translation="MSSPTIITRPLSMSENFLRSRSSTGFYNNFQVTATYSHDLTADL
                     TLLYRALRKTILDYHILICYIVKNKSIGRCVYTPISQARLKDLLIFRDSSYIDGNAIN
                     EKFMKEVNDVVFELHEDSPLFKLIIVGKHDLSVVFEHTIADGVVGNY