GenomeNet

Database: RefSeq
Entry: NC_006840
LinkDB: NC_006840
Original site: NC_006840 
LOCUS       NC_006840            2897536 bp    DNA     circular CON 15-APR-2020
DEFINITION  Aliivibrio fischeri ES114 chromosome I, complete sequence.
ACCESSION   NC_006840
VERSION     NC_006840.2
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604303
            Assembly: GCF_000011805.1
KEYWORDS    RefSeq.
SOURCE      Aliivibrio fischeri ES114
  ORGANISM  Aliivibrio fischeri ES114
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Aliivibrio.
REFERENCE   1  (bases 1 to 2897536)
  AUTHORS   Mandel,M.J., Stabb,E.V. and Ruby,E.G.
  TITLE     Comparative genomics-based investigation of resequencing targets in
            Vibrio fischeri: focus on point miscalls and artefactual expansions
  JOURNAL   BMC Genomics 9, 138 (2008)
   PUBMED   18366731
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2897536)
  AUTHORS   Ruby,E.G., Urbanowski,M., Campbell,J., Dunn,A., Faini,M.,
            Gunsalus,R., Lostroh,P., Lupp,C., McCann,J., Millikan,D.,
            Schaefer,A., Stabb,E., Stevens,A., Visick,K., Whistler,C. and
            Greenberg,E.P.
  TITLE     Complete genome sequence of Vibrio fischeri: a symbiotic bacterium
            with pathogenic congeners
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 102 (8), 3004-3009 (2005)
   PUBMED   15703294
REFERENCE   3  (bases 1 to 2897536)
  AUTHORS   Mandel,M.J., Stabb,E.V. and Ruby,E.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2007) Department of Medical Microbiology and
            Immunology, University of Wisconsin School of Medicine and Public
            Health, 1550 Linden Drive, Madison, WI 53706-1521, USA
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 2897536)
  AUTHORS   Ruby,E.G., Urbanowski,M., Campbell,J.W., Dunn,A., Faini,M.A.,
            Gunsalus,R.P., Lostroh,P., Lupp,C., McCann,J.R., Millikan,D.S.,
            Schaefer,A.L., Stabb,E.V., Stevens,A.M., Visick,K.L., Whistler,C.A.
            and Greenberg,E.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2004) Kewalo Marine Laboratory, and W.M. Keck
            Microbial Communities and Cell Signaling Program, University of
            Hawaii, Honolulu, HI 96081, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP000020.
            On Apr 4, 2008 this sequence version replaced NC_006840.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 04/04/2020 09:43:11
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 3,941
            CDSs (total)                      :: 3,781
            Genes (coding)                    :: 3,731
            CDSs (with protein)               :: 3,731
            Genes (RNA)                       :: 160
            rRNAs                             :: 13, 12, 12 (5S, 16S, 23S)
            complete rRNAs                    :: 13, 12, 12 (5S, 16S, 23S)
            tRNAs                             :: 119
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 50
            CDSs (without protein)            :: 50
            Pseudo Genes (ambiguous residues) :: 0 of 50
            Pseudo Genes (frameshifted)       :: 38 of 50
            Pseudo Genes (incomplete)         :: 7 of 50
            Pseudo Genes (internal stop)      :: 13 of 50
            Pseudo Genes (multiple problems)  :: 7 of 50
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2897536
                     /organism="Aliivibrio fischeri ES114"
                     /mol_type="genomic DNA"
                     /strain="ES114"
                     /db_xref="taxon:312309"
                     /chromosome="I"
     gene            complement(313..747)
                     /gene="mioC"
                     /locus_tag="VF_RS00005"
                     /old_locus_tag="VF0001"
                     /old_locus_tag="VF_0001"
                     /db_xref="GeneID:54162629"
     CDS             complement(313..747)
                     /gene="mioC"
                     /locus_tag="VF_RS00005"
                     /old_locus_tag="VF0001"
                     /old_locus_tag="VF_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein MioC"
                     /protein_id="WP_011260893.1"
                     /db_xref="GeneID:54162629"
                     /translation="MKKVSIITGSTLGGAEYVGDHLADLLEEMDFSTDIHNQPNLDDI
                     DIDSLWLLVVSTHGAGDYPDNIKPFIQQLESVTQPLSSVEFAVVAIGDSSYDTFCAAG
                     KSLQNTLKEHGAIEKYPLLEIDVTQNSIPEEPAELWLKQHIC"
     gene            complement(817..2184)
                     /gene="mnmE"
                     /locus_tag="VF_RS00010"
                     /old_locus_tag="VF0002"
                     /old_locus_tag="VF_0002"
                     /db_xref="GeneID:54162630"
     CDS             complement(817..2184)
                     /gene="mnmE"
                     /locus_tag="VF_RS00010"
                     /old_locus_tag="VF0002"
                     /old_locus_tag="VF_0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine-5-carboxymethylaminomethyl(34)
                     synthesis GTPase MnmE"
                     /protein_id="WP_005416772.1"
                     /db_xref="GeneID:54162630"
                     /translation="MTLHTDTIVAQATAPGRGGVGIIRVSGPKAKDVALAVIGKELKP
                     RYAEYAPFKDENGLELDQGIALYFPNPHSFTGEDVLELQGHGGPVVMDMLIKRILKID
                     GIRTARPGEFSERAFLNDKMDLAQAEAIADLIDASSEEAAKSALNSLQGVFSNKINTL
                     VESLIYLRIYVEAAIDFPEEEIDFLADGKVSGDLQGIIDNLNAVRKEANQGAIMREGM
                     KVVIAGRPNAGKSSLLNALSGKDTAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR
                     EASDEVERIGIERAWDEIAQADRVLFMVDGTTTDATDPKLIWPEFLDRLPKNMGMTVI
                     RNKADQTGEDLGICHVNDPTLIRLSAKTGEGVDALRNHLKECMGFSGNQEGGFMARRR
                     HLEALEKAAQHLDIGQQQLEGYMAGEILAEELRIAQQHLSEITGEFTSDDLLGRIFTS
                     FCIGK"
     gene            complement(2281..3906)
                     /gene="yidC"
                     /locus_tag="VF_RS00015"
                     /old_locus_tag="VF0003"
                     /old_locus_tag="VF_0003"
                     /db_xref="GeneID:54162631"
     CDS             complement(2281..3906)
                     /gene="yidC"
                     /locus_tag="VF_RS00015"
                     /old_locus_tag="VF0003"
                     /old_locus_tag="VF_0003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase YidC"
                     /protein_id="WP_011260894.1"
                     /db_xref="GeneID:54162631"
                     /translation="MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTQTD
                     GDVPTSSTANSDTPADSAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELGSKA
                     KFVLLKNDATHSYVAQSGLIGPQGIDSNSGRAQFTAQKTDYVLAEGQNELRVPLTLVK
                     DGITYTKTLILKRDSYAIDVDYTVDNQSSAPATVEMYTNLKQNLMDDGGSLTMPTYRG
                     AAYSTEDTRYKKYSFDDMEDKNLSIDMTNGQGWAGMLQHYFASAWIPRNVNDAKLTSR
                     VAGDYGYIGVRMPSVTIPAGQEATLSATLWTGPKLQKEMAATAPYLDLTVDYGWLWFI
                     ASPLHKLLSFIQGIVVNWGLAIIVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLTAMR
                     ERIGDDRQRMSQEMMELYKKEKVNPLGGCLPILLQMPIFISLYWALMESVELRHTPFF
                     GWITDLSAQDPYYILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTVFFLWFP
                     SGLVLYWLVSNIVTLIQQTLIYRALEKKGLHSK"
     gene            complement(3909..4166)
                     /gene="yidD"
                     /locus_tag="VF_RS00020"
                     /db_xref="GeneID:54162632"
     CDS             complement(3909..4166)
                     /gene="yidD"
                     /locus_tag="VF_RS00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004743588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertion efficiency factor
                     YidD"
                     /protein_id="WP_005416776.1"
                     /db_xref="GeneID:54162632"
                     /translation="MASPVSPFSWIAIGLIRFYQLVISPMIGPRCRFTPTCSHYAIEA
                     LKSHGLVKGCWLSGKRLLKCHPLNDGGYDPVPPKQHKDREQ"
     gene            complement(4133..4489)
                     /gene="rnpA"
                     /locus_tag="VF_RS00025"
                     /old_locus_tag="VF0004"
                     /old_locus_tag="VF_0004"
                     /db_xref="GeneID:54162633"
     CDS             complement(4133..4489)
                     /gene="rnpA"
                     /locus_tag="VF_RS00025"
                     /old_locus_tag="VF0004"
                     /old_locus_tag="VF_0004"
                     /EC_number="3.1.26.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004417259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="WP_005416777.1"
                     /db_xref="GeneID:54162633"
                     /translation="MMNYDFSRELRLLTPEDYKFVFKQAHRAGSPHFTILARENSLSH
                     PRLGLAVPKKQIKTAVGRNKFKRIVRESFRNKQHSLPAKDFVVIAKKSAQELSNEDFN
                     KLLDKLWHRLSRPSRG"
     gene            complement(4502..4636)
                     /gene="rpmH"
                     /locus_tag="VF_RS00030"
                     /old_locus_tag="VF0005"
                     /old_locus_tag="VF_0005"
                     /db_xref="GeneID:54162634"
     CDS             complement(4502..4636)
                     /gene="rpmH"
                     /locus_tag="VF_RS00030"
                     /old_locus_tag="VF0005"
                     /old_locus_tag="VF_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005378825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_005416778.1"
                     /db_xref="GeneID:54162634"
                     /translation="MKRTFQPSVLKRKRSHGFRARMATKNGRNVINARRAKGRKRLSK
                     "
     gene            complement(4822..5559)
                     /locus_tag="VF_RS00035"
                     /old_locus_tag="VF0006"
                     /old_locus_tag="VF_0006"
                     /db_xref="GeneID:54162635"
     CDS             complement(4822..5559)
                     /locus_tag="VF_RS00035"
                     /old_locus_tag="VF0006"
                     /old_locus_tag="VF_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017081730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_011260896.1"
                     /db_xref="GeneID:54162635"
                     /translation="MIKVKNLHKSFGDTQVLAGIDLEINKGEIIAVIGSSGTGKSTLL
                     RCINFLETANKGVISIGDVSVDSEQHTKSDVLALRRKTGFIFQNYALFAHLTARQNIA
                     EGLITVHKWKKDDALKKAQQILDDIGLGDKGDNYPAALSGGQQQRVGIGRAMALEAEL
                     LLFDEPTSALDPEWVNEVLTLMKKLATQHQTMLVVTHEMQFAREVADRVIYMSDGKIV
                     EQGTPEQIFGYPQDPKLQKFLNQVGIE"
     gene            complement(5556..6227)
                     /locus_tag="VF_RS00040"
                     /old_locus_tag="VF0007"
                     /old_locus_tag="VF_0007"
                     /db_xref="GeneID:54162636"
     CDS             complement(5556..6227)
                     /locus_tag="VF_RS00040"
                     /old_locus_tag="VF0007"
                     /old_locus_tag="VF_0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005481192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_011260897.1"
                     /db_xref="GeneID:54162636"
                     /translation="MGFDFTYMIELLPILFKYLGTTMEMALWGLLFSLALALVLANLR
                     VFKVPVFDQLSQLYISFFRGTPLLVQLFLLYYGLPQVFPIFVGLDAFSAAVIGLTLHF
                     AAYMAESIRAAIIGIDRSQMEASLSIGMTTSQAMRRIILPQATRVALPSLMNYFIDMI
                     KSTSLAFTLGVAEIMAKAQMEASSSFKFFEAFLAVALIYWGVVVILTRVQIWAEEKLN
                     KAYVR"
     gene            complement(6352..7104)
                     /locus_tag="VF_RS00045"
                     /old_locus_tag="VF0008"
                     /old_locus_tag="VF_0008"
                     /db_xref="GeneID:54162637"
     CDS             complement(6352..7104)
                     /locus_tag="VF_RS00045"
                     /old_locus_tag="VF0008"
                     /old_locus_tag="VF_0008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_011260898.1"
                     /db_xref="GeneID:54162637"
                     /translation="MKWTKNILAGLALTLATTQFAQAATEVKVGMSGRYFPFTFVKQD
                     KLQGFEVDLWDEIGRRNDYNVEYVTASFSGLFGLLETGRIDTISNQITKTKEREAKYL
                     FADPYVVDGAQITVRKGNDSIKSIDDLNGKTVAVNLGSNFEKLLRDHDKSEQINIKTY
                     DTGIEHDVALGRADAFVMDRLSAAQLIKKSGLPLQLAGKPFETIENAWPFVNNEKGQK
                     LQKEVNQALNAMREDGTLAKISQKWFDSDITQ"
     gene            7401..8810
                     /gene="dnaA"
                     /locus_tag="VF_RS00050"
                     /old_locus_tag="VF0009"
                     /old_locus_tag="VF_0009"
                     /db_xref="GeneID:54162638"
     CDS             7401..8810
                     /gene="dnaA"
                     /locus_tag="VF_RS00050"
                     /old_locus_tag="VF0009"
                     /old_locus_tag="VF_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017419841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_005416782.1"
                     /db_xref="GeneID:54162638"
                     /translation="MSSSLWLQCLQRLQEELPSAEFSMWVRPLQAELNDNTLTLFAPN
                     RFVLDWVRDKYLNSINSLLNEFCGNDIPTLRFEVGSKPVSAPAVPKQTAADVAAATSA
                     PAQLQARQSVHKPWESEGAGPVAADLNHRSNVNPKHKFTNFVEGKSNQLGLAAARQVS
                     DNPGTAYNPLFLYGGTGLGKTHLLHAVGNAIVDSKPDARVVYMHSERFVQDMVKALQN
                     NAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKE
                     INGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLADEVAFFIAKRLRSN
                     VRELEGALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIK
                     MADLLSKRRSRSVARPRQLAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLR
                     EESHDIKEDYSNLIRTLSS"
     gene            8843..9943
                     /gene="dnaN"
                     /locus_tag="VF_RS00055"
                     /old_locus_tag="VF0010"
                     /old_locus_tag="VF_0010"
                     /db_xref="GeneID:54162639"
     CDS             8843..9943
                     /gene="dnaN"
                     /locus_tag="VF_RS00055"
                     /old_locus_tag="VF0010"
                     /old_locus_tag="VF_0010"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020430388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_011260899.1"
                     /db_xref="GeneID:54162639"
                     /translation="MKFSIERSLLLKPLQQVSGALGGRPSLPILGNILLQVENGQLSM
                     TATDLEVELISKITLEGDFEAGAVTVPSRKFLDICRGLPDSANITIVLEGDRVLVRSG
                     RSRFTLATLPANDFPNIEGWESEVEITLSQAQLRKLIESTQFSMANQDVRYYLNGMMF
                     ETQGNIFRSVATDGHRMAVCNMPVESELPEQQVIMPRKGIQELVRLLDSPEQSVTLQF
                     GNSNVRAEVNNFVFTSKLVDGRFPDYRRVMPQSSNKTLEADCDELRQAFARAAILSNE
                     KFRGVRVNLANNQMRITANNPEQEEAEEILDVDFQGDDIEIGFNVSYVLDVLNTLKCE
                     RVRISMTTANASALVEDCANDEAQYVVMPIRL"
     gene            9957..11036
                     /gene="recF"
                     /locus_tag="VF_RS00060"
                     /old_locus_tag="VF0011"
                     /old_locus_tag="VF_0011"
                     /db_xref="GeneID:54162640"
     CDS             9957..11036
                     /gene="recF"
                     /locus_tag="VF_RS00060"
                     /old_locus_tag="VF0011"
                     /old_locus_tag="VF_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication/repair protein RecF"
                     /protein_id="WP_011260900.1"
                     /db_xref="GeneID:54162640"
                     /translation="MPLSRLIINDFRNITTCDIQLSSGFNFVIGPNGSGKTSVLEAIY
                     LLGHGRSFKSSLTGRIIRNDCDELFIHGRFTTPEQFELPIGINKQRDGTTEVKIGGES
                     GQKLAQLAKVLPLQLIHPEGFELVTDGPKFRRAFIDWGVFHVEPAFYDAWSRVKRLTK
                     QRNALLKTANSYRELSYWDLELAQLSEKIDQWRVDYINHISEATQQICQAFLPEYDIK
                     LSYYRGWDRETPYAELLKKNFERDKQLGYTVGGPNKADLRIKVAGTPVEDVLSRGQLK
                     LMVCALRLAQGQHLTEATGKQCIYLIDDFASELDSHRRQLLAQYLKQTKAQVFISSIT
                     AEQIADMHDDESKMFEIEHGKIAQG"
     gene            11054..13471
                     /gene="gyrB"
                     /locus_tag="VF_RS00065"
                     /old_locus_tag="VF0012"
                     /old_locus_tag="VF_0012"
                     /db_xref="GeneID:54162641"
     CDS             11054..13471
                     /gene="gyrB"
                     /locus_tag="VF_RS00065"
                     /old_locus_tag="VF0012"
                     /old_locus_tag="VF_0012"
                     /EC_number="5.6.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005458663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
                     /protein_id="WP_011260901.1"
                     /db_xref="GeneID:54162641"
                     /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNSIDEALAGHCKDIIVTIHEDNSVSVSDDGRGIPTAIHPEEGVSAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKVELTIHRAGEIHQQVYHHGEPEAPLAVIGKT
                     DTTGTKIRFWPSEETFTNVVFVYEILAKRLRELSFLNSGVSIKLQDMREEDKADHFMY
                     EGGIQAFVQHLNRNKTPIHQKVFHFDSEREDGISVEVSMQWNDGFQENIYCFTNNIPQ
                     RDGGTHLAGFRSALTRTLNTFMDKEGFSKKAKAATSGDDAREGLTAVVSVKVPDPKFS
                     SQTKDKLVSSEVKSAVESAMGEKLSEFLAENPSEAKMVCSKIIDAARAREAARKAREM
                     TRRKGALDIAGLPGKLADCQEKDPGLSELYIVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIR
                     TLLLTFFYRQMPELIERGYIYIAQPPLYKVKKGKQEQYIKDEDAMAEYQIALALDNAS
                     LFTNADAPAIAGQALEDLVVQYNSVMKLIDRMSRRYPVSVLNRLVYTGRLTQEMCADE
                     ASAQAWTEAFVAELNATEVGASQYNAALLFDEEANAYQPKLVVRTHGVEHEYVLSIDL
                     LNSKEYARIADLAEALDGLLEESAYAQRGERKQPVSSFEDALAWLTKESRRGFSLQRY
                     KGLGEMNPEQLWETTMDPESRRMMQVTINDAVAADELFTTLMGDQVEPRRNFIEENAL
                     RVSNLDI"
     gene            13895..14329
                     /gene="ibpA"
                     /locus_tag="VF_RS00070"
                     /old_locus_tag="VF0013"
                     /old_locus_tag="VF_0013"
                     /db_xref="GeneID:54162642"
     CDS             13895..14329
                     /gene="ibpA"
                     /locus_tag="VF_RS00070"
                     /old_locus_tag="VF0013"
                     /old_locus_tag="VF_0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone IbpA"
                     /protein_id="WP_005416787.1"
                     /db_xref="GeneID:54162642"
                     /translation="MRNVDFTPLYRSAIGFDRLFNQMENHSAKTNGGYPPYNIEQQSE
                     NKYRITMAVAGFADNQIDLTQHENMLIVRGERPKDIEEKTYLYQGIAERDFERKFQLA
                     DYVKVVGATMENGLLHVDLEREIPEAMQPRKIAINGNNLLEG"
     gene            complement(14539..15786)
                     /locus_tag="VF_RS00075"
                     /old_locus_tag="VF0014"
                     /old_locus_tag="VF_0014"
                     /db_xref="GeneID:54162643"
     CDS             complement(14539..15786)
                     /locus_tag="VF_RS00075"
                     /old_locus_tag="VF0014"
                     /old_locus_tag="VF_0014"
                     /EC_number="2.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012551365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate transaminase"
                     /protein_id="WP_011260902.1"
                     /db_xref="GeneID:54162643"
                     /translation="MKFTQFGEKFTRYSGITQLMDDLNDGLRTPGAIMLGGGNPAGIP
                     AMLDYFKDASQKMLDSGELIAAMANYDGPQGKDSFVKALAKLLKETYGWDISEKNISL
                     TNGSQSAFFSLFNLLAGTYADGSKKKILLPLAPEYIGYADSELEFDSFISYRPEIELL
                     DNGLFKYHVDFSQLTVDESIGAICVSRPTNPTGNVITDEEVIKLDKLARENNIPLILD
                     NAYGTPFPNIIFEEVTPFWNDNTILCMSLSKLGLPGLRCGIVIANEKMTEAITNLNGI
                     INLAPGSVGPAMGLHMIESGDLLRLSENVIQPFYCEKSQTAVNMLQTAITDPRFRIHK
                     PEGAIFLWLWFDELPITTMELYKRLKARGVLIVPGEYFFIGQDDSWKHAHQCLRMNYV
                     QDEDMMQKGINIIAEEVLRAYSE"
     gene            16015..16935
                     /gene="glyQ"
                     /locus_tag="VF_RS00080"
                     /old_locus_tag="VF0015"
                     /old_locus_tag="VF_0015"
                     /db_xref="GeneID:54162644"
     CDS             16015..16935
                     /gene="glyQ"
                     /locus_tag="VF_RS00080"
                     /old_locus_tag="VF0015"
                     /old_locus_tag="VF_0015"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004411044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_005416792.1"
                     /db_xref="GeneID:54162644"
                     /translation="MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMT
                     CLRALGPEPMSTAYVQPSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSL
                     EVLGIDPLVHDIRFVEDNWENPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGLECKPVT
                     GEITYGIERLAMYIQEVDSVYDLVWNIGPDGTAVTYGDIFHQNEVEQSTYNFEHADVD
                     FLFGFFDQCEKESKELLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILR
                     IRNLTKAVAEAYYASREALGFPMCKKNEEK"
     gene            16938..19004
                     /gene="glyS"
                     /locus_tag="VF_RS00085"
                     /old_locus_tag="VF0016"
                     /old_locus_tag="VF_0016"
                     /db_xref="GeneID:54162645"
     CDS             16938..19004
                     /gene="glyS"
                     /locus_tag="VF_RS00085"
                     /old_locus_tag="VF0016"
                     /old_locus_tag="VF_0016"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="WP_011260903.1"
                     /db_xref="GeneID:54162645"
                     /translation="MAKNFLIELGTEELPPTALRSLAEAFASNFEAELKAADLAHQGV
                     KWYATPRRLALKVAELAESQADKVVEKRGPAVSAAFDADGNPTKAAQGWARGNGITVE
                     QADRLKTDKGEWLLHKEEVKGKPVQELVVDFAAKALAGLPIPKAMRWGNSDIQFIRPV
                     KTLTILLGDELIEGSILGVSSARTLRGHRFMGESEFTIDSADQYPAILEERGKVMADY
                     DARKAIILADSEKAAAAVGGKADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPSEAL
                     VYTMKGDQKYFPVYDENKKLLPNFIFVSNIESKEPRHVIEGNEKVVRPRLADAEFFFN
                     TDRKRPLIDRLPELEQAIFQKQLGTIKDKTDRITELAGYIAEQIGADVEKSQRAGLLA
                     KCDLMTSMVFEFTDTQGVMGMHYATHDGEDEQVALALYEQYMPRFAGDDLPSTDISSA
                     VAMADKLDTLVGIFGIGQAPKGSDPFALRRAALGVLRIIVEKEYNLDLVDLVAKAQSL
                     FGDKLSNANVATDVIDFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDKRVKAVS
                     HFRELDAAESLAAANKRVGNILAKFDGELAQEIDLALLQEDAEKALAEKVEILAEALE
                     PVFAAGNYQEALSRLAELREPVDAFFDNVMVMADDEALKTNRLTLLNKLRNLFLDIAD
                     ISLLQK"
     gene            19150..20790
                     /locus_tag="VF_RS00090"
                     /old_locus_tag="VF0017"
                     /old_locus_tag="VF_0017"
                     /db_xref="GeneID:54162646"
     CDS             19150..20790
                     /locus_tag="VF_RS00090"
                     /old_locus_tag="VF0017"
                     /old_locus_tag="VF_0017"
                     /EC_number="3.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_011260904.1"
                     /db_xref="GeneID:54162646"
                     /translation="MKLSVCATLISLSLLVGCQSTPSTDNSSLSENSSNPSSDIAKST
                     NHDAADSVDIICPQLGIQPVTVAVSDLWADGEVVTDAYTGRIAQVKNGSVTLTPSRHS
                     GGLLLLESKKEEVPFQWKNATFYHIATDRFFNGNSWNDHSYGRQKTAQGFQGGDIAGL
                     TQKLDYLAELGVDVLWLSTPLEQVHGWLPGKNGNYPEYPYAGGATLDWTQLDTNMGTE
                     QEMRIFVDSAHQLGMRVVWSVDTVPSEPSLADLQQFNIQPQDASELPSYWNEWQPKDG
                     QNLTNYLDAFKDENGQIPQWWSPAWSDPSSDGNISTPEFFANKPVTNVAQVSRAKNEV
                     LTQWITTWVAKFGIDGVVLSDSTPQLTQKIEASASKAFELWKTHNQYKALESSSFLVV
                     DLNEKESFKPQIVSMQKNKEQCFSQFTYRLSTTEKSHDLYAINWFEERGLDELSEANY
                     SEYRDTASALLLSQGNLAIWYGDETAKSGEAYSEMNWDQMTGLRLSLMSHWKKLLAFR
                     ANHSALSDGEYQVIENNSYYAFIRKNKSDNVMVVYTGE"
     gene            20925..21176
                     /locus_tag="VF_RS00095"
                     /old_locus_tag="VF0018"
                     /old_locus_tag="VF_0018"
                     /db_xref="GeneID:54162647"
     CDS             20925..21176
                     /locus_tag="VF_RS00095"
                     /old_locus_tag="VF0018"
                     /old_locus_tag="VF_0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260905.1"
                     /db_xref="GeneID:54162647"
                     /translation="MTRFLAISPQSQCYLFTVALALNLLGMVLTDMWVPMVVGAIITT
                     GLSVDAWVRVHYVLPMRKELRNLQNQVEAIQKLARDINT"
     gene            complement(21222..21473)
                     /gene="tusA"
                     /locus_tag="VF_RS00100"
                     /old_locus_tag="VF0019"
                     /old_locus_tag="VF_0019"
                     /db_xref="GeneID:54162648"
     CDS             complement(21222..21473)
                     /gene="tusA"
                     /locus_tag="VF_RS00100"
                     /old_locus_tag="VF0019"
                     /old_locus_tag="VF_0019"
                     /EC_number="2.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase TusA"
                     /protein_id="WP_005416800.1"
                     /db_xref="GeneID:54162648"
                     /translation="MTINFDTATQTLEAEGLRCPEPVMMVRKTIRKMEDGETLLIKAD
                     DPSTTRDIPSFCRFMDHELIAEDTDSLPYRYLIRKGLSK"
     gene            21659..21850
                     /locus_tag="VF_RS00105"
                     /old_locus_tag="VF0020"
                     /old_locus_tag="VF_0020"
                     /db_xref="GeneID:54162649"
     CDS             21659..21850
                     /locus_tag="VF_RS00105"
                     /old_locus_tag="VF0020"
                     /old_locus_tag="VF_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005416802.1"
                     /db_xref="GeneID:54162649"
                     /translation="MLTQIDRLTIYCVLCLVTISSLVLRTPENISLFPLISLASVMVA
                     LTVELKTWSEAETAEEQDS"
     gene            21997..22938
                     /locus_tag="VF_RS00110"
                     /old_locus_tag="VF0021"
                     /old_locus_tag="VF_0021"
                     /db_xref="GeneID:54162650"
     CDS             21997..22938
                     /locus_tag="VF_RS00110"
                     /old_locus_tag="VF0021"
                     /old_locus_tag="VF_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011260906.1"
                     /db_xref="GeneID:54162650"
                     /translation="MELEEVYRRDLNLLIALKVLLEENSVSQAAVRLNLSQSAMSRVL
                     GRLRDLLGDPLFTRQGQHLVPTQKALEINEQINLPLESLRQLLTPSDFTPMHCDQHFL
                     IATTDYAMQTILPYALPKIYEQAPNISLEFAPLNHENLFKQLSTEKVDMAICRPIGSV
                     LPLKQEVLGQVGVLCLLSKNHPLSGSILTLDDYLSLPHAMIAISDGVKALIDAALSGQ
                     RERRQVLRAYHLEAALAIVDKMPLVITVPADLAYLVAERYDLVIKPLPFEFTPFDYSL
                     IWHSRCDTSPAQTWLRRVVKEECGKLIEKRIEDIGFA"
     gene            23063..23509
                     /locus_tag="VF_RS00115"
                     /old_locus_tag="VF0022"
                     /old_locus_tag="VF_0022"
                     /db_xref="GeneID:54162651"
     CDS             23063..23509
                     /locus_tag="VF_RS00115"
                     /old_locus_tag="VF0022"
                     /old_locus_tag="VF_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260907.1"
                     /db_xref="GeneID:54162651"
                     /translation="MEQHHQYYQPTSAFIMASWGAFVIGSSAYLFGLWKSTMELNEKG
                     YYFSLLLLGLFAAISLQKTIRDKHEGINVTSMYMMSCRVALISALVLMAIGLRNAELL
                     LSEKGFFAMAYTLSLFSVVTIQKNIRDVAATTSDEGLSEVKDELVE"
     gene            complement(23656..24636)
                     /locus_tag="VF_RS00120"
                     /old_locus_tag="VF0023"
                     /old_locus_tag="VF_0023"
                     /db_xref="GeneID:54162652"
     CDS             complement(23656..24636)
                     /locus_tag="VF_RS00120"
                     /old_locus_tag="VF0023"
                     /old_locus_tag="VF_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012551373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_005416807.1"
                     /db_xref="GeneID:54162652"
                     /translation="MFKALVLNQEDRNTIAAVTEIDESQLPEGNVKIDVNYSSLNYKD
                     GLAITGKGRIVRNFPMVPGIDLSGVVSQSDDPRYKAGDEVVLTGWGVGEGHWGGMAEK
                     ASLNGDWLVPMPKGLDAKKVMAIGTAGFTAMLCVQAIVDADIKPEDGEILVTGSSGGV
                     GSVAITLLNQLGYKVAAVTGRASENGELLKSLGATRIVERSELEEPAKPLEKQLWAGA
                     IDTVGSKVLAKVLAQVDYNGAVAACGLAGGFDLPTTVMPFILRNVRLQGIDSVMCPRE
                     KRIKAWEQLAELLPASFFDQATKEVSLDDAIQAAEDITNGQITGRVVIKI"
     gene            complement(25396..26559)
                     /gene="fadA"
                     /locus_tag="VF_RS00125"
                     /old_locus_tag="VF0024"
                     /old_locus_tag="VF_0024"
                     /db_xref="GeneID:54162653"
     CDS             complement(25396..26559)
                     /gene="fadA"
                     /locus_tag="VF_RS00125"
                     /old_locus_tag="VF0024"
                     /old_locus_tag="VF_0024"
                     /EC_number="2.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017419828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acyltransferase FadA"
                     /protein_id="WP_047863541.1"
                     /db_xref="GeneID:54162653"
                     /translation="MKNVVIVDCIRTPMGRSKNGVFRHTRAEDLSAHLMKGLLKRNPS
                     VDPNDIEDIYWGCVQQTLEQGFNIARNSALLAGLPQSIAATTVNRLCGSSMQALHDAS
                     RAIMVGDAEICIIGGVEHMGHVPMNHGVDFHSGLSKSVAKASGMMGLTAEMLGKMHGI
                     SREQQDAFALASHQKAHKATIEGYFDSEILPMEGHDENGALTLVTHDEVIRPETTLEG
                     LAALRPAFDPANGTVTAGSSSALSDGASAMLVMSEEKANELGLPIRAKVRSMAVSGCD
                     PSIMGYGPVPATKKALKRAGLSLDDIELFELNEAFAAQSLPCIKDLGLLDVMDEKVNL
                     NGGAIALGHPLGCSGSRIATTLINNMERTGAKLGVATMCIGLGQGIATVFERP"
     gene            complement(26573..28750)
                     /gene="fadB"
                     /locus_tag="VF_RS00130"
                     /old_locus_tag="VF0025"
                     /old_locus_tag="VF_0025"
                     /db_xref="GeneID:54162654"
     CDS             complement(26573..28750)
                     /gene="fadB"
                     /locus_tag="VF_RS00130"
                     /old_locus_tag="VF0025"
                     /old_locus_tag="VF_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid oxidation complex subunit alpha FadB"
                     /protein_id="WP_011260909.1"
                     /db_xref="GeneID:54162654"
                     /translation="MIYQGENLSVDYIEPGIAHLVFNAKGSVNKLNLATLQSVGEAID
                     ALYSQKDLQGLLLSSDKSAFIVGADITEFLGLFDIPTEELSDWLHQANAIFNRLEDIP
                     VPTLSAITGFALGGGCECVLATDFRLADETASIGLPETQLGIMPGWGGSVRLPRLIGA
                     DPAMEVITTGKPKRAKDALALGMVDGVVSRETLITDSVTMLKKAIEGQLDWQSRRTQK
                     KAPLKLSPLEAAMSFNVAKGMIMKMAGKHYPAPMTAVKSIENSAFMDRDAALEVENKN
                     FVALTQTDVAKSLVGIFLNDQLVKSKAKQAIKNSEPVTSAAVLGAGIMGGGIAYQSAS
                     KGVPVLMKDIAQQSLDLGMSEASKLLNKQLERGRLSGLKMAKVLSSITPSLNYASIEN
                     KDIVVEAVVENPKVKAAVLAEVENEVNEHAILASNTSTIPISLLAKSLKRPENFCGMH
                     FFNPVHRMPLVEVIRGEKTSQQTIDRVVAYASQMGKTPIVINDCPGFFVNRVLFPYFA
                     GFSLLLRDGGDYQQIDNVMEKEFGWPMGPAYLLDVVGIDTAHHAQAVMAQGFPERMAK
                     NGRDVIDAMFESDRYGQKNGSGFYAYSIDRKGKPKKNIDESTAGIIATVTNTTQPYTS
                     EQISARMMIPMINEVIRCLDEGIIASPAEADMALVYGLGFPPFKGGVFRYLDAIGLTT
                     YLDMAKEFEHLGAVYQVPESIKQKAADDECYYPAPQSLSAPSA"
     gene            28993..29610
                     /locus_tag="VF_RS00135"
                     /old_locus_tag="VF0026"
                     /old_locus_tag="VF_0026"
                     /db_xref="GeneID:54162655"
     CDS             28993..29610
                     /locus_tag="VF_RS00135"
                     /old_locus_tag="VF0026"
                     /old_locus_tag="VF_0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YigZ family protein"
                     /protein_id="WP_005416813.1"
                     /db_xref="GeneID:54162655"
                     /translation="MNDQPYQVPKAMVVFEEEIKKSIFITYLARTSSVDDAKAFVAEI
                     KAKHSDARHNCWGFVAGRPEDSMKWGFSDDGEPSGTAGKPILAQLSGSGIGEITAVVT
                     RYYGGVRLGTGGLVKAYGGGVQQALKLIETEEKRITDTVILHCDYNLVSLVETLLSQF
                     EGIQVDAQYSDKVVMSVELEKRVIEEFKIAIINKSGAKIEFPSDT"
     gene            29667..31124
                     /locus_tag="VF_RS00140"
                     /old_locus_tag="VF0027"
                     /old_locus_tag="VF_0027"
                     /db_xref="GeneID:54162656"
     CDS             29667..31124
                     /locus_tag="VF_RS00140"
                     /old_locus_tag="VF0027"
                     /old_locus_tag="VF_0027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004736668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_011260910.1"
                     /db_xref="GeneID:54162656"
                     /translation="MQFRSIIRIVGILLAVFSFFMLAPAFIAFIYRDGAGVPFVITFF
                     LLLAGGGALWFPNRQHKHELKSRDGFLIVVLFWMVIGSAGALPFLFSGSPDISVTNAF
                     FESFSGLTTTGATVLTGLDHLPKAILFYRQLLQWFGGMGIIVLAVAILPVLGIGGMQL
                     YRAEIPGPVKDSKMTPRIAETAKVLWYIYLTLTIACALAFWVAGMGWFDAISHSFSTI
                     AIGGFSTYDASMGHFNSPVINAITVVFLLISACNFSLHFAAFASGGVHPKYYWRDPEF
                     RAFIFIQILLFLITFLLLLKHNTYNSVGTAIDQALFQTVSISTTAGFTTTSFAEWPLF
                     LPVLLLFSSFIGGCAGSTGGGMKVIRILLLSLQGMREIKRLIHPRAIYTIKIGTKALP
                     QRVVDAVWGFFSAYALVFVICMLALIATGIDELTAFSAVAATLNNLGPGLGEVAVHFG
                     EVNDAAKWILIIAMLFGRLEVFTLLILFTPTFWRS"
     gene            31157..31681
                     /gene="hemG"
                     /locus_tag="VF_RS00145"
                     /old_locus_tag="VF0028"
                     /old_locus_tag="VF_0028"
                     /db_xref="GeneID:54162657"
     CDS             31157..31681
                     /gene="hemG"
                     /locus_tag="VF_RS00145"
                     /old_locus_tag="VF0028"
                     /old_locus_tag="VF_0028"
                     /EC_number="1.3.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinone-dependent protoporphyrinogen IX
                     dehydrogenase"
                     /protein_id="WP_005416815.1"
                     /db_xref="GeneID:54162657"
                     /translation="MERVLLLHSSREGQTIKILNYIATKLGSDVQCELVDLHQPLSVS
                     FSDYDRVVIGASIRYGHLNKKLYQFITKYQTELEQAKAGFFIVNLTARKEGKDTPETS
                     VYFKKFLLKSPWVPALQDTFAGALFYPRYNWFDRVMIQFIMKMTGGETDPTKEVEYTN
                     WQRVDQFVEKIKRG"
     gene            31800..31876
                     /locus_tag="VF_RS00150"
                     /old_locus_tag="VF_T0001"
                     /old_locus_tag="VFT0001"
                     /db_xref="GeneID:54162658"
     tRNA            31800..31876
                     /locus_tag="VF_RS00150"
                     /old_locus_tag="VF_T0001"
                     /old_locus_tag="VFT0001"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:31834..31836,aa:Trp,seq:cca)
                     /db_xref="GeneID:54162658"
     gene            32310..35063
                     /locus_tag="VF_RS00155"
                     /old_locus_tag="VF0029"
                     /old_locus_tag="VF_0029"
                     /db_xref="GeneID:54162659"
     CDS             32310..35063
                     /locus_tag="VF_RS00155"
                     /old_locus_tag="VF0029"
                     /old_locus_tag="VF_0029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insulinase family protein"
                     /protein_id="WP_011260911.1"
                     /db_xref="GeneID:54162659"
                     /translation="MKGYWLAFIACLFISGCATTSVTELKSDPRWVSGQLDNGFRYHI
                     YPDREKEVSIRFIVHAGSFQETQNQKGYAHFVEHMAFNGSEHFSQNDVISLFEDAGLS
                     FGADINAYTSYSETVYKLDLPDNSQLNNALVWMRDIGDGIELSSKEVEKEKEVILGEF
                     RYSRLEDKPISAQFYEHMTAGTVYENSDPIGNKESVLSASSTQLTEFYQQWYQPQLTE
                     IVISGDVTLEGAITLITKHFESWKKGSSAVSTMPLEPLNQNDFIVKVASGEPPSIALV
                     IDRGDFRVNTREQQHQLWLDEIAHSIIQQRLGGVFLDAAMPVQWIYSTDYYVSDQRYF
                     ISSVSFPASYRTQSQTLFLDTLASLRDHGVSHGELDNLLQPYHYQLDNLDANLENLTP
                     YDHVENRVNGVVSQQISQSSLDYKASLTSFLAATDLKVVNDHIDELLSSSYQFAIGVD
                     AVESLSQIELSIPELKSVYAKSGSEPLINNVSAAFPVPMSSGIILSETKLFEEVDLTR
                     WTLDNGLNVLYLRKTDAGDDVVFSLASQGGIAALPSELIPAANIAIPAVTRSGLGKFT
                     GSQLDAHLRNEGIELYPFINFTHHGLEGITDKEGLAETFAVITAIMSEINVDEEQLKA
                     VKQEFEQNRDAYISTSLGQFTKAINRNTYSSTNRHQLLDGEDVNLVTSEQIKRVHQLL
                     FQQNRNYQLVIVADLKPSELKPLLRQYLANIRLGAAEKTNYAVTYKSDSVPSISMAVN
                     TEQSSHYISQFIAVQGLEDHSAKSIFIQDMLQRIVSKRLMHYVREELSLDYAPYALMV
                     NADSEFKPHWVMGAQVDPKNAELIESAIDKVIKDLLRGVTENEVNAAAKQLVVDLEPL
                     KNNSTQQAWLLNRYTIHNYGIEALFGISETANSVNAEDINRLIKYSFGKNSHQFKYLS
                     TPI"
     gene            35144..35338
                     /locus_tag="VF_RS00160"
                     /old_locus_tag="VF0030"
                     /old_locus_tag="VF_0030"
                     /db_xref="GeneID:54162660"
     CDS             35144..35338
                     /locus_tag="VF_RS00160"
                     /old_locus_tag="VF0030"
                     /old_locus_tag="VF_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260912.1"
                     /db_xref="GeneID:54162660"
                     /translation="MGYDLGTVYLGQMAAKKMLNEEMYGKQQPRTKKTAVTKKLWKGF
                     EKVNTKMANMVSGYIPVLTW"
     gene            35637..37016
                     /locus_tag="VF_RS00165"
                     /old_locus_tag="VF0031"
                     /old_locus_tag="VF_0031"
                     /db_xref="GeneID:54162661"
     CDS             35637..37016
                     /locus_tag="VF_RS00165"
                     /old_locus_tag="VF0031"
                     /old_locus_tag="VF_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="voltage-gated chloride channel family protein"
                     /protein_id="WP_005416818.1"
                     /db_xref="GeneID:54162661"
                     /translation="MAHPLNRNFQNLFQVARWSLLILPVALLVGSFNAFFLWLLSEAT
                     QARIANPWLIYLLPVAGLAIVYSYRNWGKNSAGGNNLIMDEIHQAGEGVPVRMGPLVL
                     FTTVITHLFGGSAGREGTAVQIGGATTDWLSKVFKLSEDDRKMMLTAGVAAGFASIFG
                     TPFTGAIFALEVLFIGRIKFNAIIPALLAAILANVVASAWGAHHTHYLINFDQVSTLF
                     GHAVDIDLLLMAKVIIAAIGFGIAGYLFGELTHGFKDLFNATLKNPYLIVVVGGLMVI
                     IITQLLGNYDYIGIGVYPSRDGGVSITSAFTEGGAEWYSWILKLVLTAITLAAGYKGG
                     EVTPLFFVGATLGNFLGWVMGAPVDLFAALGFLAVFAAATNTPLACTIMGVELFGAEY
                     LPYFALACYTAYYFSGHTGIYSSQRVAVSKTLEHGRDHDGLNKIGSYREHNSSSLKHL
                     ANKLTKKDK"
     regulatory      37315..37427
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            37617..39551
                     /gene="thiC"
                     /locus_tag="VF_RS00170"
                     /old_locus_tag="VF0032"
                     /old_locus_tag="VF_0032"
                     /db_xref="GeneID:54162662"
     CDS             37617..39551
                     /gene="thiC"
                     /locus_tag="VF_RS00170"
                     /old_locus_tag="VF0032"
                     /old_locus_tag="VF_0032"
                     /EC_number="4.1.99.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_011260913.1"
                     /db_xref="GeneID:54162662"
                     /translation="MSSSRKQARLDAKTNIESLSVQPYPNSNKVYIEGSRPDIRVPMR
                     EISLADSLVGGTKESPIFEPNEPIQVYDTSGVYTDPSYDIDVYKGLPKLRQEWIEERN
                     DTELLDGVSSVYSQERLADETLDELRYGNLPTIRRAKQGQCVTQLHYARQGIITPEME
                     YIAIRENMGRQKFADEQLNHQHPGHSFGANLPKEITPEFVRREVAEGRAIIPSNINHP
                     EAEPMIIGRNFLIKVNANIGNSSVSSSIEEEVEKLVWSTRWGGDTVMDLSTGRNIHET
                     REWILRNSPVPIGTVPMYQALEKVNGVAENLNWEVMRDTLIEQAEQGVDYFTIHAGLL
                     LRYVPMTAKRVTGIVSRGGSIIAKWCLAHHQESFLYTHFREICEICAKYDVALSLGDG
                     LRPGSVADANDEAQFAELRTLGELTKVAWEYDVQVIIEGPGHVPMHMIKENMDEQLKH
                     CHEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWYGCAMLCYVTPKEHLGLPNKDDVK
                     TGLITYKLAAHAGDLAKGHPGAQIRDNALSKARFEFRWEDQFNLSLDPITAREYHDET
                     LPQESGKVAHFCSMCGPKFCSMKISQEVREYAKDSEQVALDQAIEIKMIDDPLEGMRQ
                     KSEEFKASGSELYHPVVEAE"
     gene            39622..40281
                     /gene="thiE"
                     /locus_tag="VF_RS00175"
                     /old_locus_tag="VF0033"
                     /old_locus_tag="VF_0033"
                     /db_xref="GeneID:54162663"
     CDS             39622..40281
                     /gene="thiE"
                     /locus_tag="VF_RS00175"
                     /old_locus_tag="VF0033"
                     /old_locus_tag="VF_0033"
                     /EC_number="2.5.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine phosphate synthase"
                     /protein_id="WP_011260914.1"
                     /db_xref="GeneID:54162663"
                     /translation="MFAFPNIDKSKFGLYPVVDDVSWIEKLLKLDVKTIQLRIKNPEQ
                     ADLEQQIIKAIRLGREYDAQVFINDYWQLAIKHNAFGIHLGQEDIEVADLQAIAEANI
                     CLGLSTHDDSELLKVKALNPSYLALGHIFPTPTKEMPSQPQGLTNLAKNQQLAGDTPT
                     VAIGGIDLSVANDVWQTGVDSIAVVRAITEAEDTEQAVAKFNAIISEPRRGNLQEVAY
                     E"
     gene            40274..41107
                     /locus_tag="VF_RS00180"
                     /old_locus_tag="VF0034"
                     /old_locus_tag="VF_0034"
                     /db_xref="GeneID:54162664"
     CDS             40274..41107
                     /locus_tag="VF_RS00180"
                     /old_locus_tag="VF0034"
                     /old_locus_tag="VF_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HesA/MoeB/ThiF family protein"
                     /protein_id="WP_011260915.1"
                     /db_xref="GeneID:54162664"
                     /translation="MSNQLMEGLSDQDFLRYSRQIMLPDIGDKGQITLRNSTVLIIGC
                     GGLGSSVGMYLSASGIGTLIIADGDKVELSNLQRQVVYRDNNLNQNKAMAMAHQLKGL
                     NGTTHIEVISHKLTEPELSRFINQVDVVLDCSDNLPTRHETNAACVKHNVPLISGAAI
                     GWQGQLMLFSNQVTENNTSCYHCLFPFTESQQTQNCQSFGIVGPVVGMIGNLQALETI
                     KYLTQPSYMKWDTIHQFDGRSLAWSSIKIPKDSQCSICASTVTNDVSRETHSKGETCH
                     E"
     gene            41100..41312
                     /gene="thiS"
                     /locus_tag="VF_RS00185"
                     /old_locus_tag="VF_2576"
                     /db_xref="GeneID:54162665"
     CDS             41100..41312
                     /gene="thiS"
                     /locus_tag="VF_RS00185"
                     /old_locus_tag="VF_2576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="WP_005416828.1"
                     /db_xref="GeneID:54162665"
                     /translation="MSDLMSIELNGVSYRVEVTHTLSSFLEYHGIDTQGCAVAISNQI
                     IPRSEWQKRGLSQGESISLFQAIAGG"
     gene            41314..42084
                     /locus_tag="VF_RS00190"
                     /old_locus_tag="VF0035"
                     /old_locus_tag="VF_0035"
                     /db_xref="GeneID:54162666"
     CDS             41314..42084
                     /locus_tag="VF_RS00190"
                     /old_locus_tag="VF0035"
                     /old_locus_tag="VF_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_011260916.1"
                     /db_xref="GeneID:54162666"
                     /translation="MNDLLTIGDKTFRSRLFTGTGKFPNASVMQKALIESGSELSTMA
                     LKRVEVNNPEDNILKPIVDAGINLLPNTSGAKNAREAIFAAQLAREALGTNWLKLEIH
                     PDPKYLMPDPIETLTAAEELVKQGFIVLPYCHADPVLCKRLEEVGCAAVMPLGAPIGS
                     NKGIVSRDFLEIIIDQARVPVVVDAGIGAPSHAALAMELGADAVLVNTAIAAARNPIA
                     MATAFKLAVQSGRLAYENGLASVNTQAVASSPLTAFLD"
     gene            42095..43210
                     /gene="thiH"
                     /locus_tag="VF_RS00195"
                     /old_locus_tag="VF0036"
                     /old_locus_tag="VF_0036"
                     /db_xref="GeneID:54162667"
     CDS             42095..43210
                     /gene="thiH"
                     /locus_tag="VF_RS00195"
                     /old_locus_tag="VF0036"
                     /old_locus_tag="VF_0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminoacetate synthase ThiH"
                     /protein_id="WP_011260917.1"
                     /db_xref="GeneID:54162667"
                     /translation="MTFTDEWEKLHWDEVKLSIYSKTHHDVEKALSKSKRDLEDFKAL
                     ISPAAESYLEQMAQESARLTRQRFGHTIGFYIPLYLSNLCANACTYCGFSMENRIKRK
                     TLNQDEVGQEVMAIKAMNFDSVLLVTGEHETKVGMNYFRQTLPQIKRSFNYLAMEVQP
                     LEQEEYAELKTLGLDAVMVYQETYHPSTYAEHHLRGNKTDFKFRLETPDRLAKAGIDK
                     IGIGALIGLEEWRTDCFFVAAHLDYLERRYWQTRYSISFPRLRPCEGALQPKSIMSDK
                     QLVQLICAYRLLNPEVELSLSTRESEHFRDNVLPLGITSISAASKTQPGGYANDDQEL
                     EQFSISDERSAESVSLAVQARGFEPVWKDWERGFSSI"
     gene            complement(43328..45775)
                     /locus_tag="VF_RS00200"
                     /old_locus_tag="VF0037"
                     /old_locus_tag="VF_0037"
                     /db_xref="GeneID:54162668"
     CDS             complement(43328..45775)
                     /locus_tag="VF_RS00200"
                     /old_locus_tag="VF0037"
                     /old_locus_tag="VF_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004412750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 20 glycosylhydrolase"
                     /protein_id="WP_011260918.1"
                     /db_xref="GeneID:54162668"
                     /translation="MKKTLLTLSISSFLFSASSLASAPNTKLNLMPYPQSVELNSGQL
                     EITSDFSIYIDGYKSERIQQLALRIIQRVEAQTGLPLLTPFASSKKEATLIIDVSKAA
                     KNKIQDNDIDESYELTINKKQIILESDRPYGALRGAETFLQLINTSKAGYFVPQVNIE
                     DEPRFPWRGASFDSSRHFVTVDTIKRQIDGFASAKMNVFHWHLWDDQAIRIQIESYPK
                     LWEKTADGDFYTKEEIKDVVEYARLRGIRVIPEISLPGHASAVAHAYPELMSGEGEQS
                     YDQQRAWGVFVPLMNPINPELYVFFDKVFSEVTELFPDEYIHIGGDEPNYQQWTDNKE
                     IQAFIAENNIDGNRGLQSYLNARIEKMLNKKGKKIMGWDEIWHKDLPTSIVIQSWRGH
                     DSIGRAAKEGYTGLLSTGFYLDQPQPTSYHYRNDPMPKGPQVDDQLHSGETFETYTWQ
                     KPRGKGGPRKGTLTIITDKNGDARAFTDYNGKSRAKVDIMEYTKGESFRGHFDNFMSY
                     TEFNLIFNNGNIKKESYQLVGNVRWPTTGEMTASSSIKNSVIPAPNGGYPVALNKDEE
                     KLILGGEAAIWAENYDDLTVEGRIWPRTYAVAERLWSAEELTDEDSMYQRLQAMDSWA
                     TISVGLQHQTNSYKQYLRIANGGDVSALMSFANYAEPAQYYARNWAKYNSTDPKGELY
                     NQYERLNRFADAVPVESFAVLEMIKLAKTAINDQSDLKALQKHYQTVLESAQKSEVMF
                     KNNVSSLDTVLLAQKHVEVAKATLAVINELEKGQQPTSTQLDKLLSITTNASGMYDEM
                     IVAIVRPTEELVRQLRK"
     gene            complement(46035..47828)
                     /locus_tag="VF_RS00205"
                     /old_locus_tag="VF0038"
                     /old_locus_tag="VF_0038"
                     /db_xref="GeneID:54162669"
     CDS             complement(46035..47828)
                     /locus_tag="VF_RS00205"
                     /old_locus_tag="VF0038"
                     /old_locus_tag="VF_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="WP_011260919.1"
                     /db_xref="GeneID:54162669"
                     /translation="MHPQTSQRVEQLRTWLAQQDFDALIIPHEDEFLGEYIPEHNERL
                     HWVTGFTGSAGAAVITKEKAAIFVDGRYTVQVRKQVPADVFEYRHLHEEPLLEWIKDS
                     LTSGSKVAIDPRMHTAQWLKTASKNVEGVVTLEAIATNPIDELWLDRPEVKVSDVRLM
                     SLEFVGKSSEDKRKEIAKEVSKKKADAALLTQLDSICWLLNIRGLDVSRLPVLLSHAI
                     IHADESVDFFLEPSRLPAEFNAHVGQGVRVHQPDALQETLESLAGKKVLVDSATSNAW
                     MSLVLSNANAQIIEASDPCLLPKAAKNETEKAGMRACHVRDGAAMAKFLTWFDAEIEA
                     GNLHDEAVLADKLQAFREEDASLADLSFDTISAAAGNAAMCHYNHQNQPEPGKLQMNS
                     LYLVDSGGQYPDGTTDITRTLAVGTPSDDIKQQFTLVLKGHIGLANARFPKGTCGHQL
                     DILARQHLWAQGYDYDHGTGHGVGHFLSVHEGPQRIAKVVNNTALLPGMVLSNEPGYY
                     RADEFGIRIENLELVVEIETQGDFSVLGFESLTRCPIDKRLINVDMLNRPELAWLNNY
                     HQKVWNEVSPLVDGEVKEWLKQATAELSYES"
     gene            complement(47933..48898)
                     /locus_tag="VF_RS00210"
                     /old_locus_tag="VF0039"
                     /old_locus_tag="VF0040"
                     /old_locus_tag="VF_0040"
                     /db_xref="GeneID:54162670"
     CDS             complement(47933..48898)
                     /locus_tag="VF_RS00210"
                     /old_locus_tag="VF0039"
                     /old_locus_tag="VF0040"
                     /old_locus_tag="VF_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011260920.1"
                     /db_xref="GeneID:54162670"
                     /translation="MFFEKLAKIDLNLLLTLHLLLEEKSVTRAAQRLCLSQSAVSKNL
                     AKLREQFNDPLFSRTSYGLQPTAKARNLQEQLHTLLSHLESITEASNFDPKSSHYRFR
                     LGLVESTYPLLLPHFMSYILNKAPNVMLDTHAWDTNTLKKLQSGEMDIGITGKDLDPK
                     YANITMHTPEDICSKEIYRDSQMCLVRRNHPVLKQEWTLDTYLQQRHVQVRCDGKDQW
                     LLDYKLADRGLERSIGIIVPDFNSAASLCTHTDLVFTAPSHFIKLIAEQLNLVVLPLP
                     TDLPQMAYTLFWHQQKENDAANCWLRNTIINHCKDLSISTIADEH"
     gene            48996..50225
                     /locus_tag="VF_RS00215"
                     /old_locus_tag="VF0041"
                     /old_locus_tag="VF_0041"
                     /db_xref="GeneID:54162671"
     CDS             48996..50225
                     /locus_tag="VF_RS00215"
                     /old_locus_tag="VF0041"
                     /old_locus_tag="VF_0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug effflux MFS transporter"
                     /protein_id="WP_011260921.1"
                     /db_xref="GeneID:54162671"
                     /translation="MHTPVTPQSATSMSSVSDKKIITLMVVLVLFSPLAIDIYLPALP
                     AMAAEFHVPSTMAQDTITWFMFSMGLGQLFAGPLADRYGRRPIALTGIVIYGLSAVLA
                     YFAQAMEMLLLARLLQGFGACATSVAAFASVRDSFGAEKGGRMISYLNGAICFIPALA
                     PILGSYLTHHFGWRSNFSFMAGFALVGFALILTNYKETKPENTVQTGKLISPSRYWSV
                     LKNPTFLFHASLCMLSMGVILAYVTSAPVFLMDQLGLTMNEFTYWFAINAAINIAVCF
                     IAPKFMIKFGTKRVLLSGLTILAISGGLMLGMQHIQQAWAFMVPIFLASVGYASVLGS
                     AAGKALAPFGDRAGTAAALLGLFQMSGAGIIVGTMQRLALPSAQLLTLMMWFLIPGLL
                     ILLTKTGQRWHSETVTQ"
     gene            50347..50637
                     /locus_tag="VF_RS00220"
                     /old_locus_tag="VF0042"
                     /old_locus_tag="VF_0042"
                     /db_xref="GeneID:54162672"
     CDS             50347..50637
                     /locus_tag="VF_RS00220"
                     /old_locus_tag="VF0042"
                     /old_locus_tag="VF_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005416841.1"
                     /db_xref="GeneID:54162672"
                     /translation="MSMSVIEMARVLEQMEESPEKLMFGKLLSELGNQSQERVRSAAR
                     QVSVPTLRDLIYQFQVVIEERKGETTKKLAEEMAKEGVSLEDFQAYLASKNK"
     gene            complement(50759..51661)
                     /locus_tag="VF_RS00225"
                     /old_locus_tag="VF0043"
                     /old_locus_tag="VF_0043"
                     /db_xref="GeneID:54162673"
     CDS             complement(50759..51661)
                     /locus_tag="VF_RS00225"
                     /old_locus_tag="VF0043"
                     /old_locus_tag="VF_0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010444912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_047863540.1"
                     /db_xref="GeneID:54162673"
                     /translation="MNERRALGFGVAAVLLWSTVATAFKITLEHFTPTQMLTIASAVS
                     ILALAGVAAYQKTLSQLIDTFLANPLYYILLGAINPLAYYLVLFKSYDLLPASQAQPL
                     NYSWAITLTLMAAVFLGQKIRKQDWIACVLGYLGVIVIATKGDVLALEFDSPLGVGLA
                     LFSTLLWAGYWILNTKNKADPILGLLLGFLVALPVAIGLSIYEGAPWAQIPMSGWAAV
                     SYVGLFEMGVTFVLWLSALRLTQNTARISNLIFASPFISLLLLANIIGEEIHPSTLIG
                     LIMIVCGLLIQQFFGKKEELQTEQ"
     gene            51789..53309
                     /gene="rmuC"
                     /locus_tag="VF_RS00230"
                     /old_locus_tag="VF0044"
                     /old_locus_tag="VF0045"
                     /old_locus_tag="VF_0044"
                     /db_xref="GeneID:54162674"
     CDS             51789..53309
                     /gene="rmuC"
                     /locus_tag="VF_RS00230"
                     /old_locus_tag="VF0044"
                     /old_locus_tag="VF0045"
                     /old_locus_tag="VF_0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RmuC"
                     /protein_id="WP_011260923.1"
                     /db_xref="GeneID:54162674"
                     /translation="MEFLNQFGGHLLFGFAGASIAYAVAHVLTKSRNQQELALLEQEL
                     ESEKKLAGTQLHQLTQQVEKQQQELDELDLERDKLAQEQKQSHGRLMAAMEKLRYFDA
                     IQKEKEYLTQQLEFSRQANSNVEAELREQEARNEEERKASQEKIELLERAEERLKQQF
                     ENLANQLFEHKTKTVDEQNKVSLEGLLSPLKEQLEGFKKQVNDSFGFEAKERHTLVHE
                     IRSLQQLNERMTQEAVNLTNALKGDNKQQGNWGEVVLSRVLKESGLREGHEYDTQVSM
                     DDEDGKRFYPDVIVHLPDEKDVVVDSKMTLVAYERFFNSEDFNQKEHALDEHLMAIRA
                     HLRGLSKKDYHKLNGLRSLDYVLMFIPVEPAFQVAIEADPSLISDAMEQNIIIVSPTT
                     LLVALRTISNLWRNERQNQNAKIIAERASKLYDKMRLFVDDMEAVGGALDKANQSYQG
                     AMNKLVSGRGNLIRQAESFKELGVEVKRDINRRLIDQSFEADTTQTLGDNGLDKVD"
     gene            53367..54131
                     /gene="ubiE"
                     /locus_tag="VF_RS00235"
                     /old_locus_tag="VF0046"
                     /old_locus_tag="VF_0046"
                     /db_xref="GeneID:54162675"
     CDS             53367..54131
                     /gene="ubiE"
                     /locus_tag="VF_RS00235"
                     /old_locus_tag="VF0046"
                     /old_locus_tag="VF_0046"
                     /EC_number="2.1.1.163"
                     /EC_number="2.1.1.201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020331899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional demethylmenaquinone
                     methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase UbiE"
                     /protein_id="WP_005416847.1"
                     /db_xref="GeneID:54162675"
                     /translation="MTDKMNMAEETTHFGFTTVAKEEKVAKVAEVFHSVAAKYDIMND
                     LMSGGVHRVWKRFTIDCSGVRPGHKVLDLAGGTGDLTAKFSRIVGEKGQVILADINNS
                     MLNVGRDKLRDMGIVGNVNYVQANAEELPFPDDHFDCITISFGLRNVTDKDKALRSMF
                     RVLKPGGRLLVLEFSKPILEPLSKIYDAYSFHLLPKMGEIIANDADSYRYLAESIRMH
                     PDQETLKGMMEDAGFEQANYYNLTGGIVALHRGYKF"
     gene            54143..54766
                     /locus_tag="VF_RS00240"
                     /old_locus_tag="VF0047"
                     /old_locus_tag="VF_0047"
                     /db_xref="GeneID:54162676"
     CDS             54143..54766
                     /locus_tag="VF_RS00240"
                     /old_locus_tag="VF0047"
                     /old_locus_tag="VF_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCP2 domain-containing protein"
                     /protein_id="WP_011260924.1"
                     /db_xref="GeneID:54162676"
                     /translation="MPLEPFVTGVMETGLNTLLKESPESKAALHRLKEKIIHVHLNEV
                     NKDLFFVFSHLQVDILSRFEGSVDCYLALNLSVLPQLRDQNNITQLIKQDKLVLEGDL
                     KLAQQFSALLEELKPDVEEKLSQYTGDIVAHTLASGVKGGACWVKKQITRQTRHAAEV
                     LTEEWKMAPAPLEIAYFCDQVTDVEAQLTELDARLSRLIQKTGLEQA"
     gene            54763..56397
                     /gene="ubiB"
                     /locus_tag="VF_RS00245"
                     /old_locus_tag="VF0048"
                     /old_locus_tag="VF_0048"
                     /db_xref="GeneID:54162677"
     CDS             54763..56397
                     /gene="ubiB"
                     /locus_tag="VF_RS00245"
                     /old_locus_tag="VF0048"
                     /old_locus_tag="VF_0048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005529019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis regulatory protein
                     kinase UbiB"
                     /protein_id="WP_011260925.1"
                     /db_xref="GeneID:54162677"
                     /translation="MTPSELKRLYHITKVQLEYGLDELLPEHALTQLPKRLRKGLFWI
                     KNKYPEKTLGERLRLALQELGPVWIKFGQMMSTRRDLFPPHLADQLALLQDQVAPFDG
                     QLAKDQMEMELGGPLDNWFTDFDIKPLASASIAQVHTAKLKDSGREIVLKVIRPDIRP
                     VIESDIRLMYRMARLVEQHIPEARRLKPVKVIEEYEKTLLDELDLRREASNAMQLRRN
                     FEGSEELYVPEVILDLSSEHLMVSERIYGIQVSDIEQLERNGTNMKLLAERGVSVFFT
                     QVFRDSFFHADMHPGNVFVNPDNPENPQWIGLDCGIVGTLNKEDKRYLAENLLGFFNS
                     DYHKVAQLHVDSGWVPADTNVEEFEFAIRMVCEPIFAKPLGEISFGHVLLNLFNTARR
                     FNMEVQPQLVLLQKTLLYVEGLGRQLYPQLDLWATAKPFLETWMAKQVGPAAFVTALS
                     EKAPFWAEKLPELPDLVYDSLRQGKVLNQRMDKLYAGYRQSKRQQAKGQFLFNVGATL
                     LICSAVLLTSNITVLASISAATGAAFWLFSWRAYRR"
     gene            56449..56697
                     /gene="tatA"
                     /locus_tag="VF_RS00250"
                     /old_locus_tag="VF0049"
                     /old_locus_tag="VF_0049"
                     /db_xref="GeneID:54162678"
     CDS             56449..56697
                     /gene="tatA"
                     /locus_tag="VF_RS00250"
                     /old_locus_tag="VF0049"
                     /old_locus_tag="VF_0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatA"
                     /protein_id="WP_011260926.1"
                     /db_xref="GeneID:54162678"
                     /translation="MGGISIWQLLIIAVIIVLLFGTKKLRGVGSDLGSAVKGFKKAIS
                     EDEPAKEAKKDADFVPQNLEKKEAETVEKQKQNDKEQA"
     gene            56701..57081
                     /gene="tatB"
                     /locus_tag="VF_RS00255"
                     /old_locus_tag="VF0050"
                     /old_locus_tag="VF_0050"
                     /db_xref="GeneID:54162679"
     CDS             56701..57081
                     /gene="tatB"
                     /locus_tag="VF_RS00255"
                     /old_locus_tag="VF0050"
                     /old_locus_tag="VF_0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatB"
                     /protein_id="WP_011260927.1"
                     /db_xref="GeneID:54162679"
                     /translation="MFDIGFWELILISVVGLVVLGPERLPKAIRSVAQFIGAAKSMAN
                     NVKDELSQELKIQELQENLRKAEQMNMDDLSPDLKKSVEELKQAAADVTRPYAKPEEE
                     KAETPSADSSSSAASDSTSKTKAE"
     gene            57084..57839
                     /gene="tatC"
                     /locus_tag="VF_RS00260"
                     /old_locus_tag="VF0051"
                     /old_locus_tag="VF_0051"
                     /db_xref="GeneID:54162680"
     CDS             57084..57839
                     /gene="tatC"
                     /locus_tag="VF_RS00260"
                     /old_locus_tag="VF0051"
                     /old_locus_tag="VF_0051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatC"
                     /protein_id="WP_011260928.1"
                     /db_xref="GeneID:54162680"
                     /translation="MSSVESSQPLLAHLLELRNRLLKAIIAVIVVFLGLVWFANDIYE
                     FLSAPLVERLPEGATMIATDVASPFFTPIKLTLVASIFVAVPVILYQVWAFVAPGLYK
                     HEKRLIMPLLFSSSLLFYAGVSFAYFVVFPLVFGFFTTIAPEGVQVATDIASYLDFVL
                     ALFLAFGIAFEVPVAIILLCWTGATDPDTLRQKRPYIIVGAFVVGMMLTPPDIISQTL
                     LAVPMCILFEIGLFFSRFYVREDNEDDLEQDEA"
     gene            complement(59230..59991)
                     /locus_tag="VF_RS00265"
                     /old_locus_tag="VF0052"
                     /old_locus_tag="VF_0052"
                     /db_xref="GeneID:54162681"
     CDS             complement(59230..59991)
                     /locus_tag="VF_RS00265"
                     /old_locus_tag="VF0052"
                     /old_locus_tag="VF_0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_011260929.1"
                     /db_xref="GeneID:54162681"
                     /translation="MIDTHAHIYAKEFDEDRDAVVQRALEQGISKILLPNIDLESIEP
                     MLKTEAAYPEVCHSMMGLHPCYVNADVKETLAIIHSWFEKHNFIAVGEIGIDLYWDKT
                     FKAEQEMAFITQLNWAKEMKLPVVIHTRDSIEETLSLLKQEQDGSLSGVFHCFGGSVD
                     EAKAINDLGFHLGLGGVSTFKNGGMDKIIPHLDMDYLILETDCPYLAPVPHRGKRNEP
                     AYTQLVAQRVADLREISLADVDAITTANAMKLFGV"
     gene            60143..61159
                     /gene="hemB"
                     /locus_tag="VF_RS00270"
                     /old_locus_tag="VF0053"
                     /old_locus_tag="VF_0053"
                     /db_xref="GeneID:54162682"
     CDS             60143..61159
                     /gene="hemB"
                     /locus_tag="VF_RS00270"
                     /old_locus_tag="VF0053"
                     /old_locus_tag="VF_0053"
                     /EC_number="4.2.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="WP_011260930.1"
                     /db_xref="GeneID:54162682"
                     /translation="MSVSILGAFPNRRMRRMRKHEFSRRLMAENQLTVNDLIYPMFVL
                     MGKDRRESVESMPGVERLSIDLLLEEAQRLYDLGIPAIALFPVVSQDVKSLCAAEAYN
                     PEGLVQRTVKALKEHVPELGVITDVALDPFTTHGQDGIIDEDGYVMNDVTTEVLIKQA
                     LSHAEAGADVVAPSDMMDGRIGEIRKALEKAGHVHTQIMAYSAKYASCYYGPFRDAVG
                     SSSNLKGGNKKNYQMDPANSDEAIHEVAMDINEGADMVMVKPGMPYLDIVRRVKTELQ
                     VPTFAYQVSGEYAMHKAAIMNGWLSERDTVMESLLCFKRAGADGILTYFAKDVAEWLA
                     EEKK"
     gene            complement(61453..62946)
                     /gene="gppA"
                     /locus_tag="VF_RS00275"
                     /old_locus_tag="VF0054"
                     /old_locus_tag="VF_0054"
                     /db_xref="GeneID:54162683"
     CDS             complement(61453..62946)
                     /gene="gppA"
                     /locus_tag="VF_RS00275"
                     /old_locus_tag="VF0054"
                     /old_locus_tag="VF_0054"
                     /EC_number="3.6.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-5'-triphosphate,3'-diphosphate
                     diphosphatase"
                     /protein_id="WP_011260931.1"
                     /db_xref="GeneID:54162683"
                     /translation="MKSSTMSPMYAAIDLGSNSFHMLVVRHINGSVQTMAKIKRKVRL
                     AAGLNENNTLSHEAMQRGWDCLSLFAERLQDIPVENIRIVGTATLRVASNVDIFLEKA
                     NQILGHNINVIEGEEEARMIYQGVAHTSGGNGRRLVVDIGGASTELIIGEGFEAQALT
                     SLKMGCVTWLEGYFKDRALTQKNFNAAIAGAKETLAPILQQYTDLGWQTCVGASGTVQ
                     ALQEIMLAQGMDEVITLAKLKRLQKQAMQYEHLEELDIDGLTLERALVFPSGLSILIA
                     IFELLNIDSMTLAGGALREGLCYGMIDELQHDEVCQRTIKSTQQRYQLDVDYAQQVTD
                     LSIQLVQQCGNDWLIEPQALPLLTAATQLHEIGMCIDYKKGGEHSAYLINALDLPGFT
                     RAQKHLLGELLRRYREYFSAMPTQHAVSDISAQRMLRILRLAIILTHRRDVNLAPTVT
                     LSEKNDVLSLSIDGAWLAANPLTRSELEIEADKQTNIGWELVIDARD"
     gene            complement(62980..64278)
                     /gene="rhlB"
                     /locus_tag="VF_RS00280"
                     /old_locus_tag="VF0055"
                     /old_locus_tag="VF0056"
                     /old_locus_tag="VF_0056"
                     /db_xref="GeneID:54162684"
     CDS             complement(62980..64278)
                     /gene="rhlB"
                     /locus_tag="VF_RS00280"
                     /old_locus_tag="VF0055"
                     /old_locus_tag="VF0056"
                     /old_locus_tag="VF_0056"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="WP_005416870.1"
                     /db_xref="GeneID:54162684"
                     /translation="MKKTHITEQNFADLGLQPQVIDGLNAKGFIKCTPIQAKALPVLL
                     AGQDIAGQAQTGTGKTLAFLTATFNHLLTTPAPEGRKITQPRAIIMAPTRELAIQIFN
                     DAESLIASTGLKAALAYGGERYEKQQQVIEQGVDILIGTTGRIIDFYKQGHIDFKMIQ
                     AVVLDEADRMFDLGFIKDIRFIFRRMPAPTERLNMLFSATLSYRVQELAFEHMQEPEH
                     VVVEPEQKTGHRIKEELFYPSNDHKMALLQTLIEEEWPDRAIIFANTKHKCESVWGHL
                     AADKHRVGLLTGDVPQKKRERILEEFTQGNVDILVATDVAARGLHIPQVTHVFNFDLP
                     NEAEDYVHRIGRTGRAGASGNSISFACEEYAINLPAIEEYIEHSIPQSDYDASALLED
                     LPAPLRLQRRPQQNRRNNNGQRQGGNRKHTRPRQPRNTQS"
     gene            64391..64717
                     /gene="trxA"
                     /locus_tag="VF_RS00285"
                     /old_locus_tag="VF0057"
                     /old_locus_tag="VF_0057"
                     /db_xref="GeneID:54162685"
     CDS             64391..64717
                     /gene="trxA"
                     /locus_tag="VF_RS00285"
                     /old_locus_tag="VF0057"
                     /old_locus_tag="VF_0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008073352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin TrxA"
                     /protein_id="WP_005416871.1"
                     /db_xref="GeneID:54162685"
                     /translation="MSDKILQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILD
                     EIADEYEGKLTIGKLNIDQNAGTPPKFGIRGIPTLLLFKDGGVAATKVGALSKTQLKE
                     FLDANL"
     gene            64957..66216
                     /gene="rho"
                     /locus_tag="VF_RS00290"
                     /old_locus_tag="VF0058"
                     /old_locus_tag="VF_0058"
                     /db_xref="GeneID:54162686"
     CDS             64957..66216
                     /gene="rho"
                     /locus_tag="VF_RS00290"
                     /old_locus_tag="VF0058"
                     /old_locus_tag="VF_0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017631298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_011260932.1"
                     /db_xref="GeneID:54162686"
                     /translation="MNLTELKNRSVSDLVALGETLGLENLARLRKQDIIFSILKQHAK
                     SGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIR
                     PPKDGERYFALLKVNAVNHDRPDNARNKILFENLTPLHANDRLRMERGNGSTEDITAR
                     VLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAHNHPECELMVLLIDERPEEVTE
                     MQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNT
                     VIPSSGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEE
                     FKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELLTKADELQKMWILRKIVHPMGE
                     IDAMEFLIDKLSMTKTNDEFFDAMRRQ"
     gene            66374..67369
                     /locus_tag="VF_RS00295"
                     /old_locus_tag="VF0059"
                     /old_locus_tag="VF_0059"
                     /db_xref="GeneID:54162687"
     CDS             66374..67369
                     /locus_tag="VF_RS00295"
                     /old_locus_tag="VF0059"
                     /old_locus_tag="VF_0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260933.1"
                     /db_xref="GeneID:54162687"
                     /translation="MRQGLLASLFLFISLLFGQVLASEIQPNFKNSLLNDQQLKKKVE
                     KLHQYLIDDDTTTLNFSLNRLSMPQQEAVRFMLLQNIEKDRLILSPTASIWLKEQLTL
                     HPTYTIKEQGDGYVVTKLAFDYSSIAARVLNQMKKEQQVLDFILAAEEKRLILSEWLT
                     GEPHQVRVRQSIVLAELDSLTPEALEYLVNQVTDDTLSVWLPTTEVMVRLAQVSKSPK
                     IYKMLWRMRTDQYSINELNRLAGLAPDPFATEQLMAATKNPSLKQSAFASLAQLHPLP
                     QEVQHFLLAKLDHIQDGGAVAMHLANYGHASWLESLVGNSSNVRRQHVKFALSQN"
     gene            67471..69315
                     /gene="ubiD"
                     /locus_tag="VF_RS00300"
                     /old_locus_tag="VF0060"
                     /old_locus_tag="VF_0060"
                     /db_xref="GeneID:54162688"
     CDS             67471..69315
                     /gene="ubiD"
                     /locus_tag="VF_RS00300"
                     /old_locus_tag="VF0060"
                     /old_locus_tag="VF_0060"
                     /EC_number="4.1.1.98"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-polyprenylbenzoate decarboxylase"
                     /protein_id="WP_011260934.1"
                     /db_xref="GeneID:54162688"
                     /translation="MQYKDLRDFIGHLEDIGQLKRISHPIDPHYEMTEISDRTLRAGG
                     PALLFENPIGYDIPVLTNLFGTPERVAIGMGRKDVLELREVGKLLAYLKEPEPPKGFK
                     DALDKLPVFKQVLNMPTKNIRKAACQQIVWQGDDVDLDKVPVMSCWADDVAPLLTWGL
                     TITKGPHKKRQNLGIYRQQKLSKNKVIMRWLAHRGGALDLRDWMETHPGEPFPVSVAF
                     GADPATILGAVTPVPDTLSEYAFAGLLRGSRTEITKSISNDLEVPASAEIVLEGYIDP
                     TEFADEGPYGDHTGYYNEVEKHHVFTVTHITMRKEPIYHSTYTGRPPDEPAVLGVALN
                     EVFVPILQKQFPEIIDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYT
                     KFVLVCDEEVNARDWSQVTAAMSQHMDPARDSLMIENTPIDSLDFASPVVGLGSKMGL
                     DITKKWEVELALSPNVECSLTSSEQIEGCIAEITKMCPEIIEIHLQNDNANMVVVSIN
                     KQAAGNAKKIMDAIWAQFEENKFVIVCDDDVNVSDWNDIIWAVTTRMDPARDTLFLQS
                     VGETSKMGLDATNKWEGECLREWGTPIKKDPEVVAKIDSIWDELGIFK"
     gene            69479..69742
                     /locus_tag="VF_RS00305"
                     /old_locus_tag="VF0061"
                     /old_locus_tag="VF_0061"
                     /db_xref="GeneID:54162689"
     CDS             69479..69742
                     /locus_tag="VF_RS00305"
                     /old_locus_tag="VF0061"
                     /old_locus_tag="VF_0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S iron-sulfur cluster binding
                     domain-containing protein"
                     /protein_id="WP_005416876.1"
                     /db_xref="GeneID:54162689"
                     /translation="MKKITLLPQQKEFSIEEGQTILDAALEAGINYPNRCQVGACAMC
                     LCKKLEGEIEYDLEPLLTDKEQQEGWVFACQATAKSDLVLLLE"
     gene            69839..70549
                     /gene="fre"
                     /locus_tag="VF_RS00310"
                     /old_locus_tag="VF0062"
                     /old_locus_tag="VF_0062"
                     /db_xref="GeneID:54162690"
     CDS             69839..70549
                     /gene="fre"
                     /locus_tag="VF_RS00310"
                     /old_locus_tag="VF0062"
                     /old_locus_tag="VF_0062"
                     /EC_number="1.16.1.3"
                     /EC_number="1.5.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-flavin reductase"
                     /protein_id="WP_011260935.1"
                     /db_xref="GeneID:54162690"
                     /translation="MPINCKVKSIEPLACNTFRILLHPEQPVAFKAGQYLTVVMGEKD
                     KRPFSIASSPCRHEGEIELHIGAAEHNAYAGEVVESMKSALETGGDILIDAPHGEAWI
                     REDSERSMLLIAGGTGFSYVRSILDHCISQKIQKPIYLYWGGRDECQLYAKAELETIA
                     QAHSHITFVPVVEKSEGWTGKTGNVLEAVKADFNSLADMDIYIAGRFEMAGAAREQFT
                     TEKQAKKEQLFGDAFAFI"
     gene            complement(70627..71811)
                     /locus_tag="VF_RS00315"
                     /old_locus_tag="VF0063"
                     /old_locus_tag="VF_0063"
                     /db_xref="GeneID:54162691"
     CDS             complement(70627..71811)
                     /locus_tag="VF_RS00315"
                     /old_locus_tag="VF0063"
                     /old_locus_tag="VF_0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260936.1"
                     /db_xref="GeneID:54162691"
                     /translation="MIRLLLLAIVLVGGLIVGTTFADQQGYVLISVANTTIEMSLTTL
                     VLFIGALIAGLFLLEMIVKRILSVSNYTRGWFSARHLRKARYNTFKGMIKLHEGEWKE
                     AERLITKGGRHNDFPLLNYLAAAEAAQGRQQIDLRDKYLQLASEQDDSTLAVALTSAK
                     LQMRQKQYELALATLQFVKVDYPRNPVLLELLKECYLALNEWQALKNIIHPLSKANLI
                     TDQQALELEEKAECGLMAVIATNKGTAGLLEHWDALPKKLKKHVPILICLIQQLQARK
                     ADSEAYIILRDNLKKRADDRLVALLPTLNLADYHPVTVLLESMADYDVRNPVIQSTLA
                     QLYMRTQKWQPAREHFEAALAIREDMSDYAYLARVLDKQNRKQAAADLSRKALTMVDD
                     KG"
     gene            complement(71808..72980)
                     /locus_tag="VF_RS00320"
                     /old_locus_tag="VF0064"
                     /old_locus_tag="VF_0064"
                     /db_xref="GeneID:54162692"
     CDS             complement(71808..72980)
                     /locus_tag="VF_RS00320"
                     /old_locus_tag="VF0064"
                     /old_locus_tag="VF_0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_011260937.1"
                     /db_xref="GeneID:54162692"
                     /translation="MTKNNNTTQPTEDKPVVTTAPDIKKEPEKTTTHSASNTENIVDK
                     KGRRLGTVAIIISILFSGGAFLASQQQVTQQQIQIAQLEQKLKTADTTLDAKLVAAEQ
                     RITDKADEIVRKATVLMQQQDKSIASLQLAIADIKGRRPNDWLLAEADYLVKMAGRKL
                     WLEHDVVSATRLMENADQRISALNDPSLTPLRRAMADDIATLKAIPLIDRDGLVLKLN
                     SLEQQINKLPLASAVLPEADAVEEKHVSTNINDWQSNLKQSLNDFAGHFITYRVREGN
                     VIPLLSPEQHFYLKENIKGKLLLASKALYREQSEVYATSLESAKLWSSQYFQQDDPAV
                     KSFMAQLDSLAKYKVDVRYPKKMKTQALLSDFISERLRRNVQAIGDTPKATEGGKS"
     gene            complement(72977..73738)
                     /locus_tag="VF_RS00325"
                     /old_locus_tag="VF0065"
                     /old_locus_tag="VF_0065"
                     /db_xref="GeneID:54162693"
     CDS             complement(72977..73738)
                     /locus_tag="VF_RS00325"
                     /old_locus_tag="VF0065"
                     /old_locus_tag="VF_0065"
                     /EC_number="4.2.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_011260938.1"
                     /db_xref="GeneID:54162693"
                     /translation="MTILVTRPEQESQALCDALNQSGHPAISHPLITIHPGNELSQLP
                     RLFYSLNDGDFIIAVSQHAVEHTQNYLKQLQLEWKQGVNYIAVGQKSAQHLKKYISDP
                     VHYPTHSDSEHLLALPVLQNATGKKAIILRGNGGRDLIYQVLNDLNVDVTYCEAYQRQ
                     AIAFDASIKTREWQEKNVNTLIVTSGEQLSFFTSQFTSTDLNWVLKLRLLVPSERINQ
                     FAKELGYQHIETVGGASNSDLLHYISEHHYDGIFK"
     gene            complement(73741..74676)
                     /gene="hemC"
                     /locus_tag="VF_RS00330"
                     /old_locus_tag="VF0066"
                     /old_locus_tag="VF_0066"
                     /db_xref="GeneID:54162694"
     CDS             complement(73741..74676)
                     /gene="hemC"
                     /locus_tag="VF_RS00330"
                     /old_locus_tag="VF0066"
                     /old_locus_tag="VF_0066"
                     /EC_number="2.5.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_011260939.1"
                     /db_xref="GeneID:54162694"
                     /translation="MSQQLPVRIATRKSPLALWQAHFVKDALQAAHPGLEVELVTMVT
                     KGDIILDTPLAKVGGKGLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICER
                     EDPRDAFVSNTYNNIDELPQGAVVGTCSLRRQCQLKEARPDLIIKELRGNVGTRLQKL
                     DDGNYDAIILACAGLIRLGLEDRIKSAIEPEQSLPAVGQGAVGIEARLDDDRLRALLE
                     PLNHPETANRVLCERAMNNRLEGGCQVPIGSYSLIDGDQIWLRALVGEPDGSVMIRGE
                     VSGPVSDAEALGTQLADQLLNDGAKEILERLYAEA"
     gene            74934..77459
                     /locus_tag="VF_RS00335"
                     /old_locus_tag="VF0067"
                     /old_locus_tag="VF_0067"
                     /db_xref="GeneID:54162695"
     CDS             74934..77459
                     /locus_tag="VF_RS00335"
                     /old_locus_tag="VF0067"
                     /old_locus_tag="VF_0067"
                     /EC_number="4.6.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I adenylate cyclase"
                     /protein_id="WP_047863539.1"
                     /db_xref="GeneID:54162695"
                     /translation="MQTYIETLIARQQRLTEQRVERALALMKPLGQEIFHQLPLLLHF
                     NHSELPGFVEGAPSGIKQFHANKKQREWMAQLTLRYPLSTSNQGNILGLYSMGSTSSI
                     GQTVASDLDIWVCIPENLPAEKKALLQQKCDALTEWALQFYIEANFFLMEQNRFRDAY
                     SEEMTGDNCGSSQHLLLLDEFYRTAVCLGGQQLLWQIIPPEMEESYDDYVDQLCEQGI
                     IQRDQWIDFGRLNHIPAEEYFGSSLWQLYKSIDSPFKSVLKAILLEAYSWEYPHTQLL
                     SIDSKRRFFADDPDLYGMDAYYLMLEKVTRYLERTNDMSRLELVRRSFYLKTHEKLSR
                     RQGQGSVEWRRKALSELTTQWGWSSEYITELDSRRTWKVEQVKKSHHDLLEALMQSYR
                     NLIRFARNNDITSSISPEDISILARKLYAAFEELPGKVTLLNPQISPDLHEADLSFIE
                     VPEDSINKAGWYVYKKPLIAKELMGAKFLEHNRYLSKLVAWAFFNGLLTESTRLDAVV
                     RDADLNIDKFYQMVSDLRNTFSVYLPQPTKEELGSPCEVRQLSIFINLESDPTERLKL
                     KPERMNQADADIFSCGSEQNNLIGSVDLVYRNSWHEVRTLNFSGETAILDALKTVLCK
                     MHQDAARPESVDVFCYSKQMRGIIRNNIYQLLAECIELRLKPVENNEKRRRFKGIKIG
                     STMYGLFFERRGVSIQKLEDSVQFYSSISTNKAIGSTTIPLGDNSGVVIPDAVDSFAS
                     EGLIQFFFDDSQNDDDGFNIYVLDEENKIEIYHQCYGSKDDMVNSINHYYTSSRNNED
                     LSNPDKVNFNLPQFYEVVYGDTQEASIHSYRSGQQHAKVKQVI"
     gene            77544..79745
                     /gene="uvrD"
                     /locus_tag="VF_RS00340"
                     /old_locus_tag="VF0068"
                     /old_locus_tag="VF_0068"
                     /gene_synonym="mutU; recL"
                     /db_xref="GeneID:54162696"
     CDS             77544..79745
                     /gene="uvrD"
                     /locus_tag="VF_RS00340"
                     /old_locus_tag="VF0068"
                     /old_locus_tag="VF_0068"
                     /gene_synonym="mutU; recL"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008080844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="WP_011260941.1"
                     /db_xref="GeneID:54162696"
                     /translation="MDVSFLLDGLNDKQREAVAAPLENMLVLAGAGSGKTRVLVHRIA
                     WLMQIEQASPFSIMSVTFTNKAAAEMRGRIEELMHGSAGGMWNGTFHGICHRILRAHY
                     LDAKLPEGFQIIDSDDQQRLLKRLIKAQNLDDKNWPARQAAWFINGKKDEGLRPHQIN
                     SFNDPITQTWLKVYSAYQEACDRAGLVDFAEILLRAHELLRDHKHIREHYQARFKHIL
                     VDEFQDTNNIQYAWLRMMAGSDCDVMIVGDDDQSIYGWRGAQIENIQKFLDEFVGAKT
                     IRLEQNYRSTANILNAANELISNNTERMGKKLWTEGVEGDLISIYSAYNELDEARFAV
                     GKIKEWRDNGGALEDSAFLYRNNAQSRVLEEALIQAGLPYRIYGGMRFFERQEIKDAL
                     SYLRLMNNRNDDAAFERVVNTPTRGLGDKTLETVRFAARERGATMWQASIALIEEQVL
                     PGRAAGALSRFIELINALEDDTRDCRLHEQTDQVIKSSGLFAMYEQEKGEKSKARIEN
                     LEELVTATRQFEKPEEAEEMTDLTAFLTHAALEAGEGQADEFEDAVQLMTLHSAKGLE
                     FPLVFMVGVEEGMFPSQMSAEEAGRLEEERRLCYVGMTRAMEKLYITYAEMRRLYGQD
                     KYHKPSRFIKEIPTECVEEVRMKAKVSRTGSYGSYGQSASSDSRFGQKAVNNNFNETG
                     YALGQRVKHPKFGEGTIINFEGAGPQGRVQVAFNGEGIKWLVTQYAKLESM"
     gene            complement(80164..81069)
                     /gene="rarD"
                     /locus_tag="VF_RS00345"
                     /old_locus_tag="VF0069"
                     /old_locus_tag="VF_0069"
                     /db_xref="GeneID:54162697"
     CDS             complement(80164..81069)
                     /gene="rarD"
                     /locus_tag="VF_RS00345"
                     /old_locus_tag="VF0069"
                     /old_locus_tag="VF_0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter RarD"
                     /protein_id="WP_047863538.1"
                     /db_xref="GeneID:54162697"
                     /translation="MPTTTLEQQRTRQGVLFALGAYTIWGIAPIYFKTISEVSPLEIL
                     SHRVIWSFFFLAALLSFSKGWATVINTLKDKKKMTYLITTSVLIGANWLIFIWAVNAG
                     HMLDASLGYYINPLLNVVLGMIFLGERLRRLQWVAVLFASAGVLIQLITFGSIPVVAI
                     ALACSFGFYGLLRKKVAMDAQTGLFIETLVMLPLTLIYLLFIADSATSNFSENTLNLN
                     LLLIAAGIITTVPLLCFTGAATRLKLSTLGFFQYIGPSLMFLLAVGLYGEEFSADKAI
                     TFGFIWGALVIFTTDAFMARNKKNK"
     gene            81298..83133
                     /gene="recQ"
                     /locus_tag="VF_RS00350"
                     /old_locus_tag="VF0070"
                     /old_locus_tag="VF_0070"
                     /db_xref="GeneID:54162698"
     CDS             81298..83133
                     /gene="recQ"
                     /locus_tag="VF_RS00350"
                     /old_locus_tag="VF0070"
                     /old_locus_tag="VF_0070"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="WP_011260943.1"
                     /db_xref="GeneID:54162698"
                     /translation="MSSMIAEQPMEEVSPSYTVLKDVFGYQEFRVGQEEVINAVLDSK
                     DCLVIMPTGGGKSLCYQIPALVFEGLTLVISPLISLMKDQVDQLKANGVKAECLNSTI
                     EREEQIAIWNRVNSGQVKMLYVSPERVMMRDFMDRLESLNLCMIAVDEAHCISQWGHD
                     FRPEYASLGQIKQRFPSVPIMALTATADEATRKDILHRLSLPEPHQYLGSFDRPNIRY
                     TVLEKHKPVSQIVRYLATQKNQCGVIYCGSRKKVEMLTEKLCNNHIRAASYHAGLDLD
                     ERNYVQEAFQRDDIQIVVATVAFGMGINKSNVRFVAHFDIPKNIESYYQETGRAGRDG
                     LPAEAVMLYDPADIVWLRKLVEEKPEGPQKLVESHKLNAMTAFAEAQTCRRQVLLNYF
                     GEYSAKPCGNCDVCLDPPKQFDGTEAAQKALSCVYRVNQSFGVGYVVEVLRGLKIARI
                     REHGHDKLSTYGIGKEHTHEYWVSIIRQLIHKGLLVQNITRNSTLQLTEEARPILKGQ
                     EPLELAVPRLDIAAKTAKSEKLNNRNYDKQLFAKLRKLRKSIADRDDLPPYVVFSDAT
                     LMDMADILPTSYGEMLAVNGVGQKKLEKYADPFLDLIEMHLTGQG"
     gene            83137..83427
                     /locus_tag="VF_RS00355"
                     /old_locus_tag="VF0071"
                     /old_locus_tag="VF_0071"
                     /db_xref="GeneID:54162699"
     CDS             83137..83427
                     /locus_tag="VF_RS00355"
                     /old_locus_tag="VF0071"
                     /old_locus_tag="VF_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3630 family protein"
                     /protein_id="WP_011260944.1"
                     /db_xref="GeneID:54162699"
                     /translation="MSLFSVIEFDKEVGRIIFAIPEFDFDTFNGMGKQLVSAMDAKVI
                     EQQVDADLHSWLIDFEGTHLMLRAEHYSNSVWLESLSSGEALDELSFIVGLF"
     gene            complement(83482..84846)
                     /gene="glpT"
                     /locus_tag="VF_RS00360"
                     /old_locus_tag="VF0072"
                     /old_locus_tag="VF_0072"
                     /db_xref="GeneID:54162700"
     CDS             complement(83482..84846)
                     /gene="glpT"
                     /locus_tag="VF_RS00360"
                     /old_locus_tag="VF0072"
                     /old_locus_tag="VF_0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter"
                     /protein_id="WP_011260945.1"
                     /db_xref="GeneID:54162700"
                     /translation="MFGVFKPKAHIAQLPTGEINSTYKRLRWQLFLGIFFGYAGYYLV
                     RKNFSLAMPYLIEQGYSRGDLGVALAAVSIAYGLSKFLMGSVSDRSNPRYFLSAGLVM
                     SALVMFCFGFMPWATGSITAMFILLFLNGWFQGMGWPACGRTMVHWWSRKERGEIVSV
                     WNVAHNVGGGLIGPMFLLGLWAFNDDWRTAFYVPAFFALLVAFFVWLTVRDTPQSCGL
                     PPIEEFKNDYPDDYDSAYETEMTAKEIFFKYVFSNKLLWSIAIANAFVYLIRYGVLDW
                     APVYLKEAKEFTVDKSSWAYFLYEWAGIPGTLLCGWISDKLFKGKRAPAGILFMALVT
                     IAVLVYWFNPAGNPTVDMIALVAIGFLIYGPVMLIGLYALELAPKKAAGTAAGLTGLF
                     GYLGGAVAANALLGYTVDHFGWDGGFMILVASCVISIVCLTYALIGEQKHHKEKIEKE
                     SHMA"
     gene            85190..85861
                     /locus_tag="VF_RS00365"
                     /old_locus_tag="VF0073"
                     /old_locus_tag="VF_0073"
                     /db_xref="GeneID:54162701"
     CDS             85190..85861
                     /locus_tag="VF_RS00365"
                     /old_locus_tag="VF0073"
                     /old_locus_tag="VF_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine/7-aminomethyl-7-
                     deazaguanine transporter"
                     /protein_id="WP_011260946.1"
                     /db_xref="GeneID:54162701"
                     /translation="MSTFTPAQQRNALSFLVVFHLVIIASSNYLVQLPFTIFGFHTTW
                     GAFTFPFIFLATDLTVRIFGAKMARSIIFFVMLPALAVSYFLSVVFFEGQYQGFSQLG
                     EFNLFVARIAVASFMAYLLGQILDVHVFNRLRQLKQWWIAPTCSTLFGNALDTLAFFS
                     IAFYQSPDAFMAEHWTEIALVDYGFKLVISLGLFVPMYGVLLNYLTRKLTSEGHQLAT
                     QPSQV"
     gene            86562..89360
                     /gene="polA"
                     /locus_tag="VF_RS00370"
                     /old_locus_tag="VF0074"
                     /old_locus_tag="VF_0074"
                     /db_xref="GeneID:54162702"
     CDS             86562..89360
                     /gene="polA"
                     /locus_tag="VF_RS00370"
                     /old_locus_tag="VF0074"
                     /old_locus_tag="VF_0074"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011260947.1"
                     /db_xref="GeneID:54162702"
                     /translation="MARIPDNPFILVDGSSYLFRAYHAAPNFTNGDGQPTGAVYGVIN
                     MLRSLLKQFETDRIAVIFDAKGKTFRNDMYPEYKANRPPMPDDLRCQIEPLHKLIKAM
                     GLPLVSIPGVEADDVIGTLASQASKAGIPVLISTGDKDMAQLVDENVTLINTMTNVIM
                     DPEGVVEKFGIGPELIIDYLALMGDKVDNIPGVPGVGDKTAKALLQGIGGLDALYEHL
                     DDIAPLGFRGSKTMAKKLIDNKEGAYLSYELATIKLDVELDKTPEEFVKQEPNVDELI
                     QMFGQMNFKRWLTEMLDGSDGKIVSHETSSNSVSTSSKQDDAEEELIVAAQVDRSKYE
                     TILTKEAFSVWLDKLNNADVAAFDTETDSLDYMVANLIGLSFAVEEGEAAYVPVAHDY
                     LDAPEQLDRDWVLEQLKPYLEDDNKAKVGQNLKYDASVLARYDIEMKGIKFDTMLESY
                     VYNSVAGKHNMDSLALRYLQHNTISFEEIAGKGKKQLTFNQIALEQAAPYAAEDADIT
                     LRLHHVLNAKLEADEKLKSVFTDIELPLVSVLSRMERKGVYIDDMLLSAQSVEIGQRL
                     DELEKAAFEVAGEEFNMNSPKQLQTILFEKMELPVIKKTPSGAASTNEEVLQELALDY
                     PLPKLILEYRGLAKLKSTYTDKLPKMINPSTGRVHTSYHQAVTATGRLSSTDPNLQNI
                     PIRNEEGRRIRQAFVAPHGWKILAVDYSQIELRIMAHLSQDKALLAAFSAGKDIHAAT
                     AAEVKGVSIEEVTSEDRRRAKAINFGLIYGMSAFGLAKQIGIPRGEAQDYMNVYFERY
                     PGVMQYMEETRLLATEQGYVETLYGRRLHLPEINARNGMRRKAAERAAINAPMQGTAA
                     DIIKKAMILVDEWVETEGKDRVNLLMQVHDELVFEVKEDALDEVTTKVRELMEQAAQL
                     DVPLVAEAGFGNNWDEAH"
     gene            complement(90085..90732)
                     /locus_tag="VF_RS00375"
                     /old_locus_tag="VF0075"
                     /old_locus_tag="VF_0075"
                     /db_xref="GeneID:54162703"
     CDS             complement(90085..90732)
                     /locus_tag="VF_RS00375"
                     /old_locus_tag="VF0075"
                     /old_locus_tag="VF_0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihA family ribosome biogenesis GTP-binding
                     protein"
                     /protein_id="WP_005416925.1"
                     /db_xref="GeneID:54162703"
                     /translation="MSKTIHYQKTHFITSAPDIRHLPEDEGIEVAFAGRSNAGKSSAL
                     NRLTNQKSLAKTSKTPGRTQLINLFKVEENCHIVDLPGYGFAQVPLEMKKKWQKSLGE
                     YLQKRQCLQGLVVLMDIRHPLKDIDQQLVFWAVDQNIPVQILLTKADKLKSGARKAQV
                     LKVREAAVDFGGEVEVDAFSSLKGIGVDKLRAKLDEWFAPAFELDDEFIEDLDAE"
     gene            91021..91638
                     /locus_tag="VF_RS00380"
                     /old_locus_tag="VF0076"
                     /old_locus_tag="VF_0076"
                     /db_xref="GeneID:54162704"
     CDS             91021..91638
                     /locus_tag="VF_RS00380"
                     /old_locus_tag="VF0076"
                     /old_locus_tag="VF_0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020433074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="WP_011260948.1"
                     /db_xref="GeneID:54162704"
                     /translation="MKKLALILTLLASCSTWAQGDIEAGKQKSATCAACHGQEGNSTL
                     TQYPNIAGQHAGYLEKQLKEFKLGMETQGKQGRLEPVMSGMAMPLTEQDIMDLSAYFA
                     SLPMADNTTPEEVIPEGKALYLAGDMERGITACVACHGPRGNGTSLSGFPKISGQHAD
                     YVKAQLEKFRSADRANDMNAMMRDIAKKLTDEDIDTLSKYVGGLH"
     gene            91793..92434
                     /locus_tag="VF_RS00385"
                     /old_locus_tag="VF0077"
                     /old_locus_tag="VF_0077"
                     /db_xref="GeneID:54162705"
     CDS             91793..92434
                     /locus_tag="VF_RS00385"
                     /old_locus_tag="VF0077"
                     /old_locus_tag="VF_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_011260949.1"
                     /db_xref="GeneID:54162705"
                     /translation="MQSCPLCQHSKADDFHQDKRRRYYRCQQCHLVYVDESDRLDAEN
                     EKAHYDLHENNLDDEGYRTFLSRFAEPLLSRVGETPQQGLDFGCGPGPLLAHMMREAG
                     HHVELYDIYYAPDKSVLNKQYDFVSCTEAVEHFYQPQNELELLLSLVKPGGWLGIMTK
                     LARDESAFATWHYKNDLTHVSFFSIETFEFIAKQYQLELEFVGKDVILLRKTQ"
     gene            92434..92979
                     /gene="yihI"
                     /locus_tag="VF_RS00390"
                     /old_locus_tag="VF0078"
                     /old_locus_tag="VF_0078"
                     /db_xref="GeneID:54162706"
     CDS             92434..92979
                     /gene="yihI"
                     /locus_tag="VF_RS00390"
                     /old_locus_tag="VF0078"
                     /old_locus_tag="VF_0078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Der GTPase-activating protein YihI"
                     /protein_id="WP_011260950.1"
                     /db_xref="GeneID:54162706"
                     /translation="MSRIKKARKPGMSSQPVVVTRNRTDRDVESREIKRKRKRKGLKA
                     GARNAESNAEQARRNAQKKDPRIGSKKPIQLVVEAKQKTTKQERRLTNEQELAMLEND
                     AQLMVLLDRLDSGENLGTGLQKYVDEKLARIEHLMGRLGLLDDEEPEEIEEFPEFAER
                     KAKSDDDLLAEFDDFNMDDFK"
     gene            92982..93473
                     /locus_tag="VF_RS00395"
                     /old_locus_tag="VF0079"
                     /old_locus_tag="VF_0079"
                     /db_xref="GeneID:54162707"
     CDS             92982..93473
                     /locus_tag="VF_RS00395"
                     /old_locus_tag="VF0079"
                     /old_locus_tag="VF_0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2489 domain-containing protein"
                     /protein_id="WP_011260951.1"
                     /db_xref="GeneID:54162707"
                     /translation="MSTVTLLALLGGAIILALAGYAGSLLMKLKKQKELQEQHRKLAI
                     QQRNANIFENVVLLCQAGLQDRCDFSELSIRLYCIMDYLQEDERIDVEKEYPALSELY
                     HVVKDMARGDERQELAKKDRMKDNLVRTKAEARLQDAIKEEIQQLHDRVKPLNQNIDI
                     KMI"
     gene            93582..94955
                     /gene="hemN"
                     /locus_tag="VF_RS00400"
                     /old_locus_tag="VF0080"
                     /old_locus_tag="VF_0080"
                     /db_xref="GeneID:54162708"
     CDS             93582..94955
                     /gene="hemN"
                     /locus_tag="VF_RS00400"
                     /old_locus_tag="VF0080"
                     /old_locus_tag="VF_0080"
                     /EC_number="1.3.98.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="WP_011260952.1"
                     /db_xref="GeneID:54162708"
                     /translation="MSNQQIVWDQEIIEKYNYSGPRYTSYPTALEFHEAYTPAEFDMA
                     CTQYPERPLSLYIHIPFCHKLCYFCGCNKVITRHHHKADIYLDSLELEIRQRAALFTE
                     RKVTQLHFGGGTPTFLTKVQFTRLMTLLRGEFQFEEGAEISIEVDPREIELDMLDHLR
                     DEGFNRLSIGVQDFNKEVQQLVNRDQDEDFIIQMVQRAKDLGFRSTNLDLIYGLPKQS
                     ADSLANTIKRVLEMEPGRLSVFNYAHMPTLFAAQRKIKDADLPAPAEKLVMLQETIET
                     LTGAGYQFIGMDHFALPDDELAVAQREGVLHRNFQGYTTQGECDLLGMGVSAISMIGD
                     SYAQNKKDLKEYYAQVDEQRHALWRGVALDNDDLIRREVIKQLICNFTLDTKAIEAEF
                     NLDFDTYFAEDIKLLQTFINDELVTMHEGRIDVELRGRLLIRNICMCFDKYLRDRARQ
                     QQFSRVI"
     gene            complement(95145..95606)
                     /gene="asnC"
                     /locus_tag="VF_RS00405"
                     /old_locus_tag="VF0081"
                     /old_locus_tag="VF_0081"
                     /db_xref="GeneID:54162709"
     CDS             complement(95145..95606)
                     /gene="asnC"
                     /locus_tag="VF_RS00405"
                     /old_locus_tag="VF0081"
                     /old_locus_tag="VF_0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011220046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator AsnC"
                     /protein_id="WP_011260953.1"
                     /db_xref="GeneID:54162709"
                     /translation="MNQTSKIDDLDRDILQALMNDARTPYAELAKRFDVSPATIHVRI
                     EKMKAANIIEGTEVVVNPKTLGYDVCCFIGINLYAARDYHSALAKLDALEEVVEAYYT
                     TGAYNIFVKLMCKSIEELQYVLIDKLQAIDEVQSTETLISLQNPISRNVKP"
     gene            95747..96526
                     /locus_tag="VF_RS00410"
                     /old_locus_tag="VF0082"
                     /old_locus_tag="VF_0082"
                     /db_xref="GeneID:54162710"
     CDS             95747..96526
                     /locus_tag="VF_RS00410"
                     /old_locus_tag="VF0082"
                     /old_locus_tag="VF_0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_011260954.1"
                     /db_xref="GeneID:54162710"
                     /translation="MQIALLSEDPNRQSELEAIATRWGLEHDEDNVFALVLTDKQLEL
                     RKRDEPKLGAIFVDLVSGAVAHRRKFGGGKGQSIAKAVGLNKGATPIVLDGTAGLGRD
                     AFVLASLGCKVQMVERHPVVAALLDDGLARAKQDAEIGVWVAERMSLLHASSHDALEQ
                     LMAQDDFVQPDVVYLDPMYPHPVNKKKSALVKKEMRVFQSLVGADNDADALLAPALSM
                     ATKRVVVKRPDYAEWLDNQKPSMAIETKKNRFDVYVNAAMA"
     gene            complement(96523..96948)
                     /locus_tag="VF_RS00415"
                     /old_locus_tag="VF0083"
                     /old_locus_tag="VF_0083"
                     /db_xref="GeneID:54162711"
     CDS             complement(96523..96948)
                     /locus_tag="VF_RS00415"
                     /old_locus_tag="VF0083"
                     /old_locus_tag="VF_0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_005416940.1"
                     /db_xref="GeneID:54162711"
                     /translation="MSYQHILVAVDLTEESKALVSKAVGLAKALDAKVSFIHIDVSYA
                     ELYTGLIDINLAETQHQAMEASKEAMKHLVEFADYPIHKTLVSSGDLSNELTEAIENL
                     DVNLVVCGHHQDFWSKLLSSTRQVINTCPIDVLVVPFKD"
     gene            97131..97658
                     /gene="ftnA"
                     /locus_tag="VF_RS00420"
                     /old_locus_tag="VF0084"
                     /old_locus_tag="VF_0084"
                     /db_xref="GeneID:54162712"
     CDS             97131..97658
                     /gene="ftnA"
                     /locus_tag="VF_RS00420"
                     /old_locus_tag="VF0084"
                     /old_locus_tag="VF_0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-heme ferritin"
                     /protein_id="WP_011260955.1"
                     /db_xref="GeneID:54162712"
                     /translation="MLAQTMVDHLNAQINLEFFSSNLYLQMSAWCEDKGFDGAAEFFR
                     AHAAEEMEHMQRLFTYVSETGAMPILGAIEAPQSEFSGLGDVFRTTLEHEQMITQEIN
                     KLAHVAFTSQDYSTFNFLQWYVAEQHEEEKLFKGILDKIDLVGEDGKALFFIDKDLAA
                     LAKSGSSSIMDSTAG"
     gene            97754..98092
                     /gene="uspB"
                     /locus_tag="VF_RS00425"
                     /old_locus_tag="VF0085"
                     /old_locus_tag="VF_0085"
                     /db_xref="GeneID:54162713"
     CDS             97754..98092
                     /gene="uspB"
                     /locus_tag="VF_RS00425"
                     /old_locus_tag="VF0085"
                     /old_locus_tag="VF_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein UspB"
                     /protein_id="WP_005416943.1"
                     /db_xref="GeneID:54162713"
                     /translation="MISGDLILLALFTVTGINIIRYLSTLKTLLFVMREAHPLLYQQV
                     DGRGFFTTHGNFGKQTKLLQYLWQEEYLDHHDTLFVFKCEKARYLFMLSSALLVVSVA
                     VFFLVISLGI"
     gene            98141..99325
                     /locus_tag="VF_RS00430"
                     /old_locus_tag="VF0086"
                     /old_locus_tag="VF_0086"
                     /db_xref="GeneID:54162714"
     CDS             98141..99325
                     /locus_tag="VF_RS00430"
                     /old_locus_tag="VF0086"
                     /old_locus_tag="VF_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_011260957.1"
                     /db_xref="GeneID:54162714"
                     /translation="MKKVDVVVIGAGAAGLMCAAEAAKRGRSVLVVDHAKKPGRKILI
                     SGGGRCNFTNYDVTASNYVCQNPHFVKSALSQYTNWDFISLISKYGIEFEERDHGQLF
                     CIDSAKEIVDMLLKECESVGVNYRYRCEISGIKKTDTGFTLMLDLDELACESLVVATG
                     GLSMPKLGATPFGYQIAEQFGLSMVPTTAGLVPFTLHKEDKEAFSELSGIAIPIVVES
                     ENGSSFKENLLFTHRGLSGPSILQISSYWKAGQKVTIDLLPNDDLSEELDKMRESNPN
                     QSIKNSLAKLLPKRVVETLLNKTIFNERSLKQVNPKEQQELCSLLHKWQVLPNGTEGY
                     RTAEVTLGGVNTDELSSKTMESKKVPGLYFVGEVMDVSGWLGGYNFQWAWSSGYVAGI
                     NV"
     gene            99442..101937
                     /locus_tag="VF_RS00435"
                     /old_locus_tag="VF0087"
                     /old_locus_tag="VF_0087"
                     /db_xref="GeneID:54162715"
     CDS             99442..101937
                     /locus_tag="VF_RS00435"
                     /old_locus_tag="VF0087"
                     /old_locus_tag="VF_0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_011260958.1"
                     /db_xref="GeneID:54162715"
                     /translation="MQTLSFSVQSITHLKEECDSLLIERASGCLIQIFSSQSMEEVST
                     YHSFLQCLFPHAEIVGLSAIHTSINSSVFTQSTIVSISTFDSSTVTSASIVHGENEPL
                     VGHQLLRKLSVNQTTKSVIAFSCYGSASNYKLFEAFSEQAYIVPVSGCVATDTGEGAW
                     ILFNGEFHQNQIVAVALHGEKLQAWYEAFVEWNPIGKHFRVTASEGRVVKAIDHIPAY
                     DFYCKYLADNKPLALSQIQAFPLMLEEETARIINTVESITKEGHLLFSAEVPVGDEVR
                     LSYYHPSLTQEQVNQGAARLANRRPESIFIYNCESRIENSTESTELQAFSDVGLCQGV
                     YGMGEFFRSHNQQILHHSLTYLALSESEEVASEYDTFSRAPRVHNLTPLFSLIKNSIQ
                     DLDHMTSELEEKIREQSLRLIQTYRTDRRTGLLNRTVLKERLSHIALTDHLLSFKLTN
                     LSQVNEKYGYHVGDKLLQDISYYMKEHLGLAIESEIELYSIGIAEWGVIFNSDTASEV
                     LRKQITGFIEKLEHENFEPYGLDDVDYLSVSISGGLISRRDFPTIASEDLILKTVEAR
                     RIAMRRNRHLCNARELMKEERTRQNQLDWLTCVNRAISQKGVLVYGQPIYKAHTHELA
                     STECLMRIQEDDQIFAPGQFLPAVEGTHLYTRLSREMISSIFEIMQSNDLTFSINLSP
                     QDLLSDRTLDLLESSMIRLDNPMRVGFEVLETEQIQDYGHIIEVCNHFRRLGARIIID
                     DFGSGYSNIDAIMKLEPQVIKLDGSIIKNVHQDKRQRLISQQMVQLCHVLDAKAVAEF
                     VHNQEVCSIVEDMGVDYLQGYFLGEPKSLHIKT"
     gene            complement(101927..102514)
                     /locus_tag="VF_RS00440"
                     /old_locus_tag="VF0088"
                     /old_locus_tag="VF_0088"
                     /db_xref="GeneID:54162716"
     CDS             complement(101927..102514)
                     /locus_tag="VF_RS00440"
                     /old_locus_tag="VF0088"
                     /old_locus_tag="VF_0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DTW domain-containing protein"
                     /protein_id="WP_047863537.1"
                     /db_xref="GeneID:54162716"
                     /translation="MTCSICGFTHNCICAHQPNLSSNIEFALLYHENERHKLTNTGKL
                     LLNSLSNTTEYTWQRKEPPQALISKINQADTETWLLFPSKEPVLSSDFHHRHDPSKKQ
                     LFVLLDATWQEAKKMVNKSPWLKALPCLEIQTDEASRYHLRRNQSEGNLCTCEAGIEV
                     LEMVKEPENAQALSCYYDQFLTVFQAERSGHKFTS"
     gene            complement(102526..103536)
                     /locus_tag="VF_RS00445"
                     /old_locus_tag="VF0089"
                     /old_locus_tag="VF_0089"
                     /db_xref="GeneID:54162717"
     CDS             complement(102526..103536)
                     /locus_tag="VF_RS00445"
                     /old_locus_tag="VF0089"
                     /old_locus_tag="VF_0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260960.1"
                     /db_xref="GeneID:54162717"
                     /translation="MKTSLTTLISATLLLLTGCSQQTSAPKNNMVAQQDEINSPHTFM
                     LRGTVIIGHESQSIQPCDSDQQYWVNLSPRQWKAGTDIQSRPYQAMYGEFIGHFEAPP
                     KGGFSSDYPARFVVSHINRLVAGEGPSCAQPPQPTKAFGNEPFWNMQVKSGELVFSQM
                     GNQTKKQPITKQEFTPTRREYHSENFSLIMTKGLCNDSMVESIYGWNSEVTVNDTTYK
                     GCGTLAPKDTTLNWVGTYQGTSTLTTPGLNINLVLNPDHSAITTYDNQTGEDPLVETG
                     VWQATRDDHVHVLMSRHQRQYLIAERTFTKKGKQIHTDKETVNGVTFPIKSGLTLFST
                     SQ"
     gene            103693..104328
                     /locus_tag="VF_RS00450"
                     /old_locus_tag="VF0090"
                     /old_locus_tag="VF_0090"
                     /db_xref="GeneID:54162718"
     CDS             103693..104328
                     /locus_tag="VF_RS00450"
                     /old_locus_tag="VF0090"
                     /old_locus_tag="VF_0090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 4-hydroxy-2-oxoglutarate
                     aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="WP_005416953.1"
                     /db_xref="GeneID:54162718"
                     /translation="MSWNLSPSDVFSASPVVPVMVIEQLEDAVPMAQALAAGGINVFE
                     ITLRTAVALEAITAIRKAMPKALVGAGTVISTHQYDQAVEAGAQFIISPGFTPSLLAH
                     AKTADVPLIPGVATPSEVIRAIELGYSHLKFFPASAFGGPSVLKAMAAPLPQVQFCPT
                     GGINPQNVNDYTALDCVATVGGSWMLPKDAVAAKDWNKVTLLAKEAVELIK"
     gene            complement(104345..106882)
                     /locus_tag="VF_RS00455"
                     /old_locus_tag="VF0091"
                     /old_locus_tag="VF_0091"
                     /db_xref="GeneID:54162719"
     CDS             complement(104345..106882)
                     /locus_tag="VF_RS00455"
                     /old_locus_tag="VF0091"
                     /old_locus_tag="VF_0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_047863536.1"
                     /db_xref="GeneID:54162719"
                     /translation="MSCKNNISLKFAITIPFMIIFTLIMTVVLNSQASIYRDMISHIS
                     EKLLDSSSRSIDAALYHQLEDPLNANINMRNTIERNELYLPENAKKLQRYLNQNLKKE
                     VSTLKQVDIIGYGNKKGDYIGFRKNKNNGTTHLLLKEQNSHLYIYQGDNLQSPVLNII
                     KNYDPRTRPWYQKSLEDPKARWSDIYSNVEENESSLLSAISPVYNKNKELEGVITTDV
                     LLTSFNKFLDKEADEINGNISIVDSNGTVWLHSDHNPNAPMHHDISRIDSIENPIVKE
                     TILYIEKVGFDKALQEKIISLNIDGQKHFMMISPFRKRIPVEGYIIASIPESTLLGAL
                     PQRRQFTIIITVIACLIAFVLAVYVIRKLIKPIIDTANSAKELAQGNWDTPLPINCTT
                     QEVMVLTRSFKFMAHNLKRSFQELQDKVTYDSLTHLYSRTGLDNVISPAITDNSGLIS
                     FTINGFRDINDSVGHLSGDHLLVDISERLKTHYQDQNIEMARIGGAEFALFFYHIDDI
                     QELINYAQQLQSIFNTPIQSASGEVVIQLSTGLVYQLNNHNAMHWLRCASLALAYAQS
                     KSSKLAVFEPYMADISQKKTKLAAELSHAIKNEELLPYYQPLVNFEDGKIHGAEALIR
                     WNSPQRGIVSPNEFIPLAEDNGMIINIGRMVLRQACIDTAQKIASGEWPDDFVMHVNV
                     STEQLHDGNSYQRLQAALTESGLEPKNLSLEIIESRLLNNDAFIIELLNKVRALGVHI
                     AIDDFGTGYSSLSYLHTLPFDCLKIDRSFVKNLTRDNAETSIVNAIIHMAKGFNVSIV
                     VEGVETKEQAEILDSLGCDIAQGYLYSKPLPIEQWGELSHLIHRSQA"
     gene            complement(107132..108133)
                     /gene="add"
                     /locus_tag="VF_RS00460"
                     /old_locus_tag="VF0092"
                     /old_locus_tag="VF0093"
                     /old_locus_tag="VF_0093"
                     /db_xref="GeneID:54162720"
     CDS             complement(107132..108133)
                     /gene="add"
                     /locus_tag="VF_RS00460"
                     /old_locus_tag="VF0092"
                     /old_locus_tag="VF0093"
                     /old_locus_tag="VF_0093"
                     /EC_number="3.5.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_011260963.1"
                     /db_xref="GeneID:54162720"
                     /translation="MIIKQLPLTDLHRHLDGNIRIETILDLGQKFGLDLPAYDIEALR
                     PHVQIVEAEPSLVAFLSKLDWGVAVLGDLDACRRVAYENVQDAMNAQIDYAELRFSPY
                     YMAMKHNLPIAGVVEAVVDGVEAGCRDFGIKANLIGIMSRTFGQDACQQELDGLLTQK
                     HKLVAIDLAGDELGQPGDLFVNHFKQVKDADLRVTVHAGEAAGAASMWQAINELGAVR
                     IGHGVKAIEDPKLMEYLAKNNIGIESCLTSNIQTSTVASFESHPIKTFLDYGVKVCLN
                     TDDPAVEGIELPHEYEVAAPKVGLTPEQLKQIQINGLDLAFLSDSEKQALREMAAKR"
     gene            complement(108298..110856)
                     /locus_tag="VF_RS00465"
                     /old_locus_tag="VF0094"
                     /old_locus_tag="VF_0094"
                     /db_xref="GeneID:54162721"
     CDS             complement(108298..110856)
                     /locus_tag="VF_RS00465"
                     /old_locus_tag="VF0094"
                     /old_locus_tag="VF_0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_011260964.1"
                     /db_xref="GeneID:54162721"
                     /translation="MTEPTHKKQFSLRTAVMLPFIAVLLVTLSIVFYTQNNSYEKLVG
                     DVSEKVLASYTQNTHADLNIFLNAPNFAVKSMVNQIQRYQMYHPNDTKQLQQFLKDSL
                     EGIYTGLEQMDVLSFGGEKKEYIGFRREPNASLSLMLQDKRTNDDLIIYRGSEMSDNI
                     RTVIANYDPRSRPWYKPAATTFKPSWSKIYTNADEKKEITISTMHPVFYDEDFIGVFA
                     ADVKLDSFNKFLSQETKHTKGVIYLIDDQQRLIAHSSVGSVLSIGTQNSPVGSRLFAV
                     ESCDETIQQSATYIKNNQLINNKNNDAEVFSFYYKGERYFSQITPYIDGNNLNWYIVI
                     SISESDLLGHLQEEQRRGLFFGIVLAAIGLIVGVYLVTQVTKPIFTTANAARNIASGN
                     WNNNVEAQGSIYETTLLMNAFNDMTNKLQSSFDAMRQQITFDSLTQVLSRQGLIEQCR
                     IMLDKKEHYEQGLLVIGINNFRDINDSFGILEGDQLLKNISDRLQCSFAHDNIAIARV
                     GGDEFALFFSKLDDVEQLKQYARDMEGCFMTPFRVASNNSLLSISTGLVYGDLSCDSM
                     TLWLRNASIALGQAKKNNLNMSLYTPEMAEASLHKANMTAELSLAIKNKELVPFYQPI
                     IDIKSGKTIGAEALIRWLSPQRGMVSPLDFIPLAEENGMIIPMGSQVLTQACLDTVER
                     IDQGLWPADFHMHVNLSVCQLTQNNFLDELKAVLHNTSMAPENLTLEITESRLVNHDN
                     STINTMQKIRDLGVQIAIDDFGTGYSSLAYIHKLPFDVLKVDRSFIKDLTAENIDSSI
                     AAAVCNMTQGFDITLVAEGIETQEQAKLLASLNYHHAQGFLYSRPIPLEDWPTE"
     gene            complement(110973..112376)
                     /gene="glnG"
                     /locus_tag="VF_RS00470"
                     /old_locus_tag="VF0095"
                     /old_locus_tag="VF_0095"
                     /db_xref="GeneID:54162722"
     CDS             complement(110973..112376)
                     /gene="glnG"
                     /locus_tag="VF_RS00470"
                     /old_locus_tag="VF0095"
                     /old_locus_tag="VF_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_011260965.1"
                     /db_xref="GeneID:54162722"
                     /translation="MSKGFIWVVDDDSSIRWVLEKTLTSTNMMCESFGDAESVIQALE
                     RNVPDVIISDIRMPGMDGLSLLHHIQENYPELPVIIMTAHSDLDAAVSAYQKGAFEYL
                     PKPFDIDETLTLVERALAHSQEQKKQSINTPKKEHHVPEIIGEAPAMQEVFRAIGRLS
                     RSSISVLINGESGTGKELVAHALHRHSPRANNEFIALNMAAIPKDLIESELFGHEKGA
                     FTGANSVRKGRFEQANGGTLFLDEIGDMPLDIQTRLLRVLADGQFYRVGGHSPVQVDV
                     RIIAATHQNLEKLVTDGEFREDLFHRLNVIRVHIPALRERREDIKKLAEHFLRLAAKE
                     LAVECKTLSQSASDKLSQCDWPGNVRQLENTCRWLTVMASSQEVLPSDLPPELFSTPI
                     PQQQHQITDWQEQLSSWVENQLNKGEEDILNKVIPNVERILLDKALHHTHGHKQDAAK
                     LLGWGRNTLTRKLKELE"
     gene            complement(112415..113470)
                     /gene="glnL"
                     /locus_tag="VF_RS00475"
                     /old_locus_tag="VF0096"
                     /old_locus_tag="VF_0096"
                     /db_xref="GeneID:54162723"
     CDS             complement(112415..113470)
                     /gene="glnL"
                     /locus_tag="VF_RS00475"
                     /old_locus_tag="VF0096"
                     /old_locus_tag="VF_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="WP_041941289.1"
                     /db_xref="GeneID:54162723"
                     /translation="MALTMDFSTQLLEHQVTAILLLDDQRQIHYANPAAEQLFSQSAQ
                     RMAQHAFDDLFHSPQFDLSTLMLPLNTGQSVTDSDVRIMIDEQPLYIELTSSPVAINK
                     SLYLLVEIRQIEQQRRLSQEINQHAQQQAAKVLVRSLAHEIKNPLGGLRGAAQLLERM
                     LPERELHEYTQIIIEQADRLRNLVDRLLGPQKLGTKQPENLHAIIEKVRQLIELNSSY
                     QVKIIRDYDPSLPDFDVDAEQIEQAILNIVSNAAEVLKDQPDGTITLKTRTDFQTNIY
                     GQRHKLAAKIDIIDNGPGIPSHIQDTLFYPMVSAREGGTGLGLSISQNLIDQHNGKID
                     VSSWPGKTIFTIYLPLK"
     gene            complement(113550..114086)
                     /locus_tag="VF_RS00480"
                     /old_locus_tag="VF0097"
                     /old_locus_tag="VF_0097"
                     /db_xref="GeneID:54162724"
     CDS             complement(113550..114086)
                     /locus_tag="VF_RS00480"
                     /old_locus_tag="VF0097"
                     /old_locus_tag="VF_0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_011260967.1"
                     /db_xref="GeneID:54162724"
                     /translation="MSYKQLIFLILFSTSAFAGTVYTWEDSDGTRHFSDSPPPTNIKS
                     KQLSLSTSVPLEESYDDTATSVEPVAKKAKSKTPEKKDKKLEISFSNLQQEETIRSSR
                     GHITVLTDLNRKLSIDEKLQLMLDGSPYGLPQASTEWKLTGIDRGTHLITVVATKDGK
                     RIASSPIITVYLHRPSAN"
     gene            complement(114336..115745)
                     /gene="glnA"
                     /locus_tag="VF_RS00485"
                     /old_locus_tag="VF0098"
                     /old_locus_tag="VF_0098"
                     /db_xref="GeneID:54162725"
     CDS             complement(114336..115745)
                     /gene="glnA"
                     /locus_tag="VF_RS00485"
                     /old_locus_tag="VF0098"
                     /old_locus_tag="VF_0098"
                     /EC_number="6.3.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017789561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--ammonia ligase"
                     /protein_id="WP_011260968.1"
                     /db_xref="GeneID:54162725"
                     /translation="MSVENVLALIQENEVKFIDLRFTDTKGKEQHISIPSHQIDADFF
                     EEGKMFDGSSVAGWKGINESDMVMMPDPASAVLDPFTEDSTLNIRCDILEPATLQGYD
                     RDPRSIAKRSEEYMRSTGIADTVLIGPEPEFFLFDDVRFNTDMSGSFFKIDDIEAAWN
                     SGTEYEGGNKGHRPGVKGGYFPVAPVDSSQDIRSAMCLIMEEMGLVVEAHHHEVATAG
                     QNEIATRFNTLTTKADETQIYKYVVHNVAHAFGKTATFMPKPLVGDNGSGMHVHQSLA
                     KDGVNLFAGDKYGGLSELAIYYIGGIIKHARAINAFANPSTNSYKRLVPGFEAPVMLA
                     YSARNRSASIRIPVVPSPKARRIEVRFGDPAANPYLCYSAMLMAGLDGIKNKIHPGEA
                     MDKDLYDLPAEEAAEIPTVAESLDIALKALDEDREFLTAGGVFSDDFIDSYIGLKSQD
                     VEAINTAVHPLEFEMYYSV"
     gene            116283..118115
                     /gene="typA"
                     /locus_tag="VF_RS00490"
                     /old_locus_tag="VF0099"
                     /old_locus_tag="VF_0099"
                     /db_xref="GeneID:54162726"
     CDS             116283..118115
                     /gene="typA"
                     /locus_tag="VF_RS00490"
                     /old_locus_tag="VF0099"
                     /old_locus_tag="VF_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005596882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_005416970.1"
                     /db_xref="GeneID:54162726"
                     /translation="MSTPQIDKLRNIAIIAHVDHGKTTLVDKLLQQSGTLESRGETEE
                     RVMDSNDIEKERGITILAKNTAINWNDHRINIVDTPGHADFGGEVERIMSMVDSVLLI
                     VDAVDGPMPQTRFVTQKAFAHGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDE
                     QLDFQVVYASALNGWATLEEGETGENMEPLFQAIVDNVDAPNVDVDGALQMQVSQLDY
                     NSYVGVIGVARVTRGSVKPNQQVTVVSADGSKRNGKVGTVLGYLGLERHEVEQANAGD
                     IIAITGLGELKISDTICDVNNVEAMTPLSVDEPTVTMTFQVNTSPFAGKEGKFVTSRN
                     ILERLEKELVHNVALRVEQTEDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVI
                     IKKDENGNLTEPFETVTIDVLEEHQGGIMENIGIRKGELTDMAPDGKGRVRMDFMMPS
                     RGLIGFQTEFMTLTSGSGLLYHTFDHYGPHKGGTIGQRNNGVLISNATGKALTYALFN
                     LQERGRLFTEHADEVYEGQVIGIHNRSNDLTVNCLKGKQLTNVRASGTDDAQVLSPAI
                     KYTLEQALEFIDDDELVEVTPESIRIRKRHLTENDRKRAGRAPK"
     gene            118412..119344
                     /locus_tag="VF_RS00495"
                     /old_locus_tag="VF0100"
                     /old_locus_tag="VF_0100"
                     /db_xref="GeneID:54162727"
     CDS             118412..119344
                     /locus_tag="VF_RS00495"
                     /old_locus_tag="VF0100"
                     /old_locus_tag="VF_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor BrkB family protein"
                     /protein_id="WP_011260969.1"
                     /db_xref="GeneID:54162727"
                     /translation="MEDKIKHKLRIGWSYLLFLKQRVIHDRLTVSAGYMAYITLLSLV
                     PLITVLLSVLSQFPVFSGAGETVQAFVIQNFVPAASDAVEASLKEFISNTGKMTAVGS
                     GFLFVASVMLISSIDRSLNYIWRVKKKRRPMYSFSLYWMILTLGPLLVGASLAATSYV
                     TSLKIMDDEIVSSFYRTLLGWLPIILSFSAFVGLYLLVPNKKVRVTHALIGAMSAGCL
                     FEFSKVGFAQYITQFPSYQVIYGALAAVPILFVWVYLCWIIVLIGAEITASLGEFEGW
                     LTGKVSVNILESDIKALTEQQGLIESDSTDPESK"
     gene            119316..119750
                     /gene="dtd"
                     /locus_tag="VF_RS00500"
                     /old_locus_tag="VF0101"
                     /old_locus_tag="VF_0101"
                     /db_xref="GeneID:54162728"
     CDS             119316..119750
                     /gene="dtd"
                     /locus_tag="VF_RS00500"
                     /old_locus_tag="VF0101"
                     /old_locus_tag="VF_0101"
                     /EC_number="3.1.1.96"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016787707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="WP_011260970.1"
                     /db_xref="GeneID:54162728"
                     /translation="MIALIQRVSEAAVKVDGEVTGEINQGLLILLGVEREDDEAKAKR
                     LMERVLTYRVFEDQDGKMNLNVQQVNGSVLVVSQFTLPADTKKGTRPGFSKGAHPVDA
                     ERLYDYFSDLCEEKLHTQRGRFAADMKVSLVNDGPVTFWLQV"
     gene            120268..121167
                     /locus_tag="VF_RS00505"
                     /old_locus_tag="VF0102"
                     /old_locus_tag="VF_0102"
                     /db_xref="GeneID:54162729"
     CDS             120268..121167
                     /locus_tag="VF_RS00505"
                     /old_locus_tag="VF0102"
                     /old_locus_tag="VF_0102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YiiD C-terminal domain-containing protein"
                     /protein_id="WP_011260971.1"
                     /db_xref="GeneID:54162729"
                     /translation="MFRLITPTTEAELKAYYHFRWKILREPWRQPEGSERDAYDDMSQ
                     HRMILDGRDQPVAVGRLYLTPDNDGQIRYMAVAPHCRGKGIGALIMVALESYARQENA
                     KRLVCNAREDAIPFYVGNGFTSQGELSDERGPVRHQQMLKHLDPLADVLRRPDWCAEL
                     QKRWENEIPISDKMGIKITQYTGYRFEVSAILNANLNPHNSMFAGSIFTMGTLTAWGI
                     VWLLLKERGLDTTSIMLVDSHIRYRQPIVDNPKGITSLNCLEGDFDRLQSGKRARVKV
                     KVDLCNGDNPAAEFTGTFMLMRD"
     gene            complement(121501..122190)
                     /gene="trmH"
                     /locus_tag="VF_RS00510"
                     /old_locus_tag="VF0103"
                     /old_locus_tag="VF_0103"
                     /db_xref="GeneID:54162730"
     CDS             complement(121501..122190)
                     /gene="trmH"
                     /locus_tag="VF_RS00510"
                     /old_locus_tag="VF0103"
                     /old_locus_tag="VF_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005416984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(18)-2'-O)-methyltransferase
                     TrmH"
                     /protein_id="WP_011260972.1"
                     /db_xref="GeneID:54162730"
                     /translation="MNLERYQRITSVLKARQTDLTLCLEEVHKANNVSAIVRTADATG
                     IHKIHAVWPTEQMQMLGHTSAGARNWVDVETHKNIEDAFATLKEQGMQILATNLSDTA
                     VDFREIDYTKPTAIILGSEKTGISKKALAMADQDIIIPMVGMVQSLNVSVASALILYE
                     AQRQRDLAGMYDREESMLPKEYINKVLFERGHPVLAKVAKRKGLELPQLDETGQIVAD
                     EEWWARMQAAD"
     gene            complement(122442..124565)
                     /gene="spoT"
                     /locus_tag="VF_RS00515"
                     /old_locus_tag="VF0104"
                     /old_locus_tag="VF_0104"
                     /db_xref="GeneID:54162731"
     CDS             complement(122442..124565)
                     /gene="spoT"
                     /locus_tag="VF_RS00515"
                     /old_locus_tag="VF0104"
                     /old_locus_tag="VF_0104"
                     /EC_number="3.1.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005472457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional GTP
                     diphosphokinase/guanosine-3',5'-bis pyrophosphate
                     3'-pyrophosphohydrolase"
                     /protein_id="WP_011260973.1"
                     /db_xref="GeneID:54162731"
                     /translation="MDLFDSLKDVAKDYLPEPHIEALRRSYLVAKEAHEGQTRSSGEP
                     YIIHPVAVARILAEMKLDHKTLMAALLHDVIEDTAVSKEELAEQFGDTVAELVDGVSK
                     LDKLKFRDKKEAQAENFRKMVMAMVQDIRVILIKLADRTHNMRTLGALRPDKRRRIAR
                     ETLEIFSPLAHRLGIHNIKTELEELGFEALYPNRYRVLKEVVKSARGNRKEMIQKIHS
                     EIEGRIAEAGITGRVIGREKNLFAIYNKMKNKEQRFHTIMDIYAFRVITDNVDTCYRA
                     LGQVHSIYKPRPGRIKDYIAVPKANGYQSLHTSMVGPHGVPVEVQIRTEDMEQMANKG
                     VAAHWSYKEGDNSSTTAQIRAQRWMQSLLELQQSAGSSFEFIENVKSDLFPNEIYVFT
                     PKGRIFELPVGATAVDFAYAVHSDVGNSCVGSRVNRQPYPLSKPLKNGQTVEIISAPG
                     ARPNAAWLNYVVTSKARTKIRQVLKTMRREDSVVLGRRLLNHALGHNVSLDDISQENI
                     DHVLSDLKLAELDDLLAAIGLGELMSIVIARRLLGSADELTEQTSNIETTTGKKLPIR
                     GADGILLTFANCCRPIPGDHIIAHVSPGRGLVVHMEECANVRGYQKELDKYMGVEWAD
                     EFDQEFDTALDIDIQNHQGALADLANVIAGTGSNIRGISTEEKDGRLYTVTIELTVKD
                     RKHLAEIMRRIRVMPHALKVRRHKN"
     gene            complement(124616..124888)
                     /gene="rpoZ"
                     /locus_tag="VF_RS00520"
                     /old_locus_tag="VF0105"
                     /old_locus_tag="VF_0105"
                     /db_xref="GeneID:54162732"
     CDS             complement(124616..124888)
                     /gene="rpoZ"
                     /locus_tag="VF_RS00520"
                     /old_locus_tag="VF0105"
                     /old_locus_tag="VF_0105"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004735648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_005416998.1"
                     /db_xref="GeneID:54162732"
                     /translation="MARVTVQDAVEKIGNRFDLVLISSRRARQMQTGGKDALVPEEND
                     KTTVIALREIEEGLITKELLDARERQEQQEQDAAELAAVSSITHNR"
     gene            complement(124997..125620)
                     /gene="gmk"
                     /locus_tag="VF_RS00525"
                     /old_locus_tag="VF0106"
                     /old_locus_tag="VF_0106"
                     /db_xref="GeneID:54162733"
     CDS             complement(124997..125620)
                     /gene="gmk"
                     /locus_tag="VF_RS00525"
                     /old_locus_tag="VF0106"
                     /old_locus_tag="VF_0106"
                     /EC_number="2.7.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017062466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_011260974.1"
                     /db_xref="GeneID:54162733"
                     /translation="MSKGTLYIVSAPSGAGKSSLISALLESNPTYAMKVSVSHTTRGM
                     RPGETDGVHYHFIQKEHFEELIQKGEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLD
                     IDWQGARQIREQMPLAKSVFILPPSNGELERRLNARGQDSDAVIAKRMSEAKSEISHY
                     DEYDYVIINDDFDTAQMDFRSIIRAERLKQDKQTTKYKGMLEALLAD"
     gene            125849..126274
                     /locus_tag="VF_RS00530"
                     /old_locus_tag="VF0107"
                     /old_locus_tag="VF_0107"
                     /db_xref="GeneID:54162734"
     CDS             125849..126274
                     /locus_tag="VF_RS00530"
                     /old_locus_tag="VF0107"
                     /old_locus_tag="VF_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-starvation-inducible PsiE family
                     protein"
                     /protein_id="WP_005417001.1"
                     /db_xref="GeneID:54162734"
                     /translation="MPSHLPKSFSKPFLKVFHILEAILLVAITLATLFAMVNEFIHVF
                     VEQQIQLTDILLMFIYLEVLAMVQQFVMNGKIPVRYPIYIAMMAIARYITLGMKEIDA
                     TLVVWLALAAFILAAATLLIRVGHHYWPYEINENKHYDE"
     gene            126471..126851
                     /locus_tag="VF_RS00535"
                     /old_locus_tag="VF0108"
                     /old_locus_tag="VF_0108"
                     /db_xref="GeneID:54162735"
     CDS             126471..126851
                     /locus_tag="VF_RS00535"
                     /old_locus_tag="VF0108"
                     /old_locus_tag="VF_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260975.1"
                     /db_xref="GeneID:54162735"
                     /translation="MLIRKIATICILMATLLVLTLYSATSRAENLPTQFSDNHAVVEI
                     SHVDFCNLELGDIQSSAESGCCDPGGSCFEKQCCSHGHASSSSLVSNSLFVNITPYHF
                     VSAPMVSTTYLSADLGYLYRPPIS"
     gene            127083..128015
                     /locus_tag="VF_RS00540"
                     /old_locus_tag="VF0109"
                     /old_locus_tag="VF_0109"
                     /db_xref="GeneID:54162736"
     CDS             127083..128015
                     /locus_tag="VF_RS00540"
                     /old_locus_tag="VF0109"
                     /old_locus_tag="VF_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_011260976.1"
                     /db_xref="GeneID:54162736"
                     /translation="MNKKYLPALLFVSVCLIWGTTWLAMEFAVQTIPPIFATGLRFLI
                     ASPLLIMLAKLFKQSLFFPKGKRLWMLIVAMFYFAIPFTLMIFGEQYISSGLASIIFA
                     NMPIAVMFTSSLFLGLKLRKIQIGGLFIAVLSLILILTKEMSLGGEDYLLGFLALGGA
                     VLMHAIMYVLVEKFCERVPVLTYNALPNLIASLCLLVTSMFIEQPDVSTFSVDSIMAV
                     IYLGIFASVGGIVAYFKLGQVSSPFTASICFLFFPLIALSLSVWFAGNSISTTSVLLL
                     LPLLFGILITKLDASFWTKLFSLGMGERRKQKVS"
     gene            complement(128097..128960)
                     /locus_tag="VF_RS00545"
                     /old_locus_tag="VF0110"
                     /old_locus_tag="VF_0110"
                     /db_xref="GeneID:54162737"
     CDS             complement(128097..128960)
                     /locus_tag="VF_RS00545"
                     /old_locus_tag="VF0110"
                     /old_locus_tag="VF_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017048260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YicC family protein"
                     /protein_id="WP_011260977.1"
                     /db_xref="GeneID:54162737"
                     /translation="MIYSMTAYARREVKADWGNAVWEIRSVNQRYLETYFRMPEQFRG
                     LEPVLRERFRKRLARGKVECHLRFEANNAANSELKINEDLARQVIKAAQWVKTESGEG
                     SINPFQILQWQGVMEAPEQDFDAINKELLEHFELAVNDFIEARASEGANMQTLIVQRL
                     DAITEEAAKVRARMPEILEWQRNRLLTKFEDAKIELDSSRVEQELILLAQKSDVAEEI
                     DRLDSHVKEANSIMKKGGACGRKLDFMMQEFNREANTLASKSISTDITASGVELKVLI
                     EQMREQIQNIE"
     gene            129121..129837
                     /gene="rph"
                     /locus_tag="VF_RS00550"
                     /old_locus_tag="VF0111"
                     /old_locus_tag="VF_0111"
                     /db_xref="GeneID:54162738"
     CDS             129121..129837
                     /gene="rph"
                     /locus_tag="VF_RS00550"
                     /old_locus_tag="VF0111"
                     /old_locus_tag="VF_0111"
                     /EC_number="2.7.7.56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010433734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="WP_011260978.1"
                     /db_xref="GeneID:54162738"
                     /translation="MRPSGRTAQQVRPITLTRNFTAHAEGSVLVEFGNTKVICTASVE
                     ENVPRWLKGKGKGWVTAEYGMLPRATHTRNRREAASGKQGGRTMEIQRLIARSLRAAV
                     DLEALGEQMITVDCDVIQADGGTRTASITGASVALADAINHMIATGKLKSNPMKGHVA
                     AVSVGIYNGEAICDLEYVEDSAADTDMNVVMMEDGKMIEVQGTAEEAPFSHQELLDML
                     ALAQQGINDIIEKQKAALAE"
     gene            130086..130727
                     /gene="pyrE"
                     /locus_tag="VF_RS00555"
                     /old_locus_tag="VF0112"
                     /old_locus_tag="VF_0112"
                     /db_xref="GeneID:54162739"
     CDS             130086..130727
                     /gene="pyrE"
                     /locus_tag="VF_RS00555"
                     /old_locus_tag="VF0112"
                     /old_locus_tag="VF_0112"
                     /EC_number="2.4.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004735727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_005417014.1"
                     /db_xref="GeneID:54162739"
                     /translation="MKAYQREFIEFALEKEVLKFGEFTLKSGRKSPYFFNAGLFNTGR
                     DLARLGRFYAAALADSGIEYDVLFGPAYKGIPIATTTAVALADHHDTDKPYCFNRKEA
                     KDHGEGGNLVGSALEGRIMLVDDVITAGTAIRESMEIIQANGADLAGVLVAIDRQEKG
                     KGELSAIQEVERDFNCSIISIVSLTDLISFLEEKGDNAEQLEAVKAYRAEFGI"
     gene            complement(130754..131497)
                     /locus_tag="VF_RS00560"
                     /old_locus_tag="VF0113"
                     /old_locus_tag="VF_0113"
                     /db_xref="GeneID:54162740"
     CDS             complement(130754..131497)
                     /locus_tag="VF_RS00560"
                     /old_locus_tag="VF0113"
                     /old_locus_tag="VF_0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_005417016.1"
                     /db_xref="GeneID:54162740"
                     /translation="MLVGYKRAQCKKVLVINRKGGAGKSTFAIAMASFYAHQKVKTEI
                     IDLDPQGTSHFWGSKTEGVRTTRFLPSSNVPFSLALRLEADTKITVIDSPSNFSRFEM
                     EKYISMVDKIIFPVQPSPIDVHSMLGFIKDLINSPAFKHNNVELAFVITRCKENNQGT
                     EFVHKVLQHMKYPLLGTMSEHQAYQEMFSEKNCFLARYPELDKPLWKNMKEWLNVDMT
                     QTTNVEDEAQKKVADTTSTTYSSILKKHY"
     gene            131703..132422
                     /gene="ompR"
                     /locus_tag="VF_RS00565"
                     /old_locus_tag="VF0114"
                     /old_locus_tag="VF_0114"
                     /db_xref="GeneID:54162741"
     CDS             131703..132422
                     /gene="ompR"
                     /locus_tag="VF_RS00565"
                     /old_locus_tag="VF0114"
                     /old_locus_tag="VF_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018150685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator OmpR"
                     /protein_id="WP_005417018.1"
                     /db_xref="GeneID:54162741"
                     /translation="MQENHKILVVDDDARLRSLLERYLSEQGFQVRSVANSEQMDRLL
                     ARETFHLMVLDLMLPGEDGLSICRRLRSANNMLPILMLTAKGDEIDRIVGLEVGADDY
                     LPKPFNPRELLARIRAVLRRQVIEAPGAPSAEDKMIEFGEFRLNLGTREMFRNEEPMP
                     LTSGEFAVLKSLVTNMREPMSRDKLMNMARGREYSAMERSIDVQISRLRRMIEEDPSR
                     PRYIQTVWGLGYVFVPDGAEA"
     gene            132855..134159
                     /gene="envZ"
                     /locus_tag="VF_RS00570"
                     /old_locus_tag="VF0115"
                     /old_locus_tag="VF_0115"
                     /db_xref="GeneID:54162742"
     CDS             132855..134159
                     /gene="envZ"
                     /locus_tag="VF_RS00570"
                     /old_locus_tag="VF0115"
                     /old_locus_tag="VF_0115"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor histidine kinase
                     EnvZ"
                     /protein_id="WP_011260981.1"
                     /db_xref="GeneID:54162742"
                     /translation="MKSTFARTLLLLASLLIASQVFSYLAVFNYALLPSLQQFNRILA
                     YEVRLMLAEDVTLESGKNVHLGQPLRRQLLEQLGVSIHDENDPDMKEYYQASPVEFLS
                     EEMTQELGAPTEVRLILGADSYVLWMKSEAMPEFYMRIPLSELQEDDFAPLFRNSLFI
                     ALLVILGGWTFIKIQNRPLMALQTAARKVGKGEIPDPLPEKGASEIQAVTRAFNQMSK
                     GIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEECNEIIGQ
                     FMDYLKPVAKQDFTQVDVNTIVNEVILAEGGYEREIQTKLAMIPKAINGNAVAIKRVI
                     TNLVVNAIRYGGDWIQVSTSVSADHKTVWIIIEDNGPGVDNAQLETVFEPFTRGDTAR
                     GSEGTGLGLAIVKRIVTQHQGEVSLSNRSEGGLKVQVEFPLG"
     gene            complement(134406..135797)
                     /locus_tag="VF_RS00575"
                     /old_locus_tag="VF0116"
                     /old_locus_tag="VF_0116"
                     /db_xref="GeneID:54162743"
     CDS             complement(134406..135797)
                     /locus_tag="VF_RS00575"
                     /old_locus_tag="VF0116"
                     /old_locus_tag="VF_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-xanthine permease"
                     /protein_id="WP_005417021.1"
                     /db_xref="GeneID:54162743"
                     /translation="MTVKNSTTKPSELIYQLDDRPPLPHTLFAAFQHLLAMFVAIITP
                     SLIICQTLGVPAAETNTIISMSLFASGISSFIQIKTFGPIGSGLLSVQGTSFNFLGPI
                     IGAGLALKAGGADVPTMMAAIFGTILVASTAEIFLSRVLEYAQKIITPLVSGIVVTLI
                     GLTLIQVGLVSMGGGYSAMGEGTFGSLDKLALAGTVLLIIVVLNRATNPYLRMASIVI
                     AMTVGTLVAWAMGMLNTEMSHDAALIALPIPMQYGLGFDWSLFIPLVLIFLITALEAI
                     GDITATSEVSGQPVKGPVYMKRIKGGVLADGINSAIAAAFNSFPNSTFSQNNGVILLT
                     GVASRYVGYFIAGMLVLLGLFPGVASMVQIIPEPVLGGATIVMFGTIAAAGVRIISRV
                     ELDRRAILIMAMSFSMGLGLAQKPEILQFMPEMIKNIFSSGVTAGGVTAIILNIVLPY
                     AEVKEEAKQDVIA"
     gene            complement(136161..136880)
                     /locus_tag="VF_RS00580"
                     /old_locus_tag="VF0117"
                     /old_locus_tag="VF_0117"
                     /db_xref="GeneID:54162744"
     CDS             complement(136161..136880)
                     /locus_tag="VF_RS00580"
                     /old_locus_tag="VF0117"
                     /old_locus_tag="VF_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ComF family protein"
                     /protein_id="WP_011260982.1"
                     /db_xref="GeneID:54162744"
                     /translation="MGGLVFIRWIRRSIQKLGVSHCDFCSQAMPPSETIWCQACLDLI
                     KTVPRCQRCGLQTEHETDVCGECLLNPPQWDRLYCVSDYSEPLREYINKLKYAQQFWL
                     AQDLGVLLSKHIPEPAPLILPVPLHWKRFWWRSYNQSDHLGWTLEREFNLKSSTTHCN
                     NKILKRVKATRPQQGLSRSFRQTNLLGAFKITQPIKEKHVALVDDVVTTGATINLLCV
                     ELRKAGVERIDVYTVCRTGRS"
     gene            136909..137682
                     /gene="bioH"
                     /locus_tag="VF_RS00585"
                     /old_locus_tag="VF0118"
                     /old_locus_tag="VF_0118"
                     /db_xref="GeneID:54162745"
     CDS             136909..137682
                     /gene="bioH"
                     /locus_tag="VF_RS00585"
                     /old_locus_tag="VF0118"
                     /old_locus_tag="VF_0118"
                     /EC_number="3.1.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pimeloyl-ACP methyl ester esterase BioH"
                     /protein_id="WP_011260983.1"
                     /db_xref="GeneID:54162745"
                     /translation="MTTPLYWQTEGEGSDLVLIHGWGMNGAVWQTTSEKLSQHYRVHT
                     VDLSGYGHSAELGCADFDEMVKQVLAQAPKKAAWLGWSLGGLIATKAALTSPERVSQL
                     ITVASSPRFSAEKGWRGIKPLVLSQFTEQLKTDFTLTVERFMALQAMGSPNAKQDIKL
                     VKKAVFSRPMPDQQALATGLMILADIDLREAVSQLSMPVCRMYGRLDGLVPIKVAHDM
                     DELMPNSAKIVFEQASHAPFISHNDEFISELRTFLNQHA"
     gene            137709..138188
                     /locus_tag="VF_RS00590"
                     /old_locus_tag="VF0119"
                     /old_locus_tag="VF_0119"
                     /db_xref="GeneID:54162746"
     CDS             137709..138188
                     /locus_tag="VF_RS00590"
                     /old_locus_tag="VF0119"
                     /old_locus_tag="VF_0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417025.1"
                     /db_xref="GeneID:54162746"
                     /translation="MIFSPNSVSVPLIAPSVNLPTEQVARENRVKKPVAPTTKMSETT
                     SEKAIKGDDKQHKRDAWEPSDHPGYDVMEEKEEPKPHFATLYDIDDDLAKLARLLSLD
                     TYAQGEGTGYTIRFNLPKNLLDKLEEMGRMVRRRSVISFHYDKAVVPNNPSDILAVL"
     gene            complement(138384..140699)
                     /locus_tag="VF_RS00595"
                     /old_locus_tag="VF0120"
                     /old_locus_tag="VF_0120"
                     /db_xref="GeneID:54162747"
     CDS             complement(138384..140699)
                     /locus_tag="VF_RS00595"
                     /old_locus_tag="VF0120"
                     /old_locus_tag="VF_0120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding transcriptional accessory protein"
                     /protein_id="WP_011260984.1"
                     /db_xref="GeneID:54162747"
                     /translation="MIINIIAKELNVRPQQVSAAVQLIDEGSTIPFIARYRKEVTDGL
                     DDTQLRTLDTRLTYLRELDDRRQSILKSIKEQDKLTPELEREILDADSKTRLEDLYLP
                     FKRKRRTKGQIAIEAGIEPLADLLWTQPENTPEDAAQSYIDEEKGFADTKAVLDGARA
                     ILMERMAEDANLLEKVRTYLTANAELVSKMVDGQEQAGEKFKDYFDHHEALTKVPSHR
                     ALAMLRGRNEGFLQLSINADPTQEEGARGSYCEIIIANHYGITLGSQPADLWRKQVIS
                     WTWRIKILMHMETELMGGLKERSENEAIDVFATNLKDLLMAAPAGLKTTLGLDPGLRT
                     GTKVAVVDATGKVLATDTIYPNQPHNQIAKSAQIIEALIKQHNVDLIAIGNGTASRET
                     DAFVGNLLKDAGLSTAKIIVSEAGASVYSASELAAKEFPDLDVSIRGAVSIARRLQDP
                     LAELVKIDPKAIGVGQYQHDVSQSQLAKKLDAVIEDCVNAVGVDVNTASPALLTRVAG
                     LSATIAQNIVDYRDENGRFENRTTLKKVARLGPKAFEQCAGFLRVMNGKNPLDASAVH
                     PEAYPVVKTIAEKNGKAIDAIIGNTEFLRSVAANDYISADFGLPTVTDIIKELDKPGR
                     DPRPEFKTATFADGVNTVSDLELGMVLEGVVSNVANFGAFVDIGVHQDGLVHISALSD
                     TFVSDPREVVKAGDIVKVKVMEVDVQRKRIALSMRLNDKPGEDNRPQRQSNKPQQRNE
                     RSQAPRQQRNNDVGGGAMGGAFAAAFAKAKK"
     gene            complement(140927..141400)
                     /gene="greB"
                     /locus_tag="VF_RS00600"
                     /old_locus_tag="VF0121"
                     /old_locus_tag="VF_0121"
                     /db_xref="GeneID:54162748"
     CDS             complement(140927..141400)
                     /gene="greB"
                     /locus_tag="VF_RS00600"
                     /old_locus_tag="VF0121"
                     /old_locus_tag="VF_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005448472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreB"
                     /protein_id="WP_011260985.1"
                     /db_xref="GeneID:54162748"
                     /translation="MKTNLITREGFNKLQDELTFLWKEERPEVTKKVTWAASLGDRSE
                     NADYQYNKKRLREIDRRVRYLRKRLDQVKVVDYSPQQDGKIFFGAFVEIENEQGDTLS
                     FRIVGPDEIFGRNDYISIDSPMARALIKKEVDEDVIVKTPDGDKEWFVNSIRYQV"
     gene            complement(141419..142357)
                     /locus_tag="VF_RS00605"
                     /old_locus_tag="VF0122"
                     /old_locus_tag="VF_0122"
                     /db_xref="GeneID:54162749"
     CDS             complement(141419..142357)
                     /locus_tag="VF_RS00605"
                     /old_locus_tag="VF0122"
                     /old_locus_tag="VF_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LpxL/LpxP family Kdo(2)-lipid IV(A)
                     lauroyl/palmitoleoyl acyltransferasee"
                     /protein_id="WP_011260986.1"
                     /db_xref="GeneID:54162749"
                     /translation="MSKYPAPKFSSALLHPKYWGVWFGFGFLFAIVTLLPYKVTYKLG
                     RSLGLLGLKLGKSRAHVARRNLELAFPEMESSEREAIIVENFKNSGLAIFETAMAWVW
                     PDWRVEKHFSYENKQHILDLAEEGRGVLVVCVHALNLELTARAFTSFAPGYGVYRPHN
                     NPAYDFIQHWGRTNNGNQMIDRKDVKGMLRVLRKGERLWYMPDHDYNRNKSVFVPFFA
                     VPDACTTVGSDILISASKCAVVTASGFRTYNNYHLQIDNDISDQFPKKDPVGVATVMN
                     KAVERVILRCIPQWMWLHKRFKTMEDPNVKKGIRYD"
     gene            complement(142382..142972)
                     /gene="slmA"
                     /locus_tag="VF_RS00610"
                     /old_locus_tag="VF0123"
                     /old_locus_tag="VF0124"
                     /old_locus_tag="VF_0124"
                     /db_xref="GeneID:54162750"
     CDS             complement(142382..142972)
                     /gene="slmA"
                     /locus_tag="VF_RS00610"
                     /old_locus_tag="VF0123"
                     /old_locus_tag="VF0124"
                     /old_locus_tag="VF_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion factor SlmA"
                     /protein_id="WP_005417043.1"
                     /db_xref="GeneID:54162750"
                     /translation="MATPRKPNRRDEILQALAEMLESNEGAARITTAKLAKQVGVSEA
                     ALYRHFPSKAKMFEGLIEFIEESIFSRVNRILEDEKDTLKRIELLLKLLLAFAERNPG
                     LTRIMTGHALMFENERLRSRINQIFERIELQFKQILRERKLREGKAFPIDESILAAQL
                     VGQVEGSFCRFVRSDFKYQPTENFNEYWALLSAQIQ"
     gene            complement(143127..144356)
                     /gene="coaBC"
                     /locus_tag="VF_RS00615"
                     /old_locus_tag="VF0125"
                     /old_locus_tag="VF_0125"
                     /db_xref="GeneID:54162751"
     CDS             complement(143127..144356)
                     /gene="coaBC"
                     /locus_tag="VF_RS00615"
                     /old_locus_tag="VF0125"
                     /old_locus_tag="VF_0125"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase CoaBC"
                     /protein_id="WP_011260987.1"
                     /db_xref="GeneID:54162751"
                     /translation="MASLAGKRILLGISGGIAAYKCAELTRRLIERGAEVRVVMTKAA
                     KEFITPLTMQAVSGHPVADSLLDPAAEASMGHIELAKWADIVLLAPATADLIARMAAG
                     MGNDLLSTLVLATDSPVAVSPAMNQQMYSNIATQENIATLARRGMHIWGPAAGQQACG
                     DVGMGRMLEPMELVHLCEDFFQANSCEQAEADEKPLKGQSLLITAGPTREAIDPVRYI
                     SNHSSGKMGFAIAEAAAQLGANVTLVSGPVNLATPENVKRIDIESAEQMHGAVMKNAQ
                     SHSIFIACAAVADFKLSQVATQKLKKTADEDGMTLHMVKNPDIVASVAALTNQRPFTV
                     GFAAETQDVEKYARGKLERKNLDMICANDVSVQGQGFNSDNNALHLYWKEGDKALPLT
                     TKSELGKAIMLEIVEKL"
     gene            144577..145251
                     /gene="radC"
                     /locus_tag="VF_RS00620"
                     /old_locus_tag="VF0126"
                     /old_locus_tag="VF_0126"
                     /db_xref="GeneID:54162752"
     CDS             144577..145251
                     /gene="radC"
                     /locus_tag="VF_RS00620"
                     /old_locus_tag="VF0126"
                     /old_locus_tag="VF_0126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_011260988.1"
                     /db_xref="GeneID:54162752"
                     /translation="MSLMNLPEESRPREKLLALGPKSLTDAELLAIFLRTGTQGMNAI
                     ELADKLLKEFGSLRKLLSSDENEFCSHKGLGTAKFAQLQAVVEMTERYLFEKIEKEDA
                     LTSPEHTKRYLTRMLRDRHREAFYVLFLDNQHRVLKGEILFEGTIDVAAVYPREVVKR
                     SIDYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLDHFVIGDGEIVSF
                     AERGWI"
     gene            145447..145683
                     /gene="rpmB"
                     /locus_tag="VF_RS00625"
                     /old_locus_tag="VF0127"
                     /old_locus_tag="VF_0127"
                     /db_xref="GeneID:54162753"
     CDS             145447..145683
                     /gene="rpmB"
                     /locus_tag="VF_RS00625"
                     /old_locus_tag="VF0127"
                     /old_locus_tag="VF_0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006881432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_005417050.1"
                     /db_xref="GeneID:54162753"
                     /translation="MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEK
                     RFVKLRLTAKGMRIIDKKGIETVLADMRARGENV"
     gene            145698..145865
                     /gene="rpmG"
                     /locus_tag="VF_RS00630"
                     /old_locus_tag="VF0128"
                     /old_locus_tag="VF_0128"
                     /db_xref="GeneID:54162754"
     CDS             145698..145865
                     /gene="rpmG"
                     /locus_tag="VF_RS00630"
                     /old_locus_tag="VF0128"
                     /old_locus_tag="VF_0128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001051801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_005417052.1"
                     /db_xref="GeneID:54162754"
                     /translation="MAKGAREKIKLVSTANTGHFYTTDKNKRNMPGKMEIKKYDPVVR
                     QHVLYKEAKIK"
     gene            146326..146781
                     /locus_tag="VF_RS00635"
                     /old_locus_tag="VF0129"
                     /old_locus_tag="VF_0129"
                     /db_xref="GeneID:54162755"
     CDS             146326..146781
                     /locus_tag="VF_RS00635"
                     /old_locus_tag="VF0129"
                     /old_locus_tag="VF_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011260989.1"
                     /db_xref="GeneID:54162755"
                     /translation="MKKPSRRKYNNMLIIFVLLFIAVLQAPQLIKTYLIEPKENIEVV
                     EGIKPLFEGENAIQKMHFSEYDLSANTSEQESQLIERWFTLEGTLLNDDSVKALKEKL
                     PAPSSVEVWLEDQEEPQRITIYQAPSFWMMQNWQGEWIAVSAEEGYLFR"
     gene            147021..147839
                     /gene="mutM"
                     /locus_tag="VF_RS00640"
                     /old_locus_tag="VF0130"
                     /old_locus_tag="VF_0130"
                     /db_xref="GeneID:54162756"
     CDS             147021..147839
                     /gene="mutM"
                     /locus_tag="VF_RS00640"
                     /old_locus_tag="VF0130"
                     /old_locus_tag="VF_0130"
                     /EC_number="3.2.2.23"
                     /EC_number="4.2.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional DNA-formamidopyrimidine
                     glycosylase/DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="WP_011260990.1"
                     /db_xref="GeneID:54162756"
                     /translation="MPELPEVETSRLGITPHLQGQTIKAIVVRTDKLRWPIPQELQKL
                     VGQRVQSIRRRAKYLMIDTPKGSAIIHLGMSGSLRVLDEEVPSAKHDHVDLVLENGKV
                     LRYNDPRKFGAWLYSEVGVAHQVLSKLGPEPLTNEFNSEYFAEKAKNKKTVVKQFIMN
                     NAVVVGVGNIYASESLFMAQIHPKTSVGSLKASQITLLVAEIKKVLETAIKQGGTTLK
                     DFNQVDGKPGYFAQELHVYGRAKKKCLLCSSIIQEEKIGQRNTFWCGHCQPFNK"
     gene            147864..149843
                     /locus_tag="VF_RS00645"
                     /old_locus_tag="VF0131"
                     /old_locus_tag="VF_0131"
                     /db_xref="GeneID:54162757"
     CDS             147864..149843
                     /locus_tag="VF_RS00645"
                     /old_locus_tag="VF0131"
                     /old_locus_tag="VF_0131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase family protein"
                     /protein_id="WP_011260991.1"
                     /db_xref="GeneID:54162757"
                     /translation="MNFQQNYKQLSRAIWLSVFIAVIILSVGRLVFLANIVDTAELAQ
                     REGDLWRALFTGFRFDLKVVVIGFAPLLLIGLSVAAFPKMYRIFSKVFPWYSGLIFFL
                     VTGFSIGNYYYYLTYGSYIDVFIFGLADDDTKAVLANAWADYPIFLSFISSLIVACCC
                     AAFIRTIIKKMQQWEWKTPHKITTSVSVFMMILTVFFFARGTLGSHPLKRYHAQVSDY
                     KVLNSITPNGIIALEWANSDYKKQNKFHTVSKAELEDQFTKVVGNTTGEFTTSKNTYL
                     ANNKPHVVMALMEGMGTNVLVEDDYPQNDLLGALRPAFESDFVFKRFLAETPATINSL
                     VNMLGQSNVPTISHSSAQKVEVAAAAARPYKNAGYKTLFITATNGMWRNVANYLPAQG
                     FDEILDENAILKAFPEAEAFRGEWGLSDEYAFKLAEKELNEATQPLMIYILTITNHTP
                     YEVPKNYDVKPLKVSKQLVERMQKGEEEAMRLLETYQYANNALGEFIANVKQSPLGDS
                     TLIAAAGDHKLRGFTMKYPDDIAIMNAVPFYLYVPEKIQQYVPYLYDEKRVGSHKDIF
                     PTLYAFSLSEAAYYSLGGENMLSTTDTSRFGYNPEMTVVEQGMYLNSQPEKLYQWRSE
                     LETSLEPTSNDKPNVDKDYHTLQTLYINGQVKGVH"
     gene            complement(149887..150375)
                     /gene="coaD"
                     /locus_tag="VF_RS00650"
                     /old_locus_tag="VF0132"
                     /old_locus_tag="VF_0132"
                     /db_xref="GeneID:54162758"
     CDS             complement(149887..150375)
                     /gene="coaD"
                     /locus_tag="VF_RS00650"
                     /old_locus_tag="VF0132"
                     /old_locus_tag="VF_0132"
                     /EC_number="2.7.7.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011260992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="WP_011260992.1"
                     /db_xref="GeneID:54162758"
                     /translation="MTKLTLYPGTFDPITNGHLDLIKRSASMFDHIIVAVAASPSKKT
                     LFTLDERVQLVQAVTKDLPNVYVEGFSGLMVDFAKEKKANLLVRGLRTTMDFEYEFGL
                     TSMYRKLMPELESVFLTPSEEYAFLSSTIVREVALHGGSVEAFVPSSVNQALKNKVAS
                     SL"
     gene            complement(150368..151396)
                     /locus_tag="VF_RS00655"
                     /old_locus_tag="VF0133"
                     /old_locus_tag="VF_0133"
                     /db_xref="GeneID:54162759"
     CDS             complement(150368..151396)
                     /locus_tag="VF_RS00655"
                     /old_locus_tag="VF0133"
                     /old_locus_tag="VF_0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009707936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_011260993.1"
                     /db_xref="GeneID:54162759"
                     /translation="MKIYHINLARGFSGGEQQTLALIKQHQKQQQEIAVIALANSPFH
                     QAVSDLGCEVITVRHYLLGHTISLPKDAVLHVHEGHAIYWAAIQHKVSQTPYIITRRL
                     DNPIKKKWLTTFAYSNAAAIVGISTCVSEVVRTRLPQQHIVTIPDSPVIYPVNHSEVA
                     NIRERFKDKFLVIQAGNMIPHKGFDVTVNAAMRLKDPNVHLCLLGDGKQRSELEEQAS
                     GLANISFMGRQHNMGDWFAAADLLIHPSYTEGLGSVILEGMNAGLPAIGSHAGGIPDI
                     IEHDKSGLLIEPGNSVELAENIEKIANDATLKERLIEGGREKLTSFMIEHTAALYFKV
                     YQRALQHD"
     gene            complement(151399..152184)
                     /locus_tag="VF_RS00660"
                     /old_locus_tag="VF0134"
                     /old_locus_tag="VF_0134"
                     /db_xref="GeneID:54162760"
     CDS             complement(151399..152184)
                     /locus_tag="VF_RS00660"
                     /old_locus_tag="VF0134"
                     /old_locus_tag="VF_0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_011260994.1"
                     /db_xref="GeneID:54162760"
                     /translation="MTHSSTPTLAVALIVKNEAKHLQACLETVQGWVDEIVILDSGST
                     DETESIARQFTDRFFVNTEWPGFGKQRQLAQQYVTADYVLWLDADERVTPELKEDILT
                     AVKANKPNVAYKINRLSSAFGKFIKHSGWSPDWVVRLYKVNDMAYNDALVHESVSVPD
                     GVQVAPLSGRLLHFTYDVLHQYNAKNVMYIKSWVDQREGKKKGSLSGAFFHGFFCFIR
                     MYILKRGFLDGRHGLLLAMLSASVTFNRYADLWLRDYNKSNKE"
     gene            complement(152194..153237)
                     /locus_tag="VF_RS00665"
                     /old_locus_tag="VF0135"
                     /old_locus_tag="VF_0135"
                     /db_xref="GeneID:54162761"
     CDS             complement(152194..153237)
                     /locus_tag="VF_RS00665"
                     /old_locus_tag="VF0135"
                     /old_locus_tag="VF_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 9 protein"
                     /protein_id="WP_011260995.1"
                     /db_xref="GeneID:54162761"
                     /translation="MPLFTSAPHSLCILRLSAIGDVCHAIAAVQTIQTTWPSTKITWI
                     VGKVEAQLIHDLPGITVIPFDKKLGLAGMRTIWHQLKDQQFDALVHMQLALRASLLTV
                     GIKAKYKVGFNRKRAKEGQWLFTNRKIEDTASAHVLDSFYAFIEYLGVPKREPSWNIP
                     LSEVDLAFIDTHVSSEKPYVVISPAASKDERNWLTERYAQLADWLNEQGYQVVLCGSP
                     SEREKQLGAAIESLAQSPLINIIGLTSLKQLTAVLKKATVVIAPDSGPAHIATTQHTP
                     VIGLYGHSNPKRTGPYNSLPYVVSVYEHHVTQQQNKPIEDLKWSTRVKGDHIMQDITL
                     DMVKEAFLRLRHQ"
     gene            153432..154136
                     /locus_tag="VF_RS00670"
                     /old_locus_tag="VF0136"
                     /old_locus_tag="VF_0136"
                     /db_xref="GeneID:54162762"
     CDS             153432..154136
                     /locus_tag="VF_RS00670"
                     /old_locus_tag="VF0136"
                     /old_locus_tag="VF_0136"
                     /EC_number="2.7.1.166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004742892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid kinase"
                     /protein_id="WP_011260996.1"
                     /db_xref="GeneID:54162762"
                     /translation="MKIIRNKKQTIWYDDSILNDSPEQCCNPNYWQQQNRIIGSAQGR
                     GTTWFIALEKMDAALRHYRRGGLFGKLIKDHYLFTSWEATRSHQEFQLLKVLRSASVN
                     VPKPIAARATKRTFCYQADLLSEKIPNARDLVAILQEKPLSEEMYQKIGNEIRKMHAV
                     QVNHTDLNIHNILIDDNDKVWIIDFDKCYQQKGDDWKQSNWDRLQRSFKKEVNKRQIH
                     WSENEWSHLLSDHHTM"
     gene            154173..156020
                     /locus_tag="VF_RS00675"
                     /old_locus_tag="VF0137"
                     /old_locus_tag="VF_0137"
                     /db_xref="GeneID:54162763"
     CDS             154173..156020
                     /locus_tag="VF_RS00675"
                     /old_locus_tag="VF0137"
                     /old_locus_tag="VF_0137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011787479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3413 domain-containing protein"
                     /protein_id="WP_162200302.1"
                     /db_xref="GeneID:54162763"
                     /translation="MNTLTLKQKLHSHGWLILINSLIAMAIASRYFAFLPEIPTDVLG
                     LSFLISGTFSQMVLLSGLIGLVALPAIFISNAKMRNATQAIIASLGIATLFIDTMVFA
                     QYRFHINAVVLELVFSGQVVSFPLITWFTVIGGVLALVMGQYLLIAWLEKPAVMTQHK
                     LGRKFALFTFFALLATHGIHIWAAANAYQPVTMVKRYLPVFYPATSTSMMKKYGWINE
                     EAIAQQKAMKLNRKSDLNYPLQPLQKEVVEKPINIMILAIDSWRADTFNAENTPNLWK
                     YAQEGMIFNNHIATGNATRTGIFGLFYGIPGTYWHGFLANQKTPLLIDRLQELNYDMG
                     IFTAAQLEKPEFNQTVFKNIPNLRIKSEGNSPSELDKDLTKDWLEWYSHRDTSKPAFS
                     FLFYDAPHGYDFPKDYAHRYEPMLDNINYLELNNDSDPTLFFNRYKTSVHFVDSVAKQ
                     VLDKLKETGDLENTLVIITGDHGQEMNDNRLNFWGHNGNFTNAQVNVPFAIFGPKINR
                     KTVEWGTNELTSHQDVVPTLMKNYLGVISDIKDYSVGEDLLGKPVARDWIMSSNYSGY
                     AIIDNDSILEVHATGQYELLDKTNRPLKDGKLNYQHLQEALEQISRFNK"
     gene            complement(156188..157444)
                     /locus_tag="VF_RS00680"
                     /old_locus_tag="VF0138"
                     /old_locus_tag="VF_0138"
                     /db_xref="GeneID:54162764"
     CDS             complement(156188..157444)
                     /locus_tag="VF_RS00680"
                     /old_locus_tag="VF0138"
                     /old_locus_tag="VF_0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_011260998.1"
                     /db_xref="GeneID:54162764"
                     /translation="MIRLIYSLFLALLSPLLLYSLYKKKDGKPAFGRRWKEHFGCTPS
                     LNTTQAPVWIHAVSVGEAIAAAPIIKTLKKQTPEQPILVTTTTSTGAEQIEKLGDLVE
                     HRYMPIDFCFAVRGFLKATKPEKMLIMETELWPNTLHTVAKFGIPISVLNARLSEKSF
                     LGYKKVQPIFNLLGKHLTHVCCQYKDDADRFVALGIQPEKVHVTGSVKFDIEITEQIQ
                     ASGGILRKQLGEDRPIWIATSTHKGEDEQVLAAHRSLLHKIPNALLILVPRHPERFNS
                     VFELCQSADFKTVKRTSNQTLTPNCQIYLGDTMGEMLTLIGASDICFMGGSLLGNKVG
                     GHNLLEPAALAKPSITGPSYYNFLEIAETLIKEDATKVIISAEELANLLEQLMTQPEY
                     AEKMGKNAQSFISKNSGAVIKTLNIV"
     gene            complement(157441..158466)
                     /gene="waaF"
                     /locus_tag="VF_RS00685"
                     /old_locus_tag="VF0139"
                     /old_locus_tag="VF_0139"
                     /db_xref="GeneID:54162765"
     CDS             complement(157441..158466)
                     /gene="waaF"
                     /locus_tag="VF_RS00685"
                     /old_locus_tag="VF0139"
                     /old_locus_tag="VF_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase II"
                     /protein_id="WP_011260999.1"
                     /db_xref="GeneID:54162765"
                     /translation="MKILIIGPSWVGDMVMSQSLYITLKQQHPKAIIDVMAPAWCKPI
                     LDRMPEVNQAIEMPLGHGDFNLLGRRALGKELKNNNYTHAYICPNSAKSALIPWFAGV
                     PVRTGWKGEMRYGLLNDLRPNKKAFQYMVERYVALAHPKSEMIDSSSLGGLENLPRPA
                     LSIDAKVQKNTLEKFSLSLDKPILGLCPGAEFGPAKQWPVEHYAAVANEMINRGHQVW
                     LFGSAKDKETTESIKALVDADNQAAVFNLAGDTSLIEAVDLLAACKTVVSNDSGLMHV
                     AAAVGCHVVGVYGSTSPKYTPPLAEKVDIVSTDIECRPCFKRDCPLGHLKCLKELKPI
                     LVLNKLL"
     gene            158549..159739
                     /locus_tag="VF_RS00690"
                     /old_locus_tag="VF0140"
                     /old_locus_tag="VF_0140"
                     /db_xref="GeneID:54162766"
     CDS             158549..159739
                     /locus_tag="VF_RS00690"
                     /old_locus_tag="VF0140"
                     /old_locus_tag="VF_0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013572542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase"
                     /protein_id="WP_011261000.1"
                     /db_xref="GeneID:54162766"
                     /translation="MNSILSLIGRDTELFHQDINANEKELQSVVSQSRFLVLGGAGSI
                     GQAVTKEIFKRNPQKLHVVDISENNMVELVRDIRSSFGYINGDFQTFALDIGSIEYDA
                     FIKADGQYDYVLNLSALKHVRSEKDPFTLMRMIDVNVFNTDKTIQQSIDAGAKKYFCV
                     STDKAANPVNMMGASKRIMEMFLMRKSEEIAISTARFANVAFSDGSLLHGFNQRIQKN
                     QPIVAPNDIKRYFVTPQESGELCLMSCIFGENRDIFFPKLSEALHLISFADIAVKYLK
                     QLGYEPHLCESEDEARELAKTLPAQGKWPCLFTSSDTTGEKDFEEFFTDKETLDMARF
                     DNLGIIKNDSLYQQELLELFEQKIGQMKTDRQWTKEEIVQLFFIMIPDFGHKETGKYL
                     DSKM"
     gene            159763..160908
                     /locus_tag="VF_RS00695"
                     /old_locus_tag="VF0141"
                     /old_locus_tag="VF_0141"
                     /db_xref="GeneID:54162767"
     CDS             159763..160908
                     /locus_tag="VF_RS00695"
                     /old_locus_tag="VF0141"
                     /old_locus_tag="VF_0141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006232904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LegC family aminotransferase"
                     /protein_id="WP_011261001.1"
                     /db_xref="GeneID:54162767"
                     /translation="MSKTPLVEFVRNIYQTNDFIPLHAPTFDGNEQKYVLETIQSTFV
                     SSVGKFVDEFEQKIETYTGTAKAVATVNGTAALHAALYMAGVQHGDFVITQALTFVAT
                     CNALHHMGAEPIFVDVSPVSLGLCPKAMDEYLTQHAQVTDTGCVHKQTKRPIRAAVPM
                     HTFGHPVELDELIAVCHKWNITLVEDAAESLGSFYKGKHTGTLGDFGAVSFNGNKIIT
                     TGGGGMVLCKSAELGARTKHVTTTAKVPHPYEFYHDEAGFNYRMPNLNAALGCAQMEI
                     LETYLAQKKALANHYQEFFAESDFQFVVEPEYAQSNYWLNAVICPSAQARDDLLKQTN
                     ESGVMTRPIWQLMHRLPMFKDAPRGDLTQSEHIEAHLINLPSTPIAL"
     gene            160943..162127
                     /gene="neuC"
                     /locus_tag="VF_RS00700"
                     /old_locus_tag="VF0142"
                     /old_locus_tag="VF_0142"
                     /db_xref="GeneID:54162768"
     CDS             160943..162127
                     /gene="neuC"
                     /locus_tag="VF_RS00700"
                     /old_locus_tag="VF0142"
                     /old_locus_tag="VF_0142"
                     /EC_number="3.2.1.183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase
                     (hydrolyzing)"
                     /protein_id="WP_011261002.1"
                     /db_xref="GeneID:54162768"
                     /translation="MSKSLINKKVAVFTGTRAEYGLLFWLLKDIQNDPELQLQLLVSG
                     MHLSPEFGETYQQIEADGFVINEKIEILLSSDSSVGTAKSMGLGVLGFADSLARLQPD
                     VLVILGDRFEALAAAQTAMIMRIPIVHLHGGEITEGAYDDAIRHAITKLSYLHGTSTE
                     EYRQRVIQLGEDPNRVQNVGAIGLDHLKRATFMTVPELSESLGFTLDKPFFLVTYHPV
                     TLGNEVPEESFQALLNALDEYPDHQVILTYPNADDGGRRIIPILEEYARNNSARVLAI
                     PSLGQVRYLSSVMHATAVIGNSSSGIIEVPAFDVPTVNIGSRQKGRLAAKSVLNVEPN
                     QQSISNGIQTAILRTYKLIDEKVHNPYGQGDTSGQVIEMIKSLQFTPSKAFYDITFNY
                     VE"
     gene            162135..163208
                     /gene="neuB"
                     /locus_tag="VF_RS00705"
                     /old_locus_tag="VF0143"
                     /old_locus_tag="VF_0143"
                     /db_xref="GeneID:54162769"
     CDS             162135..163208
                     /gene="neuB"
                     /locus_tag="VF_RS00705"
                     /old_locus_tag="VF0143"
                     /old_locus_tag="VF_0143"
                     /EC_number="2.5.1.56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006029900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate synthase"
                     /protein_id="WP_011261003.1"
                     /db_xref="GeneID:54162769"
                     /translation="MTLIIAEAGVNHNGDEHLAFQLVDAAYHAGADIVKFQTFKAKNL
                     VTEDAAQAEYQVTNTQKQESQLAMLSRLELSYEVHHQLVKHCESLGIEFLSTAFDSES
                     LDFLVNDLGLTRLKIPSGEITNAPLVLEHARTGCDLIVSTGMATLSEIEAVLGVIAFG
                     YVADKTAEPSELAFQQAYASEQGQKALKQKVTILHCTTEYPAPMPEINLKAMDTLGRA
                     FELPAGYSDHSEGITIPIAAVARGAVLVEKHFTLDKNMEGPDHKASLEPQELMAMITA
                     IRQVEVALGVGVKSPTVSEVKNKAVARKSLVVAKAIQQGEIITEDNLTIKRPGSGMSP
                     YHYWSLLNKPASKAYQAGDLIFE"
     gene            163201..163845
                     /locus_tag="VF_RS00710"
                     /old_locus_tag="VF0144"
                     /old_locus_tag="VF_0144"
                     /db_xref="GeneID:54162770"
     CDS             163201..163845
                     /locus_tag="VF_RS00710"
                     /old_locus_tag="VF0144"
                     /old_locus_tag="VF_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_011261004.1"
                     /db_xref="GeneID:54162770"
                     /translation="MNSSESKSLVVIGGGGHASVLVDILRSQQREILAIVSPENISQR
                     RIFSGITHLKNDDDILRFSPDSVNLVNGVGMLPKSGLKRKLNEYFLSLGYTFETVISD
                     SAQVSSFAEIEQGAQVFSGAIIQAGVVIDAHTIINSGVIIEHDCHIGEYNHIAPKATL
                     CGQVTTHSNVYVGANATVIQNITLEQGSIVGAGAIVTKNISSEQICYPSRSVLK"
     gene            163861..164919
                     /locus_tag="VF_RS00715"
                     /old_locus_tag="VF0145"
                     /old_locus_tag="VF_0145"
                     /db_xref="GeneID:54162771"
     CDS             163861..164919
                     /locus_tag="VF_RS00715"
                     /old_locus_tag="VF0145"
                     /old_locus_tag="VF_0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017094118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_011261005.1"
                     /db_xref="GeneID:54162771"
                     /translation="MSYSWKKILIKPESTVVDALRVIDNEALRIALVVNDEQQLLGVV
                     TDGDIRRGLLNNLPLETPVVDIMSRSPITASVNTAKEQLVKLMESKSILAVPLMEENK
                     VVGLETLHHLFEEKTYHNPVFIMAGGFGTRLRPLTDTCPKPMLKIGNKPILETVIRSF
                     IKAGFVNFYISTHYMPEQIQNHFGDGSELGVKISYVHEDSPLGTGGALGLLPDDLPQD
                     LPLIMMNGDVLTKVDFERLLDFHTENQADATMCVREYDYQIPYGVINGKGNKITSMVE
                     KPIQRFFVNAGIYVVSPSVIQSVPKNHHIDMPTLLEQHMNERDNILMFPIHEYWLDIG
                     RMDDFNRAQADIHTLGLD"
     gene            164940..165905
                     /locus_tag="VF_RS00720"
                     /old_locus_tag="VF0146"
                     /old_locus_tag="VF_0146"
                     /db_xref="GeneID:54162772"
     CDS             164940..165905
                     /locus_tag="VF_RS00720"
                     /old_locus_tag="VF0146"
                     /old_locus_tag="VF_0146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005471014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_047863549.1"
                     /db_xref="GeneID:54162772"
                     /translation="MNKVAVIGLGNIATRHRRNLKSLFPNVELLVMSASGRIPTEEIS
                     DSDGIVTSIEALIEANVELVIVASPAPFHAQHSIPLIEAGIPTLIEKPVTTTREDANA
                     IKKALNEHGTPVAIGYCLRYLPSAQKLKILLDHKAIGTLYNAHIEIGQYLPDWRPSKN
                     YRECVSANEKLGGGALFELSHELDYAQWLLGPLALQHAILRSSDELDLQVEDMADILT
                     LTESGAVASIHLDFLQRKAHRQCSFIGSEGRIDWDLIQNQLTLTTAAEAKVIYSEPEW
                     DKNQMYLAMVTDFIQMIKQQPHNCIAVTDASFTVDLISQIKQKAY"
     gene            165921..166610
                     /locus_tag="VF_RS00725"
                     /old_locus_tag="VF0147"
                     /old_locus_tag="VF_0147"
                     /db_xref="GeneID:54162773"
     CDS             165921..166610
                     /locus_tag="VF_RS00725"
                     /old_locus_tag="VF0147"
                     /old_locus_tag="VF_0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005350289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acylneuraminate cytidylyltransferase family
                     protein"
                     /protein_id="WP_011261007.1"
                     /db_xref="GeneID:54162773"
                     /translation="MKNFAFIFARGGSKGLPGKNIKPLAGKPLLQYSVDTAIASPSID
                     KVFVSTDDSDIAKVAVESGAILIERPAELATDISPEWLSWRHAIEWAEEYHGQFDGFV
                     SLPATSPLRGVEDVEAAIEKRSKVGADICISITPASRSPFFNMVKETQDGLVELVNKP
                     ESNVTRRQDAPEVFDITTVVYVTTPDFVLNNYGLFTGKVTSIEVPKVRAVDIDDIYDF
                     RMAEAILQDAK"
     gene            166610..167380
                     /locus_tag="VF_RS00730"
                     /old_locus_tag="VF0148"
                     /old_locus_tag="VF_0148"
                     /db_xref="GeneID:54162774"
     CDS             166610..167380
                     /locus_tag="VF_RS00730"
                     /old_locus_tag="VF0148"
                     /old_locus_tag="VF_0148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_011261008.1"
                     /db_xref="GeneID:54162774"
                     /translation="MEKQLENKTILIAGAGGLLGTRLVPAVLAQGGKVIAADINIEAM
                     TERLASLGVDIENKNLTLTTLDVTNEESVSQLFSNYTSIDGAVNSTYPRNKTYGSHFF
                     DVSLESFNENLSLHLGSAFLFTQQCASYFKKHETALSLVNISSIYGVVAPKFEIYDKT
                     PMTMPVEYAAIKSAIQHLNKYTVAYVNDSRFRINCVSPGGIFDHQPEAFLEAYKTKTH
                     GAGMLDVKEVVGSVLFLLSEQSRYVTGQNIIVDDGFSL"
     gene            167389..168558
                     /locus_tag="VF_RS00735"
                     /old_locus_tag="VF0149"
                     /old_locus_tag="VF_0149"
                     /db_xref="GeneID:54162775"
     CDS             167389..168558
                     /locus_tag="VF_RS00735"
                     /old_locus_tag="VF0149"
                     /old_locus_tag="VF_0149"
                     /inference="COORDINATES: protein motif:HMM:NF012744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_011261009.1"
                     /db_xref="GeneID:54162775"
                     /translation="MKIALVMVHGRVHGHVGGAPRVFFDMANHLSFEGHEVLAVYNDS
                     KEGSPYYEVTNKVNLKNLALPIKFKGLWLYKAFREVIRSFAKLFNTDLRLNPVTKKNQ
                     KRVGLALKSLIDDFKPDVTISYNVSDLVSLSYIEWKARNSIVMCHTDPKRVYKGLANY
                     ERSIWQGADFIQVLLASYKDYLSKVINTNIEVIGNVVIEHDEVNDLSAFRIIYLARIE
                     KNKQQHLLIEAINKIPLNVRLGWQVVLYGSCNDTEYSEFLINKINSYNLSDVIKLKGP
                     TGKPFEELLNSSICAFPSAFEGFPLALTEAMSLGLPCIGFQSCSGVNELLINNYNGFL
                     VKGVEEFALQLEVLMKSKERRSLMGSKARDSIECYSKESIYKKWKALIENKNVIV"
     gene            complement(168574..169425)
                     /locus_tag="VF_RS00740"
                     /old_locus_tag="VF0150"
                     /old_locus_tag="VF_0150"
                     /db_xref="GeneID:54162776"
     CDS             complement(168574..169425)
                     /locus_tag="VF_RS00740"
                     /old_locus_tag="VF0150"
                     /old_locus_tag="VF_0150"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_053044379.1"
                     /db_xref="GeneID:54162776"
                     /translation="MSSLIKNEDWDYIFTFPRSNRTFITPKIIKKIKQISSNKLDTLF
                     YSEYNAWRSKLIIKNLDFQKHVFFDDGTMTYFDYYDYIEPKASFYRPRFLQDIQLRLQ
                     GITPISKLDFFDNTEIFSIFEFKNCVITYTENKLNVLKKRINRLNNTSQFEYDVFIGQ
                     GSVDEKNRISLKEYITLIKSVLSESKSYLIYIPHRTEATHVTESIKKINGVIFHQPNY
                     PIEVELVENNITPLTITGLSSTALYTLSKIYPNSKIKLVDQQSISKGERDKRIQLYLN
                     EYFDKIK"
     gene            complement(169555..170787)
                     /locus_tag="VF_RS00745"
                     /old_locus_tag="VF0151"
                     /old_locus_tag="VF_0151"
                     /db_xref="GeneID:54162777"
     CDS             complement(169555..170787)
                     /locus_tag="VF_RS00745"
                     /old_locus_tag="VF0151"
                     /old_locus_tag="VF_0151"
                     /inference="COORDINATES: protein motif:HMM:NF016800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="WP_011261011.1"
                     /db_xref="GeneID:54162777"
                     /translation="MINNYCQKILSSISKYWVLAIVYIPILWTLSFNFTLPNGRSIAS
                     KLLVISAIFSFIYFRKRVFLFKEKPKTFKILITSLFIIILFRSILFLYHGEQTSSIRA
                     FGIIFLYIYSFPYWLVKKEHIKNLTFISLFLFGLDAFIHVINNGFTRYGGNTNPNPYG
                     LYAALIFIFVYIYNLINTKTHILYKTIPLIIIGFLPIMISQSRGVWVSTILTLIIIHI
                     ARIKFNIKNISIYILTILAIAFSLYSTPTVKNRIEATKIEIKNIEHHNLSSSLGVRIQ
                     VWKDSIPLIKEYPFFGLGNKLKEINNTRFENKKISQYSYYYSRNHLHSQYFEFITKQG
                     FIGFFIIIGAIIFPLIIMRKDNDIFVKFCSISFLCVLLINFITEVPFNWINFTYTYLI
                     LILCLTLQSYHSTKDIRS"
     gene            complement(170815..171756)
                     /gene="rfaD"
                     /locus_tag="VF_RS00750"
                     /old_locus_tag="VF0152"
                     /old_locus_tag="VF_0152"
                     /db_xref="GeneID:54162778"
     CDS             complement(170815..171756)
                     /gene="rfaD"
                     /locus_tag="VF_RS00750"
                     /old_locus_tag="VF0152"
                     /old_locus_tag="VF_0152"
                     /EC_number="5.1.3.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-glyceromanno-heptose 6-epimerase"
                     /protein_id="WP_011261012.1"
                     /db_xref="GeneID:54162778"
                     /translation="MIIVTGGAGMIGSNIVKSLNNKGFNDILVVDNLKDGKKFKNLVD
                     LDITDYMDKEDFITQIMAGDDFGPIEAIFHEGACSATTEWDGKYIMMNNYEYSKELLH
                     FCIEREIPFLYASSAATYGETDTFIEERAYEGALNVYGYSKQQFDNYVRRLWADAEEH
                     NETLSQITGFRYFNVYGPREQHKGSMASVAFHLNNQMNAGDNPKLFEGSDEFKRDFVY
                     VGDVAAVNLWFLENGVSGIYNCGTGRAEPFRAVAEAVIKHHGKGEVETIPFPEHLKGA
                     YQEFTQADLTKLRAAGCDVEFKSVADGVAEYMAMINK"
     gene            172424..173896
                     /locus_tag="VF_RS00755"
                     /old_locus_tag="VF0153"
                     /old_locus_tag="VF_0153"
                     /db_xref="GeneID:54162779"
     CDS             172424..173896
                     /locus_tag="VF_RS00755"
                     /old_locus_tag="VF0153"
                     /old_locus_tag="VF_0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_011261013.1"
                     /db_xref="GeneID:54162779"
                     /translation="MPTPLKKSTQTTNLEISLKHHGGKFGVTGSCHELRINHNGNNHG
                     ILIDCGLFQGRDAKDKNGNERKLDIEFPIAHIKALILTHTHIDHIGRLPWLLAKGFKQ
                     PIYCTPATAELVPLMLDDGLKLQLGLNKGQRERVLALIRKQIKPIPYNQWHRIPFTST
                     AKLPSSRSSRSCSKSSSSSSPLKTRFSSLYLRFQPAGHILGSAYVEIKLPNNEIIVFS
                     GDLGPSKTPLLPDPTPPKRADLLVIESTYGNKIHDSVETRATRLQQIIDRSLEDGGAI
                     IIPAFSVGRTQELLFDIEHLIHHKKIDSKIPIILDSPLANKVTKQYRRFKKLWSKEAT
                     TKLNNHRHPLNFEQCIVIESHKEHMKIVNRLKSTAEPCIIVAASGMCAGGRVMNYLEA
                     LLPDKRTDIILAGYQAHGTLGRDLQNQEHQVWIDNQPIDVNAQIHTMSGYSAHADQSD
                     LIKFVEGIEEGKREIVVVHGEDDVRREFERVLETRNYTLR"
     gene            173982..174335
                     /locus_tag="VF_RS00760"
                     /old_locus_tag="VF0154"
                     /old_locus_tag="VF_0154"
                     /db_xref="GeneID:54162780"
     CDS             173982..174335
                     /locus_tag="VF_RS00760"
                     /old_locus_tag="VF0154"
                     /old_locus_tag="VF_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011919587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="four helix bundle protein"
                     /protein_id="WP_011261014.1"
                     /db_xref="GeneID:54162780"
                     /translation="MRCEKLKVWKRACRLSCEIYKTTSSIKDYGFRDQITRSGLSVPS
                     NIAEGEERSGVKEQIRFLNYSQGSAAELITQLFIGIEIGYIEKQKGLELINETKEILA
                     IVSQLSKNKKAVLKN"
     gene            174458..175102
                     /locus_tag="VF_RS00765"
                     /old_locus_tag="VF0155"
                     /old_locus_tag="VF_0155"
                     /db_xref="GeneID:54162781"
     CDS             174458..175102
                     /locus_tag="VF_RS00765"
                     /old_locus_tag="VF0155"
                     /old_locus_tag="VF_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_005417082.1"
                     /db_xref="GeneID:54162781"
                     /translation="MKTKDRIIHGALTLFNENGERSVTTNHIAAHLEISPGNLYYHFR
                     NKEEIISGIFDNYAKELKTRFQPMAEDQQSNMPSVQVMLSYLDSIFELMWNYRFFYAN
                     LPDILSRDDALKLKYTKAQQALNENLIAIMHSFRDSGLIDLEDDELQALTKTLHLVAS
                     CWINYQTALLSDNEITEAVIYQGMLQMLNVVRPMATEQGRKQILELEEHYKGRL"
     gene            complement(175293..177545)
                     /locus_tag="VF_RS00770"
                     /old_locus_tag="VF0156"
                     /old_locus_tag="VF0157"
                     /old_locus_tag="VF_0157"
                     /db_xref="GeneID:54162782"
     CDS             complement(175293..177545)
                     /locus_tag="VF_RS00770"
                     /old_locus_tag="VF0156"
                     /old_locus_tag="VF0157"
                     /old_locus_tag="VF_0157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjbH domain-containing protein"
                     /protein_id="WP_011261015.1"
                     /db_xref="GeneID:54162782"
                     /translation="MMTPKFSLSLIAGVIASALPYSTFATDHSVANQSIEDQSAVNKV
                     SNTVFDPVVLTPSQTDFGGVGLMQMPSGRMAPEGEFNIGASINNEYHHYNVSLQVMPW
                     LETTIRYTLVQDLLYSSDESFSGRTKYTDKGIDFKIRLLEESKWLPETSVGVRDFGGT
                     GLFDGEFVAATKRFGNLDVTLGMGWGYLGQSGNITNPFCKASDKFCSRQGDYKGKGGS
                     VDFERWFKGPAAIYGGIEYQTPYQPLRLKVEYDSNDYSQDFPVTRGNVDMTQHTPWNF
                     GVLYGLGDWGDIKVSYQRGDTLTLGVNLTTNFNDMKAIWRDEPITAYDESSNQSIDEV
                     DWQRVNQQLNGNAGYEDNRIYADDDSVTLVATQTKYRDSDEAHDRASRIFANHVPETI
                     STYRIIETNQSMPVSETLIDAAQYKKVANNEYFDAKVADASQTDEVTYSPSEHSLKSD
                     NLDRWDYSVSPTLSQSIGSAESFYLYAVGINTAGSVWLTDKVQASGSLYFNLFDNYDK
                     FNYITPPDGTSVPRVRTMFRAYVHENPVRMNNLQLTWFEEYGAGFYSQMYAGYLESMF
                     GGIGSEVMYRPLNSNWAFGIDATYIKQRTPGDWFGFYEQDHQEGGDYGRDYTVVSSGV
                     TGFATAYYAPQWSFLKNTLLKVGVGQFLAGDKGTRIDFSKQFDSGVIAGAYASFTDLS
                     AEEFGEGSYTKGFYISIPFDIMTVKPSKNRANFNWQPLTRDGGQMLNKQHDLYELTDE
                     RSPWFTRKGL"
     gene            complement(177549..178310)
                     /locus_tag="VF_RS00775"
                     /old_locus_tag="VF0158"
                     /old_locus_tag="VF_0158"
                     /db_xref="GeneID:54162783"
     CDS             complement(177549..178310)
                     /locus_tag="VF_RS00775"
                     /old_locus_tag="VF0158"
                     /old_locus_tag="VF_0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsule biosynthesis GfcC family protein"
                     /protein_id="WP_011261016.1"
                     /db_xref="GeneID:54162783"
                     /translation="MHFLSSFVFSLLLSASTVTYASSTQAVSVTLPNQNLVLNYSQPV
                     RLEQVILDANAQVNFYSLGAALSDNQLQKDIDNLRNNSIEQLSSLSRETSLFSANNEF
                     KRSATQIISQLEHHTFVGRIFSSLDLDLIRINEKLNPILNADYQLFVHPRPTSVSFFG
                     AIDSESSISVPFIEHASIDDYLDSLPLSSTADTSTIYVIQPDGVVQTTEFSVWQNKPA
                     YLAPGASVYIPLGGLPSDFSSLNTSIVQLLRNKAL"
     gene            complement(178353..179027)
                     /locus_tag="VF_RS00780"
                     /old_locus_tag="VF0159"
                     /old_locus_tag="VF0160"
                     /old_locus_tag="VF_0160"
                     /db_xref="GeneID:54162784"
     CDS             complement(178353..179027)
                     /locus_tag="VF_RS00780"
                     /old_locus_tag="VF0159"
                     /old_locus_tag="VF0160"
                     /old_locus_tag="VF_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjbF family lipoprotein"
                     /protein_id="WP_011261017.1"
                     /db_xref="GeneID:54162784"
                     /translation="MFKSLVTFLSIFLLSACTPKFNDVNATLDEAFFGADDVVLSKQQ
                     IIELPYASSFVRINGGANLFMVLAFAEKNPATGAMQLKWLSSDKAMIVTEGGRIVKTL
                     GLAEANLSNITPVSSSSLPSLASISKNQTTWSAHYDWMLNDHYLFNYKANITPVLREK
                     STIETTIWNKDVTEVVEVISIPSLDYSFTNQYWLDEQFNVVKTHQYLGPDIGDIEMTI
                     LKPFAL"
     gene            complement(179151..179399)
                     /locus_tag="VF_RS00785"
                     /old_locus_tag="VF0161"
                     /old_locus_tag="VF_0161"
                     /db_xref="GeneID:54162785"
     CDS             complement(179151..179399)
                     /locus_tag="VF_RS00785"
                     /old_locus_tag="VF0161"
                     /old_locus_tag="VF_0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417092.1"
                     /db_xref="GeneID:54162785"
                     /translation="MKKTAIALMLAMTAGSAFAAAEATTTTAASTSGSAAGTAGASAA
                     AAGAASTTAIAVGVAAAVAVVAVADSGSDATTTSVTTK"
     gene            179873..181024
                     /locus_tag="VF_RS00790"
                     /old_locus_tag="VF0162"
                     /old_locus_tag="VF_0162"
                     /db_xref="GeneID:54162786"
     CDS             179873..181024
                     /locus_tag="VF_RS00790"
                     /old_locus_tag="VF0162"
                     /old_locus_tag="VF_0162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide export protein"
                     /protein_id="WP_011261018.1"
                     /db_xref="GeneID:54162786"
                     /translation="MFMSKTHRSLASALLLVMLSGCTVFPGSHISTSDKNKVEEEQSE
                     DNQNAYSSDINVYELTPQKVADYQVKQASAQANLELEEQVASYEYRVGPGDILNVTIW
                     DHPELTIPAGSYRSSSESGNWVHADGTIFYPYIGTVEVEGKTVREIRTEIAQKLRKFI
                     ESPQVDVNVAAFRSKKAYVTGEVDKPGQQAITNIPLTLLDAVNRSGGLGEDADWRNVT
                     LTRNGKEETLSLYALMQRGDLTQNRLLQSGDIIHVPRNDTQKVFVMGEVKDPKLLKMD
                     RSGMSLTEALSSVGGINELSADATGVFVIRSSSPDKKQESMADIYQLNIKDASALIIG
                     TEFDLKPYDIVYVTAAPITRWNRLIMQLMPTITGFNELTEGALRVKNWP"
     gene            181185..181535
                     /locus_tag="VF_RS00795"
                     /old_locus_tag="VF0163"
                     /old_locus_tag="VF_0163"
                     /db_xref="GeneID:54162787"
     CDS             181185..181535
                     /locus_tag="VF_RS00795"
                     /old_locus_tag="VF0163"
                     /old_locus_tag="VF_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020676303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="four helix bundle protein"
                     /protein_id="WP_011261019.1"
                     /db_xref="GeneID:54162787"
                     /translation="MRFKELDVWKRSFKVSVYICKSMRSCKDLGFKDQICRSSVSVPS
                     NIAEGSERGSNKDNIRFLFYAKGSCAELLTQVLLATEIGYLKKDEVSNLIIELEEINK
                     MIAGYIRYLQRTRG"
     gene            181890..182330
                     /locus_tag="VF_RS00800"
                     /old_locus_tag="VF0164"
                     /old_locus_tag="VF_0164"
                     /db_xref="GeneID:54162788"
     CDS             181890..182330
                     /locus_tag="VF_RS00800"
                     /old_locus_tag="VF0164"
                     /old_locus_tag="VF_0164"
                     /EC_number="3.1.3.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotyrosine protein phosphatase"
                     /protein_id="WP_011261020.1"
                     /db_xref="GeneID:54162788"
                     /translation="MFNKILVVCVGNICRSPTGEHILKQLLPNKTVDSAGVAVEKSRL
                     TGKAADAMATEVAAEHGISLESHQARQLTSDVCREYDLILVMESGHKEAVTNLAPEAR
                     SKTMLFGQWIGQQDIPDPYRQSREAFDHAYGLIEKAAQEWAKKL"
     gene            182615..184777
                     /locus_tag="VF_RS00805"
                     /old_locus_tag="VF0165"
                     /old_locus_tag="VF_0165"
                     /db_xref="GeneID:54162789"
     CDS             182615..184777
                     /locus_tag="VF_RS00805"
                     /old_locus_tag="VF0165"
                     /old_locus_tag="VF_0165"
                     /EC_number="2.7.10.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis tyrosine autokinase"
                     /protein_id="WP_011261021.1"
                     /db_xref="GeneID:54162789"
                     /translation="MSQAINSTRDTSTSDEIDLAKLFGQLIDGRWLILSITTLFAIAG
                     IAFALLSTPIYKADALVQVEQKSNGGMSALVGDMGEMFASESSSTTEIEIIKSRMILG
                     DTVDALNLTTIASPQYMPIIGKGLSRLMGEEKAIKVSRFDIPRYVDKPNFTLVLDNAE
                     QGTYTLFDGQERKILTGKVGVLADKNDYRVFVMQLEGNTGDVFDVSKISRFDAILALQ
                     QSLSISEKGKQSGVLQFSLEGENKAQIEAIINDVSQNYFLQNIARNSAEAEQSLEFLQ
                     AQLPAIKDKLTTSENVLNDFRLERKSVDLSLEARSALDVLVKLEAQLNELTFKESEIS
                     QRFTKDHPAYKSLIDKRKVLLAEKDRLNGQVQKLPKTQREVLRMQRDVELNQEIYIQL
                     LNKTQELNIVKAGTVGNVRILDTAQAYTHAVKPKKPLIVVLATLLGGMLSVAIVLLKA
                     AFHRGVENPDEIEALGIPVYASIPKSNWQEKLDIRYNKKKVKHLETLLAESNPADLSI
                     EALRGLRTSMHFAMMEAKNNVVMITGPAPNIGKSFVAVNFAAVIAKTGQKVLVVDADM
                     RKGYMQRYFGMRWDNGLSDYLSGKLSLEESIQKSEVPNLDVLTRGQVPPNPSELLMTK
                     RFSDFIDWASANYDLVLIDTPPVLAVTDPSIVGALAGTTLMVGRFDQTSVKEIDVARH
                     RFEQAGIEVKGFILNAVEKKASSTYGYGYYNYSYDSDK"
     gene            184859..185953
                     /gene="rffG"
                     /locus_tag="VF_RS00810"
                     /old_locus_tag="VF0166"
                     /old_locus_tag="VF_0166"
                     /db_xref="GeneID:54162790"
     CDS             184859..185953
                     /gene="rffG"
                     /locus_tag="VF_RS00810"
                     /old_locus_tag="VF0166"
                     /old_locus_tag="VF_0166"
                     /EC_number="4.2.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="WP_011261022.1"
                     /db_xref="GeneID:54162790"
                     /translation="MKILVTGGAGFIGSAVVRHIINNTQDSVINLDKLTYAGNLESLS
                     DVDSDERYVFEQVDICDGAELDRVFSEHKPDAVMHLAAESHVDRSIDGPAAFIETNIV
                     GTYTLLEATRSYWNTLSDDKKQAFRFHHISTDEVYGDLEGTDDLFTETTSYEPSSPYS
                     ASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLMILNALDGKSLPIYGN
                     GMQIRDWLFVEDHARALYKVVTEGVVGETYNIGGHNEKANIDVVKTICSLLEELVPNK
                     PEGVAQYLDLITYVTDRPGHDVRYAIDASKIERELGWKPEETFESGIRKTVEWYLDNK
                     QWWSRVLDGSYAGERLGVYSESAVIEKEAK"
     gene            185953..186852
                     /gene="rfbA"
                     /locus_tag="VF_RS00815"
                     /old_locus_tag="VF0167"
                     /old_locus_tag="VF_0167"
                     /db_xref="GeneID:54162791"
     CDS             185953..186852
                     /gene="rfbA"
                     /locus_tag="VF_RS00815"
                     /old_locus_tag="VF0167"
                     /old_locus_tag="VF_0167"
                     /EC_number="2.7.7.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016788445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase RfbA"
                     /protein_id="WP_011261023.1"
                     /db_xref="GeneID:54162791"
                     /translation="MKGIVLAGGSGTRLYPLTRGVSKQLLPIYDKPMVFYPISTLMLA
                     GIKDILIITTPEDNAGFKRLLGDGSDFGINLEYAIQPSPDGLAQAFIIGEEFIGDDSV
                     CLVLGDNIFYGQSFGRTLRKAAARDYGASVFGYHVKDPERFGVVEFDKDYKALSIEEK
                     PENPKSNWAVTGLYFYDNRVVSFAKKVEPSHRGELEITSINQMYLNDGSLNVELLGRG
                     FAWLDTGTHESLHEASSFVQTIENVQGLKVACLEEIAWSQGWLSDEKVYEIAKPMLKN
                     DYGKYLVSLLDNETLRSSLQANK"
     gene            186852..187409
                     /gene="rfbC"
                     /locus_tag="VF_RS00820"
                     /old_locus_tag="VF0168"
                     /old_locus_tag="VF_0168"
                     /db_xref="GeneID:54162792"
     CDS             186852..187409
                     /gene="rfbC"
                     /locus_tag="VF_RS00820"
                     /old_locus_tag="VF0168"
                     /old_locus_tag="VF_0168"
                     /EC_number="5.1.3.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014615306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="WP_011261024.1"
                     /db_xref="GeneID:54162792"
                     /translation="MDIIKTKLADCIIIKPKVFGDERGFFLETFHSQRYKEVAGIKEQ
                     FVQDNRSQSSKNVLRGLHFQKTKPQGKLVTVISGEVFDVAVDLRPESETFGQYEAVVL
                     SGDNKLQFYVPPGFAHGFCVLSESADFQYKCTDYYDPDDESGLLWSDPIINIQWPLKT
                     PLLSEKDKIQPLLSEIEAKIKEGWV"
     gene            187411..188226
                     /locus_tag="VF_RS00825"
                     /old_locus_tag="VF0169"
                     /old_locus_tag="VF_0169"
                     /db_xref="GeneID:54162793"
     CDS             187411..188226
                     /locus_tag="VF_RS00825"
                     /old_locus_tag="VF0169"
                     /old_locus_tag="VF_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016788443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_011261025.1"
                     /db_xref="GeneID:54162793"
                     /translation="MSKFTVFGGRGFIGSEFVKELRTQGHDVFVPEREDLSIYEDDLG
                     TVIYSAGYGDCQRDQFNVLTANVILLSSLLQKAKFDKLVYISSTRVYMNQNESSEYSD
                     VTICSKDNRRLFNLTKLTAEELCLKSERECLIIRPSNVYGLALNSNLFLPSIIRNAIK
                     NKHIDMYVDKNYEKDYVSVYDVVSSTLKLIKFPQEVNKIINISSGENISANDIAQVLI
                     NKTGCSIKWKQTLNNTECFSPIDISYLKSLIDYKPRTLINDINNMVDSFIESI"
     gene            188230..189483
                     /locus_tag="VF_RS00830"
                     /old_locus_tag="VF0170"
                     /old_locus_tag="VF_0170"
                     /db_xref="GeneID:54162794"
     CDS             188230..189483
                     /locus_tag="VF_RS00830"
                     /old_locus_tag="VF0170"
                     /old_locus_tag="VF_0170"
                     /inference="COORDINATES: protein motif:HMM:NF024832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flippase"
                     /protein_id="WP_011261026.1"
                     /db_xref="GeneID:54162794"
                     /translation="MKLKGVDNKILSNIFSLLSVQGALYIIPLITLPYLVRTLGVENY
                     GVFGFSLAIVSYMSLIVDYGFNITATKTGAEIRYDKNKLSKLFFEILYSKLFMFIICS
                     LSSILFSFFVENNIFNKDIIFVLMFTVFSQVIFPIWFFQAIEELKLVATLNFISKSLS
                     VPLIFILINDEKDLIKLAVIHAITTIIPAIYSVYYIHIRKLVFFYKPSLNSIVSQIKN
                     GWHIFLSGISISFYSTIVTVFLGIFSGATETGYFVAADRLRKAVQGISGPISQSFYPR
                     INSLINTNKKSAINLIKVLYKIQFIVTFILSSLLFIFSEEIVEVLYGNGFVQSIVILK
                     VLSYVPFFVSMSNASGICVIVSFGFNRLFSKIMMFSGGVGVALSFLLINSYGAIGSGL
                     SILISEFIIAIIMIYFVIKLKLLKQ"
     gene            189505..190824
                     /locus_tag="VF_RS00835"
                     /old_locus_tag="VF0171"
                     /old_locus_tag="VF_0171"
                     /db_xref="GeneID:54162795"
     CDS             189505..190824
                     /locus_tag="VF_RS00835"
                     /old_locus_tag="VF0171"
                     /old_locus_tag="VF_0171"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261027.1"
                     /db_xref="GeneID:54162795"
                     /translation="MEWSDFSDDYDMLFCDSAVAKSIKQDIYVNKLSRIKSIVKVLFL
                     FFRKNKCIDFKYNGINNLYVLESMTPSNFKTINPIFELDKSSKLIIVTTPVFQRIDNV
                     RYRGNLFNIDDYTFVNIGDFINSLHFCRRFNNKFRFVNIFQLIFLYLRASSLNNVLNE
                     LFSNVKCNNIILTNDTLGLSNLIVQNSRVFNIKNYVLQHGLPTKFYFPTSADNYIVWG
                     RRFVSEFKNKGARSKLYSLGSPKVDEVMKYCFSDAKYNDFLKRYNISNNKKIFTYFSN
                     SHAPELDKKVHEINIKLLNGLISHKDYHVCIKLHPSESMQFIKEVLQPYDGKYTIIDH
                     EDDVYDLVKFSSYCASIYSTLLIESMCLGTYTFQFNATKSHKIPDYSNGGGCVEINSF
                     EQLELSLNASNKNKILNQQLKYTENYFSNQGTSSEKILELIHERNCI"
     gene            190805..191437
                     /locus_tag="VF_RS00840"
                     /old_locus_tag="VF0172"
                     /old_locus_tag="VF_0172"
                     /db_xref="GeneID:54162796"
     CDS             190805..191437
                     /locus_tag="VF_RS00840"
                     /old_locus_tag="VF0172"
                     /old_locus_tag="VF_0172"
                     /inference="COORDINATES: protein motif:HMM:NF012360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_011261028.1"
                     /db_xref="GeneID:54162796"
                     /translation="MKETVSKFIKFLNLPFSRKIQVLSFFYRLVFCSVIYRLLCKKFG
                     RRSIVKKPLIITYEDISFGDDVIIWEDARIESVRSYFESSFQPHIKISNGVSFQQRCH
                     ITAAGELIIGENSIISYDVMITDIDHEYVDVLTPIGKQPLKVSPTIIGEQCFIGCGVK
                     IQAGTQLGKHCIVGANSVVRGIFPDYSVIVGSPAKIVKTYDKKSNTWIRC"
     gene            191442..192389
                     /locus_tag="VF_RS00845"
                     /old_locus_tag="VF0173"
                     /old_locus_tag="VF_0173"
                     /db_xref="GeneID:54162797"
     CDS             191442..192389
                     /locus_tag="VF_RS00845"
                     /old_locus_tag="VF0173"
                     /old_locus_tag="VF_0173"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261029.1"
                     /db_xref="GeneID:54162797"
                     /translation="MIKKKKRILLVIPKFFNYEKNIKKHFELMGYDVDLIIDETPFRT
                     ILCNYIPYMKLFFGFYVENKIKKLITKNDYTSCLVIKGSSLSLKALTIIESHIKNRYL
                     YQWDSLSNYPYQTMLLYFNHVLTFDISDSKHLNLEYYPLFSMIENDRKELSRNIDILF
                     IGSFHSDRYKVLKEILCQYKDLNIYFYLYIPFLSYIKRIFKGEKILLSDIRFFKIKPE
                     KLSCFYNNSKCVLDIEAYHQTGFTMRTLEALYCGCKLITTNDNIYTADFFDKKIISVI
                     DRNDVLLDKSFIFNDENVEDNKILQVKNLKEWVVRFADD"
     gene            192382..193521
                     /locus_tag="VF_RS00850"
                     /old_locus_tag="VF_2581"
                     /db_xref="GeneID:54162798"
     CDS             192382..193521
                     /locus_tag="VF_RS00850"
                     /old_locus_tag="VF_2581"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="WP_011261030.1"
                     /db_xref="GeneID:54162798"
                     /translation="MTNNTLSLSKLIVFLLLIYFTIAQLEFFNKFFLKNIVIIIINYL
                     ICMYLIVNNKDGYNLKYIYMLPFVLFFSFFTFYSFGNNLFADIYRVNLFCSFFLCVFF
                     LSNNINSVFFLKKHTINFYFIISLLIIFDMFLFFITGRVFLFNVMIYITPRFIGPFYD
                     PNFLGFIYGALFLIVYFERTYNKLYGITFLICTILSGSWIVIGLLTLILIQVRVFSFR
                     YTFLKPVICVFVVILFWFVYEYLLDDVYFLFKYLVGNLTHLSEQLIDIKFKSLEYRFE
                     VTNMAVNLIIDNPFGYGYRTITKYLPLDTHNSYLGISFEYGIGALLLLIIPFFMMGIN
                     RSVNVDSLTSFICFMALFLNVHYLPIYLFFVITVYFPFGEKRLLY"
     gene            193521..194513
                     /locus_tag="VF_RS00855"
                     /old_locus_tag="VF0174"
                     /old_locus_tag="VF_0174"
                     /db_xref="GeneID:54162799"
     CDS             193521..194513
                     /locus_tag="VF_RS00855"
                     /old_locus_tag="VF0174"
                     /old_locus_tag="VF_0174"
                     /inference="COORDINATES: protein motif:HMM:NF021616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011261031.1"
                     /db_xref="GeneID:54162799"
                     /translation="MNSYPLISVIMSVYKEEREWLVSSIQSILDQTVSDFEFIIILDF
                     PNSELLKTLKDFEKKDSRIIIYQNEKNVGLVESLNTALSFSRGKYIARMDADDISHKN
                     RFEKQLKYITLNNLDLVGGNVNIFHSNKGIYNTTDKVQSDYFLCKLLKIGTIGIVHPT
                     FFSKRNVYDTIGGYYHAECAEDLELLMRANLNGFKIGNIPDVILDCRYSEKSITKENA
                     YFMFCTVKYLKSLYRSSLKSGDYKFNSNYIELYLYDENNKLAFSEKQNLMSEARHSFN
                     EKKYISFLINLIKSILISRTVFFSIKVNVMSFLFRKVEVKIPKVLLACIKIKLQ"
     gene            194516..195304
                     /locus_tag="VF_RS00860"
                     /old_locus_tag="VF0175"
                     /old_locus_tag="VF_0175"
                     /db_xref="GeneID:54162800"
     CDS             194516..195304
                     /locus_tag="VF_RS00860"
                     /old_locus_tag="VF0175"
                     /old_locus_tag="VF_0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017100610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_047863546.1"
                     /db_xref="GeneID:54162800"
                     /translation="MSVYKSDNPIDFNVAVNSIIRQTLKCDIFIYQDGPVSRELKSAI
                     NRFRKFNNIFIFVSEENKGLAYALNYLIDSCLLNNYQYIARMDSDDISHKNRMSIQVN
                     FLEDNSDIHVVGSYCKEFGADCSLAEKKLPITHNDLLNFSITRCPFIHPSVMFRTSIF
                     YNGLRYPVNTKYTEDMAFWFILLDLGYKFENIPETLIDYRMTENTVLRRRGFDKALSE
                     VFIRFKYMIKFKKITVKNVSFIIGRFVFHLLPPNAIKYLYKKMR"
     gene            195317..196114
                     /gene="kdsA"
                     /locus_tag="VF_RS00865"
                     /old_locus_tag="VF0176"
                     /old_locus_tag="VF_0176"
                     /db_xref="GeneID:54162801"
     CDS             195317..196114
                     /gene="kdsA"
                     /locus_tag="VF_RS00865"
                     /old_locus_tag="VF0176"
                     /old_locus_tag="VF_0176"
                     /EC_number="2.5.1.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017089648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_011261033.1"
                     /db_xref="GeneID:54162801"
                     /translation="MFLIAGPCVIESEDLVLDTFAQLQEMTNKLGIEYIAKSSFTKAN
                     RSSASAFTGPGLEEGLKILQKAKDQLGVKIITDVHEDTPLDEVASVVDVLQTPAFLVR
                     QTGFIQRVASMGKPVNIKKGQWMHPADMAPVVEKCRAVGNDDIWLCDRGTSFGFGALV
                     NYMPGLTIMKETGCKVVMDATHSVQMPGMLNGSTGGNRLHVPAIARAAVAVGIDGLFM
                     ETHPDPDKALCDGPNMLPLKHMEELLETLLEIDEVVHRRAFIESKLV"
     gene            196117..196680
                     /locus_tag="VF_RS00870"
                     /old_locus_tag="VF0177"
                     /old_locus_tag="VF_0177"
                     /db_xref="GeneID:54162802"
     CDS             196117..196680
                     /locus_tag="VF_RS00870"
                     /old_locus_tag="VF0177"
                     /old_locus_tag="VF_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017089647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IIIA family hydrolase"
                     /protein_id="WP_011261034.1"
                     /db_xref="GeneID:54162802"
                     /translation="MLDKQVCKNIKMVLLDVDGVMTDGSIFINHDGEFFKSFNVKDGL
                     AIELLRSHHILVGVISGKASAALDTRCQQLGFDEIITGCKNKLPALVNICSKYKISAD
                     QIAFLGDDVLDIPIFEKVGLAVAPIDAHSLAIDSADWVSSLKGGEGMVREFADLLLTI
                     QLNLPLKDVYKPLLDKIRLDDVATMEQ"
     gene            196684..197436
                     /gene="kdsB"
                     /locus_tag="VF_RS00875"
                     /old_locus_tag="VF0178"
                     /old_locus_tag="VF_0178"
                     /db_xref="GeneID:54162803"
     CDS             196684..197436
                     /gene="kdsB"
                     /locus_tag="VF_RS00875"
                     /old_locus_tag="VF0178"
                     /old_locus_tag="VF_0178"
                     /EC_number="2.7.7.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009835084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="WP_011261035.1"
                     /db_xref="GeneID:54162803"
                     /translation="MNVKVVIPARYGSSRLPGKPLLTLLDKPVIWHVIERCKEAGIEQ
                     NDIFVATDDQRIIDALRDESIQVVLTSSEHQSGTDRINEVAQIKGWDEDTIIVNVQGD
                     EPMIPYRLIQRIVSFTQLNPSYHITTAVVPLVSQDDFVNPNVVKAIIGYNGRALYFTR
                     SPSPLNRDNSSDLSLAKRHIGIYAYRASALKQFCSYSEDELEQYEKLEQLRALSHGMS
                     IGATIFDGFVPHGIDTIDDYENIKKIMEENIL"
     gene            197437..198369
                     /locus_tag="VF_RS00880"
                     /old_locus_tag="VF0179"
                     /old_locus_tag="VF_0179"
                     /db_xref="GeneID:54162804"
     CDS             197437..198369
                     /locus_tag="VF_RS00880"
                     /old_locus_tag="VF0179"
                     /old_locus_tag="VF_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010361476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KpsF/GutQ family sugar-phosphate isomerase"
                     /protein_id="WP_011261036.1"
                     /db_xref="GeneID:54162804"
                     /translation="MASSIDIAKQVIQTEIEGLDYMAKRLGSEFEVAINAIINTKGRT
                     IICGMGKSGIIGKKIAASFASTGTPSFFMHPGEAFHGDLGMVKPEDVFIAISNSGETD
                     EVLKLLPFLRDNGNFVIAITGKENSTLATNSHCHLDISVPKEACPLQLAPTSSTTATL
                     VMGDALTVALMDVREFQPENFARFHPGGSLGRRLLSKVQDEMFSDNIPSVASDADFTS
                     IIHKISSSHLGLTLVNLKDDSLAIITDGDLRRAMESKGRDAFDLVAKDIASINPASIS
                     PESNIQKAYEIMESKGITSLIVVESNSVVGILKK"
     gene            198615..199706
                     /gene="wecA"
                     /locus_tag="VF_RS00885"
                     /old_locus_tag="VF0180"
                     /old_locus_tag="VF_0180"
                     /db_xref="GeneID:54162805"
     CDS             198615..199706
                     /gene="wecA"
                     /locus_tag="VF_RS00885"
                     /old_locus_tag="VF0180"
                     /old_locus_tag="VF_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine--undecaprenyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /protein_id="WP_005417117.1"
                     /db_xref="GeneID:54162805"
                     /translation="MINAYLFVFLVSFISLFIMRKVAKRIGLVDKPNERKHHKGVIPL
                     IGGISIFTTLCIGLLLFLPVTETLLMYLACAAVLVVLGAFDDYFDVSFKIRLIVQTGI
                     SLVIIFAGGHSLHNLGFLMGSETIMLSSAVSGFITILGVIGAINAFNMVDGIDGLLGG
                     LASVTFAALATVFYYSGNDYLAHVCGLIVIAMVPYIMLNLGFPLGRRFKVFMGDAGSM
                     FIGFTVVWMLIRGSQEPAVIAFKPVTALWLIAIPLMDMATIMIRRVRKGQSPFKPDRE
                     HLHHICQRLGLSSYMTLFLICTVALICAFFGIWADLNGVSESVMFFSFLALFGVYFMT
                     ISYIWRITTFVHKLFGKRMSVQLQAEISK"
     gene            200281..201246
                     /locus_tag="VF_RS00890"
                     /old_locus_tag="VF0181"
                     /old_locus_tag="VF_0181"
                     /db_xref="GeneID:54162806"
     CDS             200281..201246
                     /locus_tag="VF_RS00890"
                     /old_locus_tag="VF0181"
                     /old_locus_tag="VF_0181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017040656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-6-deoxy-delta-3,4-glucoseen reductase"
                     /protein_id="WP_011261037.1"
                     /db_xref="GeneID:54162806"
                     /translation="MQYKIEVLPAGVHYQSEDNLLDDALSQNIPLEHSCKTGDCGACS
                     AEIITGNVENVHGNVVTQGEILTCQSKALSDVVLKANYYPELVDIKQQTIPCKVANVI
                     RVTDDIIILKFRFPPTVKFDYLPGQYVDLSYKGIKRSYSIANAKLDSKELELHIRKVP
                     NGQMSELIFGDVQLNQLMRMEGPKGTFFVRNNNKPLLLLATGTGIAPIKAIVEELIVK
                     EDKRNVYIYWGMQYEAELYCTELAQYAEEYEHIQFSPVLSKEQDWQGHKGYVQDAVNH
                     DFDSLENVEVYACGSLRMIDEAKVLFMNKQLPSDSFHSDAFTPAK"
     gene            201269..202042
                     /gene="rfbF"
                     /locus_tag="VF_RS00895"
                     /old_locus_tag="VF0182"
                     /old_locus_tag="VF_0182"
                     /db_xref="GeneID:54162807"
     CDS             201269..202042
                     /gene="rfbF"
                     /locus_tag="VF_RS00895"
                     /old_locus_tag="VF0182"
                     /old_locus_tag="VF_0182"
                     /EC_number="2.7.7.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate cytidylyltransferase"
                     /protein_id="WP_011261038.1"
                     /db_xref="GeneID:54162807"
                     /translation="MKAVILAGGLGTRLSEETSVKPKPMVEIGGKPILWHIMKLYSAH
                     GINDFIICCGYKGYVIKEYFANYFLHMSDVTFDMKENKMEVHHKRAEPWTVTLVDTGD
                     NSMTGGRLGRVADYLKDEEAFCFTYGDGVSDVDITKTLEFHKAHGKKATLTATFPPGR
                     FGALDISAGKVNSFKEKPRGDGAMINGGFFILSPKVLKLIDGDSCTWEQYPLNKLAED
                     GELMAYEHHGFWQPMDTLRDKVYLDELWQEGKAPWKIWE"
     gene            202046..203128
                     /gene="rfbG"
                     /locus_tag="VF_RS00900"
                     /old_locus_tag="VF0183"
                     /old_locus_tag="VF_0183"
                     /db_xref="GeneID:54162808"
     CDS             202046..203128
                     /gene="rfbG"
                     /locus_tag="VF_RS00900"
                     /old_locus_tag="VF0183"
                     /old_locus_tag="VF_0183"
                     /EC_number="4.2.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002046037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-glucose 4,6-dehydratase"
                     /protein_id="WP_011261039.1"
                     /db_xref="GeneID:54162808"
                     /translation="MNPSFWKGKKVFVTGHSGFKGGWLSLWLQEMGAIVKGYSLPAPT
                     LPSLFEEAKVGSRMSNEVGDIRDFTHLRQVISEFKPEIVFHMAAQPLVRLSYDDPMET
                     YSTNVMGTVYLLEAVKQVGGVKAVVNITSDKCYENREWVWGYREDEAMGGYDPYSNSK
                     GCAELVASSYRQSFFNKDKYAEHGCALASVRAGNVIGGGDWADDRLIPDMLKAFSSNQ
                     AVEIRSPHAIRPWQHVLEPLSGYITIAEYLYEYGCDFAEGWNFGPKDEDAKPVEWIVD
                     TLTSVWGDDARWFLSEGEHPHEAHYLKLDCSKAKMRLNWQPVWDLEYTLTKIVNWQKA
                     WLNKQDMQQYTINEIKEYMTARAGTK"
     gene            203128..204441
                     /gene="rfbH"
                     /locus_tag="VF_RS00905"
                     /old_locus_tag="VF0184"
                     /old_locus_tag="VF_0184"
                     /db_xref="GeneID:54162809"
     CDS             203128..204441
                     /gene="rfbH"
                     /locus_tag="VF_RS00905"
                     /old_locus_tag="VF0184"
                     /old_locus_tag="VF_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein RfbH"
                     /protein_id="WP_011261040.1"
                     /db_xref="GeneID:54162809"
                     /translation="MSKELIRSQIADLVDQYAALEYAPKEFVGGETVVPPSGKVLGAN
                     ELKMMVEASLDGWLTTGRFNDAFEKRLGEYLGVPYVLTTTSGSSANLLALTALTSPKL
                     GDRQLKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYQIKPDMIEAAVTEKTK
                     AIMVAHTLGNVFDLTEARRVADKYNLWLIEDCCDALGSTYNDQMVGTFGDISTVSFYP
                     AHHITMGEGGAVFTKDKELRKLIESFRDWGRDCYCAPGCDDTCKKRFDQQLGSLPQGY
                     DHKYTYSHLGYNLKITDMQAACGLAQMDRVEELVQARKDNYAYLKEGLASCEEFIILP
                     EATENSTPSWFGFPITIKEDSGIERVDLLKFMDQFKIGTRLLFAGNLTRQPYFKDVEY
                     RVVGELTNTDLIMNNTFWIGVYPGLTKDHLDFVIEKFEEFFGVSF"
     gene            204457..206157
                     /locus_tag="VF_RS00910"
                     /old_locus_tag="VF0185"
                     /old_locus_tag="VF_0185"
                     /db_xref="GeneID:54162810"
     CDS             204457..206157
                     /locus_tag="VF_RS00910"
                     /old_locus_tag="VF0185"
                     /old_locus_tag="VF_0185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013855759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-binding protein"
                     /protein_id="WP_011261041.1"
                     /db_xref="GeneID:54162810"
                     /translation="MKASDAVARLLSLNNVNVGFELIGGMITHLVDSINELGETTLLS
                     LHHEQAAAFAAGGVARATNNKIIGLALGTSGPGATNLITGIADCWLDNYPCIFITGQV
                     NTYELKGDKPLRQQGFQELDIVSLVESITKYAVQVKTAEEILPTLQKAINMAKEGRPG
                     PVLIDIPMNLQREELNIQLNDINSFLNVDVDDELKSEAIDYSSLDCLLKNAEKPVFII
                     GGGACSEVHFDDWQSKISNYGIPCVSSLKGTEKTTCLPGYLGMLGAYGTRAANYAVQN
                     ADLIIILGSRLDVRQTGANADDFARSAKNIVQIDIDAAQLNNRVRNNLSIIGKCNDYF
                     IHMLNGDLKINCVEWHNEVTGLFHEKFTDEYPELKFSPFQIVNSLSQCFRGKAVQFVA
                     DVGNHQMWLAHSLLLEKQQKSHHSGGLGAMGFSLPTAIGVKLATDDLVVSISGDGGFQ
                     LNVQELDIINREQLPILVIILNNHSLGMVKNFQDMYFEGRSQPTYWNGYSCSFKDIGE
                     AYGIESHKVNDNFDFLSNVKSYVDNPRPLLIEVSIENITSCKPRLAFGKPIDEQYPND
                     "
     gene            206135..207157
                     /locus_tag="VF_RS00915"
                     /old_locus_tag="VF0186"
                     /old_locus_tag="VF_0186"
                     /db_xref="GeneID:54162811"
     CDS             206135..207157
                     /locus_tag="VF_RS00915"
                     /old_locus_tag="VF0186"
                     /old_locus_tag="VF_0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017040661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_011261042.1"
                     /db_xref="GeneID:54162811"
                     /translation="MSNILMINKNDLELISDKVESSFGLFKNKNIFITGGTGFFGKWL
                     LEAILYLNLKRNLNITVTLLSRDPERFKNNYPHLCSSDNISFIKGDVRDFPFPNEYFN
                     YIIHAATEASSTLNKENPSLMRSTIMDGAKHICNFANTVKCERLLYTSSGAAYGPQPP
                     NMKAMSEDFIINPNFNVNDAYSSAKLESEDFFKNNLKCQIIVARCFAFSGPYLPLDGS
                     YAFGNFIRDALDGKNISLNGDGTAVRSYLYAADLVIWLMKALVIGQDRTIYNIGSPDP
                     ITTLKLAEKICDASGNNSSVNVLNKSSDSGNIYIPCTLKSQSDLDVEVYTSIDESILK
                     TLKFYR"
     gene            207240..208160
                     /locus_tag="VF_RS00920"
                     /old_locus_tag="VF0187"
                     /old_locus_tag="VF_0187"
                     /db_xref="GeneID:54162812"
     CDS             207240..208160
                     /locus_tag="VF_RS00920"
                     /old_locus_tag="VF0187"
                     /old_locus_tag="VF_0187"
                     /inference="COORDINATES: protein motif:HMM:NF012745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_047863531.1"
                     /db_xref="GeneID:54162812"
                     /translation="MKNNITVCIPTFNRCESLKKTLGHLLSSKSISFSVVVSDNASED
                     DTWEYLNSLDDTRLIISRNETNIGFTGNILKVLELSPTDFILFMSDEDFVILENIEEI
                     IRTNIDDDVGVFYGGVLHENNSTYYYKYNKKTWKKKEALNKVVLSHSYMSGMIFNKKY
                     LDLNKFNTSIADEDVVLYPHEIMVYMILCNGGKLVTDSLPIAKQGEAVESEAIIKYKY
                     YEYNERLKLFKQYCRVVSNLDYGLIESRIFFKKMAIIASCVFVDEVLIKKIKPKQYLS
                     EIFSLNCGWLFKLQFVTYSSAVFLMRKLKN"
     gene            208195..209184
                     /locus_tag="VF_RS00925"
                     /old_locus_tag="VF0188"
                     /old_locus_tag="VF_0188"
                     /db_xref="GeneID:54162813"
     CDS             208195..209184
                     /locus_tag="VF_RS00925"
                     /old_locus_tag="VF0188"
                     /old_locus_tag="VF_0188"
                     /inference="COORDINATES: protein motif:HMM:NF012745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011261044.1"
                     /db_xref="GeneID:54162813"
                     /translation="MLLTIAIPTFNRAEKLDLQLKNICDQLIELKRDDICILVQDNHS
                     DDQTTEISNKYMSKFESIDFVYFRNESNLGFDRNVNLCLTNSKSKYTWILSDDDDLNS
                     NAILTIISEIDRNVGKFNFAFINYIVRSSEGVCANKCPNIKTKLVNGMNLLYEIELSH
                     SFISSCIFEVKSWLNKDVSEYFDSLWIHLLVARDIVPNGKTLLISEPVITMNMPSLEE
                     SRDSVIYEDKLEFYTNAHIRISKFCHELDNYGYSNDLKQYLVNKCRDYDRRQVINYKL
                     TVERNSFKDMVRIAKAYYSVKNNTWSYFLVLLPLILLPREFFKALKWLKYVLK"
     gene            209171..210448
                     /locus_tag="VF_RS00930"
                     /old_locus_tag="VF0189"
                     /old_locus_tag="VF_0189"
                     /db_xref="GeneID:54162814"
     CDS             209171..210448
                     /locus_tag="VF_RS00930"
                     /old_locus_tag="VF0189"
                     /old_locus_tag="VF_0189"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide flippase family protein"
                     /protein_id="WP_011261045.1"
                     /db_xref="GeneID:54162814"
                     /translation="MFLNKKINNRILNFSFILRGISSGVKFLFVLYLASFASGVVVGQ
                     YALIATITAITVQLIGFDVTTIIGRLIHKTERNGKVKLLESQYSFYLINYIVFFPLIF
                     FLFLKFVTDDFFFAMLFGFTIVVEHFFTEVFRTLVSLVKVKFATIIQFLKSVPYIVFI
                     MLSSFFYNIDISIEFIIISWLVNLLLVFIFFFFKCWNGLNLDLYFLFDKKTYVGIKHL
                     LFSAIPYFSITVLGVLFSQIDKFFINDYLGHELLGVYFTFFTICSVLTLFISLTVGVN
                     QGPVVIKIFSQSGVGAYISARKRLVSSYFKYITIGFIVSLIVGSLYIYISNKEIYSDN
                     YLSFCILLLSTAILAFGQVFRVDLYLLEKDKVLFLIYLSSLLFNLLLLSILLPIYGVL
                     GASITSLISTSFMVFTKIMQSKKYLKLVALNEC"
     gene            210438..211541
                     /locus_tag="VF_RS00935"
                     /old_locus_tag="VF0190"
                     /old_locus_tag="VF_0190"
                     /db_xref="GeneID:54162815"
     CDS             210438..211541
                     /locus_tag="VF_RS00935"
                     /old_locus_tag="VF0190"
                     /old_locus_tag="VF_0190"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261046.1"
                     /db_xref="GeneID:54162815"
                     /translation="MSVKVNNAILSRVIIDSLENEYEMDVYFNRKLNNKYMFFRPYAK
                     NNHNFIMFFLESILSFFLLLFSFAIPIINFRLIRFYHKGGSRNIIFIPSLKAQSIHDD
                     IDVDTSKFDSEISFINGSKKEKKRFKSGDYTLYLYCIFLFFKKYFNSPWFYRSILLIP
                     EMIALVSCLRLSKANNIAMTNQLDRWAYLISSFSKINDCSLSLYQHGTVIGEFKPKNK
                     LPIVNILYSYNQAERDFFESNIIDILCDCVYLKPKIKLSEISHKSSLLIIGSGSIEHF
                     SIEVETVKYLMHNKRFFVYIKPHPNLLVNRNYLEFDKERLSIISDNVFFPNVDVVIHF
                     GSTLAIEYENSKENIRVIELNKNSNIIEKLNLI"
     gene            211619..212656
                     /locus_tag="VF_RS00940"
                     /old_locus_tag="VF0191"
                     /old_locus_tag="VF_0191"
                     /db_xref="GeneID:54162816"
     CDS             211619..212656
                     /locus_tag="VF_RS00940"
                     /old_locus_tag="VF0191"
                     /old_locus_tag="VF_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_011261047.1"
                     /db_xref="GeneID:54162816"
                     /translation="MFKDKILLITGGTGSFGNAVLDRFLETDIKEIRIFSRDEKKQDD
                     MRKKYNSPKLKFYIGDVRDYNSILSASRGVDFVFHAAALKQVPSCEFHPMEAVKTNVL
                     GTENVLEACIANEVSRVVCLSTDKAVYPINAMGISKAMMEKVIVAKSRNVDPNKTVIS
                     TTRYGNVMASRGSVIPLFLRQIMSGDAITITDPNMTRFMMTLNDAVDLVLHAFIYGIN
                     GDIFVQKAPAATIDVLVQALKAITSKPEHEVNVIGTRHGEKLYEALCSREEMFVAEDQ
                     GGYYRIPSDNRDLNYSQYVEEGEQDLSTIEDYNSHNTDRLDVDGMIELLHKLDFIADI
                     EAGSLIVPEGV"
     gene            212656..213759
                     /locus_tag="VF_RS00945"
                     /old_locus_tag="VF0192"
                     /old_locus_tag="VF_0192"
                     /db_xref="GeneID:54162817"
     CDS             212656..213759
                     /locus_tag="VF_RS00945"
                     /old_locus_tag="VF0192"
                     /old_locus_tag="VF_0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000697809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_011261048.1"
                     /db_xref="GeneID:54162817"
                     /translation="MKILVTGANGFIGKNLCFQLEEQGFTDLIKIDRSNSTEELNEAL
                     KSADFIYHLAGVNRPQNDDEFKLGNADLTSHIISKLKELNRTPPILLTSSIQAEQSNA
                     YGVSKALAEDALNSYAEQSGAKVYIYRLPNVFGKWCRPNYNSVVATFCHNIVNDLPLT
                     INDPSAKVNLVYIDTVCEHFIHHLSNNEPGGEQSIKLIYPTTVGDIATALESFKASKT
                     SLVTENVGTGFLRALYSTYISYYSPEQFSYTIPAYTDPRGSFCELLKTKDAGQFSFFT
                     AHPGITRGGHYHHTKNEKFLVIKGEAKFRFEHIATGECYELDVTGEDYKVVETVPGWT
                     HDVTNIGESELVVMLWANEIFDREKPDTFTKPL"
     gene            213769..214899
                     /gene="wecB"
                     /locus_tag="VF_RS00950"
                     /old_locus_tag="VF0193"
                     /old_locus_tag="VF_0193"
                     /db_xref="GeneID:54162818"
     CDS             213769..214899
                     /gene="wecB"
                     /locus_tag="VF_RS00950"
                     /old_locus_tag="VF0193"
                     /old_locus_tag="VF_0193"
                     /EC_number="5.1.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000734414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase
                     (non-hydrolyzing)"
                     /protein_id="WP_011261049.1"
                     /db_xref="GeneID:54162818"
                     /translation="MKKLKVMSVVGTRPEIIRLSRVLAKLDEHCEHILVHTGQNYDFE
                     LNEVFFNDLGVRKPDYFLDAAGKNAAETIGQVIIKVDQALEEILPDAMLVLGDTNSCL
                     SAIPAKRHKVPIFHMEAGNRCFDQRVPEETNRRIVDHTADINLTYSSIARDYLLAEGL
                     PADRVIKTGSPMFEVLNHYMPQIDASDVLSRLGLKQGQFFVVSAHREENVDSPKQLAK
                     LAESLNCVAEYYNLPVIVSTHPRTRNRIEAQGIEFHKNIQLLKPLGFHDYNHLQKNAK
                     VVLSDSGTINEESSIMNFPALNLREAHERPEGMEEASVMMVGLSVERVMQALQILESQ
                     PSGDERLLRLVYDYSMPNVSDKMVRIIHSYTDYVKRVVWKEY"
     gene            214901..216112
                     /locus_tag="VF_RS00955"
                     /old_locus_tag="VF0194"
                     /old_locus_tag="VF_0194"
                     /db_xref="GeneID:54162819"
     CDS             214901..216112
                     /locus_tag="VF_RS00955"
                     /old_locus_tag="VF0194"
                     /old_locus_tag="VF_0194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016960220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_162200301.1"
                     /db_xref="GeneID:54162819"
                     /translation="MKKKIVILAEYIGENHNSTAYYWSQITKHLQGEYEIVLIAPENK
                     YSLFFASENKITTRFVKLAEHNKNNLLSRLQGQIKQTMSFLSVVKEEVGSADLLFSGT
                     NPIVTMASLVLLKWRYRFQWLVLVHDVFPNNLIPAKVLSASSPFYKALIALSKKMYAA
                     PDSMICIGRDMKVLLKQKIGNEKHIHYIPNWASTEKIPSLNKSDNKIITDLGWQNQVV
                     YQFFGNMGRLQGMGNLVKAIQQSTHQQARFLFIGCGSEADNVQKSLGQINEECGYDKT
                     HFYGRLDLEKNHIGLNACDISLVTLSDNMCGLGVPSKAYFSMAADKPILYVGDGDSEL
                     SILLSEYPVGWACEPEQPTLLAQQLDAITENCLISEMPKMRPRVLLTEHFSEALALTK
                     IARVVNSTIEL"
     gene            216109..217020
                     /locus_tag="VF_RS00960"
                     /old_locus_tag="VF0195"
                     /old_locus_tag="VF_0195"
                     /db_xref="GeneID:54162820"
     CDS             216109..217020
                     /locus_tag="VF_RS00960"
                     /old_locus_tag="VF0195"
                     /old_locus_tag="VF_0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001101756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="WP_011261051.1"
                     /db_xref="GeneID:54162820"
                     /translation="MNILLTGGFGFIGQQVVKLSPIKRKVVRMGESYSGSSVHQIDTL
                     STTTNWQGAFTDINAIIHLAGLAHSNSFSEQDYQEVNVDGTLHLANEAAKSGVKRFVF
                     VSSIGVNGTSTYQTPFSSLSKVEPHSAYAQSKYDAEVGLQKIAEETGLEVVIVRPTLV
                     YGPNAPGNFGALTRLVNKVPVLPFGLVNNKRDFISVQNLADLLITCANDPKAAGRTFL
                     ASDGQVVSIKDFTNAIAKGLNKRVIQLPIPVWCMRLAGKLLGKEVMIEQLVGNLEVDS
                     SNAQEVLGWIPPYTMQQAMHSLLENNK"
     gene            217017..217565
                     /locus_tag="VF_RS00965"
                     /old_locus_tag="VF0196"
                     /old_locus_tag="VF_0196"
                     /db_xref="GeneID:54162821"
     CDS             217017..217565
                     /locus_tag="VF_RS00965"
                     /old_locus_tag="VF0196"
                     /old_locus_tag="VF_0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010317076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transferase"
                     /protein_id="WP_011261052.1"
                     /db_xref="GeneID:54162821"
                     /translation="MIRILDFLAAFFGLLFLWPVLLIVTIIGLFDTGSPVFIQERVGR
                     NKKPFNLIKFRTMSVETKSVASHLASNASITKLGAFLRKTKIDELPQLINVMKGEMSL
                     VGPRPNLFNQEELIKERDALGVYDVLPGVTGLAQVQNIDMSTPALLAKTDRKMIDTLT
                     VKSYFQYILMTATGSGSGDAVK"
     gene            217580..219487
                     /locus_tag="VF_RS00970"
                     /old_locus_tag="VF0197"
                     /old_locus_tag="VF_0197"
                     /db_xref="GeneID:54162822"
     CDS             217580..219487
                     /locus_tag="VF_RS00970"
                     /old_locus_tag="VF0197"
                     /old_locus_tag="VF_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_011261053.1"
                     /db_xref="GeneID:54162822"
                     /translation="MQFLQPIWSMPRPLKRLVSIVVDILFIVFAFWAAFATRLDGIEI
                     YMQDVSYWKLLAVLIPCTLLVFTKSGLYRAILRYLSLHAVLSICISAIISSAFIVFIS
                     YFNYLYMPRSIPVIYATYLVMLCGGSRLIVRVLVSDLLGKQKKKVLIYGAGSAGLQLA
                     NMLRQGKEFHPIAFIDDDRKKHKTTMQGITIYRPKYLERLIKKHCISTVLLAVPSASQ
                     VQKKVIIESLAKLHVEVLTIPNLDDLVNGKLSIGQLKEVSIDDLLGRVAVTPQAELME
                     ANIKDKVVMVTGAGGSIGSELCRQIILNKPTTLVLFELSEFSLYQIEHELSQIIANQQ
                     LSINVVPLLGSVQRLNRLAATMKAFKVQTVYHAAAYKHVPLVEYNVVEGVRNNIFGTN
                     YAAQAAIEAKVESFVLISTDKAVRPTNVMGTTKRVAELGLQALAQVENAKPNGTRFCM
                     VRFGNVLGSSGSVIPLFKKQIAQGGPITLTHKDITRYFMTIPEAAQLVIQAGAMGKGG
                     DVFVLDMGESVKIADLARNLIHLSGLEVRSDENPDGDIEIRCTGLRPGEKLYEELLIG
                     DNVGKTAHERIMTANEEFLPLNEYNQLLDDLDTACHNFDHATIRQLLIDAPTGFAPVD
                     GIGDLVWKAEQ"
     gene            219821..220988
                     /locus_tag="VF_RS00975"
                     /old_locus_tag="VF0198"
                     /old_locus_tag="VF0199"
                     /old_locus_tag="VF_0198"
                     /pseudo
                     /db_xref="GeneID:54162823"
     CDS             219821..220988
                     /locus_tag="VF_RS00975"
                     /old_locus_tag="VF0198"
                     /old_locus_tag="VF0199"
                     /old_locus_tag="VF_0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018385.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide sugar dehydrogenase"
                     /db_xref="GeneID:54162823"
     gene            221197..222150
                     /locus_tag="VF_RS00980"
                     /old_locus_tag="VF0200"
                     /old_locus_tag="VF_0200"
                     /db_xref="GeneID:54162824"
     CDS             221197..222150
                     /locus_tag="VF_RS00980"
                     /old_locus_tag="VF0200"
                     /old_locus_tag="VF_0200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHH family phosphoesterase"
                     /protein_id="WP_011261054.1"
                     /db_xref="GeneID:54162824"
                     /translation="MNYDIFNGDADGIIALLQLRLAYPQESVLVTGVKRDINLVKKID
                     VKPEDSLTILDISMEKNMAALEVALESGAEVFYADHHRCGDIPENENLSAHIDLDANT
                     CTALIIDKLLNGQFHYWAITAAYGDNLIAKADELADTAGLSSEQKSQLKELGILINYN
                     GYGAKIDDLHFDPTDLYQALRQYLSPFDVIEDKASPFYQLQSAYQSDMNHALSIEALH
                     KSEKLALFELPNTAWARRISGVYGNLLANRSPNSSHAVITLNDDDTYTVSLRAPLNNK
                     QGAGEICSSFATGGGREAAAGINALPKEKIAEFIQVVEGKY"
     gene            222273..223280
                     /gene="galE"
                     /locus_tag="VF_RS00985"
                     /old_locus_tag="VF0201"
                     /old_locus_tag="VF_0201"
                     /db_xref="GeneID:54162825"
     CDS             222273..223280
                     /gene="galE"
                     /locus_tag="VF_RS00985"
                     /old_locus_tag="VF0201"
                     /old_locus_tag="VF_0201"
                     /EC_number="5.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005304975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="WP_011261055.1"
                     /db_xref="GeneID:54162825"
                     /translation="MNILVTGGMGYIGSHTCVQMIEAGLTPIILDNRYNSKEVVLDRI
                     EALVGVKPKFYQGDIRDPKILETIFAENQIDSVIHFAGLKAVGESVEKPIMYYDNNVS
                     GTLVLVEAMRKAGVNSIVFSSSATVYGDPASTPIREDFPTSATNPYGRSKLMVEECLT
                     DIQKAHPEMSVTLLRYFNPVGSHKSGTMGEDPQGIPNNLMPFISQVAVGRREFLSVFG
                     NDYPTVDGTGVRDYIHVVDLADGHLAALKYKGQEAGLHIYNLGTGNGNSVLQMVTAFE
                     KASGAKVPYKIVDRRPGDIAECWADPAKAREELKWEAKLSLDDMTADTWRWQSNNPEG
                     Y"
     gene            complement(223608..225140)
                     /gene="gpmM"
                     /locus_tag="VF_RS00990"
                     /old_locus_tag="VF0202"
                     /old_locus_tag="VF_0202"
                     /gene_synonym="pgmI"
                     /db_xref="GeneID:54162826"
     CDS             complement(223608..225140)
                     /gene="gpmM"
                     /locus_tag="VF_RS00990"
                     /old_locus_tag="VF0202"
                     /old_locus_tag="VF_0202"
                     /gene_synonym="pgmI"
                     /EC_number="5.4.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008078218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="WP_011261056.1"
                     /db_xref="GeneID:54162826"
                     /translation="MSAKKPMALVILDGYGHRETQADNAITNANTPVLDGLMANQPNT
                     LISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKAISDGEFQQNETLVNAI
                     DKAVKAGKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYLHCFLDGRDTPPRS
                     AENSLKNFQELFAKLGKGRIASLVGRYYAMDRDNNWERVQKAYDLMTEAKAEFTFATA
                     VEGLEAAYAREENDEFVQATEIKAEGEESAAIVDGDAVIFMNYRADRARQITRTFVPS
                     FDGFTRNVFPAIDFVMLTQYAADIPLLCAFAPASLENTYGEWLSKEGKTQLRISETEK
                     YAHVTFFFNGGIEDEFEGEERQLVASPKVATYDLQPEMSAPELTEKLVAAIKSGKYDA
                     IVCNFPNCDMVGHTGVYDAAVKAVESLDECIGKVVEAIKEVDGQLLITADHGNAEMMI
                     DPETGGVHTAHTNLPVPLIYVGSKAVEFKEGGKLSDLAPTMLALTDTAIPAEMSGEVL
                     FK"
     gene            complement(225513..226877)
                     /locus_tag="VF_RS00995"
                     /old_locus_tag="VF0203"
                     /old_locus_tag="VF_0203"
                     /db_xref="GeneID:54162827"
     CDS             complement(225513..226877)
                     /locus_tag="VF_RS00995"
                     /old_locus_tag="VF0203"
                     /old_locus_tag="VF_0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_047863530.1"
                     /db_xref="GeneID:54162827"
                     /translation="MLDKHGLLTQPISDVLRKLTTPMVFGMVAILLFNLVDTFFISLL
                     GTDALAAVSFTFPVTFAVNCITMGIGVGLSASIGHLLGEGHSKHAAELTTHGIILAIS
                     LILIACALGFFTIDPLFTLLGAEDKLLPLIDEYMSIWYLTIPLLVIPMSSNSAIRATG
                     DTKTPAKIMMLAGLINGILDPLLIFGYGPFPELGIQGAAIASAISWLGALIASFYVLT
                     HKVKLLALPNKNTLISDWKQILTIGSPAALSNALNPISGAILMMMLASQGTVAVASYG
                     AAQRVESLMLLVIMALTSSLSPLVAQNLGAKQPERVKEAIFLAIKFSVAFQLFLYILI
                     VPLSIPISHLFSQDDAVQHGLWMYLICVPFSYGFQGIVMVLVSSLNAMKKPLYSFSWS
                     FMRLFVFTLPTAWIGSQIYGMEGLFIGIAMGNVMGGISAFWYARTRIRFEDAALEERG
                     DTKS"
     gene            227164..227454
                     /locus_tag="VF_RS01000"
                     /old_locus_tag="VF0204"
                     /old_locus_tag="VF_0204"
                     /db_xref="GeneID:54162828"
     CDS             227164..227454
                     /locus_tag="VF_RS01000"
                     /old_locus_tag="VF0204"
                     /old_locus_tag="VF_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009843368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GroES"
                     /protein_id="WP_005417156.1"
                     /db_xref="GeneID:54162828"
                     /translation="MNIRPLHDRVIVERQEVESKSAGGIVLTGSAAEKSTRGTVLAVG
                     KGRILENGTVQPLDVKVGDSVIFAEGYGTKSEKIDGKEVLIMSENDIMAIVE"
     gene            227532..229178
                     /gene="groL"
                     /locus_tag="VF_RS01005"
                     /old_locus_tag="VF0205"
                     /old_locus_tag="VF_0205"
                     /db_xref="GeneID:54162829"
     CDS             227532..229178
                     /gene="groL"
                     /locus_tag="VF_RS01005"
                     /old_locus_tag="VF0205"
                     /old_locus_tag="VF_0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017079119.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="WP_005417158.1"
                     /db_xref="GeneID:54162829"
                     /translation="MAAKDVKFGNDARIKMLEGVNVLADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVVAAVEELKALSVPCADTKAIAQVGTISANSDSTVGN
                     LIAEAMDKVGRDGVITVEEGQALQDELDVVEGMQFDRGYLSPYFVNNQEAGSVDLESP
                     FILLVDKKVSNIRELLPTLEAVAKASRPLLIIAEDVEGEALATLVVNNMRGIVKVAAV
                     KAPGFGDRRKAMLQDIAVLTAGSVISEEIGLELEKVVLEDLGQAKRVTITKETTTIID
                     GSGEETIIQGRVSQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KDRVEDALHATRAAVEEGVVAGGGVALIRVASKVAGLVGDNEEQNVGIRVALRAMEAP
                     IRQITKNAGEEDSVVANNVKAGEGSYGYNAATGEYGDMIEMGILDPTKVTRSALQFAA
                     SVAGLMITTEAMVTDKPQDSGSAMPDMGGMGGMGGMGGMM"
     gene            complement(229534..230304)
                     /gene="tpiA"
                     /locus_tag="VF_RS01010"
                     /old_locus_tag="VF0206"
                     /old_locus_tag="VF_0206"
                     /db_xref="GeneID:54162830"
     CDS             complement(229534..230304)
                     /gene="tpiA"
                     /locus_tag="VF_RS01010"
                     /old_locus_tag="VF0206"
                     /old_locus_tag="VF_0206"
                     /EC_number="5.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006233896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triose-phosphate isomerase"
                     /protein_id="WP_011261058.1"
                     /db_xref="GeneID:54162830"
                     /translation="MRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPA
                     LFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERRE
                     YHNESDEFVAKKFAFLKENGLTPVLCIGESEAQNEAGETVAVCARQIDAVINTQGVDA
                     LNGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEEVAKNVVIQYGGSVKPE
                     NAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA"
     gene            230573..230917
                     /locus_tag="VF_RS01015"
                     /old_locus_tag="VF0207"
                     /old_locus_tag="VF_0207"
                     /db_xref="GeneID:54162831"
     CDS             230573..230917
                     /locus_tag="VF_RS01015"
                     /old_locus_tag="VF0207"
                     /old_locus_tag="VF_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate
                     Delta-isomerase"
                     /protein_id="WP_011261059.1"
                     /db_xref="GeneID:54162831"
                     /translation="MPHLVMEYSNSAEDRLNMQGLLEDLHQVAIASGLFSAKDVKSRA
                     VRVHSWLVGKQGNSVDFIHITLELLEGRSPEQKRELSRALMDVLAEQASHIDSLTINV
                     RDMEHESFQKIG"
     gene            complement(230932..231285)
                     /locus_tag="VF_RS01020"
                     /old_locus_tag="VF0208"
                     /old_locus_tag="VF_0208"
                     /db_xref="GeneID:54162832"
     CDS             complement(230932..231285)
                     /locus_tag="VF_RS01020"
                     /old_locus_tag="VF0208"
                     /old_locus_tag="VF_0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3135 domain-containing protein"
                     /protein_id="WP_011261060.1"
                     /db_xref="GeneID:54162832"
                     /translation="MPQSHRNLSIPSFDELKALAEKDPEQLEALRHQLSMEFIESVPE
                     EHQGPLLAQQSHIERIIERGNNPNHVNILLGRELGKQFVRFADSLNKPIDEHQAADVI
                     QFPNATSRPSNNTKH"
     gene            complement(232010..233017)
                     /gene="glpX"
                     /locus_tag="VF_RS01025"
                     /old_locus_tag="VF0209"
                     /old_locus_tag="VF_0209"
                     /db_xref="GeneID:54162833"
     CDS             complement(232010..233017)
                     /gene="glpX"
                     /locus_tag="VF_RS01025"
                     /old_locus_tag="VF0209"
                     /old_locus_tag="VF_0209"
                     /EC_number="3.1.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001887310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II fructose-bisphosphatase"
                     /protein_id="WP_011261061.1"
                     /db_xref="GeneID:54162833"
                     /translation="MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRTLL
                     NKTDISGEIVIGEGEIDDAPMLYIGENVGTGGDAVDIAVDPIEGTRMTAMGQSNALAV
                     LAAGEKGSFLKAPDMYMEKLVVGPGAKGAIDLSLSLEDNLVNIAKALGKPLETLVVTT
                     LAKPRHDEVIANMQKMGVRVFAVPDGDVAASILTCMPDSEVDVMYCIGGAPEGVVSAA
                     VIRALDGDMQARLLPRHEVKGDTEENRIHGEAELKRCEEMGVKANVILKMTDMARSDD
                     VVFAATGITKGDLLEGITRQGNIATTETLLIRGRCRTIRRIKSIHYLERKDAEVRDII
                     L"
     gene            233385..233627
                     /gene="zapB"
                     /locus_tag="VF_RS01030"
                     /old_locus_tag="VF0210"
                     /old_locus_tag="VF_0210"
                     /db_xref="GeneID:54162834"
     CDS             233385..233627
                     /gene="zapB"
                     /locus_tag="VF_RS01030"
                     /old_locus_tag="VF0210"
                     /old_locus_tag="VF_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapB"
                     /protein_id="WP_005417172.1"
                     /db_xref="GeneID:54162834"
                     /translation="MSLEILEQLEAKVQMAVDTIALLQMEVEELKETNAALTQDLEQA
                     NNGRSEVEQEAQRARDEQAQFEARIRGLLGKMDEVE"
     gene            complement(234115..234612)
                     /gene="rraA"
                     /locus_tag="VF_RS01035"
                     /old_locus_tag="VF0211"
                     /old_locus_tag="VF_0211"
                     /db_xref="GeneID:54162835"
     CDS             complement(234115..234612)
                     /gene="rraA"
                     /locus_tag="VF_RS01035"
                     /old_locus_tag="VF0211"
                     /old_locus_tag="VF_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E activity regulator RraA"
                     /protein_id="WP_005417181.1"
                     /db_xref="GeneID:54162835"
                     /translation="MEYNTSALCDIYLDQVDVVEPMFSHFGAKTSFSGQITTIKCFED
                     NGLIHQLLEEKGEGRVLLVDGGGSLRRALVDADLAAKAAHNGWEGLVIYGCVREVDYL
                     EEIEIGIQALASIPVGAARQNIGEVDVAVNFGSVTFLPEDHLYADSTGVIISQEPLEE
                     MGEEE"
     gene            complement(234737..235645)
                     /locus_tag="VF_RS01040"
                     /old_locus_tag="VF0212"
                     /old_locus_tag="VF_0212"
                     /db_xref="GeneID:54162836"
     CDS             complement(234737..235645)
                     /locus_tag="VF_RS01040"
                     /old_locus_tag="VF0212"
                     /old_locus_tag="VF_0212"
                     /EC_number="2.5.1.74"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     polyprenyltransferase"
                     /protein_id="WP_011261062.1"
                     /db_xref="GeneID:54162836"
                     /translation="MKTSPFSIWLNAARPKTLPLALASIMTGSVLAYWNNHASFTITL
                     MAFITATLLQILSNLANDYGDAVKGTDNEDRLGPQRAMQTGLVTQETMKKAIGINIVL
                     TIISGLILVFSSLHQTMDIIGFIALGLLAIGAAIAYTMGDKPYGYRGLRDISVFIFFG
                     LLGVAGTYYLHTGHLSSALFLPATACGLLAVAVLNINNLRDIENDEACGKMTLVVRMG
                     ANWGRKYHAVLMAVSFICLAVFSATQIHSLTGWLFLAIAPFVFNHVMSVMRAPNGEAI
                     RPMMGTVVQCALFTNVLFAVGLYLSV"
     gene            complement(235728..236597)
                     /locus_tag="VF_RS01045"
                     /old_locus_tag="VF0213"
                     /old_locus_tag="VF0214"
                     /old_locus_tag="VF_0214"
                     /db_xref="GeneID:54162837"
     CDS             complement(235728..236597)
                     /locus_tag="VF_RS01045"
                     /old_locus_tag="VF0213"
                     /old_locus_tag="VF0214"
                     /old_locus_tag="VF_0214"
                     /EC_number="2.7.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017009616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase"
                     /protein_id="WP_011261063.1"
                     /db_xref="GeneID:54162837"
                     /translation="MSAKHPIIAVTGSSGAGTTTTSEAFRKMFNMMDIKASWLEGDSF
                     HRFTRPEMDVEIRKAKEQGKHISYFGPQANDFPALEQFFRQYGEDGTGQYRRYLHTFD
                     EAVPFNQMPGTFTPWQDLPDDTDVLFYEGLHGGVVDGDINVSQHVDLLIGMVPIVNLE
                     WIQKFVRDTRDRGHSREAVMDSIVRSMDDYLNYITPQFSRTHINFQRVPTVDTSNPLN
                     AKGIPSLDESFVVIRFRGLSKVDFPYLLAMIDGSFMSRHNTLVVPGGKMSFAMELIIR
                     PLLQQLIDTGKIN"
     gene            complement(236700..236942)
                     /locus_tag="VF_RS01050"
                     /old_locus_tag="VF0215"
                     /old_locus_tag="VF_0215"
                     /db_xref="GeneID:54162838"
     CDS             complement(236700..236942)
                     /locus_tag="VF_RS01050"
                     /old_locus_tag="VF0215"
                     /old_locus_tag="VF_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YheU family protein"
                     /protein_id="WP_012532745.1"
                     /db_xref="GeneID:54162838"
                     /translation="MIIPWQDIAPDTLENLISEFVLREGTDYGEVEISHQEKVDQIKV
                     LLKNGEAMVVFSELHETVDIQTKARFNPNLTNHNYD"
     gene            complement(236988..237956)
                     /locus_tag="VF_RS01055"
                     /old_locus_tag="VF0216"
                     /old_locus_tag="VF_0216"
                     /db_xref="GeneID:54162839"
     CDS             complement(236988..237956)
                     /locus_tag="VF_RS01055"
                     /old_locus_tag="VF0216"
                     /old_locus_tag="VF_0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011261065.1"
                     /db_xref="GeneID:54162839"
                     /translation="MMDNFTPATGLSNAHIQTLLPRFLRRSPLFNAYWQRLELPDSDF
                     VDLAWSENPNKAGEKPLFILFHGLEGSFDSPYANGLLAAAKEQGWLGVMMHFRGCSDV
                     PNRLARAYHSGETEDARFFIEMLDARFPNQEKVATGISLGGNMLVNYLAKYQNNTLLN
                     AATVISAPLDLGACSERIQQGFSRLYQGYLLGSLKNNSIKKLNASRKEIVGLNKEMIK
                     AIPDLITFDNLITAPMHGYAHAQDYYQQCSGLQFLDRIDIPTRIIHSKDDPFMTNAVI
                     PTHPLPNCVHYQLTEHGGHVGFIDGSITKPNFWLESTVNHWFQKIL"
     gene            complement(237962..238468)
                     /locus_tag="VF_RS01060"
                     /old_locus_tag="VF0217"
                     /old_locus_tag="VF_0217"
                     /db_xref="GeneID:54162840"
     CDS             complement(237962..238468)
                     /locus_tag="VF_RS01060"
                     /old_locus_tag="VF0217"
                     /old_locus_tag="VF_0217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02444 family protein"
                     /protein_id="WP_011261066.1"
                     /db_xref="GeneID:54162840"
                     /translation="MLPSSNIPLNEHQLASITQEAFWCFSLSHYKKDGVKQAALALQD
                     TYFGNVNLALLLIWLNSLNLSFSVSDLPLLEAALHKSDTLLHSYRKLRKQIKSTQDQT
                     LYQEALRFELQIEKQQQSDLITALIRIPLVIKTDNNQISLLTHYCRSLQADALLPALE
                     SNQHNNTE"
     gene            complement(238452..240383)
                     /locus_tag="VF_RS01065"
                     /old_locus_tag="VF0218"
                     /old_locus_tag="VF_0218"
                     /db_xref="GeneID:54162841"
     CDS             complement(238452..240383)
                     /locus_tag="VF_RS01065"
                     /old_locus_tag="VF0218"
                     /old_locus_tag="VF_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011261067.1"
                     /db_xref="GeneID:54162841"
                     /translation="MITFSDIQLLRGGKPLLEQASATIHPGDKVGLVGKNGCGKSTLF
                     ALIKGELSVDAGSNRVPHNWEMAWVAQETPALERKAIDYVIDGDREFRGLEAQLAKAE
                     EADNGTLVAELHGKLETVGGYTINSRAAELLNGLGFSQQQMEWNLTQFSGGWRMRLNL
                     AQALICRSDLLLLDEPTNHLDLDAVMWLERWLQNYPGTLLLISHDRDFLDPVVNRIIH
                     VENQKLNEYTGNYSSFEVQRSEKLILQQAQYQKQQKNMAHMQSYIDRFRYKASKARQA
                     QSRIKALEKMEKVLPAQLDNPFSFNFREPDALPNPILMMDEVSAGYENNTILEQIRLN
                     LVPGSRIGLLGRNGAGKSTLIKLLSGELAPQSGVFTYSQGVKIGYFAQHQLETLHVEE
                     TPLQHLMQIAPNHTEQQLRDYLGSFGFQGDKALEKIGPFSGGEKARLVLALVVWQKPN
                     MLLLDEPTNHLDLDMRQALTMALQTFEGAMVIVSHDRYLLRATTDDLYLVHDRQVVPF
                     DGDLTDYYKWLTEQNKSERKEQQQQDKQDNPSTSTSLSAAEKKEQKRKEAEFRKLIAP
                     LRKEVTKLETRMDKLNEALSQAEEELGDVSLYEAENKKRLTEVLAIQASAKSELEEVE
                     MEWMDLQEQIEEKENAAKQ"
     gene            240600..241142
                     /gene="kefG"
                     /locus_tag="VF_RS01070"
                     /old_locus_tag="VF0219"
                     /old_locus_tag="VF_0219"
                     /db_xref="GeneID:54162842"
     CDS             240600..241142
                     /gene="kefG"
                     /locus_tag="VF_RS01070"
                     /old_locus_tag="VF0219"
                     /old_locus_tag="VF_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     ancillary protein KefG"
                     /protein_id="WP_011261068.1"
                     /db_xref="GeneID:54162842"
                     /translation="MTQLPKILVILAHPDPEQSIANKAILSAYSHLEHVTVHDLYAHY
                     PDFFIDVVFEHELLAQHDIIIFQHPLYLYSCPALLKEWMDCVLGKGFAYGNGDALKGK
                     QWRSVITAGGIEEAFSKTGYNQHSMDDILVPFKITAALCQMEWLPPSIQYWARKITVE
                     KRQQYIDEYKAWLLNPKGGI"
     gene            241142..242932
                     /gene="kefB"
                     /locus_tag="VF_RS01075"
                     /old_locus_tag="VF0220"
                     /old_locus_tag="VF0221"
                     /old_locus_tag="VF_0220"
                     /db_xref="GeneID:54162843"
     CDS             241142..242932
                     /gene="kefB"
                     /locus_tag="VF_RS01075"
                     /old_locus_tag="VF0220"
                     /old_locus_tag="VF0221"
                     /old_locus_tag="VF_0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein KefB"
                     /protein_id="WP_011261069.1"
                     /db_xref="GeneID:54162843"
                     /translation="MAGDWLHTSSIFLAAAVVTVPLAQRFGLGAVLGYLLAGIAIGPW
                     GLKLISDVDAILHFSEFGVVLLLFLIGLELNPSKLWKMRKPIIGLGGSQVVVSSVVIT
                     AAMMFFGLAWQVSLVIGMGLALSSTAIALRVIEERKLSDSESGQSGFAVLLFQDIAVI
                     PMLAILPVLAGGASGNWLDGLWVLAGVISIFTLAHFLLRPLFSYVVKSGARELFTVAA
                     LLLVIGVSAAMKQLGLSMALGAFLAGVLLAESEFRHELEVAIEPFKGLLLGLFFIAVG
                     MSVNLGLLLQYPFEILAAVLLLVVVKGLLIYGLARAFGTRAKARSQMAMILSQGGEFA
                     FVLFTAAQMEGLLSRELTAFLLVVVSISMMTTPLFLIAQDKWFARTLNSEEEMPLSDF
                     THATQPEVIIAGFGRFGQIVGRLLFANKIKLTILEADPSQIRLLRKFDYKVYYGDATQ
                     VELLRAAGAEKAKAIVVCKKDPQKVMEVVALCQRHFPHLKILARARSRVEAYELLSEG
                     VDNFSRETFYGALDLGRQTLTSLGMHPYQAKRAESHFKKLDVAMLKELLPLHSDDKSL
                     ASKAKAARIELEEIFSLEMENERSSQNHWD"
     gene            242968..243162
                     /locus_tag="VF_RS01080"
                     /old_locus_tag="VF0222"
                     /old_locus_tag="VF_0222"
                     /db_xref="GeneID:54162844"
     CDS             242968..243162
                     /locus_tag="VF_RS01080"
                     /old_locus_tag="VF0222"
                     /old_locus_tag="VF_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YheV family putative metal-binding protein"
                     /protein_id="WP_005417193.1"
                     /db_xref="GeneID:54162844"
                     /translation="MKKRFIAGAVCPSCSKEDTLRWWQESNIEYVECVDCGHTDRRTP
                     KSLEKTKHAQDDVIGVFKPE"
     gene            243219..243805
                     /gene="slyD"
                     /locus_tag="VF_RS01085"
                     /old_locus_tag="VF0223"
                     /old_locus_tag="VF_0223"
                     /pseudo
                     /db_xref="GeneID:54162845"
     CDS             243219..243805
                     /gene="slyD"
                     /locus_tag="VF_RS01085"
                     /old_locus_tag="VF0223"
                     /old_locus_tag="VF_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018396.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /db_xref="GeneID:54162845"
     gene            complement(243991..244215)
                     /locus_tag="VF_RS01090"
                     /old_locus_tag="VF0224"
                     /old_locus_tag="VF_0224"
                     /db_xref="GeneID:54162846"
     CDS             complement(243991..244215)
                     /locus_tag="VF_RS01090"
                     /old_locus_tag="VF0224"
                     /old_locus_tag="VF_0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein SlyX"
                     /protein_id="WP_011261071.1"
                     /db_xref="GeneID:54162846"
                     /translation="MTTTIEQLEQKISDLECQMAFQEQTIDELNDALSQQQLLITNMQ
                     VQMKFMVGKMKTMDSSNMADASEETPPPHY"
     gene            complement(244215..245228)
                     /locus_tag="VF_RS01095"
                     /old_locus_tag="VF0225"
                     /old_locus_tag="VF_0225"
                     /db_xref="GeneID:54162847"
     CDS             complement(244215..245228)
                     /locus_tag="VF_RS01095"
                     /old_locus_tag="VF0225"
                     /old_locus_tag="VF_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004743172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ-binding-like beta-propeller repeat protein"
                     /protein_id="WP_011261072.1"
                     /db_xref="GeneID:54162847"
                     /translation="MRAISQYIAIFVITLTLSGCFFQNSDDQRWELAPQGTTSFALSR
                     DARFALFFVKNDSIPEKNESQVKSGLHFWDLVENKELTFFGDQDQDKSTVSYIRISDN
                     SRFAITATQTNFAVWDLGMGISEGLWSISDGIIRDVAIASNGQQVLLGLSNGKAIYIN
                     LATGRRLEFLAHREKVNSVALSANGKFALSGGNDYFAYLWDTETGQILRTFEHEKRVS
                     RTALQRDGKYAFTADGGNEGFIWDLKTGEKITELSTLARQQVYSTARFSDDGQLLVTG
                     SPSGTVNVWNTTSGKKLEQWRSEPLKDARPPTAVVYDVAIDKQQRVVSATSAGIAQAW
                     LIE"
     gene            245452..246246
                     /gene="fkpA"
                     /locus_tag="VF_RS01100"
                     /old_locus_tag="VF0226"
                     /old_locus_tag="VF_0226"
                     /db_xref="GeneID:54162848"
     CDS             245452..246246
                     /gene="fkpA"
                     /locus_tag="VF_RS01100"
                     /old_locus_tag="VF0226"
                     /old_locus_tag="VF_0226"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_005417197.1"
                     /db_xref="GeneID:54162848"
                     /translation="MKSIFKVSLLAATVAFVVGCQKEEAPKTEATTLPAKIEASTESA
                     TAATFASEDEKAGYAIGASLAKYLNSNLEKQTELGLDLKKADVLAGVTDVFNGKERLT
                     DEEIQVALQNLDQRVAEIAQKKMAAESEANAKAGADFRAKFEKEDGVKKTESGLLYKV
                     ITPADGPKPKDTDTVVVHYSGTLIDGTKFDSSYDRNQPATFPLNAVIPGWTEGVQLMN
                     VGSKYKFVIPAELGYGAQGNQAIPANSTLVFDVELLEIKDAAKPAK"
     gene            246417..247121
                     /locus_tag="VF_RS01105"
                     /old_locus_tag="VF0227"
                     /old_locus_tag="VF_0227"
                     /db_xref="GeneID:54162849"
     CDS             246417..247121
                     /locus_tag="VF_RS01105"
                     /old_locus_tag="VF0227"
                     /old_locus_tag="VF_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005417199.1"
                     /db_xref="GeneID:54162849"
                     /translation="MNIENTAEESFSEVVPFTEFDHHILRSYEAVVDGIASLIGNYCE
                     IVLHSLEDINKSAIRIANGENTGRKVGSPITDLALQMLKDIERSKRNFSRSYFTRAKG
                     GVLMKSITVAIRNGDERIIGLLCININLDAPFSQVLQSFMPSEEANEAASSVNFASDV
                     DELVDQTVKRTIDEINADKEVGNNAKNKQIVMDLYDKGIFDIKDAINRVADQLNISKH
                     TVYLYIRQRKTEDGEK"
     gene            247118..247510
                     /gene="tusD"
                     /locus_tag="VF_RS01110"
                     /old_locus_tag="VF0228"
                     /old_locus_tag="VF_0228"
                     /db_xref="GeneID:54162850"
     CDS             247118..247510
                     /gene="tusD"
                     /locus_tag="VF_RS01110"
                     /old_locus_tag="VF0228"
                     /old_locus_tag="VF_0228"
                     /EC_number="2.8.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase complex subunit TusD"
                     /protein_id="WP_011261073.1"
                     /db_xref="GeneID:54162850"
                     /translation="MSLVYGLVVNGPAYGSQASRKAFQFAEAVLAQGHSIKKVFFYQE
                     GVLNASSLILPANDEVDITKQWQELALRHDIELETCVAAALRRGVIGEEEASQHQLKQ
                     HNLAVGFQQAGLGGLATALLKFDRVVQF"
     gene            247545..247901
                     /gene="tusC"
                     /locus_tag="VF_RS01115"
                     /old_locus_tag="VF0229"
                     /old_locus_tag="VF_0229"
                     /db_xref="GeneID:54162851"
     CDS             247545..247901
                     /gene="tusC"
                     /locus_tag="VF_RS01115"
                     /old_locus_tag="VF0229"
                     /old_locus_tag="VF_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase complex subunit TusC"
                     /protein_id="WP_011261074.1"
                     /db_xref="GeneID:54162851"
                     /translation="MNRLGFVFQSAPHSTSKGREGLDAILAASAYSEDIQIFFIGDGV
                     LQLLKNQEPEKILSRDYISGFKMLELYDLEEIFVCQNAMGNRGIKEEYLLIDVDSISN
                     KDINEKLSQCDQIMVF"
     gene            247902..248192
                     /gene="dsrH"
                     /locus_tag="VF_RS01120"
                     /old_locus_tag="VF_2582"
                     /db_xref="GeneID:54162852"
     CDS             247902..248192
                     /gene="dsrH"
                     /locus_tag="VF_RS01120"
                     /old_locus_tag="VF_2582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase complex subunit TusB"
                     /protein_id="WP_011261075.1"
                     /db_xref="GeneID:54162852"
                     /translation="MMLHILTSTDNLQSLHNKELPVNNENDVIIFTQDSVYAAIKDHK
                     DHSLILSFKHCYFLQEDIEARGLTKLIDDKIQRVNYSAFVSLTQDHFPIVTW"
     gene            248356..248730
                     /gene="rpsL"
                     /locus_tag="VF_RS01125"
                     /old_locus_tag="VF0230"
                     /old_locus_tag="VF_0230"
                     /db_xref="GeneID:54162853"
     CDS             248356..248730
                     /gene="rpsL"
                     /locus_tag="VF_RS01125"
                     /old_locus_tag="VF0230"
                     /old_locus_tag="VF_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005306278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_005417208.1"
                     /db_xref="GeneID:54162853"
                     /translation="MATINQLVRKPRAKQVVKSNVPALEACPQKRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGAL
                     DCAGVNDRKKGRSKYGVKRPKS"
     gene            248825..249295
                     /gene="rpsG"
                     /locus_tag="VF_RS01130"
                     /old_locus_tag="VF0231"
                     /old_locus_tag="VF_0231"
                     /db_xref="GeneID:54162854"
     CDS             248825..249295
                     /gene="rpsG"
                     /locus_tag="VF_RS01130"
                     /old_locus_tag="VF0231"
                     /old_locus_tag="VF_0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006714698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_005417210.1"
                     /db_xref="GeneID:54162854"
                     /translation="MPRRRVIGQRKILPDPKFKSELLAKFVNIVMVDGKKSTAEKIVY
                     GALDLMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
                     WMVEAARKRGEKSMAQRLANEMLDASENKGTAVKKREDVHRMADANKAFAHYRW"
     gene            249427..251523
                     /gene="fusA"
                     /locus_tag="VF_RS01135"
                     /old_locus_tag="VF0232"
                     /old_locus_tag="VF_0232"
                     /db_xref="GeneID:54162855"
     CDS             249427..251523
                     /gene="fusA"
                     /locus_tag="VF_RS01135"
                     /old_locus_tag="VF0232"
                     /old_locus_tag="VF_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006877407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011261077.1"
                     /db_xref="GeneID:54162855"
                     /translation="MARNTPIERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTTFWRGMDAQFQDHRINIIDTPGHVDFTIEVERS
                     LRVLDGAVVVFCGSSGVEPQSETVWRQADKYGVPRIVFVNKMDRAGADFLRVVDQIKN
                     RLGATPVPIQLNIGAEEDFSGVVDLIKMKRINWNEADQGMTFTYEEIPADMQELAEEW
                     RQNLVEAAAEASEELMDKYLEGEELSEAEIKEALRTRTLNNEIVLATCGSAFKNKGVQ
                     AVLDAVIEFLPAPVDVPAIKGVDENDNEVERHADDNEPFAALAFKIATDPFVGSLTFM
                     RVYSGVVNTGDAVYNSVKQKRERFGRIVQLHANKREEVKEVRAGDIAAAIGLKDVTTG
                     DTLCDQNAKVILERMEFPEPVIQIAVEPRTQADQEKMGIALGKLAAEDPSFRVETDEE
                     SGQTLISGMGELHLDIIVDRMKREFSVECNVGKPQVAYRETIRGTTEVEGKFVRQSGG
                     RGQYGHVWLKIEPSEPDAGFVFVDEIVGGAVPREYISSVAKGIEEQMHNGVLAGYPVL
                     DVKATLFDGSYLDVDSSEMAFKIAGSMAFKKGALEAQPVILEPMMKVEVTTPEDWMGD
                     VVGDLNRRRGMIEGMDDGVAGLKIIRAQVPLSEMFGYATSLRSATQGRASYSMEFAEY
                     GEVSKNIADRIIAERG"
     gene            251632..252816
                     /gene="tuf"
                     /locus_tag="VF_RS01140"
                     /old_locus_tag="VF0233"
                     /old_locus_tag="VF_0233"
                     /db_xref="GeneID:54162856"
     CDS             251632..252816
                     /gene="tuf"
                     /locus_tag="VF_RS01140"
                     /old_locus_tag="VF0233"
                     /old_locus_tag="VF_0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011151305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_005417220.1"
                     /db_xref="GeneID:54162856"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKIYGGVA
                     KDFASIDNAPEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGG
                     ILVVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSE
                     YDFPGDDLPVIQGSALGALNGEKEWEDKIVELAEALDSYIPEPERAVDQPFLLPIEDV
                     FSIQGRGTVVTGRIERGILRVGDEVEIVGIKETTMTTCTGVEMFRKLLDEGRAGENVG
                     ALLRGTKRDDVERGQVLAAKGSINPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGDITLPEGVEMVMPGDNVQMTVELIAPIAMDEGLRFAIREGGRTVGAGVVAKI
                     FA"
     gene            253229..253540
                     /gene="rpsJ"
                     /locus_tag="VF_RS01145"
                     /old_locus_tag="VF0234"
                     /old_locus_tag="VF_0234"
                     /db_xref="GeneID:54162857"
     CDS             253229..253540
                     /gene="rpsJ"
                     /locus_tag="VF_RS01145"
                     /old_locus_tag="VF0234"
                     /old_locus_tag="VF_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014268624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_005417222.1"
                     /db_xref="GeneID:54162857"
                     /translation="MQNQRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPT
                     RKERFTVLTSPHVNKDARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL
                     G"
     gene            253553..254182
                     /gene="rplC"
                     /locus_tag="VF_RS01150"
                     /old_locus_tag="VF0235"
                     /old_locus_tag="VF0236"
                     /old_locus_tag="VF_0235"
                     /db_xref="GeneID:54162858"
     CDS             253553..254182
                     /gene="rplC"
                     /locus_tag="VF_RS01150"
                     /old_locus_tag="VF0235"
                     /old_locus_tag="VF0236"
                     /old_locus_tag="VF_0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020329474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_005417224.1"
                     /db_xref="GeneID:54162858"
                     /translation="MIGLVGRKVGMTRIFTEEGVSIPVTVVEVEANRVSQVKTVETDG
                     YNAIQVTCGSKKANRVSKPEAGHFAKAGVEAGRGLWEFRLENGEEFAVGAELTVEVFN
                     EIKKVDVTGTSKGKGFQGAVKRWNFRTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKK
                     MAGHMGAERVTTQNLEIVRVDAERNLLLIKGAVPGSTGGNVIVKPAVKA"
     gene            254200..254802
                     /gene="rplD"
                     /locus_tag="VF_RS01155"
                     /old_locus_tag="VF0237"
                     /old_locus_tag="VF_0237"
                     /db_xref="GeneID:54162859"
     CDS             254200..254802
                     /gene="rplD"
                     /locus_tag="VF_RS01155"
                     /old_locus_tag="VF0237"
                     /old_locus_tag="VF_0237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010304939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_005417226.1"
                     /db_xref="GeneID:54162859"
                     /translation="MELMVKGADALTVSETTFGREFNEALVHQVVVAYAAGARQGTRA
                     QKTRSEVSGGGAKPWRQKGTGRARAGTIRSPIWRTGGVTFAAKPQDHSQKVNKKMYRG
                     ALKSILSELVRQDRLIVVDNFSVEAPKTKELVAKLKELELNDVLIVTGEVDENLFLAA
                     RNLYKVDARDVAGIDPVSLVAFDKVLMTAAAVKQVEEMLA"
     gene            254799..255101
                     /gene="rplW"
                     /locus_tag="VF_RS01160"
                     /old_locus_tag="VF0238"
                     /old_locus_tag="VF_0238"
                     /db_xref="GeneID:54162860"
     CDS             254799..255101
                     /gene="rplW"
                     /locus_tag="VF_RS01160"
                     /old_locus_tag="VF0238"
                     /old_locus_tag="VF_0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005597130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_005417228.1"
                     /db_xref="GeneID:54162860"
                     /translation="MINEERLLKVLRGPLISEKATMAAEGNNTIVFKVAINATKKEIK
                     AAVEKLFEVEVKSVNTLITKGKTKRQGLRQGRRSDVKKAYVILKEGQDLDFVGGAE"
     gene            255117..255941
                     /gene="rplB"
                     /locus_tag="VF_RS01165"
                     /old_locus_tag="VF0239"
                     /old_locus_tag="VF_0239"
                     /db_xref="GeneID:54162861"
     CDS             255117..255941
                     /gene="rplB"
                     /locus_tag="VF_RS01165"
                     /old_locus_tag="VF0239"
                     /old_locus_tag="VF_0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_005417230.1"
                     /db_xref="GeneID:54162861"
                     /translation="MAIVKCKPTSPGRRHVVKIVNADLHKGKPYAPLLEKNSKNGGRN
                     NNGRITVRHVGGGHKQHYRLIDFKRTKDGIPAVVERLEYDPNRSANIALVLFADGERR
                     YIIAPKGIQAGDTVQSGVDAPIKAGNCLPLRNIPVGSTVHCVELKPGKGAQIARSAGA
                     YAQIIARDGAYVTLRLRSGEMRKVLSEGRATIGEVGNSEHMLRELGKAGATRWRGVRP
                     TVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGMPTKGFKTRKNKSTDKYIVRRRNK"
     gene            255961..256239
                     /gene="rpsS"
                     /locus_tag="VF_RS01170"
                     /old_locus_tag="VF0240"
                     /old_locus_tag="VF_0240"
                     /db_xref="GeneID:54162862"
     CDS             255961..256239
                     /gene="rpsS"
                     /locus_tag="VF_RS01170"
                     /old_locus_tag="VF0240"
                     /old_locus_tag="VF_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011148791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_005417232.1"
                     /db_xref="GeneID:54162862"
                     /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPVKTWSRRSMIIPTM
                     INLTIAVHNGRQHVPVFVTEDMIGHKLGEFAPTRTYRGHAADKKAKKR"
     gene            256250..256582
                     /gene="rplV"
                     /locus_tag="VF_RS01175"
                     /old_locus_tag="VF0241"
                     /old_locus_tag="VF_0241"
                     /db_xref="GeneID:54162863"
     CDS             256250..256582
                     /gene="rplV"
                     /locus_tag="VF_RS01175"
                     /old_locus_tag="VF0241"
                     /old_locus_tag="VF_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_005417234.1"
                     /db_xref="GeneID:54162863"
                     /translation="MEAIAKHRFAGISPQKARLVADQVRGKSVDQALEILTFSNKKAA
                     VLVKKVLESAIANAEHNEGADIDDLNVAKIFVDEGPIMKRIMPRAKGRADRILKRSSH
                     ITIVVADR"
     gene            256602..257300
                     /gene="rpsC"
                     /locus_tag="VF_RS01180"
                     /old_locus_tag="VF0242"
                     /old_locus_tag="VF_0242"
                     /db_xref="GeneID:54162864"
     CDS             256602..257300
                     /gene="rpsC"
                     /locus_tag="VF_RS01180"
                     /old_locus_tag="VF0242"
                     /old_locus_tag="VF_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000529946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_005417236.1"
                     /db_xref="GeneID:54162864"
                     /translation="MGQKVHPNGIRLGIVKPWNATWFASSQEFADNLDGDFKVRQYLT
                     KELKKASLSRIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRAGVAKIAGVPAQIN
                     IAEVRKPELDGQLVADSIASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGA
                     EIARSEWYREGRVPLHTLRADIDYATSSAHTQYGVIGVKVWIFKGEVLGGMPAANAVE
                     PKADKPKKQRRSRK"
     gene            257312..257722
                     /gene="rplP"
                     /locus_tag="VF_RS01185"
                     /old_locus_tag="VF0243"
                     /old_locus_tag="VF_0243"
                     /db_xref="GeneID:54162865"
     CDS             257312..257722
                     /gene="rplP"
                     /locus_tag="VF_RS01185"
                     /old_locus_tag="VF0243"
                     /old_locus_tag="VF_0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017449004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_005417237.1"
                     /db_xref="GeneID:54162865"
                     /translation="MLQPKRTKFRKVMTGRNRGLAKGTEVSFGDFGLKAVGRGRLTAR
                     QIEAARRAMTRHIKRQGQIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVM
                     YEMNGVPEELAREAFRLAARKLPIKTTFVTKQVM"
     gene            257722..257913
                     /gene="rpmC"
                     /locus_tag="VF_RS01190"
                     /old_locus_tag="VF0244"
                     /old_locus_tag="VF_0244"
                     /db_xref="GeneID:54162866"
     CDS             257722..257913
                     /gene="rpmC"
                     /locus_tag="VF_RS01190"
                     /old_locus_tag="VF0244"
                     /old_locus_tag="VF_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000647192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_005417238.1"
                     /db_xref="GeneID:54162866"
                     /translation="MKAQDLREKNVEELNEELLNLLREQFNLRMQAATGQLQQTHTLK
                     AVRRDIARVKTLLNEKAGA"
     gene            257913..258167
                     /gene="rpsQ"
                     /locus_tag="VF_RS01195"
                     /old_locus_tag="VF0245"
                     /old_locus_tag="VF_0245"
                     /db_xref="GeneID:54162867"
     CDS             257913..258167
                     /gene="rpsQ"
                     /locus_tag="VF_RS01195"
                     /old_locus_tag="VF0245"
                     /old_locus_tag="VF_0245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_005417239.1"
                     /db_xref="GeneID:54162867"
                     /translation="MSEKIRTMQGRVISDKMDKSIVVAIERMVKHPIYGKYIKRTTKL
                     HAHDENNECGLGDTVEIRECRPLSKTKSWTLVNIVEKAKA"
     gene            258332..258703
                     /gene="rplN"
                     /locus_tag="VF_RS01200"
                     /old_locus_tag="VF0246"
                     /old_locus_tag="VF0247"
                     /old_locus_tag="VF_0246"
                     /db_xref="GeneID:54162868"
     CDS             258332..258703
                     /gene="rplN"
                     /locus_tag="VF_RS01200"
                     /old_locus_tag="VF0246"
                     /old_locus_tag="VF0247"
                     /old_locus_tag="VF_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005501250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_005417241.1"
                     /db_xref="GeneID:54162868"
                     /translation="MIQMQSTLDAADNSGARKVMCIKVLGGSHRRYAHIGDIIKVTVK
                     EAIPRGKVKKGDVLKAVVVRTRKGVRRPDGSIIRFDRNACVLLNDTTEQPVGTRIFGP
                     VTRELRNAKFMKIVSLAPEVL"
     gene            258717..259031
                     /gene="rplX"
                     /locus_tag="VF_RS01205"
                     /old_locus_tag="VF0248"
                     /old_locus_tag="VF_0248"
                     /db_xref="GeneID:54162869"
     CDS             258717..259031
                     /gene="rplX"
                     /locus_tag="VF_RS01205"
                     /old_locus_tag="VF0248"
                     /old_locus_tag="VF_0248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016962022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_005417243.1"
                     /db_xref="GeneID:54162869"
                     /translation="MAAKIRRNDEVIVLVGKDKGKKGKVTKVLETGKVIVEGINLVKK
                     HQKPVPALGQQGGIVEKEAAIDASNIAIYNEATGKADRIGFRFEEGKKVRFFKSNGET
                     IK"
     gene            259046..259582
                     /gene="rplE"
                     /locus_tag="VF_RS01210"
                     /old_locus_tag="VF0249"
                     /old_locus_tag="VF_0249"
                     /db_xref="GeneID:54162870"
     CDS             259046..259582
                     /gene="rplE"
                     /locus_tag="VF_RS01210"
                     /old_locus_tag="VF0249"
                     /old_locus_tag="VF_0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_011261078.1"
                     /db_xref="GeneID:54162870"
                     /translation="MAKLHDYYKSSVVAELTKEFSYTSVMQVPRVEKITLNMGVGEAI
                     NDKKLLENAAADMAIISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWEFLER
                     LISIALPRVRDFRGVSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTSA
                     NTDAEGRALLAAFNFPIP"
     gene            259604..259909
                     /gene="rpsN"
                     /locus_tag="VF_RS01215"
                     /old_locus_tag="VF0250"
                     /old_locus_tag="VF_0250"
                     /db_xref="GeneID:54162871"
     CDS             259604..259909
                     /gene="rpsN"
                     /locus_tag="VF_RS01215"
                     /old_locus_tag="VF0250"
                     /old_locus_tag="VF_0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005597110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_011261079.1"
                     /db_xref="GeneID:54162871"
                     /translation="MGKQSMKAREAKRAKLVAKFAEKRAALKVLISDVNASEEERWDA
                     VLKLQSLPRDSSASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW"
     gene            259939..260331
                     /gene="rpsH"
                     /locus_tag="VF_RS01220"
                     /old_locus_tag="VF0251"
                     /old_locus_tag="VF_0251"
                     /db_xref="GeneID:54162872"
     CDS             259939..260331
                     /gene="rpsH"
                     /locus_tag="VF_RS01220"
                     /old_locus_tag="VF0251"
                     /old_locus_tag="VF_0251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011078819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011261080.1"
                     /db_xref="GeneID:54162872"
                     /translation="MSMQDPISDMLTRVRNGQAANKVAVKMPSSKLKVAIAALLKAEG
                     YIADFAVEGDIKPELEITLKYFQAKPVIEQIQRVSRPGLRVYKKNDALPSVMGGLGIA
                     VVSTSKGLMSDRAARKAGLGGEIICYVA"
     gene            260344..260877
                     /gene="rplF"
                     /locus_tag="VF_RS01225"
                     /old_locus_tag="VF0252"
                     /old_locus_tag="VF_0252"
                     /db_xref="GeneID:54162873"
     CDS             260344..260877
                     /gene="rplF"
                     /locus_tag="VF_RS01225"
                     /old_locus_tag="VF0252"
                     /old_locus_tag="VF_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004738786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_011261081.1"
                     /db_xref="GeneID:54162873"
                     /translation="MSRVAKAPVVIPAGVEVKLNGQEITIKGGKGELTRVLNDAVVIS
                     QEDNTIVFGPREGVTNAWAQAGTARALVNNMVIGVNEGFTKKLILKGVGYRAAMKGNA
                     VGLTLGFSHPVEHALPEGIKAECPTQTEIVVTGCDKQLVGQVAADLRSYRQPEPYKGK
                     GVRYADEIVRTKEAKKK"
     gene            260887..261240
                     /gene="rplR"
                     /locus_tag="VF_RS01230"
                     /old_locus_tag="VF0253"
                     /old_locus_tag="VF_0253"
                     /db_xref="GeneID:54162874"
     CDS             260887..261240
                     /gene="rplR"
                     /locus_tag="VF_RS01230"
                     /old_locus_tag="VF0253"
                     /old_locus_tag="VF_0253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005970258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_011261082.1"
                     /db_xref="GeneID:54162874"
                     /translation="MDKKASRIRRATRARRKIAELCATRLVVHRTPRHTYAQVIAPNG
                     SEVIAAASTVEKAIREQLGSTSNKAAAEAIGKLIAERAIEKGITNVAFDRSGFQYHGR
                     VAALAESAREAGLKF"
     gene            261255..261755
                     /gene="rpsE"
                     /locus_tag="VF_RS01235"
                     /old_locus_tag="VF0254"
                     /old_locus_tag="VF_0254"
                     /db_xref="GeneID:54162875"
     CDS             261255..261755
                     /gene="rpsE"
                     /locus_tag="VF_RS01235"
                     /old_locus_tag="VF0254"
                     /old_locus_tag="VF_0254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005597103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_005417255.1"
                     /db_xref="GeneID:54162875"
                     /translation="MAKEQQQATDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNG
                     RVGFGYGKAREVPAAIQKSMEKARRNMFTIALNEGTLHHAVKGRHTGSKVYMQPAAEG
                     TGIIAGGAMRAVLEVVGVRNVLAKAYGSTNPINVVRATIAGLSSVKSPEMVAAKRGLT
                     VESISE"
     gene            261761..261940
                     /gene="rpmD"
                     /locus_tag="VF_RS01240"
                     /old_locus_tag="VF0255"
                     /old_locus_tag="VF_0255"
                     /db_xref="GeneID:54162876"
     CDS             261761..261940
                     /gene="rpmD"
                     /locus_tag="VF_RS01240"
                     /old_locus_tag="VF0255"
                     /old_locus_tag="VF_0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006647429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_005417257.1"
                     /db_xref="GeneID:54162876"
                     /translation="MSKTIKVTQTKSSIGRLPKHILCLKGLGLRRINHTVEVEDTPCT
                     RGMINKVYYMVKVEE"
     gene            261946..262380
                     /gene="rplO"
                     /locus_tag="VF_RS01245"
                     /old_locus_tag="VF0256"
                     /old_locus_tag="VF_0256"
                     /db_xref="GeneID:54162877"
     CDS             261946..262380
                     /gene="rplO"
                     /locus_tag="VF_RS01245"
                     /old_locus_tag="VF0256"
                     /old_locus_tag="VF_0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011078814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_005417259.1"
                     /db_xref="GeneID:54162877"
                     /translation="MRLNTLSPAAGSKPSKKRVGRGIGSGLGKTGGRGHKGQKSRSGG
                     KVRAGFEGGQMPLKQRLPKFGFTSRKSLVTAEVRLSELAKVEGNVIDLNSLKAANVIT
                     KNIEFAKVVLSGEIATAVTVKGLRVTKGAKAAIEAAGGKIEE"
     gene            262401..263732
                     /gene="secY"
                     /locus_tag="VF_RS01250"
                     /old_locus_tag="VF0257"
                     /old_locus_tag="VF_0257"
                     /db_xref="GeneID:54162878"
     CDS             262401..263732
                     /gene="secY"
                     /locus_tag="VF_RS01250"
                     /old_locus_tag="VF0257"
                     /old_locus_tag="VF_0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017076302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_005417263.1"
                     /db_xref="GeneID:54162878"
                     /translation="MAKKPGKEVNSAQSGLAELKSRLLFVIGALLVFRAGSFVPIPGI
                     DAAVLADLFEQQQGTIIELFNMFSGGALSRASILALGIMPYISASIVVQLLTVVHPPL
                     AELKKEGESGRRKINQYTRYGTLVLATFQAIGIATGLPSMIPGLVANPDMMFYLTATV
                     SLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGLPPAIGETIQQARQGELHVLLL
                     LLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKINMAGVIPAI
                     FASSIILFPGTLAQWFGGNGEGTFGWLTDVSMALSPGQPLYVMLYAAAIIFFCFFYTA
                     LVFNPRETADNLKKSGAFVPGIRPGEQTTKYIDKVMTRLTLAGAMYITFICLIPEFMM
                     IAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKANLKGYGR"
     gene            263763..263876
                     /gene="rpmJ"
                     /locus_tag="VF_RS01255"
                     /old_locus_tag="VF0258"
                     /old_locus_tag="VF_0258"
                     /db_xref="GeneID:54162879"
     CDS             263763..263876
                     /gene="rpmJ"
                     /locus_tag="VF_RS01255"
                     /old_locus_tag="VF0258"
                     /old_locus_tag="VF_0258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006232360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_005417265.1"
                     /db_xref="GeneID:54162879"
                     /translation="MKVRASVKKICRNCKVIKRNGVVRVICVEPKHKQRQG"
     gene            264026..264382
                     /gene="rpsM"
                     /locus_tag="VF_RS01260"
                     /old_locus_tag="VF0259"
                     /old_locus_tag="VF_0259"
                     /db_xref="GeneID:54162880"
     CDS             264026..264382
                     /gene="rpsM"
                     /locus_tag="VF_RS01260"
                     /old_locus_tag="VF0259"
                     /old_locus_tag="VF_0259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018356918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_005417266.1"
                     /db_xref="GeneID:54162880"
                     /translation="MARIAGINIPDHKHAVIALTAIYGIGKTRSQAILAEVGIAEDVK
                     ISELNDEQIDILRDGVAKYTVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPLRGQRT
                     KTNARTRKGPRKPIKK"
     gene            264404..264793
                     /gene="rpsK"
                     /locus_tag="VF_RS01265"
                     /old_locus_tag="VF0260"
                     /old_locus_tag="VF_0260"
                     /db_xref="GeneID:54162881"
     CDS             264404..264793
                     /gene="rpsK"
                     /locus_tag="VF_RS01265"
                     /old_locus_tag="VF0260"
                     /old_locus_tag="VF_0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001029758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_005303517.1"
                     /db_xref="GeneID:54162881"
                     /translation="MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAW
                     ATAGGSGFRGSRKSTPFAAQVAAERCGEMAKEYGVKNLEVMVKGPGPGRESTIRALNA
                     AGYRITNIVDATPIPHNGCRPPKKRRV"
     gene            264825..265445
                     /gene="rpsD"
                     /locus_tag="VF_RS01270"
                     /old_locus_tag="VF0261"
                     /old_locus_tag="VF_0261"
                     /db_xref="GeneID:54162882"
     CDS             264825..265445
                     /gene="rpsD"
                     /locus_tag="VF_RS01270"
                     /old_locus_tag="VF0261"
                     /old_locus_tag="VF_0261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004410410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_005417269.1"
                     /db_xref="GeneID:54162882"
                     /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGVHGAR
                     RGRLSEYGVQLREKQKVRRMYGVLEKQFRNYYKDAARLKGNTGENLLQLLEGRLDNVV
                     YRMGFGATRAESRQLVSHKSILVNGKVVNVPSFKVAANDVVSIREKAKQQSRIKAALE
                     VAEQREKPTWIEVDAGKMEGTFKRLPERSDLSADINEHLIVELYSK"
     gene            265469..266458
                     /gene="rpoA"
                     /locus_tag="VF_RS01275"
                     /old_locus_tag="VF0262"
                     /old_locus_tag="VF_0262"
                     /db_xref="GeneID:54162883"
     CDS             265469..266458
                     /gene="rpoA"
                     /locus_tag="VF_RS01275"
                     /old_locus_tag="VF0262"
                     /old_locus_tag="VF_0262"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005970247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_005417271.1"
                     /db_xref="GeneID:54162883"
                     /translation="MQGSVTEFLKPRLVDIEQVSTTHAKVTLEPLERGFGHTLGNALR
                     RILLSSMPGCAVTEVEIEGVLHEYSTKEGVQEDILEILLNLKGLAVKVEGKDEVIITL
                     NKSGAGPVVAGDITHDGDVEIANPEHVICHLTDDNAEISMRIKVERGRGYVPSTARIH
                     TEEDERPIGRLLVDATYSPVDKISYAVEAARVEQRTDLDKLVIDMETNGTLDPEEAIR
                     RAATILAEQLDAFVDLRDVRVPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIH
                     YIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
     gene            266495..266875
                     /gene="rplQ"
                     /locus_tag="VF_RS01280"
                     /old_locus_tag="VF0263"
                     /old_locus_tag="VF_0263"
                     /db_xref="GeneID:54162884"
     CDS             266495..266875
                     /gene="rplQ"
                     /locus_tag="VF_RS01280"
                     /old_locus_tag="VF0263"
                     /old_locus_tag="VF_0263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017042856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_005417273.1"
                     /db_xref="GeneID:54162884"
                     /translation="MRHRKSGRQLNRNSSHRKAMFSNMASSLVRHEIIKTTLPKAKEL
                     RRVVEPLITLAKTDSVANRRLAFARTRDNEVVAKLFTELGPRFAQRAGGYTRILKCGF
                     RAGDKAPMAYIELVDRPEVEADAE"
     gene            complement(266962..267972)
                     /gene="fbp"
                     /locus_tag="VF_RS01285"
                     /old_locus_tag="VF0264"
                     /old_locus_tag="VF_0264"
                     /db_xref="GeneID:54162885"
     CDS             complement(266962..267972)
                     /gene="fbp"
                     /locus_tag="VF_RS01285"
                     /old_locus_tag="VF0264"
                     /old_locus_tag="VF_0264"
                     /EC_number="3.1.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1 fructose-bisphosphatase"
                     /protein_id="WP_011261083.1"
                     /db_xref="GeneID:54162885"
                     /translation="MSEIRTLGEFIVAKQHDFPHASGELSSLIGSIKLAAKIVNREIN
                     KAGLVDITGASGEENIQGEQQQKLDVYANDKFKSALEARDQVCGVASEEEDEAVAFNK
                     ELNKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRISPIGTPATEEDFLQPGHKQVA
                     AGYIIYGSSTMLVYTTGNGVHGFTYDPSLGVFCLSHENMQIPKDGNIYSINEGNYIRF
                     PEGIKQYLKFCQESKPEDNRPYTSRYIGSLVADFHRNLLKGGIYLYPSTQAYPNGKLR
                     LLYECNPMAMLIEEAGGKATDGEQRILDIKPSELHQRVPFFVGSTNMVNKVHAFLDEW
                     RD"
     gene            268157..269536
                     /gene="mpl"
                     /locus_tag="VF_RS01290"
                     /old_locus_tag="VF0265"
                     /old_locus_tag="VF_0265"
                     /db_xref="GeneID:54162886"
     CDS             268157..269536
                     /gene="mpl"
                     /locus_tag="VF_RS01290"
                     /old_locus_tag="VF0265"
                     /old_locus_tag="VF_0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_011261084.1"
                     /db_xref="GeneID:54162886"
                     /translation="MHIHILGICGTFMGGAATLARQLGHKVTGCDANVYPPMSTLLES
                     QGIEIIEGFDPSQLDPAPDLVVIGNAMSRGNPCVEYVLDKNLKYTSGPQWLQEFLLQD
                     RWVMAVAGTHGKTTTSSMLAWVLEECGYKPGFLVGGVLGNFGESARLGESMFFVVEAD
                     EYDSAFFDKRSKFVHYRPRTLVLNNLEFDHADIFDDLAAIQRQFHHLIRTVPSTGRIF
                     APKQDKPLEQVLEQGCWSELEFTGEDGQWKAIKLQKDGSQFDVYFEGENVGQVNWDLV
                     GDHNVSNALMVVASARHVGVTPDLACEALGKFINTKRRLELKGEVNGVTVYDDFAHHP
                     TAIDLTLNGLRNKVGDKKIIAVLEPRSSTMKLGVHKDTLAASLHAADSVYLYQPDNIA
                     WSVDDVAQQCTQPAHTHNNIDAFVDMIVNEAQPGDQILVMSNGGFEGIHGKLLSGLGD
                     AVKHIEMVD"
     gene            269539..270156
                     /locus_tag="VF_RS01295"
                     /old_locus_tag="VF0266"
                     /old_locus_tag="VF_0266"
                     /db_xref="GeneID:54162887"
     CDS             269539..270156
                     /locus_tag="VF_RS01295"
                     /old_locus_tag="VF0266"
                     /old_locus_tag="VF_0266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UbiX family flavin prenyltransferase"
                     /protein_id="WP_005417280.1"
                     /db_xref="GeneID:54162887"
                     /translation="MSKQKAITLAMTGASGAPYGLRLLECLLAADYHVYFLISSAARV
                     VMATEHDLKLPSGPDAMKAALVEHLGCNADKLTVCGKEDWFSPVASGSAAPKQMIVCP
                     CSAGSVASIAHGISDNLIERAADVVLKERGQLILVVREAPFSTLHLENMLKLSQIGAT
                     IMPAAPGFYHQPKSIEDLIDFMVARILDHLGVEQGLVPRWGYDHR"
     regulatory      270205..270317
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            270371..271387
                     /locus_tag="VF_RS01300"
                     /old_locus_tag="VF0267"
                     /old_locus_tag="VF_0267"
                     /db_xref="GeneID:54162888"
     CDS             270371..271387
                     /locus_tag="VF_RS01300"
                     /old_locus_tag="VF0267"
                     /old_locus_tag="VF_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter substrate binding
                     subunit"
                     /protein_id="WP_011261085.1"
                     /db_xref="GeneID:54162888"
                     /translation="MKTTVTSLPVKKLSLAIALASISSFSVSASETLTVYTYDSFAAD
                     WGPGPKVEAAFEAKCGCNLELVALDDGVSILNRLRLEGKNAKADIVLGLDNNLMAEAK
                     KTGLLAQHQIDTSSVHLPNGWSDTTFIPYDFGYFAFVYNKEKVTNPPKSLKELVEQRN
                     DLKVIYQDPRTSTPGQGLLLWMKSVYGDDAAQAWKQLSKKTVTVTKGWSEAYSMFLEG
                     ESDLVLSYTTSPAYHIIAEKDQRFAAANFSEGHYTQVEVAAKVKSTKHNKLADEFLAF
                     ILSDEFQSAMPTGNWMYPVTKVELPKGFETLTVPNKALSFSSEDIAQKRKSWIREWQH
                     ALTF"
     gene            271429..273033
                     /gene="thiP"
                     /locus_tag="VF_RS01305"
                     /old_locus_tag="VF0268"
                     /old_locus_tag="VF_0268"
                     /db_xref="GeneID:54162889"
     CDS             271429..273033
                     /gene="thiP"
                     /locus_tag="VF_RS01305"
                     /old_locus_tag="VF0268"
                     /old_locus_tag="VF_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine/thiamine pyrophosphate ABC transporter
                     permease ThiP"
                     /protein_id="WP_011261086.1"
                     /db_xref="GeneID:54162889"
                     /translation="MKSRTLFNSTPLFGYIVAAIILCFVGGAISALLIESPSLDLRII
                     WSDPYYRYITQFSLYQAFLSTIISIGLAIPTAYALSRRQFIGRGLLLKLCATTLVLPV
                     LVGVFGLLAIYGNSGLIADVFTWFGASLPFSIYGLNGILLAHVFFNFPFATRLLLQSL
                     DSISIEQHQLSAHLGLMGWSKYRLVAWPRIKQQLPHVAGLVFMLCFTSFATVMALGGG
                     PKSTTIELAIYQAIKFDFDLQSGAILALWQMLLCGLLSLCIQRFSKSVSVDSASLSQV
                     VLYQDTNKAKWWDRAWITLLGLFMLPPLFMVVLSGLNSQLFVVITSPEFWSALINSLI
                     VAFGAAVIALLLGVLLLHTTRSLRLKQKRLLADKLDLIGVMILVTPGLVISTGLFLLL
                     RNITDVFSIAIWIVILVNALMALPYVIKTLAQPLLHIAQQYHLLCASLGLYGLSRFRV
                     IEWKALRKPFAHAFSIAFIMSVGDLSAIALFGSQDFRTLPLYLFQLLGSYQMEAAAVI
                     SLSLLLLSVGVFAVVEWLFLSKKRKQ"
     gene            273033..273737
                     /gene="thiQ"
                     /locus_tag="VF_RS01310"
                     /old_locus_tag="VF0269"
                     /old_locus_tag="VF_0269"
                     /db_xref="GeneID:54162890"
     CDS             273033..273737
                     /gene="thiQ"
                     /locus_tag="VF_RS01310"
                     /old_locus_tag="VF0269"
                     /old_locus_tag="VF_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter ATP-binding protein"
                     /protein_id="WP_011261087.1"
                     /db_xref="GeneID:54162890"
                     /translation="MLRFSDVKYRYYTDLFEFDLNVEQGSVVAILGPSGAGKSTLLSL
                     LAGFIEPESGDITINNESQLSLAPHQRPLSMLFQEHNLFAHLSVAENIGLGIKPNLRL
                     NEKDKKRINDAARQVGVDDLLQRLPEQLSGGQKQRVALARCLVQQKPVLLLDEPFSAL
                     DPILREEMIVLIQALIKSEKLTVLMVTHSLQDAKALASHYAFICQQKVLSQGRISELF
                     TQEKPPELTQYLQAVK"
     gene            273931..276789
                     /gene="rapA"
                     /locus_tag="VF_RS01315"
                     /old_locus_tag="VF0270"
                     /old_locus_tag="VF_0270"
                     /db_xref="GeneID:54162891"
     CDS             273931..276789
                     /gene="rapA"
                     /locus_tag="VF_RS01315"
                     /old_locus_tag="VF0270"
                     /old_locus_tag="VF_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-associated protein RapA"
                     /protein_id="WP_011261088.1"
                     /db_xref="GeneID:54162891"
                     /translation="MSFALGQRWISDTESDLGLGTVVAVDDRTVSLLFAASEENRLYA
                     KHDAPVTRVMFNKGDTIESHEGWSLDVEDVIEEGGLLTYIGTRVDTDEANVVLRETLL
                     SHQIRFNKPQDKLFAGQIDRMDRFALRFRALQNQYEQHKSPMRGLCGMRAGLIPHQLF
                     IAHEVGRRYAPRVLLADEVGLGKTIEAGMIIHQQVLSGRAERVLIVVPETLQHQWLVE
                     MMRRFNLHFSIFDEERCVEAYADSENPFDTAQFVLCSLDFIRKSKRRFEQVVEADWDL
                     LVVDEAHHLEWNQTKPSREYQVIEAIAEETPGVLLLTATPEQLGHESHFARLRLLDPD
                     RFYDYDAFVEEERQYQPVADAVTALMSGEKLSNDAKNRITELLSEQDVEPLFRIIESS
                     AAEDEQAQARQELVDNLMDRHGTGRVLFRNTRAAIKGFPQRNLNLMPMPLPSQYATSM
                     RVATMMGGRMTDEARAMKMLYPEEIFQEFEGDSATWWQFDPRVNWLLELLKENRNEKV
                     LIIASRASTALQLEQALREREGIRGTVFHEGMSIIERDKAAAYFAQEEGGAQVLICSE
                     IGSEGRNFQFANQLVMFDLPFNPDLLEQRIGRLDRIGQKRDIEIHVPYLQGTSQELLA
                     RWFDEGLNAFGETCPTGRAVYDKFADAIIAILATGKSDGLESLIEESATLNKALKSQL
                     EQGRDRLLEVHSNGGDKAKEIAEQIAATDGDTNLVNFALNLFDTIGLNQDDKGENAIV
                     VTPAENMLVSSYPGLPYEGCTITFDRETALSREDMNLISWEHPMIQGGIDLVLTEGVG
                     ATAVSLLKNKALPAGTLLLELVYVVDAQAPKQSGIARFLPKTPIRIMMDGKGNDLSAQ
                     VEFESFNRQLSPVNRHMASKLVNSVQKEIHGLIDKAEISMEERLESVRTDAEKEMKAA
                     LNSELERLQALKAVNPNIRDEELTQIGNSNERTIWLYW"
     gene            276904..277641
                     /gene="rluA"
                     /locus_tag="VF_RS01320"
                     /old_locus_tag="VF0271"
                     /old_locus_tag="VF_0271"
                     /db_xref="GeneID:54162892"
     CDS             276904..277641
                     /gene="rluA"
                     /locus_tag="VF_RS01320"
                     /old_locus_tag="VF0271"
                     /old_locus_tag="VF_0271"
                     /EC_number="5.4.99.28"
                     /EC_number="5.4.99.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017420039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tRNA pseudouridine(32) synthase/23S
                     rRNA pseudouridine(746) synthase RluA"
                     /protein_id="WP_011261089.1"
                     /db_xref="GeneID:54162892"
                     /translation="MAMLEYLPPQDPWIDIVYQDESILVVNKPSGLLSVPGRAPEHYD
                     SMWSRLKVEFPDIQVVHRLDMSTSGLMLFAMNKYSERHLKKQFQYRLTHKIYYARVWG
                     NIEQDEGEIDLPLICDWENRPKQKVCFEHGKPSQTRYQVVRREEKTTIVRLLPITGRS
                     HQLRVHMLSIGHPIVGDEFYANEEAKNFSSRLELHAAELSFYHPKSDWVRSIFVPCDF
                     YPEAQEMMFSIYDPTRKLPDYKTLKSS"
     gene            complement(277693..278130)
                     /locus_tag="VF_RS01325"
                     /old_locus_tag="VF0272"
                     /old_locus_tag="VF_0272"
                     /db_xref="GeneID:54162893"
     CDS             complement(277693..278130)
                     /locus_tag="VF_RS01325"
                     /old_locus_tag="VF0272"
                     /old_locus_tag="VF_0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020332671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_011261090.1"
                     /db_xref="GeneID:54162893"
                     /translation="MYKQILVPVDLNEKGFADKAVELAVWHAKQSNAELHLLNVLPGI
                     HMSMVSTYFPKDAAKQMKADVSEQLNKFAAKFVDEEVVYRVHVSEGKPYVTILDYAER
                     LGADLIVMPSHKRSKIDKVMLGSVASKVVENSPINVMVVKPQG"
     gene            complement(278182..280761)
                     /locus_tag="VF_RS01330"
                     /old_locus_tag="VF0273"
                     /old_locus_tag="VF_0273"
                     /db_xref="GeneID:54162894"
     CDS             complement(278182..280761)
                     /locus_tag="VF_RS01330"
                     /old_locus_tag="VF0273"
                     /old_locus_tag="VF_0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter permease"
                     /protein_id="WP_011261091.1"
                     /db_xref="GeneID:54162894"
                     /translation="MTQQSSPSQDVQEMVAQSDTGARSPQGLSGRILWFIPLCWSLFQ
                     LWYASPLPFIFDFGILNDTEARSIHLAFAIFLAFTAYPALKNSPRDRIPAIDWVLALL
                     GSFAAAYIYIFYTELAGRSGAPTTFDIVAAVTGMILLLEATRRALGPPLMVVAAVFLL
                     YTFAGPHMPDVIAHKGASLNKAMSHLWLTTEGVFGVALGVSTSFVFLFVLFGAMLEKA
                     GAGAYFIKVAFSLLGHMKGGPAKAAVVASGLSGLVSGSSIANVVTTGTFTIPLMKRVG
                     FPGTKAGAVEVAASTNGQLTPPIMGAAAFLMVEYVGISYVEVIKAALLPALISYIALL
                     YIVHLEACKAGMKGLPRRHNPTLVQSLLSFTGTILGLCIISAAVYYGIGWTKGVFGDA
                     ATPIVTIALLLSYVGLIRISAKYQEHAMMAIDEELTEVPDPGPTIKSGLHFLLPIVVL
                     VWCLTVERFSPGLSAFWASVFMIFILLTQRPLISFFTKEGDMFESVKQGFDDLLESLV
                     SGARNMIGIGVATAAAGTVVGVVTLTGIGLVMTDFVEFISGGSIILMLLFTAVISLIL
                     GMGLPTTANYIVVSTLMAPVIVTLGAAHGLIIPLIAVHLFVFYFGILADDTPPVGLAA
                     FAAAAIAKSDPIRTGIQGFTYDIRTAILPFMFIFNTQLLLMGIDSWWHLALTVISSII
                     AMLTFSAATQGWWFTKTKWWETALLLLITFSLFRPGYWWDQLYPAKDYHQGIEIAQIA
                     EGLNIGQSLELQVSGENLEGDIINKTVRLPFDERAITGEERVSSMGLMLSEVDNKMIV
                     DMVEFGSPAEASGIDFDWEIKQVVLDADRPLKEWVFVPTLLLLLALGLNQRRRAKKDN
                     LAA"
     gene            complement(281055..282029)
                     /locus_tag="VF_RS01335"
                     /old_locus_tag="VF0274"
                     /old_locus_tag="VF_0274"
                     /db_xref="GeneID:54162895"
     CDS             complement(281055..282029)
                     /locus_tag="VF_RS01335"
                     /old_locus_tag="VF0274"
                     /old_locus_tag="VF_0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010434410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TAXI family TRAP transporter solute-binding
                     subunit"
                     /protein_id="WP_011261092.1"
                     /db_xref="GeneID:54162895"
                     /translation="MALQNVIKATAVAAAMMTAGMGTASAQEFITIGTGSVTGVYYPT
                     GGAICKLVNKDRKEHNVRCSVESTGGSIYNVNTIRSGELDFGIVQSDWQYHGYNGTSK
                     FEAQGPYKKLRAMFSLHTEPFNIIARTDSGINNVADLEGKRVNIGNPGSGDRATMGVV
                     MDAMGWTNDSFKLASELKGSERSQALCDNKIDAFIYMVGHPNGSIKEATTSCDAKLVS
                     ATGPEIDKIVADNPYYAYSTVPAGMYRGTTGDVNSFGVAATMVTTSDVSDEVAYSVAK
                     AVFENFDTFKRLHPAFATLKKEDMVKAGLSIPLHPGAVKYYKEVGLLK"
     gene            complement(282360..282830)
                     /gene="argR"
                     /locus_tag="VF_RS01340"
                     /old_locus_tag="VF0275"
                     /old_locus_tag="VF_0275"
                     /db_xref="GeneID:54162896"
     CDS             complement(282360..282830)
                     /gene="argR"
                     /locus_tag="VF_RS01340"
                     /old_locus_tag="VF0275"
                     /old_locus_tag="VF_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator ArgR"
                     /protein_id="WP_011261093.1"
                     /db_xref="GeneID:54162896"
                     /translation="MRNNEKQELLVKEFKAILKAERFGSQGEIVDALRQSGFDNINQS
                     KVSRMLTKFGAVRTRNAKMEMVYCLPVELGVPTVSSSLRELVMDIDYNNALVVIHTGP
                     GAAQLIARLLDSLGKAEGILGVVAGDDTIFITPTRNIEVAELFDSVCDLFEYSV"
     gene            283104..284039
                     /gene="mdh"
                     /locus_tag="VF_RS01345"
                     /old_locus_tag="VF0276"
                     /old_locus_tag="VF_0276"
                     /db_xref="GeneID:54162897"
     CDS             283104..284039
                     /gene="mdh"
                     /locus_tag="VF_RS01345"
                     /old_locus_tag="VF0276"
                     /old_locus_tag="VF_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005504093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_005417301.1"
                     /db_xref="GeneID:54162897"
                     /translation="MKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAA
                     DLSHIPTPVSIKGYCGEDPTPALEGADVVLISAGVARKPGMDRSDLFNINAGIVKSLT
                     EKIAVTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDVIRSETFVAE
                     LKDKDPGEIRVPVIGGHSGVTILPLLSQVQGVEFTAEEVAALTPRIQNAGTEVVEAKA
                     GGGSATLSMGQAACRFGLSLVKALSGEEGVVECAYVEGNGEHARFFAQPILLGKNGVE
                     EIQSYGELSAFEQEALESMLDTLRGDIKIGEEFVQ"
     gene            complement(284128..285099)
                     /gene="ispB"
                     /locus_tag="VF_RS01350"
                     /old_locus_tag="VF0277"
                     /old_locus_tag="VF_0277"
                     /db_xref="GeneID:54162898"
     CDS             complement(284128..285099)
                     /gene="ispB"
                     /locus_tag="VF_RS01350"
                     /old_locus_tag="VF0277"
                     /old_locus_tag="VF_0277"
                     /EC_number="2.5.1.90"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_011261094.1"
                     /db_xref="GeneID:54162898"
                     /translation="MDFKAIQALTADDMAIVNETILAQLNSDVALINQLGFYIVSGGG
                     KRLRPVLAILSAKALGYEGKDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAE
                     FGNAASVLVGDFIYTRSFQMMTSLGSIKILSLMSEAVNVIAEGEVLQLMNCNDPNTTE
                     ESYMQVIYSKTARLFEAATQIGAILNDAPQEIETALQNYGKYLGTAFQLIDDVMDYTS
                     DGKDMGKNVGDDLAEGKPTLPLLHAMMHGNEEQNAMIREAIENGNGLDKLEPILACMK
                     EVGSLEYTKQKADEEADKAIAELAILPESDYKEALKALAHLAVKRSK"
     gene            285376..285687
                     /gene="rplU"
                     /locus_tag="VF_RS01355"
                     /old_locus_tag="VF0278"
                     /old_locus_tag="VF_0278"
                     /db_xref="GeneID:54162899"
     CDS             285376..285687
                     /gene="rplU"
                     /locus_tag="VF_RS01355"
                     /old_locus_tag="VF0278"
                     /old_locus_tag="VF_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000271393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_005417305.1"
                     /db_xref="GeneID:54162899"
                     /translation="MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDNVLMIANG
                     EEITVGAPLVAGGKVTAEVVQHGRGDKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIS
                     A"
     gene            285705..285962
                     /gene="rpmA"
                     /locus_tag="VF_RS01360"
                     /old_locus_tag="VF0279"
                     /old_locus_tag="VF_0279"
                     /db_xref="GeneID:54162900"
     CDS             285705..285962
                     /gene="rpmA"
                     /locus_tag="VF_RS01360"
                     /old_locus_tag="VF0279"
                     /old_locus_tag="VF_0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005369901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_005417307.1"
                     /db_xref="GeneID:54162900"
                     /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTK
                     FHAGTNVGIGKDHTLFALSEGKVKFEVKGPKNRKFVSIEAE"
     gene            286199..287371
                     /gene="cgtA"
                     /locus_tag="VF_RS01365"
                     /old_locus_tag="VF0280"
                     /old_locus_tag="VF_0280"
                     /db_xref="GeneID:54162901"
     CDS             286199..287371
                     /gene="cgtA"
                     /locus_tag="VF_RS01365"
                     /old_locus_tag="VF0280"
                     /old_locus_tag="VF_0280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009847831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Obg family GTPase CgtA"
                     /protein_id="WP_011261095.1"
                     /db_xref="GeneID:54162901"
                     /translation="MKFVDEATIKVDAGDGGNGVVSFWREKFVAKGGPDGGDGGDGGD
                     VYLEADENLNTLIDYRFNRFYNAERGKNGSGGNCTGKRGEDITLKVPVGTRAIDIDTG
                     EKVAELMTHGMKQMVAKGGWHGLGNTRFKSSVNRAPRQKTLGTKGEVRELRLELLLLA
                     DVGMLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVRARGNKSFVVADIPGLI
                     EGAADGAGLGVRFLKHLERCRVLLHVIDILPIDGSDPVQNALTIIDELEQYSEKVASK
                     PRWLLFNKTDLLLEEEADEKINEILEALAWEDRYFKIAAVSRTGTQELCDELADFMDT
                     LPKEIQTEEEKAANKVDFMWDDYHKDAMSGKDVVTEDDWDDWDDEEDDGHVIYVRD"
     gene            287505..288275
                     /locus_tag="VF_RS01370"
                     /old_locus_tag="VF0281"
                     /old_locus_tag="VF0282"
                     /old_locus_tag="VF_0281"
                     /db_xref="GeneID:54162902"
     CDS             287505..288275
                     /locus_tag="VF_RS01370"
                     /old_locus_tag="VF0281"
                     /old_locus_tag="VF0282"
                     /old_locus_tag="VF_0281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine/serine exporter family protein"
                     /protein_id="WP_011261096.1"
                     /db_xref="GeneID:54162902"
                     /translation="MDEKQREISRLVAKAGQMLLQHGAESSLVSDVSRRLGIAVGADD
                     VEVSLSASSLVITTVINEHCMTTTRRAPDRGINMRAVTEIQRICIMSEKGLLDRHDAT
                     EKLEKVSPERYNRWLVVVMIGLSCASFSRLAGGDWAVFLVTFIASALGMIVRQEIGHR
                     NFNPLLNFGVTAFVTTLISSQAVIYHIGNTPFLAMASSVLMLVPGFPLINAVADMVKG
                     YVNMGTARWTFATLLTLATSIGIVGAMNLVGAWGWLNG"
     gene            288268..288759
                     /locus_tag="VF_RS01375"
                     /old_locus_tag="VF0283"
                     /old_locus_tag="VF_0283"
                     /db_xref="GeneID:54162903"
     CDS             288268..288759
                     /locus_tag="VF_RS01375"
                     /old_locus_tag="VF0283"
                     /old_locus_tag="VF_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine/serine exporter family protein"
                     /protein_id="WP_005417313.1"
                     /db_xref="GeneID:54162903"
                     /translation="MDSLSLSSGLALFIALLNDMFFAMIPAVGFALVFNVPVKALKYC
                     AIGGAIGHGSRFLLLHFGVPLEWATLCAATTVGMIGVHWSHRFLAHPKVFTVAALIPM
                     VPGVFAFKAMIAVVEINHLGYSPELWAMMIDNLIKTLFTVAALAIGLAMPGLLFYRRK
                     SIV"
     gene            288782..289261
                     /gene="folA"
                     /locus_tag="VF_RS01380"
                     /old_locus_tag="VF0284"
                     /old_locus_tag="VF_0284"
                     /db_xref="GeneID:54162904"
     CDS             288782..289261
                     /gene="folA"
                     /locus_tag="VF_RS01380"
                     /old_locus_tag="VF0284"
                     /old_locus_tag="VF_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 3 dihydrofolate reductase"
                     /protein_id="WP_047863682.1"
                     /db_xref="GeneID:54162904"
                     /translation="MKISMIAAMAKNRIIGIDNQMPWHLPADFAWFKKCTMGKPIVMG
                     RKTYESIGRPLPGRLNIVLSRDANLQIDGVTCVTSIEEAKQAAGDIEELMIIGGGSIY
                     QACLSDADKLYLTFIDADINGDTQFPDWGEGWNQTHSETYSKDEKNQYDMEFVVLER"
     gene            complement(289516..290331)
                     /gene="apaH"
                     /locus_tag="VF_RS01385"
                     /old_locus_tag="VF0285"
                     /old_locus_tag="VF_0285"
                     /db_xref="GeneID:54162905"
     CDS             complement(289516..290331)
                     /gene="apaH"
                     /locus_tag="VF_RS01385"
                     /old_locus_tag="VF0285"
                     /old_locus_tag="VF_0285"
                     /EC_number="3.6.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase
                     (symmetrical)"
                     /protein_id="WP_011261098.1"
                     /db_xref="GeneID:54162905"
                     /translation="MATYFVGDIQGCLDELLLLLERVEFNREKDQLWLTGDLVARGPK
                     SLETLRFVKSLGNAAVTILGNHDLHLLAVSQGISRVKEKDKTAPIFTAPDSEELLTWL
                     RHQPLLAVHSEYDIVMTHAGISPQWNMATAIDCAREVESVLLSDKWVLLLENMYENYP
                     DTWDVTLSGIDRYRYIINAFTRMRFCHLDGRLDMECKLPPQDINSDELVPWFELENRL
                     PLSHKVIFGHWAALMGHDGNNVIALDTGCVWGEYMTMYRVDDGKYFTQKAIEQ"
     gene            complement(290404..291222)
                     /gene="rsmA"
                     /locus_tag="VF_RS01390"
                     /old_locus_tag="VF0286"
                     /old_locus_tag="VF_0286"
                     /db_xref="GeneID:54162906"
     CDS             complement(290404..291222)
                     /gene="rsmA"
                     /locus_tag="VF_RS01390"
                     /old_locus_tag="VF0286"
                     /old_locus_tag="VF_0286"
                     /EC_number="2.1.1.182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (adenine(1518)-N(6)/adenine(1519)-N(6))-
                     dimethyltransferase RsmA"
                     /protein_id="WP_005417325.1"
                     /db_xref="GeneID:54162906"
                     /translation="MSTRNDVHLGHKARKRFGQNFLNDPYVIDGIVSAINPLPGQNLV
                     EIGPGLGAITEPVGREVDKFTVIELDRDLAERLRNHPELGSKLTIHEGDAMRFDFTQL
                     IKENNKLRIFGNLPYNISTPLMFHLFEFHKDVQDMHFMLQKEVVNRLAAGPGTKAYGR
                     LTVMAQYFCKVMPVLEVPPTAFVPPPKVDSAVVRLVPYETLPYPATNLKWLDRVCREG
                     FNQRRKTVRNCYKALLTKEQLEELGINPSMRPENLTLEQFVNMANWLDANHSAE"
     gene            complement(291219..292208)
                     /gene="pdxA"
                     /locus_tag="VF_RS01395"
                     /old_locus_tag="VF0287"
                     /old_locus_tag="VF_0287"
                     /db_xref="GeneID:54162907"
     CDS             complement(291219..292208)
                     /gene="pdxA"
                     /locus_tag="VF_RS01395"
                     /old_locus_tag="VF0287"
                     /old_locus_tag="VF_0287"
                     /EC_number="1.1.1.262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase
                     PdxA"
                     /protein_id="WP_017018275.1"
                     /db_xref="GeneID:54162907"
                     /translation="MNNIKRIAITPGEPSGIGPDLVIAIAQQDWPHQLVICGSKQVLA
                     ERAAQLGIQIQIEDYNAQLAATSHKAGTLLVEDIELGSSVIAGELNEANGHYVLETLR
                     RAAQGNMDGEFDAVVTGPVHKGVINRAGVAFSGHTEFFAEQSNTQQVVMMLATEGLRV
                     ALVTTHIPLAYVSKAITADRLKQVTRILHQDLITKFGIANPSIFVCGLNPHAGEDGCL
                     GREEIDIIAPALNELREQEGMNLIGPLPADTLFQDKYLQEADAVLAMYHDQGLPVLKF
                     KGFGKSVNITLGLPFIRTSVDHGTALELAGTGKADAGSFITALTHAIELVENK"
     gene            complement(292201..293514)
                     /gene="surA"
                     /locus_tag="VF_RS01400"
                     /old_locus_tag="VF0288"
                     /old_locus_tag="VF_0288"
                     /db_xref="GeneID:54162908"
     CDS             complement(292201..293514)
                     /gene="surA"
                     /locus_tag="VF_RS01400"
                     /old_locus_tag="VF0288"
                     /old_locus_tag="VF_0288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase SurA"
                     /protein_id="WP_005417328.1"
                     /db_xref="GeneID:54162908"
                     /translation="MKNWKFPLISTLLLLLTINVHAAPVELDRVVAIVDEGVVLQSDI
                     DTSLKTVKINAQEKGQPLPDEAVLREQVLEKLIVDTIQSQQAEKMGIRIDDTRLEAAL
                     NDIAKENNMTLAQLQQKTAAQGLPYANFREQIRKEIAASEARNAQVRRRINILPQEVE
                     SLAQLLAEETQATVQYKISHIQLRVEDGATQADKEALEKQAEDLTERLKQGADFATMA
                     YTYSKGPKALQGGDWGWMRKEEMPTIFADQITGQGKNSIIGPFRSGVGFHILKIDDVK
                     GLETVAVTEVNARHILIKTSVIMSDEGAQRLLNTIIDDIKSGKETFADMAQRYSQDPG
                     SAANDGELGFQTPDLYVPEFKHQVETLPVGQISAPFKTVHGWHIAEVLERRQVDRTDA
                     AMKNKAYRILLNRKFNEEAGAWLQEIRASAYVEILQDDDGEDDNE"
     gene            complement(293582..295942)
                     /gene="lptD"
                     /locus_tag="VF_RS01405"
                     /old_locus_tag="VF0289"
                     /old_locus_tag="VF_0289"
                     /db_xref="GeneID:54162909"
     CDS             complement(293582..295942)
                     /gene="lptD"
                     /locus_tag="VF_RS01405"
                     /old_locus_tag="VF0289"
                     /old_locus_tag="VF_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS assembly protein LptD"
                     /protein_id="WP_011261100.1"
                     /db_xref="GeneID:54162909"
                     /translation="MSFTSRSLLASFTGCLLYGTPAIADNGSEPVSPENGIVFPLQTD
                     AVNSCEVPDKKSKEEEDQQPVLIQADSVEASNNSKAVYKGNVHIIKGRQEIKADSITL
                     HQQENIAIAEGNVDYSSMEMRTTSDKVTTNLSTEDTTMVNTAYKMSCQPIRGQAGRVL
                     KTGQEIYQLEDASFTTCPADDNSWRFKASDIELDQSDEWATFYNARFEVLDVPIFYLP
                     YVTVPVGDTRKTGVLIPSIGLDSKNGFELSVPIYWNIAPNYDATTTINYMERRGTQLE
                     TEFRYLTELGKGTVDAEYLNEDDKFKDKGSRWGVSWDHSGIYQQHWKFDVEYSKVSDI
                     DYFQDLNSSIGTRDEGQLQQSGEVSYRSQDWDMTMRVRDFQVLVEEQTPYRLMPQIEF
                     NYYAPQFYSEFDFNLHSHISKFTTDDKAKPSATRVHLEPKLSLPLSGTWWSLIPETSL
                     LYTYYQQDFDKQPVGPNGSLNLDHEVSRTIPEVRINGAIYLDSTHKFLGEYLQTLEPK
                     IQYLYVPEVDQSNIYGGTGDGGYDSSKLQLDYYGLFRDRQYSGVDYIADANQFSVGAT
                     SRFYDDAYKERMNISFGQILYLNGSGTEQNNDDKNSSAWAMESDFNYDDYLFYHGGIQ
                     YDSNVSELQVANSTLEYRFSKGYIQANYRYVSKNYIESNVNFEDDLSLITQHGIYQAG
                     LLSEYNLGRNWALKGQYFHDTKEDQMIEALVGVTYLSDCWSFGLTYSDQLIAPESAKT
                     IGTYEPEYESNLMLSIAIRGLGNNTGITSGSANNALDYGRPFYLNN"
     gene            296149..297000
                     /gene="djlA"
                     /locus_tag="VF_RS01410"
                     /old_locus_tag="VF0290"
                     /old_locus_tag="VF_0290"
                     /db_xref="GeneID:54162910"
     CDS             296149..297000
                     /gene="djlA"
                     /locus_tag="VF_RS01410"
                     /old_locus_tag="VF0290"
                     /old_locus_tag="VF_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone DjlA"
                     /protein_id="WP_005417332.1"
                     /db_xref="GeneID:54162910"
                     /translation="MQIFGKILGGFFGFLFGGFFGAALGIFIGHQFDKAKRMANSGFT
                     FQTGGASQTQRQAEFFHAAYAVMGHVAKAKGQVTREEIQLASMMMDRMNLSDEQKREA
                     QEAFREGKESDFPLRETLRNIRSITGGRYDLLQFFLELQIAAAIADGDIHPSERDVLH
                     IVAEELGFSAEQLEKRLRMQEAAFRFQQGGGFSGHQSGGSHQQGQWQQASSASQLKDA
                     YNLLGISEDADPKTIKRAHRKLMNEHHPDKLVAKGLPPEMMNMAKEKAQEIQAAYDLI
                     KKEKGIK"
     gene            complement(297067..297846)
                     /locus_tag="VF_RS01415"
                     /old_locus_tag="VF0291"
                     /old_locus_tag="VF_0291"
                     /db_xref="GeneID:54162911"
     CDS             complement(297067..297846)
                     /locus_tag="VF_RS01415"
                     /old_locus_tag="VF0291"
                     /old_locus_tag="VF_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF547 domain-containing protein"
                     /protein_id="WP_011261101.1"
                     /db_xref="GeneID:54162911"
                     /translation="MKTFISSLLLLFSFNTFAAPKSELWSYWNVSNEKNATTISHQYW
                     QQTLDKYLITRGEFTLFDYAHVTDADERTLNSYLRQMSRIDPREYKKSEQYAYWVNLY
                     NALTVKLILMDYPIESITKLGGLFSFGPWDEEIITVAGKALTLNDIEHRILRPIWNDP
                     RTHYAVNCASLGCPNLQPKAFTARNSDKLLDKAATEFINSDKGVLIKEENVQLSSIYD
                     WFAIDFGSQQQLFEHLKKYRPELKPFKGDIRYDYNWKLNQQ"
     gene            complement(297969..298571)
                     /gene="leuD"
                     /locus_tag="VF_RS01420"
                     /old_locus_tag="VF0292"
                     /old_locus_tag="VF_0292"
                     /db_xref="GeneID:54162912"
     CDS             complement(297969..298571)
                     /gene="leuD"
                     /locus_tag="VF_RS01420"
                     /old_locus_tag="VF0292"
                     /old_locus_tag="VF_0292"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="WP_011261102.1"
                     /db_xref="GeneID:54162912"
                     /translation="MSGFKQHTGLVVPLDTANIDTDAIIPKQFLQKVNRIGFGKHLFH
                     DWRFLDDAGEQPNPEFVMNAPRYQGATVLLARENFGCGSSREHAPWSLADYGIQVMIA
                     PSFADIFYGNSINNQMVPVRLTESEVDEIFQFVEANEGAEVTVDLEAMLVTANNKQYS
                     FEIDEFRRHCLLNGLDNIGLTLQHADKISEYEAKIPSFLK"
     gene            complement(298584..299999)
                     /gene="leuC"
                     /locus_tag="VF_RS01425"
                     /old_locus_tag="VF0293"
                     /old_locus_tag="VF_0293"
                     /db_xref="GeneID:54162913"
     CDS             complement(298584..299999)
                     /gene="leuC"
                     /locus_tag="VF_RS01425"
                     /old_locus_tag="VF0293"
                     /old_locus_tag="VF_0293"
                     /EC_number="4.2.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="WP_011261103.1"
                     /db_xref="GeneID:54162913"
                     /translation="MSNAKTLYEKIYDAHVAVAAEGENPILYIDRHLVHEVTSPQAFD
                     GLREKGRKVRQVGKTFATMDHNVSTQTKDINASGEMARIQMETLSKNCEEFGVTLYDL
                     NHKYQGIVHVMGPELGITLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLATQTL
                     KQARAKTMKIDVKGKVAEGITAKDIVLAIIGKTTAAGGTGYVVEFCGEAITDLTMEGR
                     MTVCNMAIELGAKAGLIAPDQTTFDYIAGRKFSPQDADLDAAIEYWSSLKTDDDAEFD
                     AVVTLDASEIKPQVTWGTNPGQVIAVDAPIPAPESFADPVEKASAEKALAYMGLEAGK
                     SLSDYNVDKVFVGSCTNSRIEDMRAAAAIAKGRKVASHVQALIVPGSEQVKAQAEKEG
                     LDVIFKEAGFEWRLPGCSMCLAMNNDRLGPHERCASTSNRNFEGRQGRDGRTHLVSPA
                     MAAAAAIAGHFVDIRTITEQA"
     gene            complement(300015..301106)
                     /gene="leuB"
                     /locus_tag="VF_RS01430"
                     /old_locus_tag="VF0294"
                     /old_locus_tag="VF_0294"
                     /db_xref="GeneID:54162914"
     CDS             complement(300015..301106)
                     /gene="leuB"
                     /locus_tag="VF_RS01430"
                     /old_locus_tag="VF0294"
                     /old_locus_tag="VF_0294"
                     /EC_number="1.1.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012126925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_005417339.1"
                     /db_xref="GeneID:54162914"
                     /translation="MTNKTYKIAVLPGDGIGPEVMEQAHKVLDAIEKKHAISFSREQH
                     DVGGIAIDNHGCPLPESTVKGCEESDAVLFGSVGGPKWEHLPPNDQPERGALLPLRKH
                     FQLFCNLRPAQIHKGLENFSPLRADISERGFDIVVVRELTGGIYFGQPKGREGEGPQE
                     KAYDTEIYHRYEIERIAKIAFESARLRNKNVYSIDKANVLQSSILWREVVEEVAKGYP
                     DVTLNHMYIDNATMQLIKDPSQFDVMLCSNIFGDIISDECAMITGSMGMLPSASLNES
                     NFGLYEPAGGSAPDIAGKNIANPVAQILSAALMLRYSLGEEEAAQSIEAAVSKALSAG
                     ELTADLAGDKPALTTSAMGDKIAEYILNS"
     gene            complement(301188..302735)
                     /gene="leuA"
                     /locus_tag="VF_RS01435"
                     /old_locus_tag="VF0295"
                     /old_locus_tag="VF_0295"
                     /db_xref="GeneID:54162915"
     CDS             complement(301188..302735)
                     /gene="leuA"
                     /locus_tag="VF_RS01435"
                     /old_locus_tag="VF0295"
                     /old_locus_tag="VF_0295"
                     /EC_number="2.3.3.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005528614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_011261104.1"
                     /db_xref="GeneID:54162915"
                     /translation="MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIE
                     AGFPVSSPGDFESVKTIAQHIKNSRICGLSRAVAKDIDAAAEALKVAEAFRIHTFIST
                     STVHVQDKLRRSYDDVVEMGVKAVKHARKYTDDVEFSCEDAGRTPIDNLCRMVEAAID
                     AGANTINIPDTVGYTVPGEFGGIVQTLFNRVPNIDKAIISVHCHDDLGMSVANSIAAV
                     QAGARQVEGTINGIGERAGNCSLEEIAMILKTRSEYLGVHTNLKHDEIHRTSKLVSQL
                     CNMPIQSNKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESIGLKNQALNLTSRSGR
                     AAVKSHMDEMGYKEDEYNLDTLYADFVKLADRKGQVFDYDLEALMHFANLRDEDDFYK
                     LNYLSVQSGSVMATTSIKLLCGDEEKCEAAVGNGPVDALYQCIYKLTGYDIVLDKFDL
                     TAKGEGEDGLGQADIIANYKGRKYHGTGLATDIIEASGQALLHVINSIHRADQIAEIK
                     QKKVETV"
     gene            303219..303863
                     /locus_tag="VF_RS01440"
                     /old_locus_tag="VF0296"
                     /old_locus_tag="VF_0296"
                     /db_xref="GeneID:54162916"
     CDS             303219..303863
                     /locus_tag="VF_RS01440"
                     /old_locus_tag="VF0296"
                     /old_locus_tag="VF_0296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_011261106.1"
                     /db_xref="GeneID:54162916"
                     /translation="MKQSGRPKGESEVREKLIFHARELFISMPYNKVSTRLIATNANV
                     NIAMIRYYFGNKEGLFEAMFKETIAPVTQQFQRLLKDDTEQDLVEFMRAYYKAMIKVP
                     AFPKLILRIMDAESEQQAALQQIIIGILQPMQNKLFDPQKSKALFKNGVDPIKARLSL
                     MSLMIFPFLAPKKMLELHNIELNETFLMELLEHNIRLLGEGLLKNKRDTDNENK"
     gene            303850..305169
                     /locus_tag="VF_RS01445"
                     /old_locus_tag="VF0297"
                     /old_locus_tag="VF_0297"
                     /db_xref="GeneID:54162917"
     CDS             303850..305169
                     /locus_tag="VF_RS01445"
                     /old_locus_tag="VF0297"
                     /old_locus_tag="VF_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_011261107.1"
                     /db_xref="GeneID:54162917"
                     /translation="MKINKKYLFFPVVAVGVIVLITITKLRPDAETKPLEDRSKVVNI
                     QLLEPQSIAPQAIGYGKIRPKFEWKAIAEVSGKVVYRHPELHKGNILLAGTEVLRIDP
                     LDYELKLAQAEADLGSSQTQLAKVDLEEKNIRNTLKIEKNRLSISKKELSRKINLQKK
                     GLTSQSDLDQQNQSYLAQQKVVQDIQNQILLLPDEKKVAAAMVKVNQAKLEEAQRSLE
                     KTSIILPTDVRISEVDIEADQVVNLQQTMFIAHGIKTMEMEAQISIHDMQTLAQSVKA
                     FQLSEQGMPNIDSLPLTANVELSSGRFDAKWEAKVARISETVDPNQATVGVILEIDQN
                     YRALQPNSLPPLVNGMFVKARIEGDASEQWVIPESALHGDKIYLLGQDNKLIILPIEI
                     VYRRNNQVAVAGDIKSHDRLILNDLLPAINGMQLRLAKSHNDEEPVQ"
     gene            305166..308270
                     /locus_tag="VF_RS01450"
                     /old_locus_tag="VF0298"
                     /old_locus_tag="VF_0298"
                     /db_xref="GeneID:54162918"
     CDS             305166..308270
                     /locus_tag="VF_RS01450"
                     /old_locus_tag="VF0298"
                     /old_locus_tag="VF_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter permease subunit"
                     /protein_id="WP_011261108.1"
                     /db_xref="GeneID:54162918"
                     /translation="MIKFFARHPTAANLLMLTLLLLGLVSLSQLKRETFPEFSPPYIL
                     AGVVYPGASPQEVEESICIRMEDAVDGLGNIEETKCEAIEGSARLVIKLNEKADIGRM
                     LVDVQTQIDSINDFPTEIESPIVQELDWNEPVVDVAITADTTWPELKAYAEKLKQSLK
                     LDYDVSLVEVSGFSDHQYRVELDETAIRQLGLNVSDIANQLAQQNIKLPSGNIETPEK
                     NFLIRFDERKTTPEELAKTVIGASENGALLRLGDIATITDRFELDEQKVLFDGKPSAV
                     LKISKNKADDALRIKDRVSEFVEYQQSIAPDGVTLEMTNDLSSLLWDRLTMMVKNGWQ
                     GIILVFLTMWLFFTFRYSFWVAAGLPVAFLGGLFLMASLGLSINIMSLVALLMAIGIM
                     MDDAIVIAESIASHLDRGQKIDDAVYNGVKKVFPGVLSSFLTTVCIFGSLMFLQGEMG
                     AVLKVIPQVLILVLSLSLIEAFLILPNHLSHSLHRAKNDKPITGFKKKVLDRFEHFRN
                     TTLVNAVTKVVEWRYAFLGAVIASLLVSFSLISGGALKFVGFPELDGDIAEARIILPP
                     GSSLSQTELVVDKIVNAANKLNKQWSEEKEGGTPLVEHITEQFNTNADANESGPHLAT
                     IRLDLLSAEKRNTLIDDFIDAWREEVGDLAEPIAMVFKQPTMGPGGRAIEIRMMDDDL
                     HTLKSASLEVQAYLNDFAGVYGVLDDMRMGKEEVLVKLRPGAEAYGVTGQLIANQLRA
                     AYFGQTADEIQLGVENIEIEVRLNKQQAGDLHTLENFPIILPTGDQIPLASIATLDFQ
                     RNYVRIQRINGLRTLSVFGDVHASQVSSTEILNQFKKDLAPELKKKYPGLRFDFEGEA
                     KDSAETGQSIGTGFMLGLFGVFVILSFQFRSYLEPFVVMLAIPLALIGVLWGHVLLGH
                     PLSMPSIMGFVSLAGIVVNDSILLVQYIRHHVDDGDSVYESVIKASRERFRAVFLTSI
                     TTAAGLLPLLLETSLQAQVIQPLVVSIVFGIFTSTLLVLFMIPAAYAILADFGLVKKH
                     EELH"
     gene            complement(308282..309283)
                     /locus_tag="VF_RS01455"
                     /old_locus_tag="VF0299"
                     /old_locus_tag="VF0300"
                     /old_locus_tag="VF_0300"
                     /db_xref="GeneID:54162919"
     CDS             complement(308282..309283)
                     /locus_tag="VF_RS01455"
                     /old_locus_tag="VF0299"
                     /old_locus_tag="VF0300"
                     /old_locus_tag="VF_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF481 domain-containing protein"
                     /protein_id="WP_011261109.1"
                     /db_xref="GeneID:54162919"
                     /translation="MLKKGLLTGLIAISASVHASEIDIEDADTSSSSPNSIEIDYGND
                     RSLSQNCSLESVYTSGTNSHVDEEKYYLSKDDCEAGTKELTLEKKPSINPVISQLEAE
                     MEEPDTTPPSPWKSQIEFGYQSSKGNDDSQSLNGRLEASYTAGQHRHTGEVKYYLAKD
                     DGETDKDQLSLNLQSDYKISPDYYLYANFKGLNTKYSAYFNDYTFSGGLGYQVSNTEK
                     LLLEVEFGPGFRYQNPNLDEIDDDDLILPETVQEPIIRTNVRTSWKALSNLTLAGEVT
                     VTAGHSNTRVDSEVSVTNNITEEIALKIAQSQQYLDRVPPGLSNTDSVFSINLLFSF"
     gene            309465..310862
                     /locus_tag="VF_RS01460"
                     /old_locus_tag="VF0301"
                     /old_locus_tag="VF_0301"
                     /db_xref="GeneID:54162920"
     CDS             309465..310862
                     /locus_tag="VF_RS01460"
                     /old_locus_tag="VF0301"
                     /old_locus_tag="VF_0301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_005417345.1"
                     /db_xref="GeneID:54162920"
                     /translation="MADNRKQNRKPDAQVDALKVPPHSLEAEQSVLGGLLLDNERWDT
                     VAEKVVASDFYSRPHRLIFESLKAILEDSLPLDLITLSEHLERHENLDSVGGFAYLAD
                     LAKNTPSAANINAYADIVRERAMVRNLIGVANEIADAGYDPQGRTSEDLLDMAESKVF
                     AIAEERTTENEGPQNVDSILEKTLERIEILYQTPQDGVTGVSTGFTDLNKKTAGLQGS
                     DLIIVAARPSMGKTTFAMNLCENAAMDQDKPVLIFSLEMPAEQLMMRMLASLSRVDQT
                     KIRTGQLDDEDWARISSTMGILTQKKNMYIDDSSGLTPTELRSRARRVARESGGLSMI
                     MVDYLQLMRVPGLQDNRTLEISEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPI
                     NSDLRESGAIEQDADLIMFIYRDEVYNPESNRKGIAEIIIGKQRNGPIGSVSLTFQGQ
                     FSRFDNYAGPAFDDE"
     gene            310875..311957
                     /gene="alr"
                     /locus_tag="VF_RS01465"
                     /old_locus_tag="VF0302"
                     /old_locus_tag="VF_0302"
                     /db_xref="GeneID:54162921"
     CDS             310875..311957
                     /gene="alr"
                     /locus_tag="VF_RS01465"
                     /old_locus_tag="VF0302"
                     /old_locus_tag="VF_0302"
                     /EC_number="5.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_011261110.1"
                     /db_xref="GeneID:54162921"
                     /translation="MSYMKAATAQIDMSALAHNLQKIKQQAPSSKLLAVVKANGYGHG
                     LLNIAKGAQGADAFGVARIEEALQLRAGGIVKPILLLEGFYSAGDLPILVTNNIQTAI
                     HCKEQLEALESTDLEFPVVAWLKVDSGMHRLGIRPEEFQEYVDRLHACKNVAKPLRYM
                     SHFGCADELDSSTTTEQIDTFMSLTKGCQGERSLAASAGLLAWPDSRLDWVRPGIIMY
                     GVSPFAEQSAQELGYLPTMTLTSHLIAVRDVKAGESVGYGAIWTSERDTKIGVIAIGY
                     GDGYPRTAPNGTPVLVNGRKVPIAGRVSMDMLTVDLGPDAQDKVGDEAILWGRDLPSE
                     EVAEHIGTIAYELVTKLTSRVQMQYT"
     gene            311969..313174
                     /locus_tag="VF_RS01470"
                     /old_locus_tag="VF0303"
                     /old_locus_tag="VF_0303"
                     /db_xref="GeneID:54162922"
     CDS             311969..313174
                     /locus_tag="VF_RS01470"
                     /old_locus_tag="VF0303"
                     /old_locus_tag="VF_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_162200315.1"
                     /db_xref="GeneID:54162922"
                     /translation="MNSFSFKSATGLALFLISHLAFSESDIWPTSLPETAAVPFMYSS
                     ESLGTTIGAAGVMKGVGQPQATLFAAGLYSSKGSYLTYLSANNFQISHSWLVGANAYN
                     ASFKDMDYHLGAAGNNDSLPEQEVFTDSVEAQYHLTAQYVLPIGNGESLGARAAYQPE
                     RKIKGFNPLDSGVSSIELSPFYYSRELSDVAGWNELESNWGMKVHFDWDNRNSVRNTT
                     HGSRTELDFTYSPEASSQQEWWTWEFQQSAFFDLGSLGDVINKQVLALDMYVADTPSW
                     DEQHQPPEYAGIKLGGLYRLRSFGGGRFHGRSAVHYSAEYRVMPDWQPLEEWPIFNLY
                     DVPWWQWVAFVDAGRVADEFSLSTLHSDMKWSAGGAIRFQVEGIVVRTEMAWGNEESQ
                     FRVMINQPF"
     gene            313389..315041
                     /gene="pgi"
                     /locus_tag="VF_RS01475"
                     /old_locus_tag="VF0304"
                     /old_locus_tag="VF_0304"
                     /db_xref="GeneID:54162923"
     CDS             313389..315041
                     /gene="pgi"
                     /locus_tag="VF_RS01475"
                     /old_locus_tag="VF0304"
                     /old_locus_tag="VF_0304"
                     /EC_number="5.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017051397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_011261112.1"
                     /db_xref="GeneID:54162923"
                     /translation="MLKNINPTETQAWADLTAHFETAQDFNLSDLFAADAQRFDKFSA
                     TFGQDILVDFSKNLITEETMKKLFALAEQTELSSAITAMFSGEKINKTEGRSVLHTAL
                     RNRSNTPVMVDGEDVMPAVNAVLEKMKGFTERLISGEWKGYTGKEITDIVNIGIGGSD
                     LGPYMVSEALAPYKTRLNMHFVSNVDGTHIVETLKPLNPETTLFLIASKTFTTQETMT
                     NAHSARDWFLAEAGDQAHVAKHFAALSTNAQSVSEFGIDTDNMFEFWDWVGGRYSLWS
                     AIGLSIALAVGFDNFIELLEGAHEVDKHFAETDLENNVPVILALIGLWYNNFHGAESE
                     SILPYDQYLHRFAAYFQQGNMESNGKCVDRNGNPVDYQTGPIIWGEPGTNGQHAFYQL
                     IHQGTKLIPCDFIAPAISHNQVGDHHQKLMSNFFAQTEALAFGKTEETVKAEFAAAGK
                     TEAEVAELVPFKVFEGNRPTNSILVKQVTPKTLGNLIAMYEHKIFVQGVIWNIFSFDQ
                     WGVELGKQLANQILPELADDKAVTSHDSSTNGLINAFKAFQA"
     gene            complement(315198..315659)
                     /locus_tag="VF_RS01480"
                     /old_locus_tag="VF0305"
                     /old_locus_tag="VF_0305"
                     /db_xref="GeneID:54162924"
     CDS             complement(315198..315659)
                     /locus_tag="VF_RS01480"
                     /old_locus_tag="VF0305"
                     /old_locus_tag="VF_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004410369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheC"
                     /protein_id="WP_005417353.1"
                     /db_xref="GeneID:54162924"
                     /translation="MRAEFVNPFLASFMNVIKTMASMDLKPQKPRIKKDEIARGDVSG
                     LIGMVGPQSKGSMSITFDEQLALQVMQNMLGERPNSINEEVTDMVGEITNMVTGGAKR
                     ILSESGFEFNMATPIVVSGKGHTITHKCEGAIIIMPFASEWGNAFIEICFE"
     gene            complement(315687..316136)
                     /gene="zur"
                     /locus_tag="VF_RS01485"
                     /old_locus_tag="VF0306"
                     /old_locus_tag="VF_0306"
                     /db_xref="GeneID:54162925"
     CDS             complement(315687..316136)
                     /gene="zur"
                     /locus_tag="VF_RS01485"
                     /old_locus_tag="VF0306"
                     /old_locus_tag="VF_0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transcriptional repressor Zur"
                     /protein_id="WP_011261113.1"
                     /db_xref="GeneID:54162925"
                     /translation="MNRTQKQKVELLCQQRGVRLTPQRLTVLELIVTHQGAISAYDLL
                     EQLKQIEPQAKPPTIYRALDFLVTQGFVHKVESINSYISCCVIGEHAHFSQLFICRTC
                     DDVVEFHDNDITKQLTKHAEQIGFSVENHIVETHGTCKTCLSNNKKN"
     gene            316316..317302
                     /gene="dusA"
                     /locus_tag="VF_RS01490"
                     /old_locus_tag="VF0307"
                     /old_locus_tag="VF_0307"
                     /db_xref="GeneID:54162926"
     CDS             316316..317302
                     /gene="dusA"
                     /locus_tag="VF_RS01490"
                     /old_locus_tag="VF0307"
                     /old_locus_tag="VF_0307"
                     /EC_number="1.3.1.-"
                     /EC_number="1.3.1.91"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA dihydrouridine(20/20a) synthase DusA"
                     /protein_id="WP_011261114.1"
                     /db_xref="GeneID:54162926"
                     /translation="MSSYPLQRFSVAPMLDWTDRHCRYFHRQLSEHALLYTEMVTTGA
                     IIHGKGDFLAYNEEEHPVALQLGGSNVKDLVHCAKLAAERGYDEVNLNVGCPSDRVQN
                     GRFGACLMAEPDLVAECVAEMKAVVDIPVTVKTRIGIDDQDSYEFLTKFVSTVHEKGG
                     CDQFTIHARKAWLSGLSPKENREIPPLDYPRAYQIKKDFPQLIIAVNGGIKTLSEAKE
                     HLEHLDGVMIGREAYQSPYLLAEVDQQLFGSDKPIKKRREIVESMYPYIERQLENGAY
                     LGHITRHMLGLFQSMPGARQWRRYISENAHKPGAGIEVVKTALAKIPSELDV"
     gene            317421..318122
                     /locus_tag="VF_RS01495"
                     /old_locus_tag="VF0308"
                     /old_locus_tag="VF_0308"
                     /db_xref="GeneID:54162927"
     CDS             317421..318122
                     /locus_tag="VF_RS01495"
                     /old_locus_tag="VF0308"
                     /old_locus_tag="VF_0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR04219 family outer membrane beta-barrel
                     protein"
                     /protein_id="WP_011261115.1"
                     /db_xref="GeneID:54162927"
                     /translation="MNKLSLATVVASAALVMAVPAHSAEKEFTTKVAIDAWFPDGKVG
                     SKDGAVRDNDVDASQAFSIAFEHPYPILPNVKVRYTPVKADRFEYDQIDYTGYYKLLE
                     TDGLQFDVGLTLTQFANGEFNKGGSVSTDPAQPANQSFSETAINMYADASMHIPNTNF
                     HIFGQYDFGSSSDTRTMDGQAGVKYILPVDAVDVEFKLGYRVMDHEFGYFEGFDSDQA
                     NVMVDGWFGGLSFDF"
     gene            318294..318524
                     /locus_tag="VF_RS01500"
                     /old_locus_tag="VF0309"
                     /old_locus_tag="VF_0309"
                     /db_xref="GeneID:54162928"
     CDS             318294..318524
                     /locus_tag="VF_RS01500"
                     /old_locus_tag="VF0309"
                     /old_locus_tag="VF_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417357.1"
                     /db_xref="GeneID:54162928"
                     /translation="MTTLSELKLMYQEDQLVEAVIEPVIVEDSWIVEFRHVRGGLVLL
                     TDLKGGEVKYRDLEAASKSALAVGFSQVRINE"
     gene            318660..320474
                     /locus_tag="VF_RS01505"
                     /old_locus_tag="VF0310"
                     /old_locus_tag="VF_0310"
                     /db_xref="GeneID:54162929"
     CDS             318660..320474
                     /locus_tag="VF_RS01505"
                     /old_locus_tag="VF0310"
                     /old_locus_tag="VF_0310"
                     /EC_number="1.8.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="assimilatory sulfite reductase (NADPH)
                     flavoprotein subunit"
                     /protein_id="WP_011261116.1"
                     /db_xref="GeneID:54162929"
                     /translation="MLLKELSALASPLNDQQIGQLQQAASELSPQQLAWVSGYFWGIS
                     QTSGATQPINQAAAAVSSQPAGKLSIIFASQTGNAKGVAEALKEEAAAAGIAVELFDA
                     SDYKGKHLAKETHVIIVASTNGEGEAPDNAIELHEFLQSKKAPKLDNLHYGVIGLGDS
                     SYEFFCQTGKDFDAFLSKQGATPFIERVDLDVDYEAPAAEWRKQALDKVKEALASEAQ
                     SAQVVQLPVGQAAHTSQYSKQNPYTATLLTSQKITGRDSGKDVRHIEIDLDGSGLTYQ
                     PGDALGVWFENSPELASAILKQVGLTGDEAVEVDGDSISLQKALVEKYEITSANPQLV
                     TQYAELSGSKKLEKLAADKDKLRQYSGNTQVIDVLSEKKAKLTAEQLVGLLRRLTPRL
                     YSIASSQSEVDEEVHLTVGVVEYLQGDETRFGGASSFLSHRLEEGDDVKVFVEHNNNF
                     KLPQDDNAPVIMIGPGTGIAPFRSFVQERDNRDAEGKNWLFFGDRIFTQDFLYQVEWQ
                     KYLKSGIVNQLDVAFSRDQQEKVYVQHRILEHAAQVWQWLQDGAYIYVCGDATRMAKD
                     VHEALICVVEQHGQKTREEAEQFVNELRKAKRYQRDVY"
     gene            320474..322204
                     /gene="cysI"
                     /locus_tag="VF_RS01510"
                     /old_locus_tag="VF0311"
                     /old_locus_tag="VF_0311"
                     /db_xref="GeneID:54162930"
     CDS             320474..322204
                     /gene="cysI"
                     /locus_tag="VF_RS01510"
                     /old_locus_tag="VF0311"
                     /old_locus_tag="VF_0311"
                     /EC_number="1.8.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="assimilatory sulfite reductase (NADPH)
                     hemoprotein subunit"
                     /protein_id="WP_011261117.1"
                     /db_xref="GeneID:54162930"
                     /translation="MSELIDVKTILSGTELGPLADNERLKRESKYLRGTIVEDLQDRI
                     TGGFTKDNFQLIRFHGMYQQDDRDIRAERAKQKLEPLHNVMLRARMPGGIITPKQWLA
                     IDKFAEEHTSYGSLRLTTRQTFQFHGVLKPNIKLMHQTLNSIGIDSIATAGDVNRNVL
                     CTTNPVESELHQEAYEWAKKISEHLLPKTRAYAEIWLDGEKLETTDEEPILGSNYLPR
                     KFKTTVVIPPQNDVDVHANDLNFIAIADNGKLVGFNVLVGGGLAMTHGDTATYPRKAD
                     DFGFVPLDKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGSDVFKGEVEKRAGVQ
                     FEKSRPYELTERGDRIGWVEGIDGKHHLALFIENGRLLDYPGKPLKTGVAEIAKVHQG
                     DFRMTANQNLIVAGVPSEQKDHIEQIARAHGLIDDTHSEQRKNSMACVAFPTCPLAMA
                     EAERFLPEFVTEIEGVLKKHNLPEEDNIIFRVTGCPNGCGRAMLAEIGLVGKAPGRYN
                     FHLGGNRSGTRVPKMYKENITDRQILTEIDQLVGRWATERNENEGFGDFTIRAGIVDE
                     VKVSKRDFHA"
     gene            322197..322958
                     /locus_tag="VF_RS01515"
                     /old_locus_tag="VF0312"
                     /old_locus_tag="VF_0312"
                     /db_xref="GeneID:54162931"
     CDS             322197..322958
                     /locus_tag="VF_RS01515"
                     /old_locus_tag="VF0312"
                     /old_locus_tag="VF_0312"
                     /EC_number="1.8.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenylyl-sulfate reductase"
                     /protein_id="WP_011261118.1"
                     /db_xref="GeneID:54162931"
                     /translation="MPKLQLSELLSLTKVEQTLRLAEVNVELEKLTAQERVVWALENL
                     EGNPALSSSFGIQAAVMLQLVTEVKSDTPIILTDTGYLFPETYQFIDQLTDRLNLNLH
                     VFTADESPNWQEARYGKLWEQGVEGIEKYNKLNKVQPMRRALDQLEIGVWFSGLRREQ
                     SGSRANLPILSIQNGVFKFLPVLDWTNKEVHYFLKEYDLPYHPLWDQGYLSVGDTHTT
                     QKWEPGMSEEETRFFGLKRECGLHEDDGELDGSGI"
     gene            complement(323046..323510)
                     /locus_tag="VF_RS01520"
                     /old_locus_tag="VF0313"
                     /old_locus_tag="VF_0313"
                     /db_xref="GeneID:54162932"
     CDS             complement(323046..323510)
                     /locus_tag="VF_RS01520"
                     /old_locus_tag="VF0313"
                     /old_locus_tag="VF_0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261119.1"
                     /db_xref="GeneID:54162932"
                     /translation="MKKTLILSTLALSLTAAAPANAFLSNLFGGSDDVKTEETTASNP
                     LVGMLTENLDISADQAAGGAGALLAMAGNGLSDSESSELNSMIPGLESLTGAIPGGLS
                     SMISNMDSVKAAFSALGLDPALISQFTPVITEYLSSQNASSGLLDSLTSLWK"
     gene            complement(323634..324254)
                     /locus_tag="VF_RS01525"
                     /old_locus_tag="VF0314"
                     /old_locus_tag="VF_0314"
                     /db_xref="GeneID:54162933"
     CDS             complement(323634..324254)
                     /locus_tag="VF_RS01525"
                     /old_locus_tag="VF0314"
                     /old_locus_tag="VF_0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019282418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_005417363.1"
                     /db_xref="GeneID:54162933"
                     /translation="MSEVKLETVEQRASYGIGLQMGQQLAQSGLEGLNVAAIAKGIAT
                     SLTGDMPEIEVDAINEALQALHMRAEEARAEASKAAAAEGEAFLADNALRPEVTVLES
                     GLQYEVLTEGTGEIPTSDKTVRVHYHGMLTNGAVFDSSVERGQPAEFPVTGVIAGWVE
                     ALQLMPVGSKWKLSIPQNLAYGERGAGAAIPPYAALVFEVELLDIL"
     gene            324394..325044
                     /locus_tag="VF_RS01530"
                     /old_locus_tag="VF0315"
                     /old_locus_tag="VF_0315"
                     /db_xref="GeneID:54162934"
     CDS             324394..325044
                     /locus_tag="VF_RS01530"
                     /old_locus_tag="VF0315"
                     /old_locus_tag="VF_0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglucosamine transferase"
                     /protein_id="WP_011261120.1"
                     /db_xref="GeneID:54162934"
                     /translation="MNKKKKMNVKRPDFSEQLANLKEKCGPLIEKVAPYWQRLPQFHQ
                     KALRILVPVTFVLILLPSGAEEEVDSIQPTVIPAPEMQRQSVSLNLEGLSEQEASSNR
                     NQRETRVNREEKVPTQTASIEKETTAVEAKWHDYQIQEGDTLYQVFRKNNLPLTELNK
                     VVKIEGADKPLSNIKKGQLFRFKLNRQGDLDIVQIERDGQAIMYFRMSDGNFGRSK"
     gene            complement(325081..325905)
                     /locus_tag="VF_RS01535"
                     /old_locus_tag="VF0316"
                     /old_locus_tag="VF_0316"
                     /db_xref="GeneID:54162935"
     CDS             complement(325081..325905)
                     /locus_tag="VF_RS01535"
                     /old_locus_tag="VF0316"
                     /old_locus_tag="VF_0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_047863685.1"
                     /db_xref="GeneID:54162935"
                     /translation="MAPTHLAIILLILGNLLASLSDVAVKVLDGGVSPFQYIFLRQLI
                     SLALLFPFWFHQQPKLRCLSNPKVTLIRAHVLLIGSGCMVVSITYLTLATANAVFYTA
                     PLLMIPLSILLLNEKPSTKKIFQTIVGFLGALIILRPSQFHWAAIFALGTATTLALYN
                     ILVRKIPNDQSVITTLFWTTLLSLPVSGGLAWLYWQPLHYHEVLWIALSATFIISYNG
                     LATIAYKKAPATQISLAEYSGLIFVVIFGVIWFDEIPDILTAVGIALIVIPLMPKT"
     gene            complement(325925..326377)
                     /locus_tag="VF_RS01540"
                     /old_locus_tag="VF0317"
                     /old_locus_tag="VF_0317"
                     /db_xref="GeneID:54162936"
     CDS             complement(325925..326377)
                     /locus_tag="VF_RS01540"
                     /old_locus_tag="VF0317"
                     /old_locus_tag="VF_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011261122.1"
                     /db_xref="GeneID:54162936"
                     /translation="MIHWQKIPFTELTTSQLYELLRLRVDVFVVEQTCPYPELDGKDC
                     QDGVYHLIGTKDNEIIACARLLPAGTSYINVSIGRVATKGTARGDGLGHKLLSQALAC
                     CEELWPGETIDIGAQEHLTHFYQKHGFQVISDMYLEDDIPHVDMRLEK"
     gene            complement(326444..327013)
                     /locus_tag="VF_RS01545"
                     /old_locus_tag="VF0318"
                     /old_locus_tag="VF_0318"
                     /db_xref="GeneID:54162937"
     CDS             complement(326444..327013)
                     /locus_tag="VF_RS01545"
                     /old_locus_tag="VF0318"
                     /old_locus_tag="VF_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_011261123.1"
                     /db_xref="GeneID:54162937"
                     /translation="MNDLFTTQLESHGFTPHEISQIVKLGKLKTLPAKSILIKQNNVA
                     NEFYFLIDGFCHSCYLTEQGKQFSKEFYWKGDWVVGFEELLDQTSSPYTLETITQTSL
                     ITLPISLLDRWRKNALPLYIKLLETQLLYKERKERFMLLHSPQARYEVFCQNYPELLA
                     QLNDYQVAAYLGITHISLSRIKNRIKKLT"
     gene            complement(327130..329112)
                     /locus_tag="VF_RS01550"
                     /old_locus_tag="VF0319"
                     /old_locus_tag="VF_0319"
                     /db_xref="GeneID:54162938"
     CDS             complement(327130..329112)
                     /locus_tag="VF_RS01550"
                     /old_locus_tag="VF0319"
                     /old_locus_tag="VF_0319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004748305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2',3'-cyclic-nucleotide
                     2'-phosphodiesterase/3'-nucleotidase"
                     /protein_id="WP_011261124.1"
                     /db_xref="GeneID:54162938"
                     /translation="MNLSAKPVSIAVLAGLGLLTLSGCSPTVTDTDEVINLRVVETTD
                     IHTNLMDYDYYKDKPTQKIGLARTATLVKEARAEVTNSVLVDNGDLLQGSPMGDYMAD
                     KGIEAGEVHPAYKAMNQLDYDAGNIGNHEFNYGLEFLAESINDADFPYISANVYDAKT
                     KEHYFKPYIIKTHKLKDTAGVEHEIKVGYIGFVPPQIMVWDKKNLEGKVFARDIKETA
                     EELVPQMKAEGADVIVAIPHSGVSTNPYKQGEENSTYYLSEVDGIDAIAFGHSHAVFP
                     GKGFDNLQGIDNENGTINGVAAVMPGRWGSHVGVMDLTLEQKDGKWSVVKGQSEARPI
                     FDKTNQKSLADADKGIVQALEADHKGTRDFVNQPIGKADDVMYSFLALVQDDPTVQIV
                     NLAQKDYVERFIQGDPDLDGTPVLSAAAPFKAGGRGNDPTNFTEVESGQLTFRNAADL
                     YLYPNTLVAMKVTGKEVKEWLECSAGQFKQIDINSTAPQQLIDWDGFRTYNFDVIDGV
                     NYQIDITQPAKYDGDCNLINEGSERIIGLTYQGKPIDAKQDFLIATNNYRAYSNKFPG
                     TGADFIAFDSPDENRTVLANYISRVSKEAGQVQPSADNNWSFAPIKNGEKLDIRFETS
                     PSEKATQFIKDKGQYPMKRVATDDVGFAVYQLNLAK"
     gene            329521..330429
                     /gene="cysD"
                     /locus_tag="VF_RS01555"
                     /old_locus_tag="VF0320"
                     /old_locus_tag="VF_0320"
                     /db_xref="GeneID:54162939"
     CDS             329521..330429
                     /gene="cysD"
                     /locus_tag="VF_RS01555"
                     /old_locus_tag="VF0320"
                     /old_locus_tag="VF_0320"
                     /EC_number="2.7.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004738750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysD"
                     /protein_id="WP_005417374.1"
                     /db_xref="GeneID:54162939"
                     /translation="MDAKRLTHLQQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVML
                     HLARKAFYPGKIPFPLLHVDTDWKFKEMIEFRDKTAEKYGFDLLVHKNPEGLEMGINP
                     FVHGSSKHTDIMKTQGLKQALNKYGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDP
                     KNQRPELWNTYNGQVNKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLSEKRPVVE
                     RDGMLIMVDDERLKLEEGEEIQHKDIRFRTLGCYPLTGAVESKANTLPEIIEEMLVAT
                     SSERQGRAIDHDSSGSMELKKRQGYF"
     gene            330459..331895
                     /gene="cysN"
                     /locus_tag="VF_RS01560"
                     /old_locus_tag="VF0321"
                     /old_locus_tag="VF_0321"
                     /db_xref="GeneID:54162940"
     CDS             330459..331895
                     /gene="cysN"
                     /locus_tag="VF_RS01560"
                     /old_locus_tag="VF0321"
                     /old_locus_tag="VF_0321"
                     /EC_number="2.7.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysN"
                     /protein_id="WP_011261125.1"
                     /db_xref="GeneID:54162940"
                     /translation="MNSAVEQQLAELGIEAYLKEHQYKSLLRFLTCGSVDDGKSTLIG
                     RLLHDSKQIYADQLDAVHADSQRVGTTGERPDLALLVDGLQAEREQGITIDVAYRYFS
                     TQKRKFIIADTPGHEQYTRNMATGASTCNVAVILIDARKGVLDQTRRHSYIANLLGIR
                     HFVVAVNKMDLVEYSQSRFEEIKEEYLAFSKKLNNPNLDISILPLSALEGDNVVNPSD
                     ALSWYQGEPLLEVLENVDIDADKGNGEFRFPVQYVNRPNLDFRGFAGTVSSGGISVGD
                     EIVALPSGKKSKVARIVTFDGDLTSAQAGQAVTLTLEDEIDISRGDLLVKSQSNLQAT
                     DQFKAEIVWMTEKGLEPGRQYDIKIAGKKTVGQIDAIHHQVNINSLEKFDTQELPLNG
                     IGLCDVSLTETVSLDRYQDCADTGGFIFIDRLTNVTVGAGMIQNLSDLSESKPINDNI
                     SAFEIELNALIRKHFPHWETKDISKLLG"
     gene            331907..333634
                     /locus_tag="VF_RS01565"
                     /old_locus_tag="VF0322"
                     /old_locus_tag="VF_0322"
                     /db_xref="GeneID:54162941"
     CDS             331907..333634
                     /locus_tag="VF_RS01565"
                     /old_locus_tag="VF0322"
                     /old_locus_tag="VF_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SLC13 family permease"
                     /protein_id="WP_011261126.1"
                     /db_xref="GeneID:54162941"
                     /translation="MAWEQGFVLALLTLIIVSLLASKLKPSVIFAGSAFIAFMVGMID
                     LPSLAKNFTNSSLLTLVLLILSSCALEKTRLISWVGRYISEGRLGSVVGKLGLSTALL
                     SSFTNNTAVVVSLIGAIKRNQRHAPSRLLIPLSYAAILGGTLTLIGTSTNLIINSFVE
                     DTGLPSLSFFAPTTIGLAVLFGGLLILIPLSYLLPQYDESHQDELPYFLEARVEGGSP
                     LVGKSISENNLRALRKLFLAEVIRNGKTIPSVDPDMILLAGDRLLFCGDIESVTTLQE
                     INGLTLFGQHHLNGQNLLEVVVSQSASIRGKSIKSAQFRERFDAVVVAIRRGHERLEG
                     GLGKIELQAGDTLILVPGKDFEQSKQQLKREFVIISDLDSAAKLDGDKSALVLVGFAA
                     VITAALLDVFPIIKGLSVYLLGMLALGIINLGEIRRRFPIDIVVIVGAALSIAQLMLS
                     SGLSVQLGEIFIELFNGWGVMGALIAVYLITLVLTELITNNAAAALAFPIGYSMALGY
                     GVDPMPFIMAVLFGASASFISPYGYQTNLLVFSVGNYTLLDYVKVGLPMSIIYSVLVL
                     ALIPYFFPF"
     gene            333649..334263
                     /gene="cysC"
                     /locus_tag="VF_RS01570"
                     /old_locus_tag="VF0323"
                     /old_locus_tag="VF_0323"
                     /db_xref="GeneID:54162942"
     CDS             333649..334263
                     /gene="cysC"
                     /locus_tag="VF_RS01570"
                     /old_locus_tag="VF0323"
                     /old_locus_tag="VF_0323"
                     /EC_number="2.7.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylyl-sulfate kinase"
                     /protein_id="WP_011261127.1"
                     /db_xref="GeneID:54162942"
                     /translation="MTALSVIKDENVVWHQHTVTKEIRSDLKKQKPAVLWFTGLSGAG
                     KSTIAGALESKLAELGYHTYLLDGDNVRHGLCKDLGFSDHDRQENIRRIGELSKLMAD
                     AGLIVLSAFISPHRAERQMVRELLPEGEFLEVFVNTSLDECEKRDPKGLYKKARAGEI
                     KHFTGIDSEYQQPLSPEIDLPAGTQSIEALVEQCLEELKVRSII"
     gene            complement(334347..335246)
                     /locus_tag="VF_RS01575"
                     /old_locus_tag="VF0324"
                     /old_locus_tag="VF_0324"
                     /db_xref="GeneID:54162943"
     CDS             complement(334347..335246)
                     /locus_tag="VF_RS01575"
                     /old_locus_tag="VF0324"
                     /old_locus_tag="VF_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03899 family protein"
                     /protein_id="WP_005417387.1"
                     /db_xref="GeneID:54162943"
                     /translation="MNTQQTIITKDETTKKEQPTHKKEHYVVSSARRLKEIAIQQGLA
                     ANLQPPKPEETLLKRALYREKLLREQQQQNLEKIVKLAHDYCNDETAGDPDPDWLHRF
                     FEMAKDIHDSSMQKLWSQIFKQEVISPGSTSMKALKVLKDMTQREAQTFQRAASLACS
                     FGQDNSKKLLLGYKCAGTFFNFYKTDGPQLIHLGNYKLPYSSLLLLIELGLLLSTELE
                     SGEIEFEPALPLQYQGKNIAIKPMQKGSRLVYYRFSPTGAELCKLLGNKPNENYYDNL
                     ISLLSQKFMVETDVAAKSISTMA"
     gene            complement(335554..336039)
                     /locus_tag="VF_RS01580"
                     /old_locus_tag="VF0325"
                     /old_locus_tag="VF_0325"
                     /db_xref="GeneID:54162944"
     CDS             complement(335554..336039)
                     /locus_tag="VF_RS01580"
                     /old_locus_tag="VF0325"
                     /old_locus_tag="VF_0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3299 domain-containing protein"
                     /protein_id="WP_005417389.1"
                     /db_xref="GeneID:54162944"
                     /translation="MKKKIIICLLMLMPFSAFSNEVLKLDWIDLIPEQERNQFDSMGM
                     PKIDHNGGQMQQSLVGSVRQELNGSMVKIPGFVIPLEGDDKMITEFLLVPYFGACIHV
                     PPPPPNQIIYVKFEKGAPIQQLWDVIYIVGKLKTETIDSELAETGYLIEGVRLEEYDD
                     E"
     gene            complement(336051..337310)
                     /locus_tag="VF_RS01585"
                     /old_locus_tag="VF0326"
                     /old_locus_tag="VF_0326"
                     /db_xref="GeneID:54162945"
     CDS             complement(336051..337310)
                     /locus_tag="VF_RS01585"
                     /old_locus_tag="VF0326"
                     /old_locus_tag="VF_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011261129.1"
                     /db_xref="GeneID:54162945"
                     /translation="MIGITKLAWKSLINRKTTVLLTVATIAISVMLLVGVERIRTEAK
                     NSFANTISNTDLIVGARSGQVNLLLYSVFRIGNATNNIDWKSYQEIIHQRAVKWAIPI
                     SLGDSHKGFRVMGTNQDYFRFYQYGKKQPLEFKEGKSFNGLFDVVLGADVANKLNYHL
                     GDKLVIAHGISDKSFTRHDNLPFTVVGILKPTGTPVDKTLHVSLEAISAIHVGWESGA
                     HLGNTPDAKVLEKQKFEPAEITAFMLGLKSKIQTFALQRYINEYSKEPLSAILPGIAL
                     HELWGMMSVAEQALLAVSVFVVAAGLMGMLTSLLTSLQERRREMAILRAMGAQPKHIF
                     ILLISEAVVITSFGIIVGLMGLYLSLSILQPIIQQYYGIAIELTLPTLYELKLLGLVL
                     CSGFVIGVIPAIQAYRHSLSDGMTIRL"
     gene            complement(337307..337993)
                     /locus_tag="VF_RS01590"
                     /old_locus_tag="VF0327"
                     /old_locus_tag="VF_0327"
                     /db_xref="GeneID:54162946"
     CDS             complement(337307..337993)
                     /locus_tag="VF_RS01590"
                     /old_locus_tag="VF0327"
                     /old_locus_tag="VF_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011261130.1"
                     /db_xref="GeneID:54162946"
                     /translation="MNIIELSNLTFHWPNQSELTLNIPSFTQKQGSKLFIKGPSGSGK
                     STLLSLLTGILSPTSGCVTINGTDINQLSSNQRDRFRADNIGYIFQQFNLLPYLSVID
                     NVILPYQFSSKKTLSIKELRIEATRLLTQLQLPASHFNKPITDLSIGQQQRVAAARAF
                     IGKPKLIIADEPTSALDHETRFAFIELLMNECGNSNASLLFVSHDPSLESLFDQSIDL
                     RELNKAGGIS"
     gene            complement(338030..338674)
                     /locus_tag="VF_RS01595"
                     /old_locus_tag="VF0328"
                     /old_locus_tag="VF_0328"
                     /db_xref="GeneID:54162947"
     CDS             complement(338030..338674)
                     /locus_tag="VF_RS01595"
                     /old_locus_tag="VF0328"
                     /old_locus_tag="VF_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2796 domain-containing protein"
                     /protein_id="WP_011261131.1"
                     /db_xref="GeneID:54162947"
                     /translation="MFICNKKTLLCLAVSGSLFSVSYAANANDHHNHHDGEHHESEHR
                     HHDAHVHGVVETNIAQDGDHLLFEITAPGADVVGFEHAPKDDAQKQVLANAVKTLNNP
                     NLIFTLPENAKCTFEEAHVSHNLVNHNDHDHDDHDHDHDHDHHDGEHHKEHGKHGEFS
                     AQYEYHCEAISNLDQIETQWFTHFPHTHKMTIQYLGDAGQKAASLTPKSSVITL"
     gene            complement(338722..339015)
                     /locus_tag="VF_RS01600"
                     /db_xref="GeneID:54162948"
     CDS             complement(338722..339015)
                     /locus_tag="VF_RS01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2607 family protein"
                     /protein_id="WP_080966769.1"
                     /db_xref="GeneID:54162948"
                     /translation="MQSYFFTKQRWLNWGFAILLALFGILVANHQVDTNVHHHEDHHC
                     QQFQSFSSGICINITSPPVIPQLIICSLFSIVENSSPLNITVHSRAPPTPSIL"
     gene            complement(339080..339631)
                     /locus_tag="VF_RS01605"
                     /old_locus_tag="VF0329"
                     /old_locus_tag="VF_0329"
                     /db_xref="GeneID:54162949"
     CDS             complement(339080..339631)
                     /locus_tag="VF_RS01605"
                     /old_locus_tag="VF0329"
                     /old_locus_tag="VF_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YtfJ family protein"
                     /protein_id="WP_011261134.1"
                     /db_xref="GeneID:54162949"
                     /translation="MKKVKLLTLAACLLPSLSFAHNLTLNKEVPSVSIEQYGEIFFKN
                     SAATYQNWNTEQLKGKVRVLQAIAGRSSAKAMNADLMSAITLEKFPETEYQTTTIINQ
                     DDSIWGTGGFVKSSAEESKEEFSWSSMVLDEHGKVAKAWDLQPESSAIIVQDKEGKIL
                     FVKEGKLSNDEIKQVIALIHTQL"
     gene            339839..340054
                     /locus_tag="VF_RS01610"
                     /old_locus_tag="VF0330"
                     /old_locus_tag="VF_0330"
                     /db_xref="GeneID:54162950"
     CDS             339839..340054
                     /locus_tag="VF_RS01610"
                     /old_locus_tag="VF0330"
                     /old_locus_tag="VF_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1107 domain-containing protein"
                     /protein_id="WP_005417417.1"
                     /db_xref="GeneID:54162950"
                     /translation="MAMFRNFKAYRPLQVARFVKTLFKGNLHIEGIGTFEFDGGKILM
                     PNQGTKKMLLVMSEVNQHIRQLSMMPA"
     gene            complement(340108..340686)
                     /gene="msrA"
                     /locus_tag="VF_RS01615"
                     /old_locus_tag="VF0331"
                     /old_locus_tag="VF_0331"
                     /db_xref="GeneID:54162951"
     CDS             complement(340108..340686)
                     /gene="msrA"
                     /locus_tag="VF_RS01615"
                     /old_locus_tag="VF0331"
                     /old_locus_tag="VF_0331"
                     /EC_number="1.8.4.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase MsrA"
                     /protein_id="WP_011261136.1"
                     /db_xref="GeneID:54162951"
                     /translation="MTTKQPTSPPLHFISQRNLEFIPPNFEQIFFGMGCFWGAERLFW
                     QLEGVYSTAVGYSGGVTSHPTYKEVCTGTTNHTEVVKVIFDPTIISLNTLLHSFWQKH
                     DPTEGMRQGNDIGSQYRSAIYTTSKAQQETAKQTQQQYQAALEKQGIMRIITTEIVPL
                     QTFYFAEEYHQQYLAKNPDGYCGLKGTGVCFI"
     gene            340801..342522
                     /locus_tag="VF_RS01620"
                     /old_locus_tag="VF0332"
                     /old_locus_tag="VF_0332"
                     /db_xref="GeneID:54162952"
     CDS             340801..342522
                     /locus_tag="VF_RS01620"
                     /old_locus_tag="VF0332"
                     /old_locus_tag="VF_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor"
                     /protein_id="WP_011261137.1"
                     /db_xref="GeneID:54162952"
                     /translation="MIKKLPLFIIVCLLAISSQALAETELEIEGLEGPLLSNVEAYIS
                     GIPEEDYSVSLRFQARLQESITDALKALGYYQSTTTFVVEGDTSDRTLLVNIDAGQPV
                     IIYVSDIVISGEAAADEDFINAVDNSGLNLGQVINHGRYESLKSTLQNLALRKGYFDG
                     DFTTNRLEIAPGRHQAIVRIHYDSGKRYSFGETSIDGSQIEEKRVRSIIPFQAGDPYL
                     ASQVGELNQYLSNTEWFSSVYVEPDIDAVGKTYQLPMKVHLSPQVRNQLETSIGYATD
                     VGARGKIRWKKPWLNPEGHSLDTALSISKPEQEATISYKIPLEQVLKDYYVVKYGLKN
                     VDNNDTDSLESNLAFERHWVYDSGWHRTIYTRFLYEEFTQGVQDGTAWLVLPGISFSK
                     SRSRGGTMPMWGDKKAFTIEATDQALTSDVKLLRLQAQGAIVRSIGENHRGVARADIG
                     AIYTDDFYKLPPSIRFFAGGDNSIRGYGYEEVSPKDSEGYLTGGQYMATASLEYQYRV
                     VGNWWVATFVDYGDAWLDTPDWKMGTGVGIRWASPVGPVRLDFAWGLDAEPGDEFKIH
                     FTLGPEV"
     gene            342519..346319
                     /locus_tag="VF_RS01625"
                     /old_locus_tag="VF0333"
                     /old_locus_tag="VF_0333"
                     /db_xref="GeneID:54162953"
     CDS             342519..346319
                     /locus_tag="VF_RS01625"
                     /old_locus_tag="VF0333"
                     /old_locus_tag="VF_0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation/assembly module TamB"
                     /protein_id="WP_011261138.1"
                     /db_xref="GeneID:54162953"
                     /translation="MSSIEMNEEHNNQELKKKRRFSRHCLCFALFFPSILLLLLLIIG
                     AVVFTNSGLKLIVWGAEKALPELSIEGVEGSVIPEFTLSNITYDNKQLLSTEISRFHF
                     ALTPNCLLIPSVCIDDISVDGLTLDFPTLPTSNEEEPTDTAENTLLSLPIPIAITNIT
                     LNNIDANILGNHIQWKAFSTGVNIYKSDLTLTPLNWDHIRLELASSESASEKNTEKPT
                     SSKKDDAPIVLPEVFIPLNIKVEQFALRDFILQQETPVKVNKLNFKATAGENNASIND
                     FYLDVPQANLSLNNEIVLKGDYPLTLDGLLELKETELKGHKLAIEADGSVADLNASLT
                     LSGGLKVKVDANVHPLDKKFPFDVHVYKGDLYWPLTGDKDIKVQIPNIKTKGNLEEYS
                     FASALYIEGKSIPQTDMRLEGRGTLEKVDLSDLLIDTLGGSISGSAEVNWASLVSWKT
                     DINLLNIQPGLQWPEAEGDISGQLITDGHLTKDGGWVVDVSTIDINGVFRNYPLLVQG
                     ALKADDVQGAGEPHVNISQLTINHGDNGLAVSGELNKEWDLSVDIDFPELSDSVPDVY
                     GKLIGNVALTGELTKPRVDVDINALGLQFLKKATLNKASIEGYIVPSPTIDADLSIKL
                     LDGKYQKQVLNDLSIRFSGKEQAHKLQIDLNSNVIDSHLVFKGALDRTQGWKGELSEA
                     DVITDIGPWNLDKKADLAYDIKKEELFVQANCWSQGKTALCLNKDLYAGKSGDADISI
                     KHFEFNKLQKFIPEETVINGEVNLDALAKWSVGQSPYVKAKLHLPKGNIQQQMESPLI
                     IGWDDFTVNAEMKNDELTTDWLLALTDNGQLTGNMKIDQLTKAKTLTGNSKIEKVSLA
                     MLEPILGEYSQLRAMVNSDIDISGPIEHPKLSGNLSIDEIKVKGEVSPVDINEGNVDI
                     VFSGHSGKLSSLITTADGDLHIEGAAHWSDLNKWDAGLDIFGNELQVNVPPMVKLKVK
                     PDMKIRINPTLAKITGSIGIPWGRIVVQELPESAIGVSKDEIILGDDLKPIEKPSPLP
                     MTVETDININIGDDVLLSAFGLEGGLVGNLNITQKNKGPFITGEVNIEEGTYRSFGQD
                     LQIRKGKILFNGPADQPYVDIKAVRNPENTKDDVVAGIKVTGPADTPRVEIFSSPSMP
                     QANALSYLLRGQDIDGESGGNAMTTTLIGLSLAKSGKVVGEIGQAFGVQDLQLDTAGS
                     GEDSQVTISGYIAPGLQVKYGVGIFNSLGEFTLRYRIISDLYIEAVSGVDNAVDLIYQ
                     FEFD"
     gene            346816..348380
                     /locus_tag="VF_RS01630"
                     /old_locus_tag="VF_R0001"
                     /old_locus_tag="VFR0001"
                     /db_xref="GeneID:54162954"
     rRNA            346816..348380
                     /locus_tag="VF_RS01630"
                     /old_locus_tag="VF_R0001"
                     /old_locus_tag="VFR0001"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:54162954"
     gene            348438..348513
                     /locus_tag="VF_RS01635"
                     /old_locus_tag="VF_T0002"
                     /old_locus_tag="VFT0002"
                     /db_xref="GeneID:54162955"
     tRNA            348438..348513
                     /locus_tag="VF_RS01635"
                     /old_locus_tag="VF_T0002"
                     /old_locus_tag="VFT0002"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:348472..348474,aa:Glu,seq:ttc)
                     /db_xref="GeneID:54162955"
     gene            348782..351697
                     /locus_tag="VF_RS01640"
                     /old_locus_tag="VF_R0002"
                     /old_locus_tag="VFR0002"
                     /db_xref="GeneID:54162956"
     rRNA            348782..351697
                     /locus_tag="VF_RS01640"
                     /old_locus_tag="VF_R0002"
                     /old_locus_tag="VFR0002"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:54162956"
     gene            351776..351891
                     /gene="rrf"
                     /locus_tag="VF_RS01645"
                     /old_locus_tag="VF_R0003"
                     /old_locus_tag="VFR0003"
                     /db_xref="GeneID:54162957"
     rRNA            351776..351891
                     /gene="rrf"
                     /locus_tag="VF_RS01645"
                     /old_locus_tag="VF_R0003"
                     /old_locus_tag="VFR0003"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:54162957"
     gene            352289..353852
                     /locus_tag="VF_RS01650"
                     /old_locus_tag="VF_R0004"
                     /old_locus_tag="VFR0004"
                     /db_xref="GeneID:54162958"
     rRNA            352289..353852
                     /locus_tag="VF_RS01650"
                     /old_locus_tag="VF_R0004"
                     /old_locus_tag="VFR0004"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:54162958"
     gene            353912..353988
                     /locus_tag="VF_RS01655"
                     /old_locus_tag="VF_T0003"
                     /old_locus_tag="VFT0003"
                     /db_xref="GeneID:54162959"
     tRNA            353912..353988
                     /locus_tag="VF_RS01655"
                     /old_locus_tag="VF_T0003"
                     /old_locus_tag="VFT0003"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:353946..353948,aa:Ile,seq:gat)
                     /db_xref="GeneID:54162959"
     gene            354026..354101
                     /locus_tag="VF_RS01660"
                     /old_locus_tag="VF_T0004"
                     /old_locus_tag="VFT0004"
                     /db_xref="GeneID:54162960"
     tRNA            354026..354101
                     /locus_tag="VF_RS01660"
                     /old_locus_tag="VF_T0004"
                     /old_locus_tag="VFT0004"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:354059..354061,aa:Ala,seq:tgc)
                     /db_xref="GeneID:54162960"
     gene            354368..357283
                     /locus_tag="VF_RS01665"
                     /old_locus_tag="VF_R0005"
                     /old_locus_tag="VFR0005"
                     /db_xref="GeneID:54162961"
     rRNA            354368..357283
                     /locus_tag="VF_RS01665"
                     /old_locus_tag="VF_R0005"
                     /old_locus_tag="VFR0005"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:54162961"
     gene            357357..357472
                     /gene="rrf"
                     /locus_tag="VF_RS01670"
                     /old_locus_tag="VF_R0006"
                     /old_locus_tag="VFR0006"
                     /db_xref="GeneID:54162962"
     rRNA            357357..357472
                     /gene="rrf"
                     /locus_tag="VF_RS01670"
                     /old_locus_tag="VF_R0006"
                     /old_locus_tag="VFR0006"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:54162962"
     gene            357504..357580
                     /locus_tag="VF_RS01675"
                     /old_locus_tag="VF_T0005"
                     /old_locus_tag="VFT0005"
                     /db_xref="GeneID:54162963"
     tRNA            357504..357580
                     /locus_tag="VF_RS01675"
                     /old_locus_tag="VF_T0005"
                     /old_locus_tag="VFT0005"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:357538..357540,aa:Asp,seq:gtc)
                     /db_xref="GeneID:54162963"
     gene            complement(358299..359576)
                     /locus_tag="VF_RS01680"
                     /old_locus_tag="VF0336"
                     /old_locus_tag="VF_0336"
                     /db_xref="GeneID:54162964"
     CDS             complement(358299..359576)
                     /locus_tag="VF_RS01680"
                     /old_locus_tag="VF0336"
                     /old_locus_tag="VF_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017109389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_011261139.1"
                     /db_xref="GeneID:54162964"
                     /translation="MSVYNTLCFLAAAAMLIAFFNSKIGKMQTTIAITAGSMMLSLGI
                     IIAGQNNWFNLREVATETLTDINFEDFLLKGILGFLLFAGGLGIKLQNLKDQKWEITV
                     LALGATLFSTFFIGFILWAICNVIGVNLDLIYCLLFGALISPTDPIAVLAIVKKMNAP
                     QRISTQIEGESLFNDGFGLVIFVTLFTIAFGHETPTVGSVTALFFQEAIGGIAYGFIL
                     GLVFHYLISSTNDHSMELLLTIGIPTAGYALAEVLHVSGPLAMVVSGIMIGNWTRFIG
                     FSKESEDHLDHFWELVDEFLNGVLFLLIGMSMLLFQFHQEDWILMAISIPLVLTSRYL
                     SVFISYIGFNRFRTYNPLSVRILTWGGLRGGLALAMALAIPAGIMVIPEKNIDVREII
                     LVMTYSVVVFSILVQGSTITPMIDKAKKLEKEM"
     gene            359759..363439
                     /gene="metH"
                     /locus_tag="VF_RS01685"
                     /old_locus_tag="VF0337"
                     /old_locus_tag="VF_0337"
                     /db_xref="GeneID:54162965"
     CDS             359759..363439
                     /gene="metH"
                     /locus_tag="VF_RS01685"
                     /old_locus_tag="VF0337"
                     /old_locus_tag="VF_0337"
                     /EC_number="2.1.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004399900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_011261140.1"
                     /db_xref="GeneID:54162965"
                     /translation="MAGSNIKVQIEKQLSERILLIDGGMGTMIQGYKFEEEDYRGERF
                     NKWHCDLKGNNDLLVLSQPQIIRDIHEAYLEAGADILETNTFNATTIAMADYDMESLS
                     EEINFEAAKLAREVADKWTEKTPNKPRYVAGVLGPTNRTCSISPDVNDPGFRNVSFDE
                     LVEAYSESTRALIRGGSDLILIETIFDTLNAKACSFAVESVFEELDITLPVMISGTIT
                     DASGRTLSGQTTEAFYNALRHVKPISFGLNCALGPDELREYVSDLSRISECYVSAHPN
                     AGLPNAFGEYDLSPEDMAEHVAEWASSGFLNLIGGCCGTTPEHIRQMALVVEGVKPRQ
                     LPELPVACRLSGLEPLTIEKDSLFINVGERTNVTGSARFKRLIKEELYDEALSVAQEQ
                     VENGAQIIDINMDEGMLDAEACMVRFLNLCASEPEISKVPVMVDSSKWEVIEAGLKCI
                     QGKGIVNSISLKEGKEKFVHQAKLIRRYGAAVIVMAFDEVGQADTRERKIEICTNAYN
                     ILVDEVGFPPEDIIFDPNIFAVATGIDEHNNYAVDFIEAVGDIKRTLPHAMISGGVSN
                     VSFSFRGNNYVREAIHAVFLYHCFKNGMDMGIVNAGQLEIYDNVPEDLREAVEDVVLN
                     RRDDSTERLLDIATEYLERAVGKVEDKSALEWRDWPVEKRLEHSLVKGITEFIVEDTE
                     EARINAEKPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAHLEPFINA
                     SKEVGATNGKILLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVSCETILKVAKEE
                     NVDIIGLSGLITPSLDEMVHVAKEMERQGFDLPLLIGGATTSKAHTAVKIEQNYSQPV
                     VYVNNASRAVGVCTSLLSDELKPSFVEKLDIDYERVREQHSRKQPRTKPVTLEVARAN
                     KVAIDWASYTPPVPLKPGVHIFDNFDVSTLRNYIDWTPFFMTWSLVGKYPKILDHEEV
                     GEEAKRLFKDANDLLDRVEKEGLLKARGMCALFPASSVGDDIEVYTDESRTKVAKVLH
                     NLRQQTEKPKGFNYCLSDYIAPKESGKNDWIGGFAVTGGIGERELADEYKANGDDYNA
                     IMIQAVADRLAEAFAEYLHEKVRKEIWGYSPNETLSNDDLIREKYQGIRPAPGYPACP
                     EHTEKGALWELMNVEESIGMSLTSSYAMWPGASVSGMYFSHPDSRYFAIAQIQQDQAE
                     SYADRKGWNMLEAEKWLGPNLN"
     gene            complement(363505..364857)
                     /gene="lysC"
                     /locus_tag="VF_RS01690"
                     /old_locus_tag="VF0338"
                     /old_locus_tag="VF_0338"
                     /db_xref="GeneID:54162966"
     CDS             complement(363505..364857)
                     /gene="lysC"
                     /locus_tag="VF_RS01690"
                     /old_locus_tag="VF0338"
                     /old_locus_tag="VF_0338"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine-sensitive aspartokinase 3"
                     /protein_id="WP_011261141.1"
                     /db_xref="GeneID:54162966"
                     /translation="MNPINVAKFGGTSVANFEAMTKSASVIEQNPNTHLVVISACSGV
                     TNLLVELANGVQDNHRKKAILEGLKTIHFSVLDQLADPLIPEQAILDILDDIEKTAET
                     AASQSNDKLTDHLVSCGELMSTHLFTQLLIERGNPAVRFDIRTVLRTDSRFGKGEPQL
                     NDISRLAQKKLTPLCQQQIVVTQGFIGSDSEGNTTTLGRGGSDYSAALIAESVDACGL
                     EIWTDVPGIYTTDPRIAPKASPIPEISFSEASEMANYGAKILHPSTLLPALRHQIPVF
                     VGSSKEPEKGGTWIKEKVDSTPLFRALTLRCNQTMVTLHSPSMFHAYGFLAEVFKILA
                     KYQISVDLITTSEVSVALTLDQTNTNGKAPELPLEAQQELEELCTVEVEHNLCLIALI
                     GNKMSHSKGSAKQVFGTLEEFNLRMICYGASQHNLCFLLHESESKQAVKILHKELFEQ
                     "
     gene            365309..366421
                     /locus_tag="VF_RS01695"
                     /old_locus_tag="VF0339"
                     /old_locus_tag="VF_0339"
                     /db_xref="GeneID:54162967"
     CDS             365309..366421
                     /locus_tag="VF_RS01695"
                     /old_locus_tag="VF0339"
                     /old_locus_tag="VF_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--glyoxylate aminotransferase family
                     protein"
                     /protein_id="WP_011261142.1"
                     /db_xref="GeneID:54162967"
                     /translation="MQSFIPPKRTLMGPGPSDISPQVLQALSRPTIGHLDPLFIKMMD
                     EVKELLKYAFQTKNDFTIAVSAPGSAGMETCFVNLVEEGEKVLVCRNGVFGERMRQNV
                     ERCGGIPIIIDDKWGEPVSLDKVAQALEENPDISVVAFVHAETSTGVLSDAKAIAQIA
                     RQYNCLTIVDAVTSLGGVPLLVDEWQLDAVYSGSQKCLSCTPGLSPVTFSDKAVAKMK
                     SRSSVVQSWFLDQSLVLGYWSGEGKRSYHHTAPVNSLYALHESLLMLKHEGIEQAWQR
                     HADYHQELKQGLEALGIKFIVDEEYRLPQLNAVYIPVGISDTQVREQLLEEYNLEIGA
                     GLGELAGKAWRIGLMGYAAKKENVALCLKALSDVLK"
     gene            complement(366473..368233)
                     /locus_tag="VF_RS01700"
                     /old_locus_tag="VF0340"
                     /old_locus_tag="VF_0340"
                     /db_xref="GeneID:54162968"
     CDS             complement(366473..368233)
                     /locus_tag="VF_RS01700"
                     /old_locus_tag="VF0340"
                     /old_locus_tag="VF_0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase C-terminal domain-containing
                     protein"
                     /protein_id="WP_011261143.1"
                     /db_xref="GeneID:54162968"
                     /translation="MATLLTQGTLLEAKKIKKPLTKSFLLSLTILFFFCAHFFQPNPG
                     GSGLHLAFNAASWIPASIAIAIALFHIAKQGILKFSTLSIVLFISVCLLSIPLLYQEA
                     SPHLATGKFLGLWAGLLFFITLQQFSFSNKQKQWLLWCIIGSVLIETLFGYIQYLFLE
                     TGNSFGYNVIVNRPYGIFQQPNVMASFLVTGLAIASYFLARQPIKYRENIIALTLLYA
                     TIIFTLPLIVVLASRTGWLSATFSLVLLVPYMWKYCTKPRFISWLLALVVGFSGSFAL
                     LDLSKNDDISNVTLISKKADLESAREYIFPQALDMFLEKPVTGYGYGNFEAEYILYTA
                     KQHQLSSDYRAGEPSMDHPHNEILYWGVEGGIVAILGLLLAAGGVLAKIRRSKLDTQF
                     ALLALIAPIFIHSQLEYPFYHSMIHWFTFIILLFWIDQLSCKYKKYRISDISKITLRV
                     SSLVLPIVTGFYMLSTLHTNWVLTQFETTKPMNPDILSRVTNPVVWEDRFNWDVLSTQ
                     LKIGIINKKPELIKPYIEWSQELIKTKPRPAFYQNLIIAYQALGDEKRAEDIRREAIF
                     LFPKSKFESVQLDKKLQMTN"
     gene            complement(368330..371155)
                     /gene="uvrA"
                     /locus_tag="VF_RS01705"
                     /old_locus_tag="VF0341"
                     /old_locus_tag="VF_0341"
                     /db_xref="GeneID:54162969"
     CDS             complement(368330..371155)
                     /gene="uvrA"
                     /locus_tag="VF_RS01705"
                     /old_locus_tag="VF0341"
                     /old_locus_tag="VF_0341"
                     /EC_number="3.1.25.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrA"
                     /protein_id="WP_011261144.1"
                     /db_xref="GeneID:54162969"
                     /translation="MDKIEVRGARTHNLKDISLTIPRDKLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLYARIGEPRCPEHHVELTAQTISQMVDKALELPEGTKLMLLAPIVKERKG
                     EHVKTLENLAAQGFIRARIDGEVCDLSDPPTLELHKKHTIEVVVDRFKVRDDLQQRLA
                     ESFETALELTGGIAVIDYMDDSEHDPLIFSANFACPHCGYSMQELEPRLFSFNNPAGA
                     CGTCDGLGVQQYFDADRVVLDDKLSIAEGAIKGWDQKNYYYFQMLGSLAKHYGFDLFA
                     PFKSISKKFQNIILNGSGNEEIEFQYSNDRGDLRVKRHPFEGILNTLDRRYKETESSA
                     VRDDLSKYISTQSCSSCHGTRLRLEARNVFVGDTTLPEICEMSIQDSMAFFSSLTLQG
                     QKAQIADKVMKEINERLHFLINVGLSYLNLSRSADTLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLKTLNHLRDLGNTVIVVEHDEDAIRSADHIIDIGPGAGV
                     HGGHIVAEGDYEAIISNPESLTGQYLNGTKEIAVPNERVKADPKKQVELIGATGNNLK
                     NVTLKLPVGLFTCITGVSGSGKSTLINDTFFKIAHTQLNGATTSEPAPYKKIKGIEHF
                     DKVIDIDQSPIGRTPRSNPATYTGIFTPIRELFSGTPESRSRGYKPGRFSFNVRGGRC
                     EACQGDGVIKVEMHFLPDVYVPCDVCSGKRYNRETLEVKYKGKSIDEVLQMTIEDAHT
                     FFEPVPVIARKLQTLMDVGLSYIRLGQAATTLSGGEAQRVKLARELSKRDTGKTLYIL
                     DEPTTGLHFHDIQQLLTVLHRLRERGNTIVVIEHNLDVVKTADWIVDLGPEGGQGGGE
                     IIAEGTPEDVAQVEGSHTARFLKPMLK"
     gene            complement(371327..372196)
                     /gene="galU"
                     /locus_tag="VF_RS01710"
                     /old_locus_tag="VF0342"
                     /old_locus_tag="VF_0342"
                     /db_xref="GeneID:54162970"
     CDS             complement(371327..372196)
                     /gene="galU"
                     /locus_tag="VF_RS01710"
                     /old_locus_tag="VF0342"
                     /old_locus_tag="VF_0342"
                     /EC_number="2.7.7.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase
                     GalU"
                     /protein_id="WP_005417439.1"
                     /db_xref="GeneID:54162970"
                     /translation="MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAI
                     NAGMDGMCIVTGRGKHSLMDHFDKNYELEHQISGTNKEELLEDVRELIDSAHFTYIRQ
                     REMKGLGHAILTGRELVGDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVEE
                     VPDNETHKYGVISGEMIKDDLYRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQ
                     TEPGKGGEIQITDALLKQAQSGCVLAYKFKGKRFDCGSVEGYIEATNHCYENIYLKDK
                     KSSELAKKVTGKK"
     gene            complement(372377..372781)
                     /locus_tag="VF_RS01715"
                     /old_locus_tag="VF0343"
                     /old_locus_tag="VF_0343"
                     /db_xref="GeneID:54162971"
     CDS             complement(372377..372781)
                     /locus_tag="VF_RS01715"
                     /old_locus_tag="VF0343"
                     /old_locus_tag="VF_0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261145.1"
                     /db_xref="GeneID:54162971"
                     /translation="MGNHRQQKLLEHFYSSLDENVIDELSEEQKESIERAIIATGLGS
                     NNRVDIRKSISVFNKRYFFVFLLGRDYRQQLRKESPFALLILTFLISIGIFCILGLAI
                     FALYLIKSALGIDIFHNFSFGVWDWFKELMQH"
     gene            complement(372768..373901)
                     /locus_tag="VF_RS01720"
                     /old_locus_tag="VF0344"
                     /old_locus_tag="VF_0344"
                     /db_xref="GeneID:54162972"
     CDS             complement(372768..373901)
                     /locus_tag="VF_RS01720"
                     /old_locus_tag="VF0344"
                     /old_locus_tag="VF_0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_011261146.1"
                     /db_xref="GeneID:54162972"
                     /translation="MTEKITVIGTRGIPNVLGGVETHCQHLYPEIHRQFDNDICVIAR
                     SPYVDYKISSFQGVQTKAVWAPKKKSLEAIIHSTLASLTTLFDGSKVIHVHAIGPGLV
                     VPLLRLLGKKVVFTHHGPDYDRQKWGGFAKRILKLGEKLAATYANEIIVISEVINDII
                     KEKYNRYDAHLIYNGVKLPTQLPQEKIDSTLSKFALTAGNYFVAVGRFVEEKGFHDLI
                     DAYQQANLNIPLVIMGDTDHPTPYSEKLKQQAKNVDGVILTGFLKGEELQAIFSQAKT
                     FVMPSYHEGLPIALLEAMSYSLPAIVSNIPANLEVKLTPDTYFSIGNTEELTLQLAQH
                     AKNEYSSINYASYLEYYDWEKIATQTMAVYQRALTKKVLSGQS"
     gene            complement(373906..375111)
                     /locus_tag="VF_RS01725"
                     /old_locus_tag="VF0345"
                     /old_locus_tag="VF_0345"
                     /db_xref="GeneID:54162973"
     CDS             complement(373906..375111)
                     /locus_tag="VF_RS01725"
                     /old_locus_tag="VF0345"
                     /old_locus_tag="VF_0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_011261147.1"
                     /db_xref="GeneID:54162973"
                     /translation="MKILLVNKFFFMKGGAETVYFQERDMLLSEGVKIVEFSMQHEKN
                     IESEYSEFFVQNVDYYQKQTIKDKLATAINFIHNRQACEKLQALLEQEKPDLVHFHNI
                     YHQLTPSIIKVAKQFGCKTVLTAHDTKIACPSYTMYRNGHTCEACVHGSVWNATKYRC
                     QEGSLSKSVLLSLEAIYQKISKNYQYLDAIVSPSRFLGRFIQQKLPHNRIEVIVNGID
                     ENVSLEGIKDNGYYLYLGRLSQEKGVPTLAEAHQLMTEKAGLKIVGDGPEFNQLKENY
                     PTAELLGFKSGEELLTLIKEAKAVIVPSECYENCSMSVIEAMSYGKPVIGSKIGGIPE
                     QIKDGIDGYLFEAGNAQALADKLDLLVKEPVKTIDMGKNARERFLSKYTLTKHKNDLL
                     NLYQELLKG"
     gene            complement(375108..376106)
                     /locus_tag="VF_RS01730"
                     /old_locus_tag="VF0346"
                     /old_locus_tag="VF_0346"
                     /db_xref="GeneID:54162974"
     CDS             complement(375108..376106)
                     /locus_tag="VF_RS01730"
                     /old_locus_tag="VF0346"
                     /old_locus_tag="VF_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_011261148.1"
                     /db_xref="GeneID:54162974"
                     /translation="MTKLPFISVIIKTYNEEAGIEKTISSIKKNMGVYPHKIIVADSL
                     STDNTQDIATKMDVTVVSLTEPEDRCCGVGHQLGYLYSEGDFLLLLDGDMELESGFIE
                     QGVSFLLENPQYAGVAGSVEMDDVDSYEFKSRKQRLHQIYPIGDCSHLGGGGLYRKTA
                     IDEIDYLTNRNLHAYEESELGMRLTHAGYKLHRLDVPYFFHTSYTMSSLALMKHRWKG
                     GYLFAPGELVKGAFGTPLFSHALKTIKNEAIFAVYLFILFASLLSFNPILIGATSLPL
                     FAFIGLKTIKNRSIRDALQSVLNLSVFAAGLIKGLFIPLKDPKTPPPHTVINEGKK"
     gene            complement(376099..377478)
                     /locus_tag="VF_RS01735"
                     /old_locus_tag="VF0347"
                     /old_locus_tag="VF_0347"
                     /db_xref="GeneID:54162975"
     CDS             complement(376099..377478)
                     /locus_tag="VF_RS01735"
                     /old_locus_tag="VF0347"
                     /old_locus_tag="VF_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417444.1"
                     /db_xref="GeneID:54162975"
                     /translation="MKMNTGLYLQIYAIFTLVFCGSTQYFTGVSAVLWLPFLLAFAMT
                     GLLLLQVRYSPLNLDHKEMIILILFLGFFGIALVSTYLQNGVTITIVGLKNELALSLI
                     LFCLLLRFCRESQIYRVTKTLYWIFYAQFPVVLYQVFVILPQRVASEGEFEKWDSVVG
                     TFGGDPMGGGNTAAMGLFCLLIMLLKLSEYKHGLTTIKSTILHIGAAFTLCILGEIKF
                     VILLSPILLAYVWLAPSYIKGMKSYDIKIILAIVSGMLLLMSIAILLLSLSYSSAFGS
                     DPTKGPLDIFIDSLEYIFDPNYIMPSGELGRMTTIFFWLEHNDLFGLPSTLFGYGLNT
                     TNHGSAVAPGFLNVVFNVILDSTALSVLLWELGIIGTLFFISMTIYILKVCKPTPLFN
                     RKDVAKEDIRLMSYPPAFNAFAIGCLLSLPYSQILMLVPMLQFLFYLSLGSNLVIRKS
                     LITAAENHD"
     gene            complement(377481..378686)
                     /locus_tag="VF_RS01740"
                     /old_locus_tag="VF0348"
                     /old_locus_tag="VF_0348"
                     /db_xref="GeneID:54162976"
     CDS             complement(377481..378686)
                     /locus_tag="VF_RS01740"
                     /old_locus_tag="VF0348"
                     /old_locus_tag="VF_0348"
                     /EC_number="2.7.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_011261149.1"
                     /db_xref="GeneID:54162976"
                     /translation="MSLLKSITTIAGASVISQIIGAISIWLISHKYNMSQVGIYALVY
                     SIVLIGAQICTFASQLLLPKQNDHTLSQNIVFSLLQSMLIALPYSYIMTLFFEQNGYI
                     LYVLTLCHAWILVSENLLLRVENIRLLAFQRISVSLLVIGAIFLTPNIESFYFCWAAG
                     LLFLICAWLTYSVSFAQISISHFSLSNNLAFIKENRSHLSGIGSAEVLAMANNNLPTL
                     LINFWFSPLTAGYFAVVNRFCLAPVTIVGNAVRNSIFSKWSIDFRNNTFNFQEFKKVR
                     LMLLVLGLIATAGVLIFYPLIMQLGFNDEWLSSVPTSRYMLPYLLPALAVCPLTVIEL
                     VFGSPKYFLRIQIEQLLVIVLAFVVFPYFHKDYAYSVLLFAVLSFIRYAFIYLKVNKR
                     AHLLAKEDA"
     gene            complement(378691..380871)
                     /locus_tag="VF_RS01745"
                     /old_locus_tag="VF0349"
                     /old_locus_tag="VF_0349"
                     /db_xref="GeneID:54162977"
     CDS             complement(378691..380871)
                     /locus_tag="VF_RS01745"
                     /old_locus_tag="VF0349"
                     /old_locus_tag="VF_0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis tyrosine autokinase"
                     /protein_id="WP_011261150.1"
                     /db_xref="GeneID:54162977"
                     /translation="MALSIIENGKKLESTIDFSNFLKEFKKYRLRVLLVVLAITLAAF
                     PLINGMTPQYTATATIVLKAKTDNSTPIDQVEDFDATQAEYYPTQAELLQSKTVIEAA
                     AKKLDLINSPIFEDEDKDENIPQSEEEHLYSIVKAIKKKLSISPVRFSQLVHVSYESK
                     DSDMSALVANAVVESYIEQQEQRKIEKTQQAQQWNNTRMSELKEKIKQQKADIDKFLS
                     DNGLLTYQGVDGFETEQLALVNDRLATAKEKRITAKANYNTISEALGYPLEDVATLPS
                     ISNHAQLQDLRIALIQAKRTLFDLQKMYGPKNRQILEANAQIKAIELQTTALLKELKT
                     GLYKEYQAAIERENKYRALLAEQKKDFTALAAKKDTYNTMKADLDKTQELYEKIFLRS
                     KEQELTVLYREPVARLLDAATPPHKPSKPNKALLLIMVCAMTIIFSLLFIIIKSALNK
                     SINNLTQVNTRLGLQGIGELISLNYIDELALFTKNFFKNSYSAETVHAIRTTILLDDK
                     PWPIIGLTSTESTESNELNSYLLAYSFSQDRSTLLIDLDYRKEISLTEAILMQKENEI
                     DAKKAENSDDFETVPTSTVMGVAEALEQKHPINDCLIKIENNLTFLPRGTLTETPLIT
                     LASEELGRQLKELSKQFEQVIVNLPAMTESKDAQLIARHLSGVIYTVQAGELSANHIL
                     ANIEKVKQVQTPIMGVILTDVQNDELETEEAKQQLIHQNDDILG"
     gene            complement(380875..381462)
                     /locus_tag="VF_RS01750"
                     /old_locus_tag="VF0350"
                     /old_locus_tag="VF_0350"
                     /db_xref="GeneID:54162978"
     CDS             complement(380875..381462)
                     /locus_tag="VF_RS01750"
                     /old_locus_tag="VF0350"
                     /old_locus_tag="VF_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide export protein"
                     /protein_id="WP_011261151.1"
                     /db_xref="GeneID:54162978"
                     /translation="MKPLFISFCLFLSFVSNALASEAQETPSDTQEKAKTEQSQQKED
                     LGYILGAGDTIQISVFKEPEMTTRLKIHRGGYVNFPYLGEIKLSGRTPTQIEEDIEAR
                     LADGYILQPMVTVSIEAFRKFFISGEVANPNGYEFQPGLTVEQAIAMAGGFTDRSDRD
                     SINVRSAATNELIEDVAPTYPVGPGDVVIIEQSFF"
     gene            complement(381463..382779)
                     /locus_tag="VF_RS01755"
                     /old_locus_tag="VF0351"
                     /old_locus_tag="VF_0351"
                     /db_xref="GeneID:54162979"
     CDS             complement(381463..382779)
                     /locus_tag="VF_RS01755"
                     /old_locus_tag="VF0351"
                     /old_locus_tag="VF_0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane beta-barrel protein"
                     /protein_id="WP_011261152.1"
                     /db_xref="GeneID:54162979"
                     /translation="MIRPTKTPISFNKLILLTTSLVSSSCYAYLTPKPHIGPAGVEYQ
                     SNVAVDYGYDDNVNYQSDHTPHVQSDFFNVKPFVQLKGVHNADVYTLQYTGDYRQYQE
                     NNTSDDYYDHHIAFIGAWKKGLNNDLLFTIENTIGHENRGEGLTDGLSAEQFQKYGIT
                     DVLETNMFHTELRYSIDKQDSIGKLSFAVQYKDFTYDDRTSNFTSGSIYNFNQYIEEQ
                     EWDQTTFTIELFDQASSRTRFRYSIVSNLRHYKINNLKDTNETFFIAGIKTIRTGKTT
                     IDANIAWLYKDFPNNPDSESFGGLNWDIDIKWSPVRHSSFHFYTDQSVEDPTEIGGYV
                     LNTEYGTNWEHFWWSSRLSTTLGYHYKTSADKDKSSDKVETKTEAIAKITYKFRPSIQ
                     FELSYQQLVNESNKEFDDFTINSVETVTQTLGYDKSLIMFTTKVQI"
     gene            complement(382763..384175)
                     /locus_tag="VF_RS01760"
                     /old_locus_tag="VF0352"
                     /old_locus_tag="VF_0352"
                     /db_xref="GeneID:54162980"
     CDS             complement(382763..384175)
                     /locus_tag="VF_RS01760"
                     /old_locus_tag="VF0352"
                     /old_locus_tag="VF_0352"
                     /EC_number="2.7.8.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="WP_011261153.1"
                     /db_xref="GeneID:54162980"
                     /translation="MKQQNIKMISDSYRTLTKAFDFIAINLLLTSILSFHGLEETAVD
                     LSAGLLFSTIFLLISEYSGLYTINTKVELKKYLLRLTFSLLLTVSVFFILKLRLASLE
                     GMQISNLNSHIYLLWYVCVWGGLSLSRTLCTLSYTYIVIPRLKINKIAIIGLTPAGLS
                     IEQALISKYKNQKISIEFYDDRSSSRFSYVNKSGYAGKVSELIEKVKNDEIQSVYIAL
                     PMVAKDRIKDIIHQLSNSTVNAYIVPDLYTYKLSVSQIKRIGNVHTFSIFSSPFEGLG
                     AVIKRIEDIVIGSLITLLILPVLCIVALGVKLSSPGPILFKQDRYGLGGKKIKVWKFR
                     SMKVMENSEVVTQATKNDPRVTRFGSFIRRTSLDELPQFINVLQGSMSIVGPRPHAVA
                     HNEEYRVLVDNYMVRHKIKPGITGLAQINGYRGETDTLDKMEKRVEYDIKYLQNWSLS
                     MDLKIIFLTVFKGFVSDTAY"
     gene            384488..385021
                     /locus_tag="VF_RS01765"
                     /old_locus_tag="VF0353"
                     /old_locus_tag="VF_0353"
                     /db_xref="GeneID:54162981"
     CDS             384488..385021
                     /locus_tag="VF_RS01765"
                     /old_locus_tag="VF0353"
                     /old_locus_tag="VF_0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004740861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011261155.1"
                     /db_xref="GeneID:54162981"
                     /translation="MASRGVNKVILVGNLGQDPEIRYMPSGGAVANITIATSETWRDK
                     ATGEQREKTEWHRVALFGKLAEVAGEYLRKGSQVYVEGQLQTRKWQDQNGQDRFTTEV
                     VVQGFNGVMQMLGGRGQGAPAGGQQQQGNWGQPQQPAQQNNFAPQQQQAPQQQAPQAA
                     QPQYNEPPMDFDDDIPF"
     gene            complement(385106..385762)
                     /locus_tag="VF_RS01770"
                     /old_locus_tag="VF0354"
                     /old_locus_tag="VF_0354"
                     /db_xref="GeneID:54162982"
     CDS             complement(385106..385762)
                     /locus_tag="VF_RS01770"
                     /old_locus_tag="VF0354"
                     /old_locus_tag="VF_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261156.1"
                     /db_xref="GeneID:54162982"
                     /translation="MFFISIIVFLVIANGFAIISEHFLSYSHMETIIRLFNVDKEMNV
                     PTLYSSCAMIFASVLLALIAYVHFNKNEQYLAWAGLSAIFLFLALDEMTELHEMLVGP
                     VRNSLNTTGILYFAWVIPYAALLLVFGLTYFKFLFRLPTNTRNRLILAGIIYVSGALV
                     MELIGGKIAEQHGTDALIYAISYTIEETLEMLGIATLIYTATTYISEQFPTLSVQIKD
                     "
     gene            386002..387981
                     /gene="csrD"
                     /locus_tag="VF_RS01775"
                     /old_locus_tag="VF0355"
                     /old_locus_tag="VF_0355"
                     /db_xref="GeneID:54162983"
     CDS             386002..387981
                     /gene="csrD"
                     /locus_tag="VF_RS01775"
                     /old_locus_tag="VF0355"
                     /old_locus_tag="VF_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase E specificity factor CsrD"
                     /protein_id="WP_011261157.1"
                     /db_xref="GeneID:54162983"
                     /translation="MRKTPSLRLSNRLISFVTLMVSAAIFILFIGGTISVKQIGTEYL
                     DHYLTGVVTVVDEELVNPEKAKSMETWLPKLLKASNVVSMDLSSSTGPIYSFQSLAII
                     PDDSLLYHKTLPLQINKGYEISFKSVPPYSAFTYSLGALFSITAAIAVIVVSLLWGVV
                     WLRKQLHGSELLEERGRMLLAGKLDDYSTGSEEEWPATASLALDNIIAELKDARKERS
                     RFDTFIRTHTFLDQLTGSANRVLFDSKLESILQESQSQGVLLLLRINGWEELVEEQGS
                     AVGDELIVEVGKQLNNIMQRYSDSVLSRYYQSDFALLVPQQSLKEAKSLAAQCLKLIE
                     KINPPRSLDRDNWCHIGVSMFVSGERRGRLMEELDMAHRSALLQNNNTWSLFKKQQQL
                     AESLGSVRWRTLFDAIFQQDKLIIYKQPTFLFDGNELVPLHLELFSRIKDENGVQIKA
                     SRFLPAIKQVGYQVKLDSAVLKQVFPLLSDPELNHNSFSVHLQVKSITNAAFIRQLRN
                     RLLQTPRAQLQRLSFELIEGQVVTYLDAVRPVAKMLKSFGCQLVVEQAGRTIVSTHYI
                     KDLNVDFVKLHRSLMKDIHQRYENQLFVRSLLGACETTGAQVIAVGIEKEKEFRLLKD
                     LGVEGGQGRFFESETALHHRQEKVSIPKRRSRWGK"
     gene            388038..389564
                     /locus_tag="VF_RS01780"
                     /old_locus_tag="VF0356"
                     /old_locus_tag="VF_0356"
                     /db_xref="GeneID:54162984"
     CDS             388038..389564
                     /locus_tag="VF_RS01780"
                     /old_locus_tag="VF0356"
                     /old_locus_tag="VF_0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshI"
                     /protein_id="WP_162200316.1"
                     /db_xref="GeneID:54162984"
                     /translation="MRVTCVLYENVVSKVRKVEQSMKIMDALKKLKLSRSVKTTTSIV
                     ILQGGVYIAKSDGFDELQEHYFTPINQPQSWKDVIVEACEKAGVTNSSASVILGSHLY
                     QSFQIDNPNLPKEELTGALPFLVKDLITDRIADIVADGIETINGKLQVYISQVTTLHT
                     LIDSLSPLSIQINNVTPDELLWAYSQPEDGSFMLLNHSQSADFKLLAFNNGHLHLNRS
                     LRGITAPLTGDQANSFQMDSLALELQRSLDYLSSQLHGVSINNLFFRCDDEDDALLAL
                     ELQNRLGVKVASLLVDEPRAFRSGEVLAWLALFNTPSINLFHETLKLKTDYFTLQNVM
                     ISWGVGLALSIAVVGYYQWQIYNLETTINANSLKESNYKQELATLNKKLESHKPSAAK
                     LAAIKRLNDDIQSKKASLKVIDNFDEGMQVGYSGVMSSLTQLGKGNISLNKIYISGDK
                     VNFAGYARTPDVIPRWVQSFDSELHLVGRTFDQLEIKTDDKGLVSFILNTKASEGNHE
                     "
     gene            389557..390195
                     /gene="pilO"
                     /locus_tag="VF_RS01785"
                     /old_locus_tag="VF0357"
                     /old_locus_tag="VF_0357"
                     /db_xref="GeneID:54162985"
     CDS             389557..390195
                     /gene="pilO"
                     /locus_tag="VF_RS01785"
                     /old_locus_tag="VF0357"
                     /old_locus_tag="VF_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 4a pilus biogenesis protein PilO"
                     /protein_id="WP_011261159.1"
                     /db_xref="GeneID:54162985"
                     /translation="MSNWNQVKEKFGALSQREKVLITLVGWVAVIFISLSLFIEPKIE
                     QYHQSQQKVVRITNSISSLKQQIELAEFRLKKDPNVEITKQYQQLMIESQDLADLLFS
                     RVASLVSPSQMASLLEKVLKKSSKLKLQSMTTLPSERLLDENNNAGYYIHPVKIVLSG
                     EYFDIEEYLSHLETLPVKYYWRNFHYEVKKYPIAEVTIEVYTLGSSRGFIGG"
     gene            390197..390538
                     /locus_tag="VF_RS01790"
                     /old_locus_tag="VF0358"
                     /old_locus_tag="VF_0358"
                     /db_xref="GeneID:54162986"
     CDS             390197..390538
                     /locus_tag="VF_RS01790"
                     /old_locus_tag="VF0358"
                     /old_locus_tag="VF_0358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261160.1"
                     /db_xref="GeneID:54162986"
                     /translation="MKNRFLVFILMSLPLSVSASEAVLGHDPTEPLSWSTPAPAQKKV
                     IKKRQYFPSLQAINCNAKSDCYAVLDDKSMKRGDKVSGYTLLTIGEESVSIGRAGKQW
                     QLSLFPQNIKN"
     gene            390550..392190
                     /gene="mshL"
                     /locus_tag="VF_RS01795"
                     /old_locus_tag="VF0359"
                     /old_locus_tag="VF_0359"
                     /db_xref="GeneID:54162987"
     CDS             390550..392190
                     /gene="mshL"
                     /locus_tag="VF_RS01795"
                     /old_locus_tag="VF0359"
                     /old_locus_tag="VF_0359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus (MSHA type) biogenesis protein MshL"
                     /protein_id="WP_011261161.1"
                     /db_xref="GeneID:54162987"
                     /translation="MKVRNVIIGFMVASLTGCSMGHRDPVEIKQTLDKSINENGGLLL
                     ADLPASVQADLMPELNTPHVEVEEPVKRFRVRANGVGAKAFFTSLVKGTEYSVVIHPQ
                     VSGRITMNLSDVTMDDVLSSVEDLYGYDIVKAGKVLQVYPATIRTETIPVDYLQLTRK
                     GRSLTTITTGSITNSDNNSSNNNNSSSKSNNNSSSSSSSATGGTEIETTSESDFWKEL
                     ETAISVMIGNGADRSVVVSPQASVVTITASPDELRKVKQFLGTSHKRLQRQVILEAKL
                     LEVTLSDGYQQGINWSNLTASLGGTDVVFGQTSGLVQGALPGMDTIGTLLGGQTNITV
                     SDGNFQAVLSFMDTQGDLNVLSSPRVTAANNQKAVIKVGRDEYYVTEVSSVTGSGDNS
                     NASPEVTLTPFFSGISLDVTPQIDDKGNVMLHVHPSVIDVENEVKEIDLGDVGGVLKL
                     PLAKSSIRESDSVIRAKSGDVVVIGGLMKSQTVDQVSKVPLLGDVPALGHLFRNVSQL
                     TQKTELVILLKPTVVGVDTWQEELERSRDLLQEWFPDE"
     gene            392203..393051
                     /locus_tag="VF_RS01800"
                     /old_locus_tag="VF0360"
                     /old_locus_tag="VF_0360"
                     /db_xref="GeneID:54162988"
     CDS             392203..393051
                     /locus_tag="VF_RS01800"
                     /old_locus_tag="VF0360"
                     /old_locus_tag="VF_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_005417458.1"
                     /db_xref="GeneID:54162988"
                     /translation="MYEAHFGLKQLPFTLTPNTSLFHGLSPHYEAIHTVLSAISMGEG
                     IIKVTGEVGTGKTLVCRMLINELPSNVELLYLPNPVMNGHELRQALAKELWLDQSGDD
                     IALIDRIHEKIIDLHAEGKLVVVFIDEAQALSDEALETLRLFGNLETDYKKLLQIVLF
                     GQPELDERLQQHNLRQLRQRITFSALLRALNMNETVAYIRYRIAESGCENNPFSLVQM
                     KAIWKATNGIPRLINQVCHKSLLIAFSEQVNNVPSKAVFNAIIDTADTVKPKHYFPTF
                     WGWRVS"
     gene            393048..394181
                     /locus_tag="VF_RS01805"
                     /old_locus_tag="VF0361"
                     /old_locus_tag="VF_0361"
                     /db_xref="GeneID:54162989"
     CDS             393048..394181
                     /locus_tag="VF_RS01805"
                     /old_locus_tag="VF0361"
                     /old_locus_tag="VF_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshN"
                     /protein_id="WP_047863686.1"
                     /db_xref="GeneID:54162989"
                     /translation="MSVTNKALLNITRQDENKEKQHSLSPADIPNVESKYKASFFFAI
                     GVLSSLSLIGWSTLSGSTEQNVGLKVSEHTQQQALTNEVSEHASSNIKTAQLSISPTK
                     KESTSAVSSIYAEKPLSVDKIEVTASVRSQSTQYHSAVDKPQLITSTEIAKPTSKSTS
                     IVPATSKEQAQANEMLQVEEVELLPSELAHRSRDAAKKALDRSDFKAAMKEYYTVLKY
                     QPSDEESRKRLAALLYGKRDVSEAAAILQQGIKLNDDSVDLRLALSSLLQKEQQPEAA
                     LSVLEYIPVGASVDYLATRGGLAQQLKLMDLAKESYQMLVNQEPDNGRWWLGLAIVYE
                     REAKVKSAYEAYQTALIKPGLSRSSQAFVRDRIKLLATMEGIE"
     gene            394181..395905
                     /gene="tadA"
                     /locus_tag="VF_RS01810"
                     /old_locus_tag="VF0362"
                     /old_locus_tag="VF_0362"
                     /db_xref="GeneID:54162990"
     CDS             394181..395905
                     /gene="tadA"
                     /locus_tag="VF_RS01810"
                     /old_locus_tag="VF0362"
                     /old_locus_tag="VF_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GspE/PulE family protein"
                     /protein_id="WP_005417461.1"
                     /db_xref="GeneID:54162990"
                     /translation="MRLKLRKRLGDLLVEENIVTEEQIEQALSTQKKTGRKLGATLIQ
                     LGFLSEKQMLTFLSQQLGVPLVDLNRAEIDAAAVQLLPEVHARRLRALVLSQQGNTIR
                     VAMSDPADLSAQEALFSQLQQYQVEMVIASERQLVDSFDRFYRRTKEIASFAEKLHSE
                     HQVNDDFNFGISDNDNEEVTVVKLINSLFEDAIQVGASDIHIEPDERVLRLRQRIDGV
                     LHETLLNEVNIASALVLRLKLMANLDISEKRLPQDGRFNIKSRGQSVDIRLSTMPVQY
                     GESVVMRLLNQTSGVQELEQSGLPEHLLTRLRKQLRRPHGMILVTGPTGSGKTTTLYG
                     ALSELNQPSKKIITAEDPVEYRLPRVNQVQVNSKIDLSFSKILRTFLRQDPDIILIGE
                     MRDQETVEIGLRAALTGHLVLSTLHTNDSVDSALRMMDMGAPGYLVASAVRAVLAQRL
                     VKKVCPECSAPDELDEARKQWVQSRFPNQVGVTFQRGNGCQSCNLTGYRGRIGVFELL
                     ELDQPMMDALRANDAVGFSQKARQNPDYKPLLASAMELAMSGVISLDEVMVLGEGDNA
                     SSHQPILM"
     gene            395915..397141
                     /locus_tag="VF_RS01815"
                     /old_locus_tag="VF0363"
                     /old_locus_tag="VF_0363"
                     /db_xref="GeneID:54162991"
     CDS             395915..397141
                     /locus_tag="VF_RS01815"
                     /old_locus_tag="VF0363"
                     /old_locus_tag="VF_0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_011261163.1"
                     /db_xref="GeneID:54162991"
                     /translation="MAIFKYSGRNLRGESVSGSIEATSQESAAEQLMNDGVIPTGIKA
                     NKFGGTSRSMDWKKWLQPSIPLEVLVIFCRQMYSLTKAGVPLLRAMNGLAQNSNNKLL
                     KTTLEEVTADLTNGRSLSVSMQQHPQVFSSLFVSMIHVGENTGRLDQSLMQLANYYEQ
                     EMETRKRIKSAMRYPVFVLTFILLAMFVLNIKVIPQFAGMFARFGVELPLPTRILIAT
                     SSFFVNYWHLLIGAMTGAMFAFQAWISRAEGREKWDKFRLRLPIVGGIVTRAQMSRFS
                     RTFALMLKSGVPLNQSLALSAESLGNKYLENRLLEMKAGIESGTSMSATAAQSGIFTP
                     LVQQMIAVGEETGQIDDLLLEVSDFYDREVDYDLKTLTARIEPILLVIVSGMVLILAL
                     GIFLPMWNMLDVVKGT"
     gene            397144..397599
                     /locus_tag="VF_RS01820"
                     /old_locus_tag="VF0364"
                     /old_locus_tag="VF_0364"
                     /db_xref="GeneID:54162992"
     CDS             397144..397599
                     /locus_tag="VF_RS01820"
                     /old_locus_tag="VF0364"
                     /old_locus_tag="VF_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417464.1"
                     /db_xref="GeneID:54162992"
                     /translation="MSATRILWGALVIILLAVIFINWEKIEPEVEDTAVIMTSREILS
                     SANEFKNYWVVNGQPKTMVKDDIEVSFSSLGWPIALKENDEIDCLQWLHLLLPNKDKI
                     YADSIEIKKPELAKKEQYRCDYSTANGKVVSVMLVKDALKVSVGFIEKK"
     gene            397686..398249
                     /locus_tag="VF_RS01825"
                     /old_locus_tag="VF0365"
                     /old_locus_tag="VF_0365"
                     /db_xref="GeneID:54162993"
     CDS             397686..398249
                     /locus_tag="VF_RS01825"
                     /old_locus_tag="VF0365"
                     /old_locus_tag="VF_0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011261164.1"
                     /db_xref="GeneID:54162993"
                     /translation="MKTQKGFSLVELVIVIVVIGLLATVALPRFLDVSLEAKKASIEG
                     VAGGYATAVLSARAQWEAEARPKTDGYNAVSYDGTEFWLTDPSQANQANYRPGYPIAP
                     REDLDGNDTGSYPASLTSKECILLMEMLLQNAPHVTDDKNDNEGKYLAEVISENGRSQ
                     CKYTQQENEGHFFTYEPESGRVVVTLQ"
     gene            398415..398879
                     /locus_tag="VF_RS01830"
                     /old_locus_tag="VF0366"
                     /old_locus_tag="VF_0366"
                     /db_xref="GeneID:54162994"
     CDS             398415..398879
                     /locus_tag="VF_RS01830"
                     /old_locus_tag="VF0366"
                     /old_locus_tag="VF_0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017050658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011261165.1"
                     /db_xref="GeneID:54162994"
                     /translation="MKRQGGFTLIELVVVIVILGILAVTAAPKFLNLQSDARASSLQG
                     LKGAMAGAAGIVYGKAAIDGKETASTETDVDGIATKYGYPMAKDTGIAEAVVGLSEDW
                     SSATSGATILVVGFKSDNATAASIVATNCFVTYGEATTVSSGVSTIVTDTGC"
     gene            399006..399602
                     /locus_tag="VF_RS01835"
                     /old_locus_tag="VF0367"
                     /old_locus_tag="VF_0367"
                     /db_xref="GeneID:54162995"
     CDS             399006..399602
                     /locus_tag="VF_RS01835"
                     /old_locus_tag="VF0367"
                     /old_locus_tag="VF_0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011261166.1"
                     /db_xref="GeneID:54162995"
                     /translation="MMTFPLKKNQIKQRQNRNGFTLVELIVVILLLAIIAVYTASKYM
                     GASRFSSAAAQEQVLSILRHVQIASMQTNTSHINNACRSVLTSSNQFGVDSACQNQGM
                     ASAVLSDYSKENDRENLDMIRLSYAFNTASGAVAISALSFDLLGRPIIPVSPNLILCT
                     QEDCRITITTPATNESRSVCINNEGFMYRSLQNMSCKI"
     gene            399599..400180
                     /locus_tag="VF_RS01840"
                     /old_locus_tag="VF0368"
                     /old_locus_tag="VF_0368"
                     /db_xref="GeneID:54162996"
     CDS             399599..400180
                     /locus_tag="VF_RS01840"
                     /old_locus_tag="VF0368"
                     /old_locus_tag="VF_0368"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011261167.1"
                     /db_xref="GeneID:54162996"
                     /translation="MKGSLNTQRGLTLIESIVGIVILGFALSVLVSGVFTSSSTSHKA
                     TYQAQAATLGHSVVTDILSRQFDENSDPNGGKYRCGEKNGSGIRISCSMNLGKDGIET
                     IAATFNDVDDFIGCWGEVSVCSSTSLPQYQLGDLIGVSNADEYKSFTVEITVNYNDVD
                     NSGTVITPYKLIRVTLYGSNHAKYTFSAYRGNY"
     gene            400180..400905
                     /locus_tag="VF_RS01845"
                     /old_locus_tag="VF0369"
                     /old_locus_tag="VF_0369"
                     /db_xref="GeneID:54162997"
     CDS             400180..400905
                     /locus_tag="VF_RS01845"
                     /old_locus_tag="VF0369"
                     /old_locus_tag="VF_0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011261168.1"
                     /db_xref="GeneID:54162997"
                     /translation="MKRALGFTLIELILTIVVVGLVALAASNTLQLGFQSYNDSIDRQ
                     DNQMQAKFLIEKLSRELRHAVPNSVEVTSNNQCISFVPIESSAFYLSFPLINQKTIDV
                     VVLSELSLNTNNLRLIINPSTQDDLLQEENHRYVTVDTIAVSGGVSTVTFSSNNNPAF
                     ISNSVSERAFFYHPHPIEYCIVGDGVFRSNTQLINQVHNGHFSFENASIQRNSIMKLV
                     LAFKSDLGEMTQYQHDVQVINVP"
     gene            400895..401329
                     /locus_tag="VF_RS01850"
                     /old_locus_tag="VF0370"
                     /old_locus_tag="VF_0370"
                     /db_xref="GeneID:54162998"
     CDS             400895..401329
                     /locus_tag="VF_RS01850"
                     /old_locus_tag="VF0370"
                     /old_locus_tag="VF_0370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047863687.1"
                     /db_xref="GeneID:54162998"
                     /translation="MFPNKRKQKGNLLVMSIVVMVVVGFLSLNLLKVESSNHDTLSKE
                     VLGTQAWFLAHSGAEWGLTQLFPLGVSGADTSICNGVVRRPSMKSDESGCKQEPEVVC
                     VRNTMNYHSEEIQYFKITSSVTCGSGIDQVTRVQEVWAKEIN"
     gene            401329..404436
                     /locus_tag="VF_RS01855"
                     /old_locus_tag="VF0371"
                     /old_locus_tag="VF_0371"
                     /db_xref="GeneID:54162999"
     CDS             401329..404436
                     /locus_tag="VF_RS01855"
                     /old_locus_tag="VF0371"
                     /old_locus_tag="VF_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MSHA biogenesis protein MshQ"
                     /protein_id="WP_011261170.1"
                     /db_xref="GeneID:54162999"
                     /translation="MNIVWRVIFICLSLVSLSLQAQDFTIPPQQCDAFNGMQTWRNNS
                     VNLITMENHAVVSGGGSIKGQVRFTNDIVNQYPGFIPEVPIEHGLCDGKSCSLSNDSD
                     LPDFLNFSWQVSSEARIINGYDSNWDDQKVFQRTTYFKNPYGIGSHTGFSVKSSHTVL
                     FKSGEYWFDDMRVLGNIEIEGDVIFHVQDKIDFARNVNANNGGTLFIYSYKDSGCEST
                     IDISPNQPLVNQDYSLNLNTDAYVNGYIYTKGSMTLTNGAKVRGAVTACQIAMSNDSE
                     FIHEPLTNCGSNSYQLVISPTSGKGLACDGIEIDFSLVDSNGDVVEGKGQELQVTSAP
                     VATGDRNSACWSDDGNITTPECNHADDSRFETVFPSSGPAVVTRYIHSKFLNSYNVSA
                     SVSSENLTTTEGPYEFIAKAISIVPSEGVDGSDSNQVAGRPYPFRLKIRGKENGNGNM
                     LNCHIIKETTDINVTFSNSVLPATSNESIEIKKEGSSWAEANKSLSISFVNGVAGGDE
                     NQADGSLQARLNDAGKAKLTASANIQGDTFTTSEKFYFRPFTAALCDQSSALPSYTDE
                     LNGAYLTSGTDFNAYLKAVNWIKELDSGTYGNGIPDHDNPSLVCSQVATPSYITHSEG
                     NAKLNLSSQLDYPLSGAIGVITVDGQPIADFNKEVTSENQNSSTKINWNEVGTLSFDV
                     FQNDYFNRSGFNIPSTASKVGRFYPAYFSITNTEWDYPQKQGTSEGSFVYMDQFFKNV
                     DFQVTAYSALDSEVTNYGLFNNELKSRFSLGGEYASRLNITDVDLDETHWSDKAVWQV
                     TNLDHAVTWSKKEGAPSFGNRTTVVDGPFNASGHSSSEITSLGLKISGADPVTFIKDQ
                     QSAEVELLSQPDVRYGRMVLDNVGVASGLSVSVPLRVEYWDGQRFILSKDDDAAVFNG
                     SYHYKQTIWPESDKESAAKLMGTGGIKSGLNSIDLIAEPDNSQLREQIRFWLCLSEGS
                     PQLSEKHTHCESKPSGLYLQPWLQFNWRGKGDEDPSTLVTFGVYRGNDRVIFRGESNI
                     IGTSN"
     gene            404559..405602
                     /locus_tag="VF_RS01860"
                     /old_locus_tag="VF0372"
                     /old_locus_tag="VF_0372"
                     /db_xref="GeneID:54163000"
     CDS             404559..405602
                     /locus_tag="VF_RS01860"
                     /old_locus_tag="VF0372"
                     /old_locus_tag="VF_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000913396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein"
                     /protein_id="WP_005417472.1"
                     /db_xref="GeneID:54163000"
                     /translation="MFKKLRGMFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRQD
                     RSGSAKSVAAVGHDAKQMLGRTPGNISAIRPMKDGVIADFYVTEKMLQHFIKQVHDNS
                     VLRPSPRVLVCVPCGSTQVERRAIRESAQGAGAREVFLIDEPMAAAIGAGLPVSEATG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERI
                     KHEIGSAYPGDDVCEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALE
                     QCPPELASDISEHGMVLTGGGALLRDLDRLLTEETGIPVVVAEEPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     gene            405626..406477
                     /gene="mreC"
                     /locus_tag="VF_RS01865"
                     /old_locus_tag="VF0373"
                     /old_locus_tag="VF_0373"
                     /db_xref="GeneID:54163001"
     CDS             405626..406477
                     /gene="mreC"
                     /locus_tag="VF_RS01865"
                     /old_locus_tag="VF0373"
                     /old_locus_tag="VF_0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_011261171.1"
                     /db_xref="GeneID:54163001"
                     /translation="MTPIFGRGPSLQFRLFIAVMVSASLMLADSRLNTFSDIRYLLNS
                     FVSPIHYAANLPRTMFNGMYERFNSRNTLMLENQRLKQEMFVQNSNLLLMEQLKQENS
                     RLRNLLGSPFIRDEKKMVTEVMAVDSAPYTHQVMIDKGAADGVYEGQPVISDKGIVGQ
                     INNVGAHNSRVLLLTDANNAIPVQAVRNDIRVIASGKGHLDTMQLEHIPTNTDLKVGD
                     LLVTSGLGLVYPEGYPVGYISKIDNDNKRPFASIDIETTVEFDKLRYLLLVWPTGKAP
                     EEISDGE"
     gene            406467..406958
                     /gene="mreD"
                     /locus_tag="VF_RS01870"
                     /old_locus_tag="VF0374"
                     /old_locus_tag="VF_0374"
                     /db_xref="GeneID:54163002"
     CDS             406467..406958
                     /gene="mreD"
                     /locus_tag="VF_RS01870"
                     /old_locus_tag="VF0374"
                     /old_locus_tag="VF_0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="WP_011261172.1"
                     /db_xref="GeneID:54163002"
                     /translation="MASSHLMRGRVIIWLSFLIALTLQAAPWPGALEVLRPSWIILVT
                     FYWVLALPHRVNVGTAMVLGILWDLLLGTTLGIRGMTMAILVYLVAANFKVLRNLALW
                     QQAAIFSGLTLLGKVLEFMGEFLVHDVSFNAHFLWAGVLNFLLWPWLFLLMRRVRRHW
                     SIR"
     gene            406969..407544
                     /locus_tag="VF_RS01875"
                     /old_locus_tag="VF0375"
                     /old_locus_tag="VF_0375"
                     /db_xref="GeneID:54163003"
     CDS             406969..407544
                     /locus_tag="VF_RS01875"
                     /old_locus_tag="VF0375"
                     /old_locus_tag="VF_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="WP_011261173.1"
                     /db_xref="GeneID:54163003"
                     /translation="MEAQVFLASGSPRRKELLTQLGYQFDVLSVDVEEIHQEHETPLM
                     YVERLSKDKAQAGVKAIEKTKNKYTPVLGSDTIVVIDGVILEKPKDFKDAKRMLLALS
                     GRQHQVMTAVTIATPEKIRTKTVITQVWFKTLSEQEIEQYWESGEPCDKAGSYGIQGS
                     GGRFVSRIDGSYHAVMGLPLMETDQLLHQFL"
     gene            407563..409032
                     /gene="rng"
                     /locus_tag="VF_RS01880"
                     /old_locus_tag="VF0376"
                     /old_locus_tag="VF_0376"
                     /db_xref="GeneID:54163004"
     CDS             407563..409032
                     /gene="rng"
                     /locus_tag="VF_RS01880"
                     /old_locus_tag="VF0376"
                     /old_locus_tag="VF_0376"
                     /EC_number="3.1.26.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_005417478.1"
                     /db_xref="GeneID:54163004"
                     /translation="MSTELLINVTPSETRVAMIEAGVLQEVHVEREARRGIVGNIYKG
                     RVSRVLPGMQAAFIDIGLDKAAFLHASDIVPHTECVSENEKRQFQVRDISQLVHQGQD
                     LVVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEKERNRLKDTVSD
                     YCDEFGGFIIRTAAEGASEAEISQDAAFLKRLWHKVIERRKKNKTKSMLYGELGLDQR
                     ILRDFVGTELDLIRVDSKLAFEKLKEFTTEFVPELTKKLEYYSGDKPIFDMYETENEI
                     QRALDRKVELKSGGYLIIDQTEAMTTVDINTGAFVGRRNLEETIFNTNIEATQAIARQ
                     LRLRNLGGIIIIDFIDMLSEEHRRRVLQSLGSALEKDRVKTNINGFTQLGLVEMTRKR
                     TRESIEHILCGQCPTCEGRGAVKTVESVCYEILREITRVNRAYDSDKFVVYASVAVAD
                     ALEGEESHALAELELFIGKQVKIQAEPLYIQEQFDVVMM"
     gene            409044..412913
                     /locus_tag="VF_RS01885"
                     /old_locus_tag="VF0377"
                     /old_locus_tag="VF_0377"
                     /db_xref="GeneID:54163005"
     CDS             409044..412913
                     /locus_tag="VF_RS01885"
                     /old_locus_tag="VF0377"
                     /old_locus_tag="VF_0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02099 family protein"
                     /protein_id="WP_047863688.1"
                     /db_xref="GeneID:54163005"
                     /translation="MTTKLIRFERCLMGLLLLVFLLAALVITSLRLFLPTLNQYQPEI
                     ETFLSETTGFSISIGEVKGRWRNTNPSLNLRKLTAVDPSTGDEIISVGAVEIQLNILS
                     SLWAQRPQFADLRIDKLTADLTSLGPSSLGKSEEDAKAEQESDESLAKRLEDLFLVRL
                     NHFSIKSSQVAFMALDGKEKTIQIDSLQWRNERRKHLAEGIVSVIGSEINQLKVIANF
                     KEKGSFKSLDGHFYVEAKNIQVTPWITESIQKEYGITQGEVSVNAWFSFKDGQPIDAL
                     VEASPSYLNWVEDKSIHQVSVEGGVFELQPDDAGWKVFATDVQVKHQGNKWPEITGSF
                     SWQPEKWILNLAHIDLQSALGLKTLLPPSQDNVTDLLATLNPKGSVNDIRVESDTTIG
                     LSYSASILSAGMNQWELLPGFHKLDVLISGDEEKGKAKLSLVDDTLPYGDVFQAPLNI
                     NDGDVTAYWEVNDDGWRLWSDYIYVSTPDLQARGEFRLDFPTDKPSVLSFYAEADAFN
                     ADQTWRYLPTLALGQDLTDYLSAAVQGGNAKTVQLLWYGELNDFPYTKYDGIFQVKVG
                     LKDAQFAFDTAWPPLTNLQLDLMFQNASMFLSSHSADLMDVHATRVTGRIANLSEDGK
                     LTIRATANGSGKAVREYMTATPLVDSVGAALNSIQVDNRVDALLRLDIPFSGEDVRAW
                     GYADLANNHIELQSPNIVLTNAKGRIEFDNDVVKANGIKASLLGQPVSLSFHGEDQSD
                     YYGVKIETKGNWKIAPLKDYIDSPMMDKVSGTSSWNSNINLQVADVGFTYQIGVYAQL
                     GNMTSTLPYPLASEKGTTEKASLQVSGNSEKLSGRLTLPDTKYQAEIDITGKIPEITA
                     SHVVVGKGNYKVSPIVGNSASINTKYLDADAWIAEPILSKESNKKPKSVAMSHFPVIP
                     VPTRIDSNIKSLHLASLDWNDVNADIRKKSQGWYAQVRSQEVDGKASWKDNDELLVQL
                     DNLHIFIPSLDKPENQRGLNRAKENEPLISSFDREFFRLMPNLELTIKDAWIQGYKLG
                     KVDTKLHKKGDTFYLDKLKITSGENKLAMSGNWLLDKEKSHSTFKVKASGENNSELLA
                     RFGISSGIQKASYSMDGDLNWDGAPWSIRTNTLSGELASTLGEGVITDVKGAARFLGL
                     FSIDSIIRKMQLDFRDVFDDGMAFNSITGSGKMRNGIFVSNNLTMDAVAGEMNIKGKA
                     DLNTRLVDAEVSFTPDLTSGIPIITAFAVAPQTAIIVLAVATAIAPVIDVITQVNYKV
                     EGPLDSPTVKELSRSQGEYQLPEKTEK"
     gene            412928..413746
                     /locus_tag="VF_RS01890"
                     /old_locus_tag="VF0378"
                     /old_locus_tag="VF_0378"
                     /db_xref="GeneID:54163006"
     CDS             412928..413746
                     /locus_tag="VF_RS01890"
                     /old_locus_tag="VF0378"
                     /old_locus_tag="VF_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase family protein"
                     /protein_id="WP_011261175.1"
                     /db_xref="GeneID:54163006"
                     /translation="MSKVGIVQMTSGAEPDENIKQLKLKLKGLQLQGAKLVLTPENCI
                     VFGQKDDYERYAEPVGKGVLQDQLSALARHYQLWLVIGSFPTRNENGSLSTTSLVFDD
                     NGHLVEHYNKLHMFDVDVEDRHQSYRESDTFTAGNDIKIVDTPIGKVGLSICYDVRFP
                     QLYSELRKQGAEIILVPAAFTKVTGYAHWDILLRSRAIETQCWVLAAGQWGKHGAGRE
                     TWGHSMIIDPWGNKVTAQQEGTGVIIADIDLEQMNQIRKKMPVAQHARLISYLP"
     gene            413840..415285
                     /gene="tldD"
                     /locus_tag="VF_RS01895"
                     /old_locus_tag="VF0379"
                     /old_locus_tag="VF_0379"
                     /db_xref="GeneID:54163007"
     CDS             413840..415285
                     /gene="tldD"
                     /locus_tag="VF_RS01895"
                     /old_locus_tag="VF0379"
                     /old_locus_tag="VF_0379"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008220563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease TldD"
                     /protein_id="WP_011261176.1"
                     /db_xref="GeneID:54163007"
                     /translation="MSLQEVEQSLLSQAGIGQQELSQTLSTIAKRDVDYADIYFQSCW
                     HESLVLEDSIIKDGSFNIDRGVGIRAVAGEKTGFAYSDQINLEALTQSARAARGIVQQ
                     GGEGKVKAFSSQSIPQFYQPVNPLNSLDKQQKIALLEEIDAYIRAKEPLVQEVSASIS
                     GVYEQMLVAALDGTYAADIRPLVRLSISVLVQRGDKRERGSAGGGGRYGYDYFLTEVN
                     GKSIALEFADEAIRQALVNLDADAAPAGMMPVVLGSGWPGVLLHEAVGHGLEGDFNRK
                     GSSVFAGKVGEKVTSSVCTIVDDGTMVDRRGSLNVDDEGVPGQYNTLIENGVLKGYMQ
                     DKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMLPGEYAPEEIISTVKKGIYAPNFG
                     GGQVDITSGKFVFSASEAYLIEDGKITRPVKGATLIGSGIEAMQQISMVGNDLSLDRG
                     VGVCGKAGQSVPVGVGQPTLKLDALTVGGTE"
     gene            complement(415378..415908)
                     /locus_tag="VF_RS01900"
                     /old_locus_tag="VF0380"
                     /old_locus_tag="VF_0380"
                     /db_xref="GeneID:54163008"
     CDS             complement(415378..415908)
                     /locus_tag="VF_RS01900"
                     /old_locus_tag="VF0380"
                     /old_locus_tag="VF_0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein"
                     /protein_id="WP_005417486.1"
                     /db_xref="GeneID:54163008"
                     /translation="MARKNQKAPWEEEEEIIWVSKTEMKNDMEDLQKLGEELVGLKPS
                     VLAKFPLSDDLREAINDAQRFKNEAKRRQLQFIGKLMRNEDPEPIQLALDKIRNKHSQ
                     ATAALHKLETLRDRMIEEGDAVIEEVMVKYPDADRQRFRQLARQAKKEKASNKPPKAF
                     REIFQILKDLYLNEDL"
     gene            416027..417370
                     /gene="pmbA"
                     /locus_tag="VF_RS01905"
                     /old_locus_tag="VF0381"
                     /old_locus_tag="VF_0381"
                     /db_xref="GeneID:54163009"
     CDS             416027..417370
                     /gene="pmbA"
                     /locus_tag="VF_RS01905"
                     /old_locus_tag="VF0381"
                     /old_locus_tag="VF_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011149374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease PmbA"
                     /protein_id="WP_005417487.1"
                     /db_xref="GeneID:54163009"
                     /translation="MGAKQQMMNQKIELEAAVAKALDMATQHASAAEVAITKTTGISV
                     STLMGEVENVEFNRDGALGITVYRGHRKGSASTSDLSDKAIQQTVAAALDIANYTSED
                     PFSGPAPKELMAKDIPDLDLFHPDEPEPDYAAQKAIEAEQAALEYHSSIKQSDGASYD
                     SHYGIKVYGNSHGMLASYPSSRQSISCSVIGVDKNGDMERDYSYTVARHRDDLWDAKK
                     VGLEAAKRTVSRLDAKKLDTMKVPVMFAADVATGLLGHLVMAISGANLYRKSTFMLDK
                     LNEKILPEWFNVSERPHILKGLASSPFDSEGLYTQDREIITDGVLATYLLTSYAARKL
                     NMTPTGHAGGIHNWFVKSTGQSFEQMLKTMGTGLLVTELMGQGVNTVTGDYSRGAAGF
                     WVENGEIQYPVSEITIAGNLADMYHNIVAVGNDVETRSQIQTGSILIESMKIAGQ"
     gene            complement(417477..418832)
                     /gene="mgtE"
                     /locus_tag="VF_RS01910"
                     /old_locus_tag="VF0382"
                     /old_locus_tag="VF_0382"
                     /db_xref="GeneID:54163010"
     CDS             complement(417477..418832)
                     /gene="mgtE"
                     /locus_tag="VF_RS01910"
                     /old_locus_tag="VF0382"
                     /old_locus_tag="VF_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_005417489.1"
                     /db_xref="GeneID:54163010"
                     /translation="MQELQDFDQTHQTLQEVSNALDSGMFVHVRRLLQDMEPEDIAHL
                     LEASPRKSRNVLWQLTDPEDYGEILDELSEDVKDGIVSQMAPESIAEATEGMETDDVA
                     YVLRSLPDDVSREVLSQMDTVDRFRVETALSYPEDTAGGMMNTDFITIRADVEIDVVL
                     RYLRMKGELPEATDALYVLDEESRLIGHLSLTTILTAQPDVLVSDVMEDADEAIPVNT
                     DDGEVANLFERRNWVSAPVVDENNLLLGRITIDDVVDVIREDAEHSMMSMAGMDDEED
                     TFAPVVKSARRRSVWLGMNVLAALAAASVSNMFEATLAQMASIAVLMTIVPSMGGVAG
                     NQTVALVIRGLAVGHIGDSNKKELLMKEAGIGILNGILWAAIIGGIVMVWKGDIMLGA
                     IISAAMLVNLTVAGVAGVSIPLILKKMNIDPALAGGMALTTITDVIGLFAFLGLATIL
                     M"
     gene            complement(418983..419261)
                     /locus_tag="VF_RS01915"
                     /old_locus_tag="VF0383"
                     /old_locus_tag="VF_0383"
                     /db_xref="GeneID:54163011"
     CDS             complement(418983..419261)
                     /locus_tag="VF_RS01915"
                     /old_locus_tag="VF0383"
                     /old_locus_tag="VF_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr family phosphocarrier protein"
                     /protein_id="WP_005417490.1"
                     /db_xref="GeneID:54163011"
                     /translation="MPISSRHLLIKNRLGLHARAAIKLVEMAQSFDAVITLTNEENTQ
                     ATADGVMGLLMLDSSQGQYVDVSADGVDAEQALNAICELIEAGFDEDE"
     gene            complement(419280..420134)
                     /gene="rapZ"
                     /locus_tag="VF_RS01920"
                     /old_locus_tag="VF0384"
                     /old_locus_tag="VF_0384"
                     /db_xref="GeneID:54163012"
     CDS             complement(419280..420134)
                     /gene="rapZ"
                     /locus_tag="VF_RS01920"
                     /old_locus_tag="VF0384"
                     /old_locus_tag="VF_0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase adapter RapZ"
                     /protein_id="WP_011261178.1"
                     /db_xref="GeneID:54163012"
                     /translation="MKLMVVSGSSGAGKSVALRVLEDLGYYCVDNLPIDLLTQFVESI
                     QHSSQNVAVSVDIRNLPKDPALLKNTLALLKKTHDVTVIFLDAEDKELIKRYSETRRL
                     HPLSLIGEQCSLEQAVTLEKSILSDYREEADLVLDTTTKSIHDLSETLRSRILGRESK
                     ELVMVFESFGFKHGLPTDADYVFDVRFLPNPHWEPSLRPMTGLDKPVADYLAKHTEVI
                     QLKEQIQQFLTTWLPALEKNNRSYLTVAIGCTGGQHRSVYITQQLGEYFKQQGKQVQI
                     RHKTLERH"
     gene            complement(420158..420601)
                     /gene="ptsN"
                     /locus_tag="VF_RS01925"
                     /old_locus_tag="VF0385"
                     /old_locus_tag="VF_0385"
                     /db_xref="GeneID:54163013"
     CDS             complement(420158..420601)
                     /gene="ptsN"
                     /locus_tag="VF_RS01925"
                     /old_locus_tag="VF0385"
                     /old_locus_tag="VF_0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen regulatory protein PtsN"
                     /protein_id="WP_011261179.1"
                     /db_xref="GeneID:54163013"
                     /translation="MQLSTILSLDCTKSAVQCTSKKRALELISEIAAPRIGQSPQELF
                     ESLLNREKMGSTGIGNGIAIPHGRMFNCDNAVAVLIQCQEPIEFDAIDNRPVDILFAL
                     LVPDEQCKLHLKTLSSVAEKLNDKQVLRQLRHAENDDELYQIITS"
     gene            complement(420603..420890)
                     /gene="hpf"
                     /locus_tag="VF_RS01930"
                     /old_locus_tag="VF0386"
                     /old_locus_tag="VF_0386"
                     /db_xref="GeneID:54163014"
     CDS             complement(420603..420890)
                     /gene="hpf"
                     /locus_tag="VF_RS01930"
                     /old_locus_tag="VF0386"
                     /old_locus_tag="VF_0386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013855969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome hibernation promoting factor"
                     /protein_id="WP_011261180.1"
                     /db_xref="GeneID:54163014"
                     /translation="MQINIAGQNVELTDSLREYVNTKFQKLERFFEHINNVHVVLKLE
                     KVQHVAEATLHVNQGDIHAHSDSEDMYAAIDGLVDKLIRQLNKHKEKLSSH"
     gene            complement(420910..422379)
                     /locus_tag="VF_RS01935"
                     /old_locus_tag="VF0387"
                     /old_locus_tag="VF_0387"
                     /db_xref="GeneID:54163015"
     CDS             complement(420910..422379)
                     /locus_tag="VF_RS01935"
                     /old_locus_tag="VF0387"
                     /old_locus_tag="VF_0387"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017022383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="WP_011261181.1"
                     /db_xref="GeneID:54163015"
                     /translation="MKASLQLKMGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALDSN
                     PLLDVEEEALSTPETLTSPEPKSEKETASAEQETPITDSSDVIESNNISEELEMDASW
                     DDVYSANSGSTGLAIDDDTPIYQGETTESLQDYLMWQADLTPFTDLDRTIATTIIESL
                     DEYGYLTSSLDDILESIGDEEVEMDEVEAVLKRIQQFDPLGVASRDLAECLLLQLATY
                     PANTPWLPETKLILKDHINLLGNRDYRQLAKETKLKESDLKQVMMLIHELDPRPGNRV
                     IDTETEYVIPDVSVFKHNGKWVVTINPDSVPRLKVNAEYAALGKTMGNTPDGQFIRTN
                     LQEAKWLIKSLESRNETLLKVARCIVEHQQDFFEYGEEAMKPMVLNDIALDVDMHEST
                     ISRVTTQKFMHTPRGIFELKYFFSSHVSTDNGGECSSTAIRALVKKLVAAENQAKPLS
                     DSKIATLLAEQGIQVARRTIAKYRESLGIAPSNQRKRLL"
     gene            complement(422403..423128)
                     /gene="lptB"
                     /locus_tag="VF_RS01940"
                     /old_locus_tag="VF0388"
                     /old_locus_tag="VF_0388"
                     /db_xref="GeneID:54163016"
     CDS             complement(422403..423128)
                     /gene="lptB"
                     /locus_tag="VF_RS01940"
                     /old_locus_tag="VF0388"
                     /old_locus_tag="VF_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002537305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS export ABC transporter ATP-binding protein"
                     /protein_id="WP_005417497.1"
                     /db_xref="GeneID:54163016"
                     /translation="MAILEAKNLAKTYGSRKVVSDVSLTVESGKIVGLLGPNGAGKTT
                     SFYMIVGLVARDEGSITIDGVDISLQPMHNRSKMGIGYLPQEASIFRKLSVFDNIMAV
                     LQTRKDLNKAERLDKLEELLDEFNIQHIRNSNGMALSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVIDIKKIIQHLRDRGLGVLITDHNVRETLDVCEHAYIVSQGHMIAN
                     GTPEHVLNDEHVKRVYLGDQFKL"
     gene            complement(423131..423628)
                     /gene="lptA"
                     /locus_tag="VF_RS01945"
                     /old_locus_tag="VF0389"
                     /old_locus_tag="VF_0389"
                     /db_xref="GeneID:54163017"
     CDS             complement(423131..423628)
                     /gene="lptA"
                     /locus_tag="VF_RS01945"
                     /old_locus_tag="VF0389"
                     /old_locus_tag="VF_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide transport periplasmic protein
                     LptA"
                     /protein_id="WP_011261182.1"
                     /db_xref="GeneID:54163017"
                     /translation="MKLSHVSLLASLLFSASSWALSSDTEQPIHINSNSQNFDMQSNQ
                     VTFTGNVTLKQGSIEIFADKIVVIRPQGKEGREVLEAYGKPTRFSQLTDDGKTLKGKA
                     NKLRYELENEFLKMTDSAELTQDDSIIKGKVITYNMKTQKLIADGGKDDRVTTILQPS
                     QLNNK"
     gene            complement(423609..424172)
                     /gene="lptC"
                     /locus_tag="VF_RS01950"
                     /old_locus_tag="VF0390"
                     /old_locus_tag="VF_0390"
                     /db_xref="GeneID:54163018"
     CDS             complement(423609..424172)
                     /gene="lptC"
                     /locus_tag="VF_RS01950"
                     /old_locus_tag="VF0390"
                     /old_locus_tag="VF_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS export ABC transporter periplasmic protein
                     LptC"
                     /protein_id="WP_011261183.1"
                     /db_xref="GeneID:54163018"
                     /translation="MSLKHLFMAVLLMICSWSGYNLYYDYVKGEQQTTPDQQVPVFTG
                     KGITNNNYDVSGIRNYQINAKALARFGKTGETNFTTPHLFVFKDGELKEWEIISDLGV
                     LNKKHELYLSGNVIVKNLLPDAAFETMTTDSMKIELTTKDFMTEDVVNLIGPTFETTG
                     VGMKGNFTSQEATLLENVQGIYEAFTR"
     gene            complement(424169..424729)
                     /gene="kdsC"
                     /locus_tag="VF_RS01955"
                     /old_locus_tag="VF0391"
                     /old_locus_tag="VF_0391"
                     /db_xref="GeneID:54163019"
     CDS             complement(424169..424729)
                     /gene="kdsC"
                     /locus_tag="VF_RS01955"
                     /old_locus_tag="VF0391"
                     /old_locus_tag="VF_0391"
                     /EC_number="3.1.3.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate-8-phosphatase KdsC"
                     /protein_id="WP_011261184.1"
                     /db_xref="GeneID:54163019"
                     /translation="MTTKLVSTLYGQVEESIFNIAKEIKLLICDVDGVFSDGLVYMGN
                     DGEELKTFHTRDGYGVKSLMSAGVEIAIITGRSSKIVENRMTALGIKLIYQGQDNKLQ
                     AYQDILTKLNVAPEHTGYIGDDLIDWPVMEKVALKVCVADGHPLLVQRANYVTTIKGG
                     HGAVREVSDLILEAKGELEQHKGLSI"
     gene            complement(424729..425703)
                     /gene="kdsD"
                     /locus_tag="VF_RS01960"
                     /old_locus_tag="VF0392"
                     /old_locus_tag="VF_0392"
                     /db_xref="GeneID:54163020"
     CDS             complement(424729..425703)
                     /gene="kdsD"
                     /locus_tag="VF_RS01960"
                     /old_locus_tag="VF0392"
                     /old_locus_tag="VF_0392"
                     /EC_number="5.3.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose-5-phosphate isomerase KdsD"
                     /protein_id="WP_011261185.1"
                     /db_xref="GeneID:54163020"
                     /translation="MATQFDFCKAGKNVLQIEIDALTQLSNYINDDFTKACQLMLECK
                     QKVVVMGMGKSGHIGNKIAATLASTGTPSFFVHPGEASHGDLGMIEKGDIVIAISNSG
                     EASEILALLPVIKRLGITLITMTGKPESSMAKVADVNLQITVPQEACPLGLAPTSSTT
                     ATLAMGDAFAVALLQARGFTADDFALSHPGGALGRKLLLLLSDIMHTGDELPMVTADA
                     LIKTALLEVSEKGLGMTAIVDNEQKVIGIFTDGDLRRLLDNKIDIHTQTIGEVMTHSP
                     AVANPNLLAVEGLNLMQDKKINGLLLCDETHRLVGALNMHDLLKAGVM"
     gene            complement(425889..426860)
                     /locus_tag="VF_RS01965"
                     /old_locus_tag="VF0393"
                     /old_locus_tag="VF_0393"
                     /db_xref="GeneID:54163021"
     CDS             complement(425889..426860)
                     /locus_tag="VF_RS01965"
                     /old_locus_tag="VF0393"
                     /old_locus_tag="VF_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium/sodium antiporter"
                     /protein_id="WP_011261186.1"
                     /db_xref="GeneID:54163021"
                     /translation="MTELLMPTLLLIVGLSLLVWGADKLVFGSAALARNYGISPLVIG
                     MTILAMGSSAPEMMVSAAAALDGKTDTAVGNVIGSNIANIALILGITALIKPLAISSA
                     IIRRELPLMLMVTLLAGGIMFNNYLGFYEGLLLIGLFACFIIAMLYISKNEQQNGDIL
                     LEEQESEIPEGVANGKALFWVVVGLILLPVGANMLIDNAVVIAKYFGMSELVIGLTII
                     ALGTSLPELAASVAGVLKGEDDMAAGNIIGSNVFNILAVMGIPALINPSEISPDLMGR
                     DFYVMLGVSILLLIMALGKSRSINRIEGGILVTCFCVYQGYLFLNMG"
     gene            427062..427868
                     /gene="mlaF"
                     /locus_tag="VF_RS01970"
                     /old_locus_tag="VF0394"
                     /old_locus_tag="VF_0394"
                     /db_xref="GeneID:54163022"
     CDS             427062..427868
                     /gene="mlaF"
                     /locus_tag="VF_RS01970"
                     /old_locus_tag="VF0394"
                     /old_locus_tag="VF_0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid ABC transporter ATP-binding protein
                     MlaF"
                     /protein_id="WP_012534228.1"
                     /db_xref="GeneID:54163022"
                     /translation="MDTQNTLIKIENLTFKRGERIIFDDISLSVPKGKITAIMGPSGI
                     GKTTLLRLIGGQILPESGNIHFEEWNIPKLGRKALYLARKKMGMLFQSGALFTDMNVF
                     DNVAFPLREHTQLPEKLIRTLVLLKLEAVGLRGAAQLMPSELSGGMARRAALARAIAL
                     DPDLIMYDEPFVGQDPITMGVLVDLIRNLNDALGLTSVVVSHDVPEVMSIADHVYLLA
                     NGKIIAQGSPQELEQNPDPQVRQFLDGESDGPVPFRFPANTLNEDLFSYE"
     gene            427861..428655
                     /gene="mlaE"
                     /locus_tag="VF_RS01975"
                     /old_locus_tag="VF0395"
                     /old_locus_tag="VF_0395"
                     /db_xref="GeneID:54163023"
     CDS             427861..428655
                     /gene="mlaE"
                     /locus_tag="VF_RS01975"
                     /old_locus_tag="VF0395"
                     /old_locus_tag="VF_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid asymmetry maintenance ABC transporter
                     permease subunit MlaE"
                     /protein_id="WP_011261188.1"
                     /db_xref="GeneID:54163023"
                     /translation="MSNFSLVSSIEQIGRRALSVCEAFGRATFMLLGAIFAKPQPIKM
                     FPLLLKQLYSVGVLSLVIIVVSGLFIGMVISLQGYIILVDYGAETSLGQLVSLSLLRE
                     LGPVVTALLFAGRAGSALTAEIGLMKTTEQISSMEMMAVDPLRQIIAPRLWAGIISMP
                     VLAVIFMAVGIWGGQIVGVEWKGIDYGSFWSVMQSSVDVRYDIINSLIKCVVFAFIVT
                     WIALFNGYDATPTSEGISLATTRTVVHSSLAVLGIDFVLTALMFGN"
     gene            428659..429153
                     /gene="mlaD"
                     /locus_tag="VF_RS01980"
                     /old_locus_tag="VF0396"
                     /old_locus_tag="VF_0396"
                     /db_xref="GeneID:54163024"
     CDS             428659..429153
                     /gene="mlaD"
                     /locus_tag="VF_RS01980"
                     /old_locus_tag="VF0396"
                     /old_locus_tag="VF_0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipid asymmetry maintenance
                     protein MlaD"
                     /protein_id="WP_011261189.1"
                     /db_xref="GeneID:54163024"
                     /translation="MQQTRKVEFFVGLFVLAGMAALLMLLLKVADVRSGGSGEYYTLN
                     AQFDNIGSLKSRSPVKVGGVVIGRVDNITLDKESYLPIVSMQIDKQFGSFPETSAAQI
                     LTSGLIGEQYIGIVPGFIDEDIDMLGNGDFIEDTKSALVLEDMIGQVLYSIGGDSSEA
                     SEEE"
     gene            429153..429794
                     /gene="mlaC"
                     /locus_tag="VF_RS01985"
                     /old_locus_tag="VF0397"
                     /old_locus_tag="VF0398"
                     /old_locus_tag="VF_0397"
                     /db_xref="GeneID:54163025"
     CDS             429153..429794
                     /gene="mlaC"
                     /locus_tag="VF_RS01985"
                     /old_locus_tag="VF0397"
                     /old_locus_tag="VF0398"
                     /old_locus_tag="VF_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid-binding protein MlaC"
                     /protein_id="WP_011261190.1"
                     /db_xref="GeneID:54163025"
                     /translation="MKQWISAVIVVICFFSSAINAQEIDKTKPYEMMAQVSEITFARL
                     KSEQSAIKTDPNILKTVVDEELMPYVNVKYAAYKLLGTHLKKTTPEERAEFVTAFRDY
                     LVSSYAQVLTLYTDQKIVLEKAKKIPEGKRIISVRVDILDSARPTVKVDFKLRKNKKT
                     GEWQAFDMVAEGVSLLSTKQSEWNGKIRKEGISSVSAELHSLAKQPIRLEGNK"
     gene            429794..430114
                     /locus_tag="VF_RS01990"
                     /old_locus_tag="VF0399"
                     /old_locus_tag="VF_0399"
                     /db_xref="GeneID:54163026"
     CDS             429794..430114
                     /locus_tag="VF_RS01990"
                     /old_locus_tag="VF0399"
                     /old_locus_tag="VF_0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="STAS domain-containing protein"
                     /protein_id="WP_011261191.1"
                     /db_xref="GeneID:54163026"
                     /translation="MPVIDLCVTKVDEISFKGALDRETVPNIWNKLTKWQPNLSQVKV
                     DLAHVNRIDSAGLVLLLHLIEHAKNQNCHIMFTFVPDQLITLIQLSNVESLFADHINN
                     AKVE"
     gene            430114..430371
                     /locus_tag="VF_RS01995"
                     /old_locus_tag="VF0400"
                     /old_locus_tag="VF_0400"
                     /db_xref="GeneID:54163027"
     CDS             430114..430371
                     /locus_tag="VF_RS01995"
                     /old_locus_tag="VF0400"
                     /old_locus_tag="VF_0400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="WP_005417509.1"
                     /db_xref="GeneID:54163027"
                     /translation="MDSAEIKELLDAALQLEEIHVKGEGSHFEVIAVDASFAGMSRVK
                     KQQTIYGPLMEHISTNTIHALSIKAFTPEEWARDKKLNSLF"
     gene            430383..431651
                     /gene="murA"
                     /locus_tag="VF_RS02000"
                     /old_locus_tag="VF0401"
                     /old_locus_tag="VF_0401"
                     /db_xref="GeneID:54163028"
     CDS             430383..431651
                     /gene="murA"
                     /locus_tag="VF_RS02000"
                     /old_locus_tag="VF0401"
                     /old_locus_tag="VF_0401"
                     /EC_number="2.5.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_011261192.1"
                     /db_xref="GeneID:54163028"
                     /translation="MYKFRIQGSDKPLSGEVTISGAKNAALPILFASLLAEEPVEVAN
                     VPKLRDVDTTMELLKRLGAEVSRNGSVHIDASGVNDFCAPYDLVKTMRASIWALGPLV
                     ARFGKGQVSLPGGCAIGARPVDLHIHGLEQLGATIKLEEGYVKAEVDGRLKGAHIVMD
                     KVSVGATITVMCAATLAEGTTVLENAAREPEIVDTANFLNAIGAKVSGMGTDTITIEG
                     VERLGGGYHEVVADRIETGTFLVAAAVSGGKIVCKNTKAHLLEAVLAKLEEAGADVQT
                     GDDWISLDMTGRELKAVNIRTAPHPAFPTDMQAQFTLLNMMAKGSGIITETIFENRFM
                     HIPELQRMGAHAEIEGNTAICGDTDGLSGAQVMATDLRASASLVIAGCIAKGETIVDR
                     IYHIARGYDKIEDKLTALGANIERVHSDDL"
     gene            431799..432527
                     /locus_tag="VF_RS02005"
                     /old_locus_tag="VF0402"
                     /old_locus_tag="VF_0402"
                     /db_xref="GeneID:54163029"
     CDS             431799..432527
                     /locus_tag="VF_RS02005"
                     /old_locus_tag="VF0402"
                     /old_locus_tag="VF_0402"
                     /EC_number="2.3.1.51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acylglycerol-3-phosphate O-acyltransferase"
                     /protein_id="WP_005417513.1"
                     /db_xref="GeneID:54163029"
                     /translation="MIALLRLIALAIFAVFTFVFGCGYCLLSPRNPKHVYTFGRLFAR
                     MSRVFGIKLEIRVPESAKSSEPSLYIANHQNNWDLFTVSGAIQPRTVTVGKKSLAWMP
                     LFGQLYWITGNILIDRNNRSKAVGTIAQVAENIKKRNVSVWMFPEGTRSRGRGLLPFK
                     TGAFHAAIAADVPVTPIVCSNTQGNIKLNRWNNGHVIVEILPPISSEGYEKDNVRELA
                     NLCREQMITKLEELNKEVAERNQA"
     gene            432599..433144
                     /gene="idi"
                     /locus_tag="VF_RS02010"
                     /old_locus_tag="VF0403"
                     /old_locus_tag="VF_0403"
                     /db_xref="GeneID:54163030"
     CDS             432599..433144
                     /gene="idi"
                     /locus_tag="VF_RS02010"
                     /old_locus_tag="VF0403"
                     /old_locus_tag="VF_0403"
                     /EC_number="5.3.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="WP_011261194.1"
                     /db_xref="GeneID:54163030"
                     /translation="MTEYVVLVNEQGDAIGTMEKLEAHEKGLLHLAFSVLLYRETDLG
                     KEFLLQKRAECKYHSKNKWSNTCCSHPRVNENVEVAGTRRLNEEIGITGVLPEQFVNL
                     GWFIYQAELENGLSEHEQDYILIANTPDVSFILNPEEVSDIQWWSEADIEKEMKANPD
                     TFSVWFPTVYKKVLTHLQQVN"
     gene            complement(433218..433607)
                     /locus_tag="VF_RS02015"
                     /old_locus_tag="VF0404"
                     /old_locus_tag="VF_0404"
                     /db_xref="GeneID:54163031"
     CDS             complement(433218..433607)
                     /locus_tag="VF_RS02015"
                     /old_locus_tag="VF0404"
                     /old_locus_tag="VF_0404"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014233065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_005417516.1"
                     /db_xref="GeneID:54163031"
                     /translation="MTKVLHTDNAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVSD
                     DIAEQARQSLENVKAVVEASGLTVSDIVKMTVFVKDLNDFGTVNEVYGNFFDEHKVAN
                     YPARSCVEVARLPKDVGIEIEAIAVRK"
     gene            complement(433746..434210)
                     /locus_tag="VF_RS02020"
                     /old_locus_tag="VF0405"
                     /old_locus_tag="VF_0405"
                     /db_xref="GeneID:54163032"
     CDS             complement(433746..434210)
                     /locus_tag="VF_RS02020"
                     /old_locus_tag="VF0405"
                     /old_locus_tag="VF_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="WP_011261195.1"
                     /db_xref="GeneID:54163032"
                     /translation="MANKTQLRVEAINNGTVIDHIPANIGIKVLKLFQMDKSAERVTV
                     GLNLPSSALGAKDLLKIENTFITPEQASKLALYAPHATVNQIENYEVVKKIPLVLPEQ
                     ITGVFECPNSNCITHGEPVDSSFKVLTKKEDIHLKCKYCEKVYSREVVTDLN"
     gene            complement(434224..435153)
                     /gene="pyrB"
                     /locus_tag="VF_RS02025"
                     /old_locus_tag="VF0406"
                     /old_locus_tag="VF_0406"
                     /db_xref="GeneID:54163033"
     CDS             complement(434224..435153)
                     /gene="pyrB"
                     /locus_tag="VF_RS02025"
                     /old_locus_tag="VF0406"
                     /old_locus_tag="VF_0406"
                     /EC_number="2.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_021017973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_011261196.1"
                     /db_xref="GeneID:54163033"
                     /translation="MTNSLYQKHIISIPELSRQELELIVETAGKIKKEPQPDLLKNKI
                     VASCFFEASTRTRLSFETAIQRLGGSVIGFDTAGNTSLAQKGETLADSVQIITSYADA
                     YVMRHPQEGAARLASEFSNGTPVINAGDGANQHPTQTLLDLYTIYETQGRLDNLNVAF
                     VGDLKYGRTVHSLTQALAKFEGIKFFFIAPEVLAMPDYICEELDELGIEYQLVESMDD
                     AIPELDILYMTRVQKERFDESEYAHIKSAYILSAENLQPARENLKVLHPLPRVDEIDT
                     DVDATPHAYYFQQAENGVYARQALLALVLNETL"
     gene            complement(435399..436403)
                     /gene="argF"
                     /locus_tag="VF_RS02030"
                     /old_locus_tag="VF0407"
                     /old_locus_tag="VF_0407"
                     /db_xref="GeneID:54163034"
     CDS             complement(435399..436403)
                     /gene="argF"
                     /locus_tag="VF_RS02030"
                     /old_locus_tag="VF0407"
                     /old_locus_tag="VF_0407"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_011261198.1"
                     /db_xref="GeneID:54163034"
                     /translation="MAFNLRNRNFLKLLDFTPKEIAHLLELSAELKKAKYSGYEQPRL
                     TGKNIALIFEKSSTRTRCAFEVAAFDQGAKVTYLGPSGSQIGHKESMKDTARVLGRMY
                     DGIEYRGFGQTIVEELGQYAGVPVWNGLTDEFHPTQILADFLTMQEYANGKQLSQITF
                     AYLGDARNNMGNSLMVGAAKMGMEIRLVAPKQFWPEEELVTQCQEIALQTGAKIVLTE
                     EVTEGVKGCDFLYTDVWVSMGEAPEAWDERVALMTPYQINMDVIKATENPNVKFMHCL
                     PAFHNDETTLGKEIAEKYGMNGLEVTEDVFESEYSIVFDEAENRMHTIKAVMVATLGS
                     "
     gene            complement(436516..437736)
                     /gene="arcA"
                     /locus_tag="VF_RS02035"
                     /old_locus_tag="VF0408"
                     /old_locus_tag="VF_0408"
                     /db_xref="GeneID:54163035"
     CDS             complement(436516..437736)
                     /gene="arcA"
                     /locus_tag="VF_RS02035"
                     /old_locus_tag="VF0408"
                     /old_locus_tag="VF_0408"
                     /EC_number="3.5.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017051835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine deiminase"
                     /protein_id="WP_011261199.1"
                     /db_xref="GeneID:54163035"
                     /translation="MNKLFVGSEIGQLRRVILHRPERALSHLTPTNCHNLLFDDVLSV
                     EKALLEHDQFVKTLENQDVDVLLLQDLLEQTLENPEAKEWLLKHQISHYRFGPTFANQ
                     IRVFLLEHSNKELASILLGGLAFIELPFKAPSMLQQLSDPFDFVIAPLPNHLFTRDTS
                     CWIYGGVSINPMAKAARKRESNHLRAIYRWHPLFSHHDFARYFEDENRYYDNATIEGG
                     DVLVIGKGNVLVGISERTTPQGIENLAKQLFRTHQAKQVIAIKLPEDRSCMHLDTVMT
                     HMDHNVFSVYPRVIDKNMGCWSITPCGEQHLDIKEMPNFQNVLMSALELDNLNIITTG
                     GDSYEAEREQWHDANNVLTIKPGVVVAYERNTYTNEKYDKAGIHVLPITGDELGRGRG
                     GARCMSCPIERDGI"
     gene            437890..438306
                     /gene="rraB"
                     /locus_tag="VF_RS02040"
                     /old_locus_tag="VF0409"
                     /old_locus_tag="VF_0409"
                     /db_xref="GeneID:54163036"
     CDS             437890..438306
                     /gene="rraB"
                     /locus_tag="VF_RS02040"
                     /old_locus_tag="VF0409"
                     /old_locus_tag="VF_0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E inhibitor RraB"
                     /protein_id="WP_005417527.1"
                     /db_xref="GeneID:54163036"
                     /translation="MSQEDEYLSVEQFLELQKAETREIIESLKADGSEPDALYAIEHH
                     LMAEDFKALENAVVEAFKMGFEVLEAEELEDEDGAKILCCDAVMDSALDAEVIDAQVE
                     KLVNLAEKYDIIYDGWGTYYEGEDAEYDVIEDGDED"
     gene            438377..439219
                     /locus_tag="VF_RS02045"
                     /old_locus_tag="VF0410"
                     /old_locus_tag="VF_0410"
                     /db_xref="GeneID:54163037"
     CDS             438377..439219
                     /locus_tag="VF_RS02045"
                     /old_locus_tag="VF0410"
                     /old_locus_tag="VF_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_011261200.1"
                     /db_xref="GeneID:54163037"
                     /translation="MTINSRIILNNEQALWQLSPLTDTSLLIKDIPIQQGISSAFDEL
                     SLLQVEAQEWHLMRYFDVDDTLLNYPAIELVMSGVSRYAEVRINGVAVFDCTEKMTRY
                     RKDIKEYLQVGGNRFEVLFLQEDEDDWLIDDENETKLCDINQAYHRRFGAVQDIDIKE
                     DIGVFGVCFLQPISHLALNHISIEQIWHHGCELKVNVFFQTYKANLISASIKFDGMTL
                     TIPVDVRSDQVSALFQVEAPKYWSDEKNNLDDLYRVEITLDGQLHELEFGLCETENVI
                     HFPL"
     gene            complement(439340..442213)
                     /locus_tag="VF_RS02050"
                     /old_locus_tag="VF0411"
                     /old_locus_tag="VF_0411"
                     /db_xref="GeneID:54163038"
     CDS             complement(439340..442213)
                     /locus_tag="VF_RS02050"
                     /old_locus_tag="VF0411"
                     /old_locus_tag="VF_0411"
                     /EC_number="6.1.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005385530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--tRNA ligase"
                     /protein_id="WP_011261201.1"
                     /db_xref="GeneID:54163038"
                     /translation="MEKTYNPQSIEQTLYQTWEEKGYFKPHGDTSKEAYSIMIPPPNV
                     TGSLHMGHAFQDTIMDTLIRAERMKGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTK
                     HDYGRDAFIDKIWEWKNESGGTITKQLRRLGASVDWDRERFTMDDGLSAATQEVFVRL
                     YEEDLIYRGKRLVNWDPKLHTAISDLEVENKDKKGFMWHFRYPLANGVKTADGKDYIV
                     VATTRPETMLGDTGVAVNPEDPRYKDLIGKEILLPIVNRLIPIVGDEHADMEKGTGCV
                     KITPAHDFNDYEVGKRNQLPMINILTFNADIRESAEVFTTNGEVSDVYSTEIPAKYQG
                     MERFEARKTIVAEFEELGLLEEIKDHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAEP
                     AVKAVEDGQIQFVPKQYENMYFAWMRDVQDWCISRQLWWGHRIPAWYDNDGKVYVGRT
                     EEEVREKNNLAPVVVLRQDDDVLDTWFSSALWTFGTQGWPENTDALKTFHPSEVLVSG
                     FDIIFFWVARMIMMTMHFVKDEEGNAQVPFKTVYMTGLIRDENGDKMSKSKGNVLDPI
                     DMIDGIDLESLVEKRCGNMMQPQLAKKIEKNTRKTFENGIEPYGTDALRFTLAAMAST
                     GRDINWDMKRLEGYRNFCNKLWNASRYVLMNTEEHDCGMSLSAEERANMEFSLADKWI
                     ESQFELAAKEFNAHLDNYRLDMAANTLYEFIWNQFCDWYLELTKPVLWKGTEAQQQAT
                     RYMLITVLEKTLRLAHPVLPYITESIWQSVKPLVDGVEGDTIMTQALPQFNEENFNAD
                     VVADLEWVKAFITSIRNLRAEYDIAPSKGLEVMIKVADEKDAARIEANKVVLSSLAKL
                     DEIKVLANGEETPACATSLVGKSELMIPMAGLIDKDAELARLAGEVKKTQGEIKRIEG
                     KLGNEGFVAKAPEAVIAKEREKLEGYQETLVKLEAQQETIAAL"
     gene            complement(442324..442767)
                     /locus_tag="VF_RS02055"
                     /old_locus_tag="VF0412"
                     /old_locus_tag="VF_0412"
                     /db_xref="GeneID:54163039"
     CDS             complement(442324..442767)
                     /locus_tag="VF_RS02055"
                     /old_locus_tag="VF0412"
                     /old_locus_tag="VF_0412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="WP_005417533.1"
                     /db_xref="GeneID:54163039"
                     /translation="MSQALFYVLEPTSPAATTDGQLKFVCQLAHYYYSQNARVYVLAQ
                     DKEQALLIDEALWQYDVSEFTPHNLVGEGPKSGSPIEIGWGTLRSSGRRHVLINLAQE
                     VASFAVSFAQVVDFVPCEEKSKQQARERYKIYRNAGRAMQTEILK"
     gene            complement(442847..444355)
                     /gene="pepA"
                     /locus_tag="VF_RS02060"
                     /old_locus_tag="VF0413"
                     /old_locus_tag="VF_0413"
                     /db_xref="GeneID:54163040"
     CDS             complement(442847..444355)
                     /gene="pepA"
                     /locus_tag="VF_RS02060"
                     /old_locus_tag="VF0413"
                     /old_locus_tag="VF_0413"
                     /EC_number="3.4.11.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004747273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="WP_011261202.1"
                     /db_xref="GeneID:54163040"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISGGYIS
                     SLLRRGDLEGKPGQMLLLHQVPNILSERVLLVGCGKERELGERQYKDIIKKTISTLNE
                     TGSMEAVCFLTELHVKGRDTYWKVRQAVESTKDSLYTFNQFKSNKPETRRPLRKLVFN
                     VPTRRELNLGEKAIAHGLSIASGVKASKDLGNMPPNVANPAYLASQARRLADDYETVT
                     TKIIGEEEMKKLGMTSYLAVGQGSHNESMMSIMEYKGHPDPAAKPIVLIGKGLTFDSG
                     GISIKPSEGMDEMKYDMCGAASVFGAMKALAKLNLPLNVVGVLAGCENMPSSNSYRPG
                     DILTTMSGQTVEVLNTDAEGRLVLCDALTYVERYEPECVVDVATLTGACVVALGHHIS
                     GLISNHNPLAHELINASEQSGDRAWRLPMAEEYNEQLSSPFADMGNIGGKAAGTITAG
                     CFLSRFAKKYHWAHIDSAGTAWVSGANKGSTGRPVSLLVQFLLNRSGQENEE"
     gene            444545..445657
                     /gene="lptF"
                     /locus_tag="VF_RS02065"
                     /old_locus_tag="VF0414"
                     /old_locus_tag="VF_0414"
                     /db_xref="GeneID:54163041"
     CDS             444545..445657
                     /gene="lptF"
                     /locus_tag="VF_RS02065"
                     /old_locus_tag="VF0414"
                     /old_locus_tag="VF_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS export ABC transporter permease LptF"
                     /protein_id="WP_047863689.1"
                     /db_xref="GeneID:54163041"
                     /translation="MIIIRYLIKETLKSQFAIFFVLFLIFMSQKFISVLADASDGDIP
                     GGLILSLVGLNMPAMGLLMLPLSIFIGILLTFGRLYAESEITVMNATGMGNSILIRAA
                     LYLALITGAAATFNSLWLSPWSQEKTTQLMETVESDAGVDLLQKGQFQRSPDGKAVVF
                     IDDISNKNGKELRHIFLAQPVPHDSLRPSVLVADKGVVKELKDGRQVLELQDGTRYEG
                     IPTRLDYLESNFKSYEVLIGQKEVKEKRRDWDAIPTLDLMKRPELEAKAELQWRISLI
                     ICIPLLTMVVVPLSAVNPRQGRFAKLGPAVLLYLAYFLSLSAGKSAIEDGGLAPSIGL
                     WAINATLLLVGIVLNSMDSVFVRQIKDKMRRKPKNV"
     gene            445650..446726
                     /gene="lptG"
                     /locus_tag="VF_RS02070"
                     /old_locus_tag="VF0415"
                     /old_locus_tag="VF_0415"
                     /db_xref="GeneID:54163042"
     CDS             445650..446726
                     /gene="lptG"
                     /locus_tag="VF_RS02070"
                     /old_locus_tag="VF0415"
                     /old_locus_tag="VF_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016958936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS export ABC transporter permease LptG"
                     /protein_id="WP_011261204.1"
                     /db_xref="GeneID:54163042"
                     /translation="MFKILDWYIGRTIIATSALCLVTLVGLSSIIKYVEQLRKVGRGT
                     YDLLDALYFVILSMPRDIEMFFPMAALLGALIGLGMLAASSELVVMQAAGYSKLSIGV
                     SVLKTAIPLMLMVMALGQWGAPQAQKMARDLRTFEVSGGNIAAVRAGVWAKDADDFIY
                     LARVENKEKLYGVTVWQFDDNQDLNNVIFARTATYQAAQDDWKMNDVSITQMKDKAVI
                     SEKKVDSLDWSTTLTPDKLAVVTVKPEEQSLTGLYDYVNYLKDSELDASRYELAFWRK
                     ALQPISVAVMMLLALSFVFGPLRSVTMGARILSGVIAGFTFYISNEVFGPMTLVYNIH
                     PIFGALGPSLVFLAVTVGLLNRKL"
     gene            complement(446800..447264)
                     /locus_tag="VF_RS02075"
                     /old_locus_tag="VF0416"
                     /old_locus_tag="VF_0416"
                     /db_xref="GeneID:54163043"
     CDS             complement(446800..447264)
                     /locus_tag="VF_RS02075"
                     /old_locus_tag="VF0416"
                     /old_locus_tag="VF_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="WP_047863690.1"
                     /db_xref="GeneID:54163043"
                     /translation="MNTQKQAGFMRRMGAWFYDTLIISAVMMLTGGAIVATLEMLYGA
                     GIISYGEFPDVSSYLNHDPLWRNLYPVTLVSVFVGFFAYFWCKGQTLGMRAWKLQVQQ
                     LDGSPITLTQAIIRMSTSAFGLGNLLVFISHDNSAFQDTWAKTRVIVLDKAI"
     gene            447444..447528
                     /locus_tag="VF_RS02080"
                     /old_locus_tag="VF_T0006"
                     /old_locus_tag="VFT0006"
                     /db_xref="GeneID:54163044"
     tRNA            447444..447528
                     /locus_tag="VF_RS02080"
                     /old_locus_tag="VF_T0006"
                     /old_locus_tag="VFT0006"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:447478..447480,aa:Leu,seq:caa)
                     /db_xref="GeneID:54163044"
     gene            complement(447663..447920)
                     /locus_tag="VF_RS02085"
                     /old_locus_tag="VF0417"
                     /old_locus_tag="VF_0417"
                     /db_xref="GeneID:54163045"
     CDS             complement(447663..447920)
                     /locus_tag="VF_RS02085"
                     /old_locus_tag="VF0417"
                     /old_locus_tag="VF_0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2999 domain-containing protein"
                     /protein_id="WP_011261206.1"
                     /db_xref="GeneID:54163045"
                     /translation="MNPIIQTLKEHNVSDEQIAEVFQTLTQNPFAAMATIQSLGIPQE
                     KLQPLMMLVMSNPALIKEAVEELGLDFSKVEEAKAKLNENQ"
     gene            complement(447954..448340)
                     /locus_tag="VF_RS02090"
                     /old_locus_tag="VF0418"
                     /old_locus_tag="VF_0418"
                     /db_xref="GeneID:54163046"
     CDS             complement(447954..448340)
                     /locus_tag="VF_RS02090"
                     /old_locus_tag="VF0418"
                     /old_locus_tag="VF_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_011261207.1"
                     /db_xref="GeneID:54163046"
                     /translation="MTDVPSGKPGNTGIKRIIKATGFSIQGLKAAFKHEAAVRQEFAM
                     LVIATPIALLLDVTVVEKILLVGVFVLIFMIELLNSAIEAVVDRIGPEHHELSGRAKD
                     IGSAAVFVALCFAGFTWLMILGSHYL"
     gene            complement(448451..448526)
                     /locus_tag="VF_RS02095"
                     /old_locus_tag="VF_T0007"
                     /old_locus_tag="VFT0007"
                     /db_xref="GeneID:54163047"
     tRNA            complement(448451..448526)
                     /locus_tag="VF_RS02095"
                     /old_locus_tag="VF_T0007"
                     /old_locus_tag="VFT0007"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(448491..448493),aa:Asn,seq:gtt)
                     /db_xref="GeneID:54163047"
     gene            complement(448533..448608)
                     /locus_tag="VF_RS02100"
                     /old_locus_tag="VF_T0008"
                     /old_locus_tag="VFT0008"
                     /db_xref="GeneID:54163048"
     tRNA            complement(448533..448608)
                     /locus_tag="VF_RS02100"
                     /old_locus_tag="VF_T0008"
                     /old_locus_tag="VFT0008"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(448573..448575),aa:Phe,seq:gaa)
                     /db_xref="GeneID:54163048"
     gene            complement(448616..448691)
                     /locus_tag="VF_RS02105"
                     /old_locus_tag="VF_T0009"
                     /old_locus_tag="VFT0009"
                     /db_xref="GeneID:54163049"
     tRNA            complement(448616..448691)
                     /locus_tag="VF_RS02105"
                     /old_locus_tag="VF_T0009"
                     /old_locus_tag="VFT0009"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(448656..448658),aa:Thr,seq:tgt)
                     /db_xref="GeneID:54163049"
     gene            complement(448765..448840)
                     /locus_tag="VF_RS02110"
                     /old_locus_tag="VF_T0010"
                     /old_locus_tag="VFT0010"
                     /db_xref="GeneID:54163050"
     tRNA            complement(448765..448840)
                     /locus_tag="VF_RS02110"
                     /old_locus_tag="VF_T0010"
                     /old_locus_tag="VFT0010"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(448805..448807),aa:Asn,seq:gtt)
                     /db_xref="GeneID:54163050"
     gene            complement(448874..448949)
                     /locus_tag="VF_RS02115"
                     /old_locus_tag="VF_T0011"
                     /old_locus_tag="VFT0011"
                     /db_xref="GeneID:54163051"
     tRNA            complement(448874..448949)
                     /locus_tag="VF_RS02115"
                     /old_locus_tag="VF_T0011"
                     /old_locus_tag="VFT0011"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(448914..448916),aa:Thr,seq:tgt)
                     /db_xref="GeneID:54163051"
     gene            complement(448991..449066)
                     /locus_tag="VF_RS02120"
                     /old_locus_tag="VF_T0012"
                     /old_locus_tag="VFT0012"
                     /db_xref="GeneID:54163052"
     tRNA            complement(448991..449066)
                     /locus_tag="VF_RS02120"
                     /old_locus_tag="VF_T0012"
                     /old_locus_tag="VFT0012"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(449031..449033),aa:Asn,seq:gtt)
                     /db_xref="GeneID:54163052"
     gene            complement(449073..449148)
                     /locus_tag="VF_RS02125"
                     /old_locus_tag="VF_T0013"
                     /old_locus_tag="VFT0013"
                     /db_xref="GeneID:54163053"
     tRNA            complement(449073..449148)
                     /locus_tag="VF_RS02125"
                     /old_locus_tag="VF_T0013"
                     /old_locus_tag="VFT0013"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(449113..449115),aa:Phe,seq:gaa)
                     /db_xref="GeneID:54163053"
     gene            complement(449156..449231)
                     /locus_tag="VF_RS02130"
                     /old_locus_tag="VF_T0014"
                     /old_locus_tag="VFT0014"
                     /db_xref="GeneID:54163054"
     tRNA            complement(449156..449231)
                     /locus_tag="VF_RS02130"
                     /old_locus_tag="VF_T0014"
                     /old_locus_tag="VFT0014"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(449196..449198),aa:Thr,seq:tgt)
                     /db_xref="GeneID:54163054"
     gene            complement(449307..449382)
                     /locus_tag="VF_RS02135"
                     /old_locus_tag="VF_T0015"
                     /old_locus_tag="VFT0015"
                     /db_xref="GeneID:54163055"
     tRNA            complement(449307..449382)
                     /locus_tag="VF_RS02135"
                     /old_locus_tag="VF_T0015"
                     /old_locus_tag="VFT0015"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(449347..449349),aa:Phe,seq:gaa)
                     /db_xref="GeneID:54163055"
     gene            complement(449492..450627)
                     /gene="mltC"
                     /locus_tag="VF_RS02140"
                     /old_locus_tag="VF0419"
                     /old_locus_tag="VF0420"
                     /old_locus_tag="VF_0420"
                     /pseudo
                     /db_xref="GeneID:54163056"
     CDS             complement(449492..450627)
                     /gene="mltC"
                     /locus_tag="VF_RS02140"
                     /old_locus_tag="VF0419"
                     /old_locus_tag="VF0420"
                     /old_locus_tag="VF_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533722.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound lytic murein transglycosylase
                     MltC"
                     /db_xref="GeneID:54163056"
     gene            complement(450736..451008)
                     /locus_tag="VF_RS02145"
                     /old_locus_tag="VF0421"
                     /old_locus_tag="VF_0421"
                     /db_xref="GeneID:54163057"
     CDS             complement(450736..451008)
                     /locus_tag="VF_RS02145"
                     /old_locus_tag="VF0421"
                     /old_locus_tag="VF_0421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005482430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidative damage protection protein"
                     /protein_id="WP_005417551.1"
                     /db_xref="GeneID:54163057"
                     /translation="MSRTVFCVRLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQH
                     KQTMLINEKKLNMMDPEHRKLLETEMEGFLFDGKDVVIDGYTPPSE"
     gene            complement(451011..452063)
                     /gene="mutY"
                     /locus_tag="VF_RS02150"
                     /old_locus_tag="VF0422"
                     /old_locus_tag="VF_0422"
                     /db_xref="GeneID:54163058"
     CDS             complement(451011..452063)
                     /gene="mutY"
                     /locus_tag="VF_RS02150"
                     /old_locus_tag="VF0422"
                     /old_locus_tag="VF_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="WP_011261209.1"
                     /db_xref="GeneID:54163058"
                     /translation="MTSFSQAILEWYDNYGRKTLPWQLEKTPYKVWLSEIMLQQTQVT
                     TVIPYFERFMTRFPTIVDLAHAEQDEVLHLWTGLGYYARARNLHKTAQIIAEQYNGIF
                     PTNIDDVIALPGIGRSTAGAVLSLSLQQHHPILDGNVKRTLSRCFAIEGWPGKKSVEN
                     EMWAVAETHTPKQGVERYNQAMMDMGAMVCTRSKPKCELCPVNDLCQAKAQDKQLDFP
                     TKKPKKEKPVKEAWFAIYYHDGEVWLEQRPQSGIWGGLFCFPEQPTNTLDELSEDYGF
                     KVASKQQLIAFRHTFSHYHLDITPVLITLAKKPNMIMEGTRGVWYNLSQPMTVGLAAP
                     VQKLLDALPYEISNGE"
     gene            452308..453024
                     /gene="trmB"
                     /locus_tag="VF_RS02155"
                     /old_locus_tag="VF_2589"
                     /db_xref="GeneID:54163059"
     CDS             452308..453024
                     /gene="trmB"
                     /locus_tag="VF_RS02155"
                     /old_locus_tag="VF_2589"
                     /EC_number="2.1.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(46)-N7)-methyltransferase TrmB"
                     /protein_id="WP_005417556.1"
                     /db_xref="GeneID:54163059"
                     /translation="MTEVTKNDFTEEGKIVRKIRSFVRREGRLTKGQEGAIQECWPSM
                     GIDFVEQMLDWNEVFGNNNPVVLEIGFGMGASLVEMAKNAPEKNFLGIEVHRPGVGAC
                     LAAAKEAGVTNLRVMCHDAVEVFESMIPDSSVNTLQLFFPDPWHKARHHKRRIVKAEF
                     AEMIRPKLIQGGIFHMATDWENYSEHMIEVMNAAPGYENIATDGDFIPRPDERPLTKF
                     EARGHRLGHGVWDIKFRRNA"
     gene            453108..454028
                     /gene="glsB"
                     /locus_tag="VF_RS02160"
                     /old_locus_tag="VF0423"
                     /old_locus_tag="VF_0423"
                     /db_xref="GeneID:54163060"
     CDS             453108..454028
                     /gene="glsB"
                     /locus_tag="VF_RS02160"
                     /old_locus_tag="VF0423"
                     /old_locus_tag="VF_0423"
                     /EC_number="3.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004398319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminase B"
                     /protein_id="WP_005417557.1"
                     /db_xref="GeneID:54163060"
                     /translation="MKPTKQILEDILDEVRPLIGQGKVADYIPALACVPNDKLGIAVF
                     TNDGEMLTAGDATECFSIQSISKALSLTLAMELYQPEELWQRVGKEPSGQAFNSLIQL
                     EMEQGVPRNPFINAGAIVISDMLYSRFSAPKHRLLEFVRKLSGNDHIIYDRVVANSEM
                     DHSDRNASIAYLMRSFGNFDNEVMPVLKNYFHACALSMNCVDLARTFGYLANKGIQPG
                     ISEPIVTPMQCKQINALMATCGLYDGAGEFAYRVGMPGKSGVGGGIIAIVPGEMTIAV
                     WSPELDPSGNSLAGTKALELLSERIGRSIF"
     gene            complement(454132..455292)
                     /gene="hemW"
                     /locus_tag="VF_RS02165"
                     /old_locus_tag="VF0424"
                     /old_locus_tag="VF_0424"
                     /db_xref="GeneID:54163061"
     CDS             complement(454132..455292)
                     /gene="hemW"
                     /locus_tag="VF_RS02165"
                     /old_locus_tag="VF0424"
                     /old_locus_tag="VF_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM family heme chaperone HemW"
                     /protein_id="WP_011261210.1"
                     /db_xref="GeneID:54163061"
                     /translation="MLIPPPLSLYIHIPWCIQKCPYCDFNSHALKAEIPEAQYISALI
                     DDLDTDLARYDMQSEPRKLHSIFIGGGTPSLITAPEIKRLLSEVEKRLPFAGDIEITM
                     EANPGTVEAGRFVKYRQAGVNRISIGVQSFQQEKLEKLGRIHGKDEAIRAAHLAHEAQ
                     LNSFNLDLMHGLPNQSIEDALSDLQQAIDLNPPHLSWYQLTIEPNTVFYYKPPTLPDD
                     DDLWDIFEQGHQMLAKAGYVQYEISGYSKVGYQCRHNLNYWRFGDYLGIGCGAHGKLS
                     FADGRIVRTTKIKHPRGFLDLTKPYLIDEQEVMDHDRPFEFFMNRFRLLEACPKQEFL
                     DTTGLGFDTIQETIDWAKEKKYLDETETHWQITEHGKLFLNDLLEAFMGDED"
     gene            complement(455296..455892)
                     /locus_tag="VF_RS02170"
                     /old_locus_tag="VF0425"
                     /old_locus_tag="VF_0425"
                     /db_xref="GeneID:54163062"
     CDS             complement(455296..455892)
                     /locus_tag="VF_RS02170"
                     /old_locus_tag="VF0425"
                     /old_locus_tag="VF_0425"
                     /EC_number="3.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XTP/dITP diphosphatase"
                     /protein_id="WP_011261211.1"
                     /db_xref="GeneID:54163062"
                     /translation="MSKIVLATGNQGKVREMADILADFGFDVVAQSEYNVSDVAETGT
                     TFIENAIIKARHAAKETGLPAIADDSGLEVDALNGAPGVYSARYSGEGATDQKNIDKM
                     LAAMEGIPAEKRTARFHCVLVLMKHENDPTPLICHGTWEGHITTEQKGENGFGYDPIF
                     WVSEDNCSSAELEPARKKQLSHRGQALKKLFAALKEGQ"
     gene            complement(455903..456334)
                     /locus_tag="VF_RS02175"
                     /old_locus_tag="VF0426"
                     /old_locus_tag="VF_0426"
                     /db_xref="GeneID:54163063"
     CDS             complement(455903..456334)
                     /locus_tag="VF_RS02175"
                     /old_locus_tag="VF0426"
                     /old_locus_tag="VF_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4426 domain-containing protein"
                     /protein_id="WP_011261212.1"
                     /db_xref="GeneID:54163063"
                     /translation="MKKTLLLLSLFIFSLPSFAGQFVQIKNVEVHYSAFNSTFLTSKV
                     ARAYQLKRSGYNALLNISVLDTSQAGKPAISANISGSAKNLLGQTKQLTFKEIKEQNA
                     IYYIAELPITNEETFRFDIDVSAGTKGAGKLKFNQKFYVEE"
     gene            complement(456404..456691)
                     /locus_tag="VF_RS02180"
                     /old_locus_tag="VF0427"
                     /old_locus_tag="VF_0427"
                     /db_xref="GeneID:54163064"
     CDS             complement(456404..456691)
                     /locus_tag="VF_RS02180"
                     /old_locus_tag="VF0427"
                     /old_locus_tag="VF_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggU family protein"
                     /protein_id="WP_005417561.1"
                     /db_xref="GeneID:54163064"
                     /translation="MPVKYDKDDLILRLYLQPKASRDQIVGIHGEELKIAITAPPVDG
                     KANAHLIKYFSKLFKVAKGKITVEKGELNRHKQVRIHSPELIPNEIQQLLV"
     gene            complement(456699..457253)
                     /locus_tag="VF_RS02185"
                     /old_locus_tag="VF0428"
                     /old_locus_tag="VF_0428"
                     /db_xref="GeneID:54163065"
     CDS             complement(456699..457253)
                     /locus_tag="VF_RS02185"
                     /old_locus_tag="VF0428"
                     /old_locus_tag="VF_0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001087264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggT family protein"
                     /protein_id="WP_011261213.1"
                     /db_xref="GeneID:54163065"
                     /translation="MNAMSFLISTVFDLYIMVVILRIWLQMARADFYNPFSQFIVKAT
                     QPIVSPLRRVIPSIGSLDLATVLFAYVLCVFKFVALQLVVSGGVAFGPEFLFIGLIAL
                     AKAAGGLLFWILLVRAILSWVSQGRSPIEYVMHQLTEPMLAPIRKILPQMGGLDLSVL
                     VLFIVLQFANFLMGDLIGPIWYSL"
     gene            complement(457302..458120)
                     /locus_tag="VF_RS02190"
                     /old_locus_tag="VF0429"
                     /old_locus_tag="VF_0429"
                     /db_xref="GeneID:54163066"
     CDS             complement(457302..458120)
                     /locus_tag="VF_RS02190"
                     /old_locus_tag="VF0429"
                     /old_locus_tag="VF_0429"
                     /EC_number="1.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_011261214.1"
                     /db_xref="GeneID:54163066"
                     /translation="MEHRNIAFIGAGNMTRSIIAGLISSGYPKDKITATNPSTEKLDH
                     LSQCYGIHTSTDNLQAAQQADVIVLAVKPQMMAMAAEPLQQIDFSNKLVISIAAGISA
                     KRLNEMFASELNLVRVMPNTPALVGKGMSGLFAVEHINEQDKCFASDLLSAVGEVCWV
                     AQESGINSVIAAAGSAPAYFFLFMEAMQAEAINQGFDEATARQLVQQAALGAAEMVVA
                     NPETQLSTLREQVTSKGGTTAEALRTFNEHQLQEIVAKAMQAAVSRAEEMESLF"
     gene            complement(458204..458914)
                     /locus_tag="VF_RS02195"
                     /old_locus_tag="VF0430"
                     /old_locus_tag="VF_0430"
                     /db_xref="GeneID:54163067"
     CDS             complement(458204..458914)
                     /locus_tag="VF_RS02195"
                     /old_locus_tag="VF0430"
                     /old_locus_tag="VF_0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggS family pyridoxal phosphate-dependent
                     enzyme"
                     /protein_id="WP_011261215.1"
                     /db_xref="GeneID:54163067"
                     /translation="MTSIKQNINQITHQIENSIQKCGRNPDSVQLLAVSKTKPIELLE
                     QAIEAGQRIFGENYVQEGIEKVQYFQKQHSTTSLEWHFIGPIQSNKTRPIAEHFDWVH
                     SVERLKIAQRLNDQRPSELGELNVLIQVNTSSEESKSGTTAEEVMELAAAINKMPNLT
                     LRGLMSIPANVSNYAEQLAAFKQLTSIQNQLRAQYPQIDTLSMGMSGDMDAAIEAGST
                     MVRIGTAIFGARDYKNKE"
     gene            458938..459975
                     /locus_tag="VF_RS02200"
                     /old_locus_tag="VF0431"
                     /old_locus_tag="VF_0431"
                     /db_xref="GeneID:54163068"
     CDS             458938..459975
                     /locus_tag="VF_RS02200"
                     /old_locus_tag="VF0431"
                     /old_locus_tag="VF_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus twitching motility protein PilT"
                     /protein_id="WP_005417568.1"
                     /db_xref="GeneID:54163068"
                     /translation="MDITELLDFSVKQNASDLHLSAGVPPMVRVDGEVRKLTLPDFTH
                     ADVHRLVTDIMNDAQRSEFEDKLEVDFSFELPNIGRFRVNAFNQSRGCAAVFRTIPVD
                     IPSLEQLAAPQVFTDIAKYQKGLVLITGPTGSGKSTTLAAMVDYINENYNKHVLTIED
                     PIEFVHKNKKCLINQREVNRDTHSFKAALRSALREDPDVILVGELRDQETISLALTAA
                     ETGHLVFGTLHTSSAAKTIDRIIDVFPGSDKSMVRSMLSESLRAVVAQTLLKRIGGGR
                     IACHEIMIATPAIRNLIREDKVAQMYSIIQTGSSFGMNTMEQNAKKIIAQGLVDPDEV
                     VKKVEMSSIGF"
     gene            459978..461078
                     /locus_tag="VF_RS02205"
                     /old_locus_tag="VF0432"
                     /old_locus_tag="VF_0432"
                     /db_xref="GeneID:54163069"
     CDS             459978..461078
                     /locus_tag="VF_RS02205"
                     /old_locus_tag="VF0432"
                     /old_locus_tag="VF_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017062241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilT/PilU family type 4a pilus ATPase"
                     /protein_id="WP_011261216.1"
                     /db_xref="GeneID:54163069"
                     /translation="MTLDQILKQMITLKASDIYLTVDAPCLLRVNGELQALGHKQSIE
                     SVTALLAEMMDEERQEEFNESLEANFAIVKEFGRFRVSAFWQREQPGAVIRRIETKIP
                     SMESLNLPEVMKELAVTKRGLVLVVGATGSGKSTSMAAMTGYRNDNRSGHILTVEDPI
                     EFVHPHNKCIVTQREVGLDTESYEVALKNSLRQAPDMILIGEIRNRETMEYAMSFAET
                     GHLCMATLHANNANQALERILHLVPKESKEQFLFDLSMNLKGVIAQQLVPDMNGNGRH
                     GVYEVLLNTPRVADLIRRGDLHELKSTMAKSRESGMQTFDQSLFELVMDKKISEMEAL
                     HSADSANDLRLMLKTKEGMRSLHLHWIMCRYR"
     gene            complement(461218..461643)
                     /gene="ruvX"
                     /locus_tag="VF_RS02210"
                     /old_locus_tag="VF0433"
                     /old_locus_tag="VF_0433"
                     /db_xref="GeneID:54163070"
     CDS             complement(461218..461643)
                     /gene="ruvX"
                     /locus_tag="VF_RS02210"
                     /old_locus_tag="VF0433"
                     /old_locus_tag="VF_0433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006713632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RuvX"
                     /protein_id="WP_011261217.1"
                     /db_xref="GeneID:54163070"
                     /translation="MSSRTIMAFDFGTKSIGSAIGQEITGTASPLKAFKAQDGTPNWD
                     DIEKQIKEWNPDLIVVGLPTDLHGKELDTITPRAKKFANRLHGRFGKQVELHDERLST
                     AEARADLFEFGGYKALSKGNIDCQSAVVILESWFENQWG"
     gene            complement(461640..462203)
                     /locus_tag="VF_RS02215"
                     /old_locus_tag="VF0434"
                     /old_locus_tag="VF_0434"
                     /db_xref="GeneID:54163071"
     CDS             complement(461640..462203)
                     /locus_tag="VF_RS02215"
                     /old_locus_tag="VF0434"
                     /old_locus_tag="VF_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqgE/AlgH family protein"
                     /protein_id="WP_005417575.1"
                     /db_xref="GeneID:54163071"
                     /translation="MNLKNHFLVAMPSMKDPFFQRSVIYICEHDSDGTMGLRINEPVQ
                     ISLKGMLDQIELDNPSPIIFPQTLSQPVLNGGPVSDDRGFVLHSNKDNYLSSIQVTDE
                     LSVTTSKDILATLGTEYQPYKYLVALGYSGWEGGQLEKELSENTWLTLEADPSVIFDT
                     PIPDRWRKALQLLGINPANLSSEIGHA"
     gene            complement(462316..463263)
                     /gene="gshB"
                     /locus_tag="VF_RS02220"
                     /old_locus_tag="VF0435"
                     /old_locus_tag="VF_0435"
                     /db_xref="GeneID:54163072"
     CDS             complement(462316..463263)
                     /gene="gshB"
                     /locus_tag="VF_RS02220"
                     /old_locus_tag="VF0435"
                     /old_locus_tag="VF_0435"
                     /EC_number="6.3.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase"
                     /protein_id="WP_011261218.1"
                     /db_xref="GeneID:54163072"
                     /translation="MIKLGIVMDPISSINIKKDSSFAMMLEAQKRGWEIHYMEMSDLH
                     LAQGKAVADTKIVTLKDDPTGWYEFQSEQTIDLADLDAVLMRKDPPFDTEYIYATYIL
                     ERAEIQGALIVNKPQSLRDCNEKLFTAWFPELTPTTLVTRKAEKIKAFREEHGDVILK
                     PLDGMGGASIFRVKAGDPNVSVIIETLTNHGQNYCMAQTFVPDISNGDKRILVVDGEP
                     MPYCLARIPAKGETRGNLAAGGTGEARPLSETDWAIANAVAPTLKEKGLIFVGLDVIG
                     DKLTEINVTSPTCIKEIEAAFDISITGKLMDAIERRINA"
     gene            complement(463277..464008)
                     /gene="rsmE"
                     /locus_tag="VF_RS02225"
                     /old_locus_tag="VF0436"
                     /old_locus_tag="VF_0436"
                     /db_xref="GeneID:54163073"
     CDS             complement(463277..464008)
                     /gene="rsmE"
                     /locus_tag="VF_RS02225"
                     /old_locus_tag="VF0436"
                     /old_locus_tag="VF_0436"
                     /EC_number="2.1.1.193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004735483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (uracil(1498)-N(3))-methyltransferase"
                     /protein_id="WP_011261219.1"
                     /db_xref="GeneID:54163073"
                     /translation="MRIPRIHHPELLPSQGKVNLSDDAANHVGRVMRMKEGESVLLFD
                     GSGSEFPAVITSASKKSVEVEITERIERSSESPLNLHLGQVVSRGDKMEFTIQKSVEL
                     GVNIITPLISERCGVKLNKERFEKKLDQWQKIAIAACEQCGRNTVPEIRPIMSLEEWC
                     AEEYDGLKLNLHPRAKYSINTLPEPVTNVRLLIGPEGGLSSDEISMTEQYQFEETLLG
                     PRVLRTETAALTAITALQVRFGDLG"
     gene            complement(464082..464786)
                     /locus_tag="VF_RS02230"
                     /old_locus_tag="VF0437"
                     /old_locus_tag="VF_0437"
                     /db_xref="GeneID:54163074"
     CDS             complement(464082..464786)
                     /locus_tag="VF_RS02230"
                     /old_locus_tag="VF0437"
                     /old_locus_tag="VF_0437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_011261220.1"
                     /db_xref="GeneID:54163074"
                     /translation="MKLIRLLISIIAIGSAFNVLAAPPSSFSKAKKEAVKIYLDHPTS
                     FYCGCDITWKDKKKGIPDLQSCGYNVRKQEKRASRIEWEHVVPAWQFGHQRQCWQDGG
                     RKNCTRKDKQFKLMEADLHNLVPAIGEVNGDRSNFRFSQWNGNKGAYYGQCAFKVDFK
                     GRVAEPPAQSRGAIARTYLYMNQEYRFNLSKSQRQLMNAWDKQYPVSEWECERDKRIA
                     KIQGNHNQFVYKACRK"
     gene            complement(464878..465378)
                     /locus_tag="VF_RS02235"
                     /old_locus_tag="VF0438"
                     /old_locus_tag="VF_0438"
                     /db_xref="GeneID:54163075"
     CDS             complement(464878..465378)
                     /locus_tag="VF_RS02235"
                     /old_locus_tag="VF0438"
                     /old_locus_tag="VF_0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SprT family zinc-dependent metalloprotease"
                     /protein_id="WP_011261221.1"
                     /db_xref="GeneID:54163075"
                     /translation="MTPLQQASIAKAQQCIQQASTFFNRPFSLPEIKFTQRGKIAGTA
                     RLQGWEIRINPILLEENQHTFINEVIPHEIAHLITFKLYGRVRPHGKEWQGVMNQVFN
                     LPARTTHSFSVDSVKGKTFPYRCKCSTHELTVRRHNRVQKKQTQYVCKNCQSPLKLSR
                     AKINCS"
     gene            complement(465544..466698)
                     /gene="metK"
                     /locus_tag="VF_RS02240"
                     /old_locus_tag="VF0439"
                     /old_locus_tag="VF_0439"
                     /db_xref="GeneID:54163076"
     CDS             complement(465544..466698)
                     /gene="metK"
                     /locus_tag="VF_RS02240"
                     /old_locus_tag="VF0439"
                     /old_locus_tag="VF_0439"
                     /EC_number="2.5.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017075413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="WP_005417583.1"
                     /db_xref="GeneID:54163076"
                     /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACET
                     YVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPD
                     INQGVDKADPKEQGAGDQGIMFGYATNETPILMPAPITYSHLLVQKQAEVRKSGKLDF
                     LRPDAKSQVTFQYDQGKIVGIDAVVLSTQHCDSVTTPDLREAVMEEIIKPVLPAEWLN
                     KDTNFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAA
                     YAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQNF
                     DLRPYGLQEMLNLLQPIYKKTAAYGHFGREEFPWEATDKAAILRDFAGIK"
     gene            467063..469057
                     /gene="tkt"
                     /locus_tag="VF_RS02245"
                     /old_locus_tag="VF0440"
                     /old_locus_tag="VF_0440"
                     /db_xref="GeneID:54163077"
     CDS             467063..469057
                     /gene="tkt"
                     /locus_tag="VF_RS02245"
                     /old_locus_tag="VF0440"
                     /old_locus_tag="VF_0440"
                     /EC_number="2.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016798778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_011261222.1"
                     /db_xref="GeneID:54163077"
                     /translation="MSSRKHLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSH
                     LNHNPQNPEWADRDRFILSNGHGSMLIYSLLHLSGYDLSIEDLKNFRQLHSKTPGHPE
                     YGYAPGVETTTGPLGQGITNGVGMAMAEKALAAQFNREGHDIVDHNTYVFMGDGCLME
                     GISHEACSLAGTLGLGKLIAFWDDNGISIDGEVEGWFSDDTPKRFEAYGWHVIPAVDG
                     HDSDAINAAIEAAKADPRPSLICTKTVIGFGSPNKQGTHDCHGAPLGAEEIAATKAQL
                     GWEYGAFDIPADVYAGWDAKEVGAEKEAAWNAKFDAYAAAHPELAAEYKRRVNGDLPA
                     EWEEKANTIIADLQANPANIASRKASQNALEAFGAMLPEFMGGSADLAPSNLTMWSGS
                     KSLEANDFSGNYIHYGVREFGMTAIMNGIALHGGFVPYGATFLMFMEYARNAMRMAAL
                     MKVQNIQVYTHDSIGLGEDGPTHQPVEQIASLRLTPNMSTWRPCDQVESAVAWKLAIE
                     RKDGPSSLIFSRQNLAQQERTQEQVADIAKGAYILKDCEGQPELILIATGSEVELAVE
                     AAAQLTAEGKAVRVVSMPSTDAFDKQDEGYREAVFPSAVTKRIAIEAGIADFWYKYVG
                     FGGKIIGMTTFGESAPADELFKMFGFTTENVVNTAKELLA"
     gene            469202..470221
                     /gene="epd"
                     /locus_tag="VF_RS02250"
                     /old_locus_tag="VF0441"
                     /old_locus_tag="VF_0441"
                     /db_xref="GeneID:54163078"
     CDS             469202..470221
                     /gene="epd"
                     /locus_tag="VF_RS02250"
                     /old_locus_tag="VF0441"
                     /old_locus_tag="VF_0441"
                     /EC_number="1.2.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="erythrose-4-phosphate dehydrogenase"
                     /protein_id="WP_011261223.1"
                     /db_xref="GeneID:54163078"
                     /translation="MLRVAINGFGRIGRSVLRALYESDKRDKIEVVAVNELSQPEAMA
                     HLFQYDSTHGRFQHKVTHDQEYPYSDVPDSSQDKVRILHQADLSLLPWQSLEVDLVLD
                     CTGVYGSKSDGEKHITAGAKKVLFSHPGGSDLDNTIIYGVNHDTLLPEHRIVSNGSCT
                     TNCIIPVIKAIDDAFGIDSGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSIIPVDTK
                     LHKGIERIFPKFSNKFEAISVRVPTVNVTAMDLSVTINTNVKVNDINQTIVNASRCTL
                     HNIVDYTEAPLVSIDFNHDPHSAIVDGSQTRVSNGHLVKMLVWCDNEWGFANRMLDTA
                     LAMSK"
     gene            470388..471551
                     /locus_tag="VF_RS02255"
                     /old_locus_tag="VF0442"
                     /old_locus_tag="VF_0442"
                     /db_xref="GeneID:54163079"
     CDS             470388..471551
                     /locus_tag="VF_RS02255"
                     /old_locus_tag="VF0442"
                     /old_locus_tag="VF_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006075685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_011261224.1"
                     /db_xref="GeneID:54163079"
                     /translation="MSVIKMTDLELAGKRVFIRADLNVPVKDGKVTSDARILASLPTI
                     KLCLEAGAKVMVTSHLGRPTEGEYNEEFSLAPVVNYLNDALDCDVKLAKDYLDGLELN
                     AGELVVLENVRFNKGEKKNEEELSKKYAALCDIFVMDAFGTAHRAQASTHGVGMNAPV
                     ACAGPLLAAELEALGKAMSNPERPLVAIVGGSKVSTKLTVLESLSKIADQLVVGGGIA
                     NTFIAAEGHNVGKSLYEADLVETAQKLMKECAIPVATDVACAKAFDENAEAEIKHVSE
                     VQDDDMIFDLGPDSTAALAEIIGNAKTILWNGPVGVFEFKNFEAGTAGISKAIAESAG
                     FSVAGGGDTLAAIDKFGIKADVSYISTGGGAFLEFVEGKVLPAVAMLEERAKA"
     gene            471707..472783
                     /gene="fbaA"
                     /locus_tag="VF_RS02260"
                     /old_locus_tag="VF0443"
                     /old_locus_tag="VF_0443"
                     /db_xref="GeneID:54163080"
     CDS             471707..472783
                     /gene="fbaA"
                     /locus_tag="VF_RS02260"
                     /old_locus_tag="VF0443"
                     /old_locus_tag="VF_0443"
                     /EC_number="4.1.2.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000034369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II fructose-bisphosphate aldolase"
                     /protein_id="WP_005417587.1"
                     /db_xref="GeneID:54163080"
                     /translation="MSKIFDFVKPGVISGDDVQKVFEVAKENKFALPAVNVVNTDSIN
                     GVLEAAAKVKAPVVVQFSNGGAGFFAGKGVKLEGQGAQILGAVAGAKYVHAVAEAYGV
                     PVILHTDHAAKKLLPWIDGLLDAGEAFFAETGKPLFSSHMIDLSEESLEENIEISGKY
                     LERMAKMGMTLEIELGCTGGEEDGVDNSHMDASELYTSPEDVAYAYEKLNAISPRFTI
                     AASFGNVHGVYQAGNVVLTPTILRDSQAYCAEKFGIAPNALNFVFHGGSGSSEAEIQE
                     SIGYGVIKMNIDTDTQWATWDGIRTYEAENRDFLQGQIGNPTGESAPNKKYYDPRVWL
                     RAGQASMVTRLEKAFADLNAIDVL"
     gene            complement(473008..474249)
                     /gene="srmB"
                     /locus_tag="VF_RS02265"
                     /old_locus_tag="VF0444"
                     /old_locus_tag="VF_0444"
                     /db_xref="GeneID:54163081"
     CDS             complement(473008..474249)
                     /gene="srmB"
                     /locus_tag="VF_RS02265"
                     /old_locus_tag="VF0444"
                     /old_locus_tag="VF_0444"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase SrmB"
                     /protein_id="WP_011261225.1"
                     /db_xref="GeneID:54163081"
                     /translation="MLKTFADLDLSPNLLRALEEIDYQRPTQVQAMTIPEALEGKDIL
                     ASAPTGTGKSAAFLLPALQHLDDFPRREPGPARILILTPTRELAIQVADEARQLAKYT
                     RHKVFTITGGISYQDHADILATTQDIVVATPGRLMEYIEAERFDCRAIETLILDEADR
                     MLDMGFGPVVDRLSKECRWRKQTFLFSATLEGRGVEGFTADLLNEPAEINAEPSRRER
                     KKITQWYHRADNMAHKIDLLKNILTEQAERSIVFVKTRERLAELRGHLETAKIPCAWI
                     QGEMAQESRNNAISRFRDGTVNVLIATDVAARGIDLPDVSHVINFDMPRTADVYLHRI
                     GRTARAGKKGNAVSLIEAHDQPMMERVGRYIKEDDIIKERFIEGLKPKHKKPVFKNKQ
                     KKNAKKKAALAKKKAPKKKKK"
     gene            complement(474338..475042)
                     /locus_tag="VF_RS02270"
                     /old_locus_tag="VF0445"
                     /old_locus_tag="VF_0445"
                     /db_xref="GeneID:54163082"
     CDS             complement(474338..475042)
                     /locus_tag="VF_RS02270"
                     /old_locus_tag="VF0445"
                     /old_locus_tag="VF_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011261226.1"
                     /db_xref="GeneID:54163082"
                     /translation="MSKSFTFKQFHIDIGSCGMPVSTDGVLLGAWADIRACSQILDIG
                     AGTGLLSLMSAQRNSDAHIDAIELMPIAADVARLNFYQSPWKERLTLIHHDFLTYQAP
                     HKYDAIICNPPYFNNGEQSQKGERSTARHTDSLPFDKLLQHCKTLISPTGRASFILPV
                     FEGELFIKVAKNDDFHLTKITKVKTTEKKSPTRLLIELSLFPHIYQESTLTIHDGNGY
                     SDDFIKLTRTFYLNMD"
     gene            475331..476644
                     /gene="brnQ"
                     /locus_tag="VF_RS02275"
                     /old_locus_tag="VF0446"
                     /old_locus_tag="VF_0446"
                     /db_xref="GeneID:54163083"
     CDS             475331..476644
                     /gene="brnQ"
                     /locus_tag="VF_RS02275"
                     /old_locus_tag="VF0446"
                     /old_locus_tag="VF_0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transport system II
                     carrier protein"
                     /protein_id="WP_011261227.1"
                     /db_xref="GeneID:54163083"
                     /translation="MKQSLKLADIIAVGFMLFAFFLGAGNIIFPPIAGQMAGEHVFGA
                     MSGFLITAVGLPLLTIIAIGVSGGSWQHLTRDLPPKVAMIMAILMFVIIGPAFAAPRT
                     GLVAYEMAAKPFIGADAGQFSLTLFSIVFFSIAMFFAWSQGKLIDTIGKFLTPALFIG
                     LIVLAIAVFVNPQGDIVAATGKYVDSPLTTGFFEGYNTMDTFGALMFGILIIDALKSK
                     GITEHKATTKYLTIAGLIAASGLAFVYVSLFYLGATSSTVAAGADNGGAILTAYTHAL
                     FGTSGQTVLSVIVLIACLTTAIGLISACADYFSSICKVTYKSWVIIVGVACAVVANVG
                     LTQLITLSVPVLFLLYPVAIALVVLAFIRKMMPNPQLAYRVVISVATCFAILDAAKVA
                     GADMSAFSMLPMFDHGMAWVIPTFASMIIVRFVGKKEDELVTENA"
     gene            complement(476766..477284)
                     /gene="fldB"
                     /locus_tag="VF_RS02280"
                     /old_locus_tag="VF0447"
                     /old_locus_tag="VF_0447"
                     /db_xref="GeneID:54163084"
     CDS             complement(476766..477284)
                     /gene="fldB"
                     /locus_tag="VF_RS02280"
                     /old_locus_tag="VF0447"
                     /old_locus_tag="VF_0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin FldB"
                     /protein_id="WP_011261228.1"
                     /db_xref="GeneID:54163084"
                     /translation="MKIGLFYGSSTCYTEMASEKIRAFIGEDLVDVFNIKETPVTTMN
                     DYDLLLLGISTWDFGEIQEDWLAVWEELDGLSLDGKTIALFGLGDQEGYGEWFLDAMG
                     LLHDELKATNAKFIGYWKNEGYQFDASKALTEDESHFVGLALDEDSQYDKSNERIEQW
                     CEQILVEYHESL"
     gene            477430..478326
                     /gene="xerD"
                     /locus_tag="VF_RS02285"
                     /old_locus_tag="VF0448"
                     /old_locus_tag="VF_0448"
                     /db_xref="GeneID:54163085"
     CDS             477430..478326
                     /gene="xerD"
                     /locus_tag="VF_RS02285"
                     /old_locus_tag="VF0448"
                     /old_locus_tag="VF_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005369667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerD"
                     /protein_id="WP_011261229.1"
                     /db_xref="GeneID:54163085"
                     /translation="MNNDMALMERFLDTMWMERGLSENTLASYRNDLVKLLQWLEDNH
                     YKCASISAMGLNEFQAYLVDKEYKQTSRARMLSALRRFFQYLHREKIRGDDPTALLAS
                     PKLPQRLPKDLSEEQVDALLNAPNVEDPLELRDRAMLELLYATGLRVTELVSLTMENV
                     SLRQGVVRVTGKGDKERLVPMGENAVDWIEQFLTHGRPMLLGEKSSDVVFPSKRAKQM
                     TRQTFWHRIKHYAVIAGIDSDKLSPHVLRHAFATHLLNYGADLRVVQMLLGHSDLSTT
                     QIYTHVATERLKQIHQEHHPRS"
     gene            478401..479177
                     /gene="dsbC"
                     /locus_tag="VF_RS02290"
                     /old_locus_tag="VF0449"
                     /old_locus_tag="VF_0449"
                     /db_xref="GeneID:54163086"
     CDS             478401..479177
                     /gene="dsbC"
                     /locus_tag="VF_RS02290"
                     /old_locus_tag="VF0449"
                     /old_locus_tag="VF_0449"
                     /EC_number="5.3.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein-disulfide
                     isomerase/oxidoreductase DsbC"
                     /protein_id="WP_011261230.1"
                     /db_xref="GeneID:54163086"
                     /translation="MSFIRRTSAMIIALMSVVSFTACSDEQAKNQDASPSAVEAAQPD
                     AEQAITQRLTTLGLPVEAIHDSEVDGFKQVETPFGIFYVSSDGKHFIQGRIFEFDENG
                     DMKDLLAARFAKLVDSQSENMIVFPAKNEKHVITVFTDITCGYCTKLHKEMKDYNDAG
                     ITVRYLAYPRQGYQGSVADKMAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIK
                     EQYLLGRKMGVNGTPAIVLPSGDLVPGYKPARELLSDLEK"
     gene            479248..480987
                     /gene="recJ"
                     /locus_tag="VF_RS02295"
                     /old_locus_tag="VF0450"
                     /old_locus_tag="VF_0450"
                     /db_xref="GeneID:54163087"
     CDS             479248..480987
                     /gene="recJ"
                     /locus_tag="VF_RS02295"
                     /old_locus_tag="VF0450"
                     /old_locus_tag="VF_0450"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_011261231.1"
                     /db_xref="GeneID:54163087"
                     /translation="MIEVKRRTVPSSTQLPDSIPPILQRIYAARGITSSSQLERGAKF
                     LLSFQSMHGISKAVDILVEAIQKQTRIIVVGDFDADGATSSALSVMAFRMMGSQNVDY
                     LVPNRFEDGYGLSPDVVDQAKEMGAEIIMTVDNGVSSIDGVLKAKEYGMQVVVTDHHL
                     PGAHLPLADAIVNPNLEACAFPSKSLAGVGVAFYLMLAIRARLREINWFEKQNIAIPN
                     LADLLDLVALGTVADLVALDENNRILVHQGIQRIRAGKCRPGIQALIEVANRVPSRIV
                     ASDFGFALGPRINAAGRLDDMSFGVELLMSNNIHAARRMAAELDSLNQTRKEIEQGMK
                     EEAMAICERLEFGAQSELPFGLVLFQRDWHQGVIGILASRIKEKYHRPVIAFADGGDG
                     FIKGSCRSIAGFHMRDALDLIDTRNPGLILKFGGHAMAAGLTIKEADYKKFSQAFDDV
                     VRESVEEEALKGIILSDGALTPEEFTLGTAEIIRAGGPWGQAFPEPIFDGEFKVLNQR
                     LVGEKHLKLMLEPIHRDFPTNKMVDAIAFNIDVRRWPDASVQKVKLAYRLDINEFRGN
                     QTLQLMVENIEPL"
     gene            481257..482355
                     /gene="prfB"
                     /locus_tag="VF_RS02300"
                     /old_locus_tag="VF0452"
                     /old_locus_tag="VF_0452"
                     /db_xref="GeneID:54163088"
     CDS             join(481257..481331,481333..482355)
                     /gene="prfB"
                     /locus_tag="VF_RS02300"
                     /old_locus_tag="VF0452"
                     /old_locus_tag="VF_0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311790.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_011261232.1"
                     /db_xref="GeneID:54163088"
                     /translation="MFEINPIKNRLQDVSERTNILRGYLDYDAKKERLEEVNAELEQP
                     DVWNEPERAQALGKERASLEAVVETIDLLDQGVEDVDGLLELAVEEEDQETFDEIEPE
                     LAELEAKLAKLEFRRMFSGDHDASDCYIDLQSGSGGTEAQDWTSMMLRMYLRWAEAKG
                     FKVEVIEVSEGEVAGLKGATVRIAGEYAYGWLRTETGVHRLVRKSPFDSSGRRHTSFA
                     SAFIYPEIDDNIQIDINPSDLRIDVYRASGAGGQHVNTTESAVRITHVPTNIVVQCQN
                     DRSQHKNKDQAMKQLRAKLFEYELQKQNAEKQANEDAKSDIGWGSQIRSYVLDDSRIK
                     DLRTGIENRNTQAVLDGDLDKFIEASLKSGL"
     gene            482369..483874
                     /gene="lysS"
                     /locus_tag="VF_RS02305"
                     /old_locus_tag="VF0453"
                     /old_locus_tag="VF_0453"
                     /db_xref="GeneID:54163089"
     CDS             482369..483874
                     /gene="lysS"
                     /locus_tag="VF_RS02305"
                     /old_locus_tag="VF0453"
                     /old_locus_tag="VF_0453"
                     /EC_number="6.1.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005459407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_011261233.1"
                     /db_xref="GeneID:54163089"
                     /translation="MTEQVQLDENKLIAERRGKLDHIRQACKANGHPNDFRRDSLAGD
                     LQAEFGEKTKEELEELNHVVAIAGRVMAKRGPFLLIQEVSGKIQAYAAKEVQKELKDK
                     YQGLDIGDIIGVKGALHKSGKGDLYVNMEEYVLLTKALRPLPEKFHGLTDQEMRYRQR
                     YVDLIVNDDSRHAFIVRSKVVAAIRNFMVDKGFMEVETPMMHVIPGGASARPFVTHHN
                     ALDVDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYAD
                     YNDLMDLTEEMLSTVATSVLGSDKMPYGEHTVDFGGKYARMSMLDAIKQYNPDHAEIQ
                     ALTYEGVKDRDLMVSIAKSVHVDVESFWTCGQLLEEIFGETAEPKLMQPTFITEYPAD
                     ISPLARRNDDNDFITDRFEFFIGGREVANGFSELNDAQDQDERFKAQVNAKESGDDEA
                     MYYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPSMRPQA"
     gene            484262..485599
                     /locus_tag="VF_RS02310"
                     /old_locus_tag="VF0454"
                     /old_locus_tag="VF_0454"
                     /db_xref="GeneID:54163090"
     CDS             484262..485599
                     /locus_tag="VF_RS02310"
                     /old_locus_tag="VF0454"
                     /old_locus_tag="VF_0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_005417604.1"
                     /db_xref="GeneID:54163090"
                     /translation="MGTQFRMDSVPGSLVVVGGSYEPWLAVLEQVGWRCHRCYDLRAA
                     QALFDEIGPCIGIVDLSQDDFSLNGIATLVNNNKQVRWMAFIRESQLSSDTICQFIVN
                     FCIDFFTAPIPDAQLLSTIGHQLGMLKLERKVWPNMGNKSDLGILGEAPAVKRLRDQI
                     RRVAPTDVSILISGESGVGKDAVAKAVHESSGRNKGPFVSLNCGSLSENKIEQELFGS
                     HSSSPEESKLFQANGGTLFLNDINDLPASQQQHLLRFLQEGNIETEKGFVDLDVRVIV
                     ASHIDLEKAIEEGSFKEELYYRLNVLRIHVPSLKERSSDISVLAEHFLQRYAKEYNTQ
                     ARTFSEEALQTMLHYQWPGNVRELVNQVKRAVLLADSMTIDLEHLDLPQRSETKRSLR
                     VIRENSERDALLMVLESHDGQVSSAAKELGVSRATMYRLLNKHNLISEPRSYS"
     gene            complement(485652..486320)
                     /gene="mutH"
                     /locus_tag="VF_RS02315"
                     /old_locus_tag="VF0455"
                     /old_locus_tag="VF_0455"
                     /db_xref="GeneID:54163091"
     CDS             complement(485652..486320)
                     /gene="mutH"
                     /locus_tag="VF_RS02315"
                     /old_locus_tag="VF0455"
                     /old_locus_tag="VF_0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutH"
                     /protein_id="WP_011261234.1"
                     /db_xref="GeneID:54163091"
                     /translation="MSLPPPNTIDELLQRAESIAGYTLSELAEQAGIPVPENLKRDKG
                     WVGQLLEWHLGASAGSKPLPDFIDLSVELKTIPISYTGKPLETTFVCVAPLTGVHSLQ
                     WEESHVRHKLAHVLWIPVEGEREIPVGDRHVGYPVLWQPSLEEERQLKQDWEELMDLI
                     VLGKVESITAKHGEVLQLRPKAANSQALTEAYGENGQPIKTLPRGFYLKTQFTHSILT
                     SFFN"
     gene            486918..487430
                     /gene="rppH"
                     /locus_tag="VF_RS02320"
                     /old_locus_tag="VF0456"
                     /old_locus_tag="VF_0456"
                     /db_xref="GeneID:54163092"
     CDS             486918..487430
                     /gene="rppH"
                     /locus_tag="VF_RS02320"
                     /old_locus_tag="VF0456"
                     /old_locus_tag="VF_0456"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="WP_005417607.1"
                     /db_xref="GeneID:54163092"
                     /translation="MIDGDGFRPNVGIVICNSHGQVFWAKRYGQHSWQFPQGGIDDGE
                     TPEQAMYRELYEEVGLTKNDVRILASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLL
                     RLECDESKVNMQRDRSPEFDGWRWVSYWYPVRQVVSFKRDVYRRALKEFAVIAMPFKE
                     RKFKRKGKKG"
     gene            487469..489730
                     /gene="ptsP"
                     /locus_tag="VF_RS02325"
                     /old_locus_tag="VF0457"
                     /old_locus_tag="VF_0457"
                     /db_xref="GeneID:54163093"
     CDS             487469..489730
                     /gene="ptsP"
                     /locus_tag="VF_RS02325"
                     /old_locus_tag="VF0457"
                     /old_locus_tag="VF_0457"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="WP_011261235.1"
                     /db_xref="GeneID:54163093"
                     /translation="MLTQLRDIVDHVAKAESLDDALALLVKNTRHSMHTECCSVYLMS
                     NDNLRLELMATEGLKAKPKTVSLGIDEGLVGLVARSCEPLNLANASVHPSYKYIPSIA
                     EYKFNSFLATPIIYRRQNLGVLVVQQKEKRQFTEVEESFLVTLSAQLAVILAHAKAHE
                     SWSTQLQPQSIEQKQFKGISASNGVAIAPLWFDDAQPRIESILPSSCLDTEQEQDRLG
                     TAVELALKDFRRAKKRFEQELNTETLAIFDLFTHLLNDPMLKGDLKKQINQGDSAEWA
                     LRQVIESYAGRFEKMSDSYLSERANDVRELGQRLLYFLNYEGKLELDLAHPVILVTTQ
                     LTASMLASVPQDKLKAVISLEGAANSHAAILSRALGIPAIMGVEFNPTHYHQNLAIVD
                     GYSGALYIKPTEALIQEYTELQNEELALSELITQDLDKPTFTRDEHQMKIYLNAGLSA
                     DTSIAVNQGVDGVGLYRTEIPFLLQQRFPSEEEQYLQYKTILETYPKKPVIMRTLDIG
                     GDKPLPYLPIEEENPFLGWRGIRFTLDHPDIFLLQLKAMVRANIGNGNLSIMLPMISG
                     LPELKQARKLINQAYEEVLGESEGDFSQPRIGMMIEVPSMLYLLPRVVGLVDFISVGT
                     NDLTQYLLAVDRNNARVSHVYESYHPAVLLALKQIIDTANQYKLPVSVCGELAGDPIG
                     CLLLLGLGYQSLSMNTSNVAKVKYIIRQVSQQEVEQLVATLLHHDDAEQILTDMIGFF
                     EEKDLSGFIRAGR"
     gene            489730..490533
                     /locus_tag="VF_RS02330"
                     /old_locus_tag="VF0458"
                     /old_locus_tag="VF_0458"
                     /db_xref="GeneID:54163094"
     CDS             489730..490533
                     /locus_tag="VF_RS02330"
                     /old_locus_tag="VF0458"
                     /old_locus_tag="VF_0458"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="WP_011261236.1"
                     /db_xref="GeneID:54163094"
                     /translation="MTVDFSSLFVLYLLLGSIVGVMAGLLGIGGGLLVVPALLWLLPQ
                     AGIDSSIVMQMALGTSLATIILTSTSSALNHLRLGNVEVALIRSLAPGVIAGGFLGSY
                     VAELIPSQYLPKVFGVIVLLLALQMLLALKLTATRTLPSPLKIAASGSVIGIVSSLAG
                     IGGGSLTVPYLSFHGIEMRKAIGSSSLCGTLIALAGMIGFILHGVQVTNLPPMSLGYV
                     YLPALCGIGVTSILTTRIGAKLTSHLPTSTLKKIFAIFLVFIGSKMFLG"
     gene            490545..491378
                     /gene="lgt"
                     /locus_tag="VF_RS02335"
                     /old_locus_tag="VF0459"
                     /old_locus_tag="VF_0459"
                     /db_xref="GeneID:54163095"
     CDS             490545..491378
                     /gene="lgt"
                     /locus_tag="VF_RS02335"
                     /old_locus_tag="VF0459"
                     /old_locus_tag="VF_0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_011261237.1"
                     /db_xref="GeneID:54163095"
                     /translation="MSQGYLNFPHIDPVLIEIGPLAVRWYGLMYLFGFMFALWLANKR
                     ADKPNSGWTRDQVSDLLFAGFLGVVIGGRVGYVLFYNFGYFLDNPLYLFEVWTGGMSF
                     HGGLLGVISAMLWYGYKNNRSFFTIADFVAPLVPFGLGAGRLGNFMNGELWGRVTDVP
                     WAMVFPTGGPFPRHPSQLYEFALEGVVLFLILNWFIRKPRPLGTVSGLFLFGYGTFRF
                     LVEYVRQPDAQLGLFGDWISMGQILSLPMVIGGLLMMLWAFKRNLYPSIEQPQSTTKK
                     K"
     gene            491457..492308
                     /locus_tag="VF_RS02340"
                     /old_locus_tag="VF0460"
                     /old_locus_tag="VF_0460"
                     /db_xref="GeneID:54163096"
     CDS             491457..492308
                     /locus_tag="VF_RS02340"
                     /old_locus_tag="VF0460"
                     /old_locus_tag="VF_0460"
                     /EC_number="2.1.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006075639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_047863653.1"
                     /db_xref="GeneID:54163096"
                     /translation="MKQYLDLCQRIVDEGTWIENERTGKRCLTVINADLTYDVENGVF
                     PLVTTRKSFWKAAVAEMIGYIRGYDSAEDFRKIGTKTWDANANLNDAWLNNPHRKGDD
                     DMGRVYGVQGRSWAKPNGEFVDQLKKIIDDLSQGIDDRGEILNFYNPGEFDMGCLRPC
                     MYSHHFSLLGDTLYLNSTQRSCDVPLGLNFNMVQVYFLLAIVAQITGHKAGKAYHKIV
                     NAHIYEDQLELMQSVQLKREPLQAPIFKINPEIKSLEDLETWVTMDDFEVIGYESHEA
                     IKYPFSV"
     gene            complement(492382..493527)
                     /locus_tag="VF_RS02345"
                     /old_locus_tag="VF0461"
                     /old_locus_tag="VF_0461"
                     /db_xref="GeneID:54163097"
     CDS             complement(492382..493527)
                     /locus_tag="VF_RS02345"
                     /old_locus_tag="VF0461"
                     /old_locus_tag="VF_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na/Pi cotransporter family protein"
                     /protein_id="WP_011261239.1"
                     /db_xref="GeneID:54163097"
                     /translation="MNTQSISAATMSNTSRMLRWANLAFMLYLLLLAVSMVGTGFKWS
                     VGQEAKVLFEFAAHPIAGLMIGLVATALIQSSSTVTSIIVGLVAGGLPVETAIPMVMG
                     ANIGTTVTNTLVSLGHARCKNEFRRAFACATVHDFFNLLAVTIFLPLEMMFGIFQKLS
                     AWLVSPLLNAGDMSMKGFDFIKPITKPVISAIQEPLSSFGSMTGGLLMIALGITILFI
                     AITLMGKLMKSLMVGRAKELLKSAIGRGPIHGIASGTAVTVLVQSSSTTTSLMVPLVG
                     TGVLKVRDVYPFTLGANIGTCVTALLAATAVSGEYAVFALQIALVHLCFNVIATLVIF
                     GTPFLRELPIKGAEWIAEMANRNRSVVAGYLGFVFIILPGSVLALTV"
     gene            493943..494833
                     /gene="nhaR"
                     /locus_tag="VF_RS02350"
                     /old_locus_tag="VF0462"
                     /old_locus_tag="VF_0462"
                     /db_xref="GeneID:54163098"
     CDS             493943..494833
                     /gene="nhaR"
                     /locus_tag="VF_RS02350"
                     /old_locus_tag="VF0462"
                     /old_locus_tag="VF_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator NhaR"
                     /protein_id="WP_011261240.1"
                     /db_xref="GeneID:54163098"
                     /translation="MSHLNYNHLYYFWMVCKQGSVTKAAEALFLTPQTVTGQIKALED
                     RLDGKLTKRNGRNIEPTELGQLIYKYADRMFGLSYEMLDIVNYSQQANVLFDVGVADA
                     LSKRLVSKVLSTTVPEDASIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQNSGL
                     FSKKLGECEMSFFCSKELKGVTFPEVLEKHKVLIPGSRTSMGRKVVQWCDQQGVTPNI
                     LGEFDDVALMKAFARENNAVFLAPSVYMNEADSDLSLHKIADVRDLKEEYYVIFAERM
                     IQHPAVKSICEADFSHLFDF"
     gene            494897..495193
                     /locus_tag="VF_RS02355"
                     /old_locus_tag="VF0463"
                     /old_locus_tag="VF_0463"
                     /db_xref="GeneID:54163099"
     CDS             494897..495193
                     /locus_tag="VF_RS02355"
                     /old_locus_tag="VF0463"
                     /old_locus_tag="VF_0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_011261241.1"
                     /db_xref="GeneID:54163099"
                     /translation="MDLQMMEDNAPQAVTLLKAMANERRLFILCLLLDGELSVGQIAE
                     KLELSQSALSQHLGWLRRDELVSTRKESQTVFYSLNSQEVRSMIQLLHDLYCQK"
     gene            complement(495308..495568)
                     /gene="rpsT"
                     /locus_tag="VF_RS02360"
                     /old_locus_tag="VF0464"
                     /old_locus_tag="VF_0464"
                     /db_xref="GeneID:54163100"
     CDS             complement(495308..495568)
                     /gene="rpsT"
                     /locus_tag="VF_RS02360"
                     /old_locus_tag="VF0464"
                     /old_locus_tag="VF_0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005447926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_005417629.1"
                     /db_xref="GeneID:54163100"
                     /translation="MANSKSAKKRATQAERRRQHNASRRSMMRTYMKKTIAAIEAGDK
                     EAATAALATATPLLDRMATKGLIHKNKAARHKARFTAAIKAL"
     gene            495788..497347
                     /gene="murJ"
                     /locus_tag="VF_RS02365"
                     /old_locus_tag="VF0465"
                     /old_locus_tag="VF_0465"
                     /db_xref="GeneID:54163101"
     CDS             495788..497347
                     /gene="murJ"
                     /locus_tag="VF_RS02365"
                     /old_locus_tag="VF0465"
                     /old_locus_tag="VF_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein biosynthesis integral membrane protein
                     MurJ"
                     /protein_id="WP_011261243.1"
                     /db_xref="GeneID:54163101"
                     /translation="MSKRLLRSGLIVSIMTLVSRVLGLVRDVVVANLMGAGASADVFF
                     FANKIPNFLRRLFAEGAFSQAFVPVLTEYHASGDDNKTRELIAKASGTLGVLVTIVTF
                     FGIIGSGVVTALFGAGWFMDWLNDGPAAPKFELASFLLKITFPYLWFITFVALSGAIL
                     NTLGKFAVSSFTPVFLNIAIIACAYFVSPNLEQPEIGLAIGVFLGGLIQFLFQLPFLY
                     KAKMLVRPQWGWNDPGVVKIRTLMIPALFGVSVSQINLLFDTFIASFLATGSISWLYY
                     SDRLLEFPLGLFGIAIATVILPALSRKHVDAEGDGFSQTMDWGVRMVILLGIPAMLGL
                     MVLAKPMLMVLFMRGEFSPNDVHQASLSLLAYASGLLNFMLIKVLAPGYYARQDTKTP
                     VRYGIIAMVTNMFFNAIFAYFYGYVGLAMATALSALVNMVLLYRGLHLANVYKLSKET
                     VFFVLKLIVSGGVMVSILLWLMPSMSIWLEWDLAKRVMMLFAFIGLGAISYLITAIVF
                     GLRLRHLRASV"
     gene            497438..498370
                     /gene="ribF"
                     /locus_tag="VF_RS02370"
                     /old_locus_tag="VF0466"
                     /old_locus_tag="VF_0466"
                     /db_xref="GeneID:54163102"
     CDS             497438..498370
                     /gene="ribF"
                     /locus_tag="VF_RS02370"
                     /old_locus_tag="VF0466"
                     /old_locus_tag="VF_0466"
                     /EC_number="2.7.1.26"
                     /EC_number="2.7.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FAD synthetase"
                     /protein_id="WP_011261244.1"
                     /db_xref="GeneID:54163102"
                     /translation="MELIRGIHNITPDHKGCVMTIGNFDGVHLGHQQVLQQVKSKAKE
                     LGLPSVVMTFEPQPMEFFAKEKAPARLTRLRDKFVQLKKLEIERLLCINFNQKFAEQS
                     ADEFVEDLLVRLLDVKFLVVGDDFCFGKHRKGNFAMLQEAGKKHGFEVVNTQSFCLQQ
                     QRVSSTAIRSALLHNKLDDVATMLGRHYSITGRVSHGRKLGRTIGFPTANIPLKRCVS
                     PVSGVYVVQAKDSKGKQLGGVANIGHRPTVNGARQQLEVHFFDYKGNLYGQQLDVELL
                     YKLRDEHKFESFDALKQQIELDSQAARVWLSENR"
     gene            498407..501265
                     /gene="ileS"
                     /locus_tag="VF_RS02375"
                     /old_locus_tag="VF0467"
                     /old_locus_tag="VF_0467"
                     /db_xref="GeneID:54163103"
     CDS             498407..501265
                     /gene="ileS"
                     /locus_tag="VF_RS02375"
                     /old_locus_tag="VF0467"
                     /old_locus_tag="VF_0467"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012842132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_005417642.1"
                     /db_xref="GeneID:54163103"
                     /translation="MSDYKDTLNLPETGFPMRGNLANREPEMLKRWYDEDLYGEIRKA
                     KKGKKSFVLHDGPPYANGDIHIGHALNKILKDIIIKSKTLSGFDAPYVPGWDCHGLPI
                     ELMVEKKKGKPGQKISAAEFREECRKYAAGQVEGQKESFKRLGVMGEWDKPYRTMDFG
                     TEANIIRSLGKIADQGHLLKGFKPVHWCTDCGSALAEAEVEYQDKVSPSIDVRFVAAD
                     EAATLAKFSTPEGHQGEGELSVVIWTTTPWTLPANRAVALHADLEYVLVQVEAHGEQK
                     AQRLILASELAKSVLDRANIEHYHNLGFAKGSDLELLQFNHPFYNFTVPAILGEHVTT
                     DSGTGIVHTAPGHGQEDFVVGKKYDLEIANPVGSNGVYLPDTELFAGQHVFKANDSVL
                     EVLKEKGALLHHHAYEHSYPHCWRHKTPIIFRATPQWFISMDQAGLRAKALEEVKSVE
                     WMPEWGQNRIEGMIEGRPEWCISRQRTWGVPIALFVHKETAELHPDSLELIEKVAKLV
                     EEKGIQAWWDVDAAELMGEEDAANYEKVLDTLDVWFDSGVTHFSVVDSREEYNFPEEE
                     RTHSADLYLEGSDQHRGWFQSSLISSVAMKGKAPYRQVLTHGFVVDGNGRKMSKSIGN
                     VVAPKDVTNKLGADILRLWVASTDYTNEVAVSDEILKRSADAYRRIRNTARFFLANLS
                     GFNPATDIVPAEEMVALDRWAVGRAFAAQQEIIKSYDEYNLHEVTQRLMHFCSIEMGS
                     FYLDVIKDRQYTAKKGGHAQRSCQTALYYIVEALVRWMAPIMSFTADEIWNEMPGERE
                     KFVFTGEWYQGLFDLAEGEEFNNEFWTEIQAVRASVNKLLEAARGEKVIGGALQAEVT
                     LYADDALIAKINKLEDELRFVLLTSAATVKPLSEKTESAKATELDGLFVDVAASEAAK
                     CERCWHHVADVGTIEGHEEVCGRCVSNVDGEGEERKFA"
     gene            501265..501780
                     /gene="lspA"
                     /locus_tag="VF_RS02380"
                     /old_locus_tag="VF0468"
                     /old_locus_tag="VF_0468"
                     /db_xref="GeneID:54163104"
     CDS             501265..501780
                     /gene="lspA"
                     /locus_tag="VF_RS02380"
                     /old_locus_tag="VF0468"
                     /old_locus_tag="VF_0468"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="WP_005417644.1"
                     /db_xref="GeneID:54163104"
                     /translation="MTSDKKTLPLLKESGLRWLWLAGIIFMADISIKLFVMKEMGYGW
                     ANRIEVLPFFNFLYVHNYGAAFSFLSDQAGWQRWFFTGIAISVCGLLVYWMRKAPQKD
                     KLNNIAYALIIGGAIGNVFDRLVHGFVVDYLDFYWGNYHWPAFNLADAAICIGAGLII
                     LDGLRSGKKEQ"
     gene            501852..502280
                     /gene="fkpB"
                     /locus_tag="VF_RS02385"
                     /old_locus_tag="VF0469"
                     /old_locus_tag="VF_0469"
                     /db_xref="GeneID:54163105"
     CDS             501852..502280
                     /gene="fkpB"
                     /locus_tag="VF_RS02385"
                     /old_locus_tag="VF0469"
                     /old_locus_tag="VF_0469"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_011261245.1"
                     /db_xref="GeneID:54163105"
                     /translation="MKIENNSEVTLHFTIKLKDGSVADSTHSSGKPAKFTMGDGSLSE
                     NFEKCLLGLEAEQAKSIELCAEDAFGLPNPDNIHHMDRNRFVGDAAAEVGTIMAFSGP
                     DGMDIPGIITEIAGDSVTVDFNHPLAGQDVIFDVEIVAVG"
     gene            502305..503249
                     /gene="ispH"
                     /locus_tag="VF_RS02390"
                     /old_locus_tag="VF0470"
                     /old_locus_tag="VF_0470"
                     /gene_synonym="lytB"
                     /db_xref="GeneID:54163106"
     CDS             502305..503249
                     /gene="ispH"
                     /locus_tag="VF_RS02390"
                     /old_locus_tag="VF0470"
                     /old_locus_tag="VF_0470"
                     /gene_synonym="lytB"
                     /EC_number="1.17.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_011261246.1"
                     /db_xref="GeneID:54163106"
                     /translation="MKIVLANPRGFCAGVDRAISIVERALELYEAPIYVRHEVVHNRF
                     VVEGLKQRGAIFVEELHEVPDDNIVIFSAHGVSQAVRKEAKERALTVFDATCPLVTKV
                     HMEVARASKKNIEVVLIGHAGHPEVEGTMGQYASDSAGMYLVETPDDVIKLNVKDPSN
                     LHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRDMASQVDVMI
                     VVGSKNSSNSNRLRELSEKLGTTSYLIDCPEDLKEEWLTEQTKVGVTAGASAPEELVN
                     QIIEQVKAFGGTAVEELTGREENMFFEVPKELQIKTVS"
     gene            503322..504131
                     /gene="dapB"
                     /locus_tag="VF_RS02395"
                     /old_locus_tag="VF0471"
                     /old_locus_tag="VF_0471"
                     /db_xref="GeneID:54163107"
     CDS             503322..504131
                     /gene="dapB"
                     /locus_tag="VF_RS02395"
                     /old_locus_tag="VF0471"
                     /old_locus_tag="VF_0471"
                     /EC_number="1.17.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="WP_005417649.1"
                     /db_xref="GeneID:54163107"
                     /translation="MVRVAIAGAAGRMGRNLIKAVNGSQFAVLAAASERPESSLIGVD
                     VGEMAGLGKSGILIVDDLAKVTDDFDVIIDFTLPISTLKNIELCQEHNKAIVIGTTGF
                     SEPGKEIIDQASKEIPVVMAPNYSVGVNLVFKLLEKAAKVMGDYCDIEIVEAHHRYKV
                     DAPSGTAIGMGEAIAGAMGNKLEDVAVYAREGITGERSKDEIGFATIRAGDIVGEHTA
                     MFADIGERVEITHKATDRMTFANGAVRASHWLHKKEPGFYTMHDVLNLDQI"
     gene            504726..505883
                     /gene="carA"
                     /locus_tag="VF_RS02400"
                     /old_locus_tag="VF0472"
                     /old_locus_tag="VF_0472"
                     /db_xref="GeneID:54163108"
     CDS             504726..505883
                     /gene="carA"
                     /locus_tag="VF_RS02400"
                     /old_locus_tag="VF0472"
                     /old_locus_tag="VF_0472"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-hydrolyzing carbamoyl-phosphate
                     synthase small subunit"
                     /protein_id="WP_011261247.1"
                     /db_xref="GeneID:54163108"
                     /translation="MSKSALLVLEDGTVFHGQSIGADGSAVGEVVFNTSMTGYQEILT
                     DPSYSQQIVTLTYPHIGNTGINSEDEESSSIHAQGLVIRDLPLLASNFRSEQTLSEYL
                     KSQNIVGIADIDTRKLTRILREKGAQNGCIVAGTNLDEAFALAQAKEFPGLKGMDLAK
                     EVTTSEAYQWKQGSWTLTGGLPEEKADSELPFHVVAYDFGAKRNILRMLVDRGCRLTV
                     VPAQTSAEEVLAMNPDGVFLSNGPGDPAPCTYAIEATKVFLEKGLPIFGICLGHQILA
                     LASGAQTVKMKFGHHGANHPVKDLERDVVMITAQNHGFAADEETLPENLRATHKSLFD
                     GTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIQQSIADKTNKA"
     gene            505901..509131
                     /gene="carB"
                     /locus_tag="VF_RS02405"
                     /old_locus_tag="VF0473"
                     /old_locus_tag="VF_0473"
                     /db_xref="GeneID:54163109"
     CDS             505901..509131
                     /gene="carB"
                     /locus_tag="VF_RS02405"
                     /old_locus_tag="VF0473"
                     /old_locus_tag="VF_0473"
                     /EC_number="6.3.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase large subunit"
                     /protein_id="WP_011261248.1"
                     /db_xref="GeneID:54163109"
                     /translation="MPKRTDIKSVLILGAGPIVIGQACEFDYSGAQACKALREEGYRV
                     ILVNSNPATIMTDPDMADATYIEPIHWEVVRNIIEKERPDAVLPTMGGQTALNCALDL
                     EKHGVLAEFGVEMIGATADAIDKAEDRSRFDKAMKSIGLECPRADTAKTMEEAYGVLD
                     MVGFPCIIRPSFTMGGTGGGIAYNKEEFEEICRRGLDLSPTNELLIDESLIGWKEYEM
                     EVVRDKNDNCIIVCAIENFDAMGIHTGDSITVAPAQTLTDKEYQLMRNASLAVLREIG
                     VETGGSNVQFGINPKDGRMVIIEMNPRVSRSSALASKATGFPIAKIAAKLAIGFTLDE
                     LMNDITGGATPASFEPTIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRNQQ
                     ESLQKALRGLEVGATGFDEMVDLDAPDALTKIRHELKDAGAERIWYIADAFRAGMSVD
                     GVFNLTNVDRWFLVQIEDLVKEEEAVKAGGFANLTADALRKLKRKGFADARLSKLLGV
                     GESEIRRLRDQHDIHPVYKRVDTCAAEFSSDTAYMYSSYDEECEANPTDKDKIMILGG
                     GPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLED
                     VLAIARVEKPKGVIVQYGGQTPLKLARALEAAGVPIIGTSPDAIDRAEDRERFQVAVD
                     RLELLQPENATVTTMEQAIDKSKEIGFPLVVRPSYVLGGRAMEIVYDEQDLRRYFNEA
                     VSVSNESPVLLDSFLDDAVEVDVDAICDGEQVVIGGIMEHIEQAGVHSGDSACSLPAY
                     TLSEEIQDVMRDQVRKLAFELGVRGLMNTQFAVKDNKVYLIEVNPRAARTVPFVSKAT
                     GAPLAKIAARVMAGQSLESQGFTKEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTG
                     EVMGVGTTFAEAFAKAELGCSKEYPEGGRALLSVREGDKKRVVDLAKHLVKLGYQLDA
                     THGTAVILGEAGINPRLVNKVHEGRPHILDRIKNGEYTYIVNTAAGRQAIEDSKVLRR
                     GALAEKVNYTTTLNAAFASCLAHEADDRKTVNSVQELHAKVAAKYA"
     gene            complement(509280..510686)
                     /gene="dacB"
                     /locus_tag="VF_RS02410"
                     /old_locus_tag="VF0474"
                     /old_locus_tag="VF_0474"
                     /db_xref="GeneID:54163110"
     CDS             complement(509280..510686)
                     /gene="dacB"
                     /locus_tag="VF_RS02410"
                     /old_locus_tag="VF0474"
                     /old_locus_tag="VF_0474"
                     /EC_number="3.4.16.4"
                     /EC_number="3.4.21.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine-type D-Ala-D-Ala carboxypeptidase"
                     /protein_id="WP_011261249.1"
                     /db_xref="GeneID:54163110"
                     /translation="MFFSRYSLIALSLISFSSIADIKETLSSLPSGSRTAITVENLQS
                     NKIEFQQKQDELLPPASTLKIATALAARLALGTEFTFTTTLYKADKDVVLTFSGDPSL
                     SRKQLSELFDDSELKTIQGDLWIDGSIFTGYERAVGWPWDILGVCYSAPSSALSIDEN
                     CVQASITTHEDGSTRVFVPIHQPISFSSYAKSVSREEQKSTFCDLELTTQGNHYELNG
                     CLVRRNKPLPLKFAVQDTRDFTKRTVSKILAEHNIKLNGEIHFGAPKSELTNLNVLAN
                     HNSKPLMELLDHMLKKSDNHYADNLTKMLGHLNYQQPGSFTNGTAAIKDILLKQADID
                     LSNAVLVDGSGLSRNNRMTANQMKSILQFIHKYDKELGLIELLPTSGIDGTLKYRNSM
                     RKEPIKGSMKSKSGSLFGSYNMAGFVGLENKEPQLFVQFVADYHPVVAKEGTIPVERP
                     IDSFEKSFYQELIKLSQE"
     gene            complement(510829..511797)
                     /locus_tag="VF_RS02415"
                     /old_locus_tag="VF0475"
                     /old_locus_tag="VF_0475"
                     /db_xref="GeneID:54163111"
     CDS             complement(510829..511797)
                     /locus_tag="VF_RS02415"
                     /old_locus_tag="VF0475"
                     /old_locus_tag="VF_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_011261250.1"
                     /db_xref="GeneID:54163111"
                     /translation="MMNKKVLALAVAAITSAGAVNAAELYKDEAQSIEMGGRAEARLA
                     MKDGDAADNTRIRLNFKGTTQISDGLYGVGFWEGEFTTNDAVNPNGNLENRYTYAGIG
                     GNFGEVTYGKNDGALGVITDFTDIMAYHGNSAAYKLAVADREDNAIAYKGQFGDFAFK
                     ANYRFDDAAANQESNDGFSTSGIYAFGDSGFKLGAGYADQGTDNEAMVAGSMTMGDFY
                     FAGTFTTGEVVDLDYTGFEVAGAYTMGKTVFTATYNNADHDTNALTVANNENADNFAV
                     DATYFFNANFRTYISYNLNLLDDDASKGITKAMTEDEVALGMRYDF"
     gene            512384..512857
                     /gene="greA"
                     /locus_tag="VF_RS02420"
                     /old_locus_tag="VF0476"
                     /old_locus_tag="VF_0476"
                     /db_xref="GeneID:54163112"
     CDS             512384..512857
                     /gene="greA"
                     /locus_tag="VF_RS02420"
                     /old_locus_tag="VF0476"
                     /old_locus_tag="VF_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004394173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_011261251.1"
                     /db_xref="GeneID:54163112"
                     /translation="MDKVPMTVRGEKLLRDELEVLLKRRPLISKAIGEARELGDLKEN
                     AEYHAAREEQGICEAQIRDIEYKLSVAQVIDVTKMTNTGKVIFGTTVTLIDVNTDEEV
                     KYQIVADDEANIKEGRISVNSPIARGLIGKMEGDEVNIQTPGGTKEFEIDAVDYI"
     gene            complement(512957..513253)
                     /gene="yhbY"
                     /locus_tag="VF_RS02425"
                     /old_locus_tag="VF0477"
                     /old_locus_tag="VF_0477"
                     /db_xref="GeneID:54163113"
     CDS             complement(512957..513253)
                     /gene="yhbY"
                     /locus_tag="VF_RS02425"
                     /old_locus_tag="VF0477"
                     /old_locus_tag="VF_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001054291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome assembly RNA-binding protein YhbY"
                     /protein_id="WP_005417663.1"
                     /db_xref="GeneID:54163113"
                     /translation="MNLSTKQKQYLKGLAHNLKPVVLMGANGLTEAVVAEIEIALNHH
                     ELIKVKVASEDRDTKQLIVEAIIRETEAEKVQVIGKTLVLYRPSEDRKIEIPRK"
     gene            513372..514001
                     /gene="rlmE"
                     /locus_tag="VF_RS02430"
                     /old_locus_tag="VF0478"
                     /old_locus_tag="VF_0478"
                     /db_xref="GeneID:54163114"
     CDS             513372..514001
                     /gene="rlmE"
                     /locus_tag="VF_RS02430"
                     /old_locus_tag="VF0478"
                     /old_locus_tag="VF_0478"
                     /EC_number="2.1.1.166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006958070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (uridine(2552)-2'-O)-methyltransferase
                     RlmE"
                     /protein_id="WP_011261252.1"
                     /db_xref="GeneID:54163114"
                     /translation="MSKNKVSASSGRWLKEHFDDKYVLEAQKRGYRSRAIFKIEEIQN
                     KDKLLKPGMTVVDLGAAPGGWSQYAVEQVGDEGQVIACDILPMDSIAGVSFLQGDFRE
                     EAVLDALLERIQPDMVDVVMSDMAPNMSGNLAVDQPRAMYLVELALDMCRQVLAPNGS
                     FTVKVFQGEGFDQYLQEVRNMFKVVKIRKPDSSRARSREVYIVATGYKG"
     gene            514087..516060
                     /gene="ftsH"
                     /locus_tag="VF_RS02435"
                     /old_locus_tag="VF0479"
                     /old_locus_tag="VF_0479"
                     /db_xref="GeneID:54163115"
     CDS             514087..516060
                     /gene="ftsH"
                     /locus_tag="VF_RS02435"
                     /old_locus_tag="VF0479"
                     /old_locus_tag="VF_0479"
                     /EC_number="3.4.24.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005593310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="WP_011261253.1"
                     /db_xref="GeneID:54163115"
                     /translation="MAKNLILWLVIAVVLMSVFQSFGPGDSSGRSIDYTTFVKEVGNS
                     QVQEATFNNREIKVMKRDGTRYVTYMPVFQDPKLLDDLINQNVIVKGTPPEEQSLLES
                     IFISWFPMILLIGVWIFFMRQMQGGGGKGAMSFGKSKAKMMTEEQIKTTFDDVAGCDE
                     AKEDVKELVDYLREPSRFQKLGGKIPTGVLLVGPPGTGKTLIAKAIAGEAKVPFFSIS
                     GSDFVEMFVGVGASRVRDMFEQAKKSSPCIIFIDEIDAVGRQRGAGVGGGNDEREQTL
                     NQMLVEMDGFEGNEGIIVIAATNRPDVLDAALLRPGRFDRQVVVGLPDIRGREQILQV
                     HMRKVPLGAGVEPSLIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFELAKDK
                     IMMGAERKSMVMSEETKESTAYHEAGHAIVGRLVPEHDPVYKVSIIPRGRALGVTMYL
                     PEQDRISMNRQHLESMISSLYGGRLAEELIYGVDKVSTGASNDIERATDIARKMVTQW
                     GFSDALGPLLYAEDQGDPFSGHGGSHQPKHVSPETLQLIDAEIRTIIDRNYARARQIL
                     EDNMDIMHAMKDALMKFETIDAGQIDDLMDRKADIREPQGWGDNNPQPQAKTEAPVEK
                     EETESKAEEKVEETKEQPTSTDETKNDSESSEK"
     gene            516129..516965
                     /gene="folP"
                     /locus_tag="VF_RS02440"
                     /old_locus_tag="VF0480"
                     /old_locus_tag="VF_0480"
                     /db_xref="GeneID:54163116"
     CDS             516129..516965
                     /gene="folP"
                     /locus_tag="VF_RS02440"
                     /old_locus_tag="VF0480"
                     /old_locus_tag="VF_0480"
                     /EC_number="2.5.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_011261254.1"
                     /db_xref="GeneID:54163116"
                     /translation="MKLISKNKSLLLDRSHVMGILNVTPDSFSDGGQFTHLDAALKQA
                     EKMVKAGVSFIDIGGESTRPGAPEVSLQEELDRVLPIIEAIHQRFDTWISIDTSKAVV
                     MEEAVKVGADLINDVRALQEPNALKVAAEANVPVCLMHMQGQPRTMQTNPSYQDLFTD
                     ISSFLSERIDACQSVGIAKDKLILDPGFGFGKTLAHNYQLLAELERFHQFGLPLLAGM
                     SRKSMVFKLLDVEPKMALSGSLACATIAAMKGAQIIRVHDFEQTMDIVKVCQATLEQS
                     PH"
     gene            517014..518351
                     /gene="glmM"
                     /locus_tag="VF_RS02445"
                     /old_locus_tag="VF0481"
                     /old_locus_tag="VF0482"
                     /old_locus_tag="VF_0481"
                     /db_xref="GeneID:54163117"
     CDS             517014..518351
                     /gene="glmM"
                     /locus_tag="VF_RS02445"
                     /old_locus_tag="VF0481"
                     /old_locus_tag="VF0482"
                     /old_locus_tag="VF_0481"
                     /EC_number="5.4.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002540330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_011261255.1"
                     /db_xref="GeneID:54163117"
                     /translation="MAERKYFGTDGVRGLVGQAPITPDFVMKLGWAAGQVLAKQGTKK
                     VIIGKDTRISGYMLESALEAGLAAAGLQAKFTGPMPTPAVAYLTQTFRAEAGIVISAS
                     HNPYYDNGIKFFSSEGTKLPDDVEMAIEAELDKPMTCVESALLGKASRLNDAAGRYIE
                     FCKSTFPKELSLAGLKIVIDCANGATYHIAPNVFKELGAEIITIGCEPNGTNINHEVG
                     ATDVRALQAKVVEEKADFGVAFDGDGDRIIMVDEFGEKVDGDQIAYIIARDALRRGEL
                     KGGVVGTLMTNMGMEVALRNLGIPFVRSDVGDRYVMEKLLENNWLIGAENSGHVILLD
                     KVTTGDAIVAALQVIASIVGSKMSLKELCDGMTMFPQILVNVRFAGENDPLESDAVKA
                     AQADVEAKLGDNGRVLLRKSGTEPLIRVMVEGEDAELVTQYAQQIADAVKESC"
     gene            518503..518835
                     /gene="secG"
                     /locus_tag="VF_RS02450"
                     /old_locus_tag="VF0483"
                     /old_locus_tag="VF_0483"
                     /db_xref="GeneID:54163118"
     CDS             518503..518835
                     /gene="secG"
                     /locus_tag="VF_RS02450"
                     /old_locus_tag="VF0483"
                     /old_locus_tag="VF_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_005417674.1"
                     /db_xref="GeneID:54163118"
                     /translation="MHTILLVIYLIAAVGVIGLVLVQHGKGADMGASFGAGASNTVFG
                     SSGSGNFLTRMTAICATVFFVISLALGNMSTHKSEGFDLKLDQQATEQVTDNASDVPA
                     TEDSDVPL"
     gene            518845..518929
                     /locus_tag="VF_RS02455"
                     /old_locus_tag="VF_T0016"
                     /old_locus_tag="VFT0016"
                     /db_xref="GeneID:54163119"
     tRNA            518845..518929
                     /locus_tag="VF_RS02455"
                     /old_locus_tag="VF_T0016"
                     /old_locus_tag="VFT0016"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:518879..518881,aa:Leu,seq:gag)
                     /db_xref="GeneID:54163119"
     gene            518999..519075
                     /locus_tag="VF_RS02460"
                     /db_xref="GeneID:54163120"
     tRNA            518999..519075
                     /locus_tag="VF_RS02460"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:519033..519035,aa:Met,seq:cat)
                     /db_xref="GeneID:54163120"
     gene            519240..519695
                     /gene="rimP"
                     /locus_tag="VF_RS02465"
                     /old_locus_tag="VF0484"
                     /old_locus_tag="VF_0484"
                     /db_xref="GeneID:54163121"
     CDS             519240..519695
                     /gene="rimP"
                     /locus_tag="VF_RS02465"
                     /old_locus_tag="VF0484"
                     /old_locus_tag="VF_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000147144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimP"
                     /protein_id="WP_011261256.1"
                     /db_xref="GeneID:54163121"
                     /translation="MTGLERQLTEMLEAPVGALGYELVGLEFVRAGEHSTLRVFIDHE
                     NGIFVEDCAEASRQISAVMDVEDPITVAYNLEVSSPGLERPLFKAAHYQQFVGHEVSL
                     VLKMPMNNRRKWKGDILEINGEIVTVTVDGNNEEFALSNISKANLVPKF"
     gene            519713..521200
                     /gene="nusA"
                     /locus_tag="VF_RS02470"
                     /old_locus_tag="VF0485"
                     /old_locus_tag="VF_0485"
                     /db_xref="GeneID:54163122"
     CDS             519713..521200
                     /gene="nusA"
                     /locus_tag="VF_RS02470"
                     /old_locus_tag="VF0485"
                     /old_locus_tag="VF_0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017633283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusA"
                     /protein_id="WP_011261257.1"
                     /db_xref="GeneID:54163122"
                     /translation="MNKEILAVVEAVSNEKAVPRERIFEALEIALATATKKKSEMEIE
                     VRVAIDRKTGDFETFRRWVAVENVENPTLEISIEAAQFEDETIEIGGYVEDDIESVTF
                     DRITTQTAKQVIVQKVREAERAMIVEQFIDNEGELITGIVKKVNRDAIIVDLGNNAEA
                     VILREDQLPRENFRPGDRVRGLLYAVKPEARGFQLFMTRSKGVMLTELFRVEVPEIGE
                     ELIELKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSGELGGERIDIVLW
                     DDNPAQFVINAMAPAEVASIIVDEDNNTMDIAVEADNLAQAIGRSGQNVRLASQLTGW
                     ELNVMTVADLNKKHQEEAQGSIDAFVKHLDIDADFAQLLVEEGFTTLEEVAYVPVNEL
                     LEIEELDEDTVDALRTRAKEALTTLALAQEESLDGVEPAEDLLALEGLERELAFKLAA
                     KGVITLEDLADQGVDELSDIENLTEERAGELIMAARNICWFSDEE"
     gene            521225..523906
                     /gene="infB"
                     /locus_tag="VF_RS02475"
                     /old_locus_tag="VF0486"
                     /old_locus_tag="VF_0486"
                     /db_xref="GeneID:54163123"
     CDS             521225..523906
                     /gene="infB"
                     /locus_tag="VF_RS02475"
                     /old_locus_tag="VF0486"
                     /old_locus_tag="VF_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008072190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_011261258.1"
                     /db_xref="GeneID:54163123"
                     /translation="MTKLTVKALSEEIGTPVDRLLQQFSDAGINKKDGDSVTESEKQS
                     LLVHLKKEHGSVDDSASPTRLTLQRKTRSTLSVAGSGGKSKDVQVEVRKKRTYVKASA
                     LEEEKKAEQLKAEAEEQAKRDAEEAAVRELEQKAQREAEEQAKREAEAEAKAKREAEE
                     KAKRAEADKAKKEMTKKNEQAKKEAEELKARQELEATRKAEAEAAKLVEEARKLAEEN
                     EARWKEEEQKKSAAEKDADYHVTTSSHAREAEDAADRKEEQQPRRRKKKAKPAEAAAP
                     RGGRNQRGGRNKKAQVNKPTSMQHGFDKSATVAKQDVAIGETIVVSELASKMSVKATE
                     VIKVMMKMGAMATINQVIDQETAQLVAEEMGHKVILRKENELEEAVLSDRDNSAEAEG
                     RAPVVTIMGHVDHGKTSTLDYIRRAHVADAEAGGITQHIGAYHVETDNGMITFLDTPG
                     HAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAGVPLIVAVNKIDKEDA
                     NPDNVKNELAQYDVIPEEWGGENMFVHISAKQGTNIDGLLEAILLQSEVLELTAVREG
                     MASGVVVESRLDKGRGPVATVLVQSGTLNKGDIVLCGQEYGRVRAMRDENGKEIESAG
                     PSIPVEILGLSGVPASGDEATVVRDERKAREVANYRQGKFRDVKLARQQKAKLENMFS
                     NMTAGEVAELNVVLKADVQGSVEAIADSLRKLSTDEVKVNIVGSGVGGITETDAVLAA
                     ASNAIILGFNVRADATARRTIENENLDLRYYSIIYQLIDEVKAAMGGMLAPEFKQEII
                     GLAQVRDVFKSPKLGAIAGCMVTEGTIKRSNPIRVLRDNVVIYEGELESLRRFKDDVA
                     EVKNGYECGIGVKNYNDVRVGDQIEVFEIVEIKRTLD"
     gene            524018..524425
                     /gene="rbfA"
                     /locus_tag="VF_RS02480"
                     /old_locus_tag="VF0487"
                     /old_locus_tag="VF_0487"
                     /db_xref="GeneID:54163124"
     CDS             524018..524425
                     /gene="rbfA"
                     /locus_tag="VF_RS02480"
                     /old_locus_tag="VF0487"
                     /old_locus_tag="VF_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosome-binding factor RbfA"
                     /protein_id="WP_011261259.1"
                     /db_xref="GeneID:54163124"
                     /translation="MSKEFSRTQRVSQQLQKELAVMLQREVRDSRIGMVTISDVEVSR
                     DLAYAKVFVTFFCVGEQTPESSLAALKEHEPSLRMMLGKRIRLRLTPEIRFTYDNTLV
                     EGMRMSNLVTDVVNTDKRKMAESGRTESDEGEE"
     gene            524425..525375
                     /gene="truB"
                     /locus_tag="VF_RS02485"
                     /old_locus_tag="VF0488"
                     /old_locus_tag="VF_0488"
                     /db_xref="GeneID:54163125"
     CDS             524425..525375
                     /gene="truB"
                     /locus_tag="VF_RS02485"
                     /old_locus_tag="VF0488"
                     /old_locus_tag="VF_0488"
                     /EC_number="5.4.99.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(55) synthase TruB"
                     /protein_id="WP_011261260.1"
                     /db_xref="GeneID:54163125"
                     /translation="MARRRKGRPVNGVILIDKPTGITSNDTLQKVKRIYFAEKAGHTG
                     ALDPLATGMLPICLGEATKFSQFLLDSDKRYRVVAKLGERTNTSDSDGEVVQTREVKV
                     DRGQLERCIAKFRGTTDQIPSMFSALKYQGRPLYEYAREGIEVPRESRKITVYSIELL
                     RFEGHEVEMEVHCSKALTFVRLPTILGEMLGCGAHVTYLRRTGVSNYPYENMVTIEDL
                     EALLEQAHREERAPRELLDPLLMPMDSAVQDLPEVNMIPELADHVLHGQPVQVFGAPQ
                     DGIVRMTSGDERLFIGVGHIDDDGRVAPKRLVVFRDEEEK"
     gene            525539..525808
                     /gene="rpsO"
                     /locus_tag="VF_RS02490"
                     /old_locus_tag="VF0489"
                     /old_locus_tag="VF_0489"
                     /db_xref="GeneID:54163126"
     CDS             525539..525808
                     /gene="rpsO"
                     /locus_tag="VF_RS02490"
                     /old_locus_tag="VF0489"
                     /old_locus_tag="VF_0489"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005301136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_005417682.1"
                     /db_xref="GeneID:54163126"
                     /translation="MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFA
                     NHKHDHHSRRGLLRMVSSRRKLLDYLKGKNLARYQDLIKRLGLRR"
     gene            526147..528276
                     /gene="pnp"
                     /locus_tag="VF_RS02495"
                     /old_locus_tag="VF0490"
                     /old_locus_tag="VF_0490"
                     /db_xref="GeneID:54163127"
     CDS             526147..528276
                     /gene="pnp"
                     /locus_tag="VF_RS02495"
                     /old_locus_tag="VF0490"
                     /old_locus_tag="VF_0490"
                     /EC_number="2.7.7.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_011261261.1"
                     /db_xref="GeneID:54163127"
                     /translation="MFANPVVKSFQYGNHTVTLETGVIARQATAAVMASMDDTSVFVS
                     VVAKKEAVPGQDFFPLTVNYQERTYAAGKIPGGFFKREGRPSEAETLTARLIDRPIRP
                     LFPDAFKNEVQVIATVVSINPEVNPDMITMIGTSAALAIAGIPFNGPIGAARVGHING
                     ELVLNPSNTELENSKLDLVVSGTEGAVLMVESEADNLTEEEMLSAVVFGHEQQQVVIN
                     AINEFAAEVATPAWDWVAPEENTVLNARIAELAEAKLVEAYQITEKMTRYDRIHEIAA
                     EVNEVLVSENEDVNLKEVHTIFHDLEKTVVRRSIIAGNPRIDGREKDMVRALDVRTGV
                     LPRTHGSSLFTRGETQALVTATLGTQRDAQIIDSLMGEKKDHFLLHYNFPPYCVGETG
                     FVGSPKRREIGHGKLAKRGIQAVMPSIEEFPYTVRVVSEITESNGSSSMASVCGTSLA
                     LMDAGVPIKASVAGIAMGLVKEGDDFVVLSDILGDEDHLGDMDFKVAGTNEGITALQM
                     DIKIEGITKEIMQIALNQAQGARKHILKVMDEAISGAREEISEFAPRIHTMKISSDKI
                     KDVIGKGGAVIRALCEETGTTIEIEDDGTIKIAATEGAAAKEAIRRIEEITAEVEVGK
                     IYTGKVMRIVDFGAFVTVLGPKEGLVHISQIAEERIEKVADHLQVGQEVKTKVLEIDR
                     QGRIRLSIKEANAELNPAPAAEAKDAE"
     gene            528397..529380
                     /gene="nlpI"
                     /locus_tag="VF_RS02500"
                     /old_locus_tag="VF0491"
                     /old_locus_tag="VF_0491"
                     /db_xref="GeneID:54163128"
     CDS             528397..529380
                     /gene="nlpI"
                     /locus_tag="VF_RS02500"
                     /old_locus_tag="VF0491"
                     /old_locus_tag="VF_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpI"
                     /protein_id="WP_011261262.1"
                     /db_xref="GeneID:54163128"
                     /translation="MNWIRVALVGAVLVLSGCASKGDTSGWGYPPMAVPLQPSIQQEI
                     QLSRLDQLLQRPDVDDVTRAKMYYERGLIKDSLGLRDLARVDFTQSLTLKPDQSDVFN
                     ILGVYYTQNTDFDGAYEALDSALELDPNNQFAERNLAIALYYGERYDQAYEIAQKHYN
                     DAPRDPYRAIWLYWIGLEVDAKVATETFQKQYQQRTDEDFGWDLAGLILKETSEDEFL
                     KKILTTTRNNVALAEKLTEGYFYLAKRYQYEGDYPNAIALYKLSMSNNVYEYVEHRYS
                     FVELGNIYKALRDLQEQKIKEQQAQEAKEAPVAPQEKSTEKEMLKEEATAK"
     gene            complement(529456..530334)
                     /locus_tag="VF_RS02505"
                     /old_locus_tag="VF0492"
                     /old_locus_tag="VF_0492"
                     /db_xref="GeneID:54163129"
     CDS             complement(529456..530334)
                     /locus_tag="VF_RS02505"
                     /old_locus_tag="VF0492"
                     /old_locus_tag="VF_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="U32 family peptidase"
                     /protein_id="WP_011261263.1"
                     /db_xref="GeneID:54163129"
                     /translation="MKYALGPLLYFWSKENVESFYQQATNSEADIIYLGESVCSKRRE
                     MKPKDWFAIAKDISDSGKQVVLSTMALLEAPSEVNVMKKYIDNGDFIIEANDVSAIQL
                     ASESKVPFVVGPAVNCYNAQTLNLFLKQGMTRWCMPVELSREWLQNVLTQCDELGIRN
                     KFETEVFSYGYLPLAYSARCFTARAENKPKDECETCCIKYPTGITVNSQEGQEVFTLN
                     GIQTQSGYCYNLINDLPSMSNLVDVVRLSPLSVDTFDEVRKFKANETGSEKFALKDAR
                     HCNGYWHNIAGLDIQM"
     gene            complement(530344..531345)
                     /locus_tag="VF_RS02510"
                     /old_locus_tag="VF0493"
                     /old_locus_tag="VF_0493"
                     /db_xref="GeneID:54163130"
     CDS             complement(530344..531345)
                     /locus_tag="VF_RS02510"
                     /old_locus_tag="VF0493"
                     /old_locus_tag="VF_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017031235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="U32 family peptidase"
                     /protein_id="WP_005417689.1"
                     /db_xref="GeneID:54163130"
                     /translation="MELLCPAGNLPALKTAIDCGADAVYIGFKDDTNARHFAGLNFTG
                     KKLEKAVQYVHDKNKHIHVALNTFAHPDGFSRWTKAVDNAAAMGIDALIISDIAVLEY
                     AATTYPDLELHLSVQASATNVAAIDFYKKNFNIKRVVLPRVLSIHQVKQLSRNLTSDV
                     DLEVFAFGSLCIMSEGRCYLSSYMTGESPNTVGACSPAKYVRWQETDNGLESRLNNIL
                     IDRYGEGENAGYPTLCKGRFDVEGKTFHALEEPTSLNTLSLVPELFAANVASVKIEGR
                     QRSPAYVEQVTRTWRAAIDSYKANPEGYAVEPKWDATLANVSEGTQTTLGAYHKKWQ"
     gene            complement(531563..533590)
                     /locus_tag="VF_RS02515"
                     /old_locus_tag="VF0494"
                     /old_locus_tag="VF_0494"
                     /db_xref="GeneID:54163131"
     CDS             complement(531563..533590)
                     /locus_tag="VF_RS02515"
                     /old_locus_tag="VF0494"
                     /old_locus_tag="VF_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_011261264.1"
                     /db_xref="GeneID:54163131"
                     /translation="MSLSQIQHWLPLLTDNSPFLFAILDKDHKYITVNNRYCELSGLN
                     RESLCGRSDSEILGKHFYSSLKAYYDRALNGEKIEAEITLDDHRFDTSLHFSLFPIHE
                     EDTTYIVFHAVDTSERQQLLNSLKESESKYHKLTELLSDSVFLIEGDIIVSANGASAK
                     MLGFNNPTEFIGESIEQLLHSPSRTQCLSELISSLPSEQQLTVRTTANCSLRAELILT
                     VEETHILGSPAHLVILKENKKQIAMSNHIAASQVDLLTGIYNRHGFTHVIEKMIKEDI
                     PFFMLYLDIDNFKNINDSLGHHIGDRVLKEISNRLQKLLPKHAVVGHLGGDEFGILFP
                     KPEHNQVLEQLSEKIISLINQPFDLVHFSKRLACSIGSVQYPADGSDARSLLQNADTA
                     MYEAKDRGRNRLIKFHDQMNKEARMRLWLEIELQKALQNNGLEVWYQPKVSARDFRIN
                     GAEALVRWKHPVEGYISPARFIPVAERSGLIETLGKVVMREVFQTVKEWKNQGILPGR
                     IAINLSPEQFGNPQLIEYMERLLKTTQVDPNCITLELTESAVMSDGEHAIQMLDAIKK
                     LGFTLSIDDFGTGYSSLAYLARFPLDELKIDRGFINEIDTLPKQITIIENVINLGKNL
                     NMDIVAEGVETRQQAMLLSSLNCDSIQGFHFYKPQPKHEIEALLVQNKRAR"
     gene            533798..534316
                     /locus_tag="VF_RS02520"
                     /old_locus_tag="VF0495"
                     /old_locus_tag="VF_0495"
                     /db_xref="GeneID:54163132"
     CDS             533798..534316
                     /locus_tag="VF_RS02520"
                     /old_locus_tag="VF0495"
                     /old_locus_tag="VF_0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCP2 domain-containing protein"
                     /protein_id="WP_047863654.1"
                     /db_xref="GeneID:54163132"
                     /translation="MINQIRSKLVENAASVLKTPAKLVPVSIQQKMLLEGLKQVFHEA
                     LEDGDFEFLEDKWLKVSILDLELEWFISYQDAKLVVSNKTENDDVSFSGQLNDLILIA
                     GRKEDPDTLFFQRRLKIEGDTELGLEVKNLMDSVDLDSLPKPLNQALMTLANFVQQGL
                     QKPEVKETMNAY"
     gene            534306..534809
                     /locus_tag="VF_RS02525"
                     /old_locus_tag="VF0496"
                     /old_locus_tag="VF_0496"
                     /db_xref="GeneID:54163133"
     CDS             534306..534809
                     /locus_tag="VF_RS02525"
                     /old_locus_tag="VF0496"
                     /old_locus_tag="VF_0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_011261266.1"
                     /db_xref="GeneID:54163133"
                     /translation="MLIRTEAPADILTVDRLVRSAFDTEAEAKLVMSLRENSHLTLAL
                     VACSDDGEVIGHCLFSPVTLNGDDLNWQGLAPLCVKKEHQKQGIAEALVKEGLEMLTE
                     LGYPVVVVLGDSNYYQRFGFESATNYDMHSKWEVPEGAFMIKACSSEFLEGRSGLIEY
                     CPEFDVL"
     gene            complement(534865..535332)
                     /locus_tag="VF_RS02530"
                     /old_locus_tag="VF0497"
                     /old_locus_tag="VF_0497"
                     /db_xref="GeneID:54163134"
     CDS             complement(534865..535332)
                     /locus_tag="VF_RS02530"
                     /old_locus_tag="VF0497"
                     /old_locus_tag="VF_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261267.1"
                     /db_xref="GeneID:54163134"
                     /translation="MKKRLITTATISSIFSTMALVLLINIASTNTTYAKDNGDWVLIS
                     DKTVNFEQEEDKVEPLPFLSERKFSKIKIKCVQGTVSIKSMKVTMTDGSTKQLKTMGT
                     LTKGMSTRTYKLPGTDKSKFDFLELQYKSWGNLTLNAAGVVKKAKVEIWGLKR"
     gene            535542..535943
                     /locus_tag="VF_RS02535"
                     /old_locus_tag="VF0498"
                     /old_locus_tag="VF_0498"
                     /db_xref="GeneID:54163135"
     CDS             535542..535943
                     /locus_tag="VF_RS02535"
                     /old_locus_tag="VF0498"
                     /old_locus_tag="VF_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit psi"
                     /protein_id="WP_005417701.1"
                     /db_xref="GeneID:54163135"
                     /translation="MPQQALQFLNEMDISVWQVRQTSYFPALENTTLSLPETCQLLFV
                     APAIPTERDAFLFGKVLASMKLSPEQALFLSSESLEYIGEHHLDWCWFSGVSTTELEG
                     VKILTSPLLSEMHSNTQSRRDLWRQICSYDN"
     gene            535933..536379
                     /gene="rimI"
                     /locus_tag="VF_RS02540"
                     /old_locus_tag="VF0499"
                     /old_locus_tag="VF_0499"
                     /db_xref="GeneID:54163136"
     CDS             535933..536379
                     /gene="rimI"
                     /locus_tag="VF_RS02540"
                     /old_locus_tag="VF0499"
                     /old_locus_tag="VF_0499"
                     /EC_number="2.3.1.266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S18-alanine
                     N-acetyltransferase"
                     /protein_id="WP_011261268.1"
                     /db_xref="GeneID:54163136"
                     /translation="MTIKIQTTSESHLDDIWRIERAAHSHPWAESMIRELDSRCAQHR
                     VMLVDEQVVGYFYAQNVVGEVTLLNIAIDPAHQGKGFGRKLTEFFIDMCMEQKAESAW
                     LEVRESNTKAISLYESEGFNEVTRRHDYYPTNNGKEDAIIMSFIFF"
     gene            536476..538056
                     /gene="prfC"
                     /locus_tag="VF_RS02545"
                     /old_locus_tag="VF0500"
                     /old_locus_tag="VF_0500"
                     /db_xref="GeneID:54163137"
     CDS             536476..538056
                     /gene="prfC"
                     /locus_tag="VF_RS02545"
                     /old_locus_tag="VF0500"
                     /old_locus_tag="VF_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017419803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_011261269.1"
                     /db_xref="GeneID:54163137"
                     /translation="MSFLQEVGKRRTFAIISHPDAGKTTITEKVLLFGNAIQKAGTVK
                     GRGSNQHAKSDWMEMEKERGISVTTSVMQFPFNDCLVNLLDTPGHEDFSEDTYRTLTA
                     VDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREVRDPMEVLDEVESELG
                     MACAPISWPIGCGKEFKGVYHIHRDETILYESGHGHEIQEVRTIKGLDNPELDATVGA
                     DLAESVREELELVMGACPEFDHELFLAGELTPVYFGTALGNFGVDHMLEGLTDWAPAP
                     QTRQANERDVVATEDKFSGFVFKIQANMDPKHRDRIAFMRIVSGTYTQGMKMNHVRTG
                     KNVSISDAVTFMAGDRSRAETAYAGDIIGLHNHGTIQIGDTFTQGESLKFSGIPNFAP
                     ELFRRIRLKDPLKQKQLLKGLVQLSEEGAVQVFRPLQNNDLIVGAVGVLQFDVVVARL
                     KAEYNVEAIYEGVSVATARWVDCADGKKMDEFQRKNQANLALDGGDNLTYIAPTMVNL
                     NLASERFPDVQFRATREH"
     gene            538315..539091
                     /locus_tag="VF_RS02550"
                     /old_locus_tag="VF0501"
                     /old_locus_tag="VF_0501"
                     /db_xref="GeneID:54163138"
     CDS             538315..539091
                     /locus_tag="VF_RS02550"
                     /old_locus_tag="VF0501"
                     /old_locus_tag="VF_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TatD family hydrolase"
                     /protein_id="WP_011261271.1"
                     /db_xref="GeneID:54163138"
                     /translation="MVFTFIDSHCHFDFDPFKNNEVSYLQMAKDKGVTTLVVPSVNQS
                     NWNHVSRLAHQFDEIYYALGIHPLFITPSYERELENLGELLDGKNKKCVAIGECGLDF
                     WYPESDIETQISVFRQHCLLAKQHQLPLIVHSRKSHDMVLKLLREIQPERGGVIHGFS
                     GSLQQANQFIDLGFYIGVGGVISYERAKKTKMVISQLPLDKIILETDAPDMPLFGFQG
                     EKNSPDKVRNVFEYLSLIRKESMQTISETVYKNTTSLFGI"
     gene            539290..540546
                     /locus_tag="VF_RS02555"
                     /old_locus_tag="VF0502"
                     /old_locus_tag="VF_0502"
                     /db_xref="GeneID:54163139"
     CDS             539290..540546
                     /locus_tag="VF_RS02555"
                     /old_locus_tag="VF0502"
                     /old_locus_tag="VF_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NupC/NupG family nucleoside CNT transporter"
                     /protein_id="WP_011261272.1"
                     /db_xref="GeneID:54163139"
                     /translation="MSLLMSLVGIVVLLGIAVLLSDNRKAINLRTVGGAFAIQFFLGA
                     FVLYVPVGRDVLYGASEAVANVINYGNQGIEFLFGGLVSGKMFEVFGGGGFVFALRVL
                     PVIVFFASLTAVLYYLGIMQIVINFLGGALQKALGTSRAESLSATANIFVGQTEAPLV
                     VRPFVPKMTQSELFAVMCGGLASVAGGVLAGYASMGVPLEYLIAASFMAAPGGLLFAK
                     IIKPETEQPIEQLDALNNEGDDKPANVIDAAAAGAATGMQLALNVGAMLLAFIGLIAL
                     INGILGGIGGWFDMPHITLELILGYIFAPLAFLIGVPWEEATIAGSFLGQKLVVNEFV
                     AYLNFAPYLANGAEVVLSEKTEAIISFALCGFANLSSVAILLGGLGSLAPARRHDIAR
                     MGMKAVAAGTLSNLMSATIAGLFLSL"
     gene            540832..541002
                     /locus_tag="VF_RS02560"
                     /old_locus_tag="VF0503"
                     /old_locus_tag="VF_0503"
                     /db_xref="GeneID:54163140"
     CDS             540832..541002
                     /locus_tag="VF_RS02560"
                     /old_locus_tag="VF0503"
                     /old_locus_tag="VF_0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005345947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1427 family protein"
                     /protein_id="WP_005417708.1"
                     /db_xref="GeneID:54163140"
                     /translation="MNEVLLSMFAGLIVGVVFSAIKLPIPAPPVLSGVMGIVGVYAGA
                     VGYQWIVERFFS"
     gene            541279..542055
                     /gene="deoC"
                     /locus_tag="VF_RS02565"
                     /old_locus_tag="VF0504"
                     /old_locus_tag="VF_0504"
                     /db_xref="GeneID:54163141"
     CDS             541279..542055
                     /gene="deoC"
                     /locus_tag="VF_RS02565"
                     /old_locus_tag="VF0504"
                     /old_locus_tag="VF_0504"
                     /EC_number="4.1.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010436196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="WP_005417709.1"
                     /db_xref="GeneID:54163141"
                     /translation="MSDLKAAALRALKLMDLTTLNDNDTDEAVIALCKNAKTAVGNTA
                     AVCIYPRFIPIAKKTLREQGTPEVRIATVTNFPHGNDDIEIAVAETKAAVAYGADEVD
                     VVFPYRALIAGDETTGFELVKQCKEACGDVLLKVIIETGELKEEALIKKASQICIEAG
                     ANFIKTSTGKVPVNATPEYARMMLEVIRDMDVAKTVGFKPAGGVRTAEDAQAYLAMAD
                     DILGGDWADNMHYRFGASSLLTNLLNTLEVTEETADPSAY"
     gene            542171..543502
                     /gene="deoA"
                     /locus_tag="VF_RS02570"
                     /old_locus_tag="VF0505"
                     /old_locus_tag="VF_0505"
                     /db_xref="GeneID:54163142"
     CDS             542171..543502
                     /gene="deoA"
                     /locus_tag="VF_RS02570"
                     /old_locus_tag="VF0505"
                     /old_locus_tag="VF_0505"
                     /EC_number="2.4.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="WP_011261273.1"
                     /db_xref="GeneID:54163142"
                     /translation="MYLPQEIIRKKRDNKELTAEEINFFIQGVAKETVSEGQIAAFAM
                     AVYFNEMTMPERIALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMV
                     AACGGYVPMISGRGLGHTGGTLDKLESIAGYNITPSNDVFGKVTKEAGVAIIGQTGDL
                     APADKRVYATRDVTATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASE
                     ELAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAIRFLTGEYRNPRLYEVT
                     MALCAEMLVIANLAKDEQDARAKLQTVLDNGKAAECFGKMVFGLGGPSDIIENYDNHL
                     ESAQIIKPVFADTTGFVQAMDTRDLGMAVVGMGGGRRVASDTIDYAVGLSDMIRLGQT
                     ADNQQPLAMIHARNEEQWQQAANAVKAAIVISEKQPEATPEVYRKIRPEDV"
     gene            543513..544745
                     /locus_tag="VF_RS02575"
                     /old_locus_tag="VF0506"
                     /old_locus_tag="VF_0506"
                     /db_xref="GeneID:54163143"
     CDS             543513..544745
                     /locus_tag="VF_RS02575"
                     /old_locus_tag="VF0506"
                     /old_locus_tag="VF_0506"
                     /EC_number="5.4.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004415391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="WP_011261274.1"
                     /db_xref="GeneID:54163143"
                     /translation="MKRAIILVLDSFGIGAAGDADKFGDVGSDTMGHIAEQCDKGLAD
                     NGNRKGPLTLPNLSKLGLAMAGKESTGKFSAGLDANAEIIGAYGHAAELSSGKDTPSG
                     HWEIAGVPVLFDWGYFTDKENSFPKELTDRILERANLPGYLGNCHASGTQVLDDLGEE
                     HMKTGMPIFYTSADSVFQIACHEETFGLDNLLTLCQIAREELEDYNIGRVIARPFIGP
                     GKGQFERTGNRRDLSVEPPAATILQKLVDEKGGQVHSIGKISDIYAGCGITKKTKATG
                     IPALFDATKEAIEQAIEQAGDNTIVFTNFVDFDSAYGHRRDVAGYAAALEYFDGRLPE
                     IMDMLQEDDILILTADHGCDPTWPGTDHTREHIPVLVYGHKVPAGSLGRRDTFADIGQ
                     TLAEYFETSDMEYGKSFL"
     gene            544817..545533
                     /gene="deoD"
                     /locus_tag="VF_RS02580"
                     /old_locus_tag="VF0507"
                     /old_locus_tag="VF_0507"
                     /db_xref="GeneID:54163144"
     CDS             544817..545533
                     /gene="deoD"
                     /locus_tag="VF_RS02580"
                     /old_locus_tag="VF0507"
                     /old_locus_tag="VF_0507"
                     /EC_number="2.4.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine-nucleoside phosphorylase"
                     /protein_id="WP_005417712.1"
                     /db_xref="GeneID:54163144"
                     /translation="MATPHINAEMGDFADVVLMPGDPIRAKYIAETFLDDVVQVCDVR
                     NMYGFTGTYKGRKISVMGHGMGIPSCSIYMTELIKDFGVKKVIRVGSCGAVNEGIKVR
                     DVVIGMGACTDSKVNRIRFKDHDFAAIADYEMVRNAELAAQARGIDVKVGNLFSAELF
                     YTPDPSMFDLMDKYGIVGVEMEAAGMYGVAAEYGAKALAICTVSDHIKTGEQTTSDER
                     ATTFDEMMLIALDSVLLGDK"
     gene            complement(545597..546193)
                     /locus_tag="VF_RS02585"
                     /old_locus_tag="VF0508"
                     /old_locus_tag="VF_0508"
                     /db_xref="GeneID:54163145"
     CDS             complement(545597..546193)
                     /locus_tag="VF_RS02585"
                     /old_locus_tag="VF0508"
                     /old_locus_tag="VF_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMP protein"
                     /protein_id="WP_005417713.1"
                     /db_xref="GeneID:54163145"
                     /translation="MLSQNFVIKGLMLLSLMAFSYFILINSTIISDSNQVIQNKQLQD
                     LSRTMTRQAALFAVDSIKEDNHEALFQLTNNLAKERLVFDATIYDAEGRILGKSDNAL
                     TASQITGLNTPLSIDGIGRQQLIEPIIKDDHLLGFLRVTFEKSTLTGFANHHYRKSDR
                     LMFGMLAISLVSGMLIMGLLRKRKDASKPITTLFGGKA"
     gene            546328..547296
                     /gene="serB"
                     /locus_tag="VF_RS02590"
                     /old_locus_tag="VF0509"
                     /old_locus_tag="VF_0509"
                     /db_xref="GeneID:54163146"
     CDS             546328..547296
                     /gene="serB"
                     /locus_tag="VF_RS02590"
                     /old_locus_tag="VF0509"
                     /old_locus_tag="VF_0509"
                     /EC_number="3.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_047863655.1"
                     /db_xref="GeneID:54163146"
                     /translation="MDRIIPFSIKKHIPLLNRFSSTLTTTQFDVKKTGWIIYGPQLSP
                     RHFDDIDFFVGYKTQLIKTWKVGYYEVAAIAGALTEEHKIIVDALGLDYAEMKDIPDL
                     SKPGIILFDMDSTAIEIECIDEIAKLAGVGEQVAEVTERAMQGELDFKESLIQRVGTL
                     AGADEAILAEVKANLPFMPEIRELVATMHKYGWKPAIASGGFTYFSDYLKQELNLVHA
                     QSNQLEIVDGKLTGKVLGEIVSAETKAHILVELADKYDIEISNTVAVGDGANDLVMME
                     AAGLGIAYHAKPKVQEQAQTAIKHADLGGVACILSASLLFGNKLSW"
     gene            547556..547771
                     /locus_tag="VF_RS02595"
                     /old_locus_tag="VF0510"
                     /old_locus_tag="VF_0510"
                     /db_xref="GeneID:54163147"
     CDS             547556..547771
                     /locus_tag="VF_RS02595"
                     /old_locus_tag="VF0510"
                     /old_locus_tag="VF_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012535160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Flp family type IVb pilin"
                     /protein_id="WP_011261276.1"
                     /db_xref="GeneID:54163147"
                     /translation="MLTKLFVKSQLALQSFKNDERGVTAIEYAIIGVCMSAIVLAVFN
                     GTLQEALQGAMDTISTNITAANTAPAE"
     gene            547789..548220
                     /locus_tag="VF_RS02600"
                     /old_locus_tag="VF0511"
                     /old_locus_tag="VF_0511"
                     /db_xref="GeneID:54163148"
     CDS             547789..548220
                     /locus_tag="VF_RS02600"
                     /old_locus_tag="VF0511"
                     /old_locus_tag="VF_0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_162200313.1"
                     /db_xref="GeneID:54163148"
                     /translation="MKLLIISVVTIANIYAVFHDIKNRKISNNIVFIIMIIGFFSIFV
                     KGGMSYLLSPLIILFVGFILFKFNIIAAGDIKYYAAMSLMIEQQYLLLVTCIILCLGG
                     LQAYCQYSIYKLTGNERWIERGVPYGVAISIGSLFGILASI"
     gene            548228..549040
                     /gene="cpaB"
                     /locus_tag="VF_RS02605"
                     /old_locus_tag="VF0512"
                     /old_locus_tag="VF_0512"
                     /db_xref="GeneID:54163149"
     CDS             548228..549040
                     /gene="cpaB"
                     /locus_tag="VF_RS02605"
                     /old_locus_tag="VF0512"
                     /old_locus_tag="VF_0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly protein CpaB"
                     /protein_id="WP_011261278.1"
                     /db_xref="GeneID:54163149"
                     /translation="MKSKIILVLAVIAISIGLYGMSQTSTTESPITEKVQEFDKRPEA
                     TVMVWIAKKDLMFGSPVQRTDLEVQRISQTQADRFGIIHDVKFNFNKKLLVKKDILQG
                     DIVTSDMLLSPGQEGYLNLVISEGKVPFNLEVSNDAILGGAISVGDVVDIASISSSEQ
                     NLSNDASISNVQSLKMAPLLTQIMVLDIIQQEKPVRLNSKSTKTVTNLVLEVSNRELA
                     KLVIAQRIAELEVHKSIGAEFSHELHADSSDVITIPGFKKVKPVNSIQEFRG"
     gene            549044..550354
                     /locus_tag="VF_RS02610"
                     /old_locus_tag="VF0513"
                     /old_locus_tag="VF_0513"
                     /db_xref="GeneID:54163150"
     CDS             549044..550354
                     /locus_tag="VF_RS02610"
                     /old_locus_tag="VF0513"
                     /old_locus_tag="VF_0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspD"
                     /protein_id="WP_011261279.1"
                     /db_xref="GeneID:54163150"
                     /translation="MRYRILIILTVLLSIVSLNVRAKEIENLSAGDAKSITTTTEIGS
                     VFISNPKVADYKIIDKYKVVLFGREVGDSVFIAFDVQGRELLNKKIIVSKNYSGIEQQ
                     VKLRFPTSDIDIFAIGTNAVVSGTVLNEEDRDQIYEMVATLLFDDNADNNAQDDRTEL
                     TYMDKLNFEGVVNQIEVARTKQVNVKLTIAEVSHSFMQDFGIKVGSNGQAGIFVDQLV
                     HFSASDIVSVITAVGTDSVGQVLAEPNLSVISGEDASFLVGGELPVVTVIDGATNVQY
                     KEFGVKLDLTAKVERDDKIKLALAPSVSSLDTQYANDNYNLPSLKTRSARTTVELGDG
                     QSFVLGGLLNSEEKESLTRIPFVGDIPILGALFRHTGTERNKTELIIVATVNLVQPVK
                     ANQIQLPTMQKTSTLRRFLGMGSDYERAEDQWASEVLNAGGFRK"
     gene            550351..550821
                     /locus_tag="VF_RS02615"
                     /old_locus_tag="VF0514"
                     /old_locus_tag="VF_0514"
                     /db_xref="GeneID:54163151"
     CDS             550351..550821
                     /locus_tag="VF_RS02615"
                     /old_locus_tag="VF0514"
                     /old_locus_tag="VF_0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_011261280.1"
                     /db_xref="GeneID:54163151"
                     /translation="MKKLYVIAVLLFLSGCADHINEKQGTHINVIPVTYSFSINSQSD
                     DIIKNKLNTFINHHGLKNKKGYWEISIYKDDVKEQEIKYQQLLGEFGYTINQIKTVEL
                     QDKPYFIVTVSFITQKIEYQICGYEQIDYYGSNNIGCYTESNRWHSMVNPENAM"
     gene            550871..552109
                     /locus_tag="VF_RS02620"
                     /old_locus_tag="VF0515"
                     /old_locus_tag="VF_0515"
                     /db_xref="GeneID:54163152"
     CDS             550871..552109
                     /locus_tag="VF_RS02620"
                     /old_locus_tag="VF0515"
                     /old_locus_tag="VF_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning ATPase"
                     /protein_id="WP_011261281.1"
                     /db_xref="GeneID:54163152"
                     /translation="MFDLAERLSSNKSNESKLSHKLKTMLFYQTEECRSLVNESFRFD
                     GKDEPKCVKNRDEEFRQIDLLNPPEVVIIELNASQDVVQDAQRLAHLLPSQVSVVIVG
                     SEDAISTIRLLKEMGFYYLFWPVSKQECSDFMKHVLDNHEQHRGLMANRKSKRVAMVG
                     VKGGVGTSLISSEVSRMLSFDKGVSTLLVDHNYHGGNLDIFMGLKQHQKRIVQKGTLI
                     SNIDGTYALGLIRKITPMLSMLAIDSDELNAQELKEYTLAVQEQALKNSSVMIEDHAH
                     LIRNEDDIIKLLQQVDVLVLVFDATVSSLRDYNRLNQLVKKNNLDNQTRVISVLNSSR
                     PSNSGSVSAEEIEKYSGQRATISIPYDDKAPQYVLEGLQIVKTKSAMALPLMNLVALI
                     LGEEPKQESRSFLSFFKKKG"
     gene            552116..553405
                     /locus_tag="VF_RS02625"
                     /old_locus_tag="VF0516"
                     /old_locus_tag="VF_0516"
                     /db_xref="GeneID:54163153"
     CDS             552116..553405
                     /locus_tag="VF_RS02625"
                     /old_locus_tag="VF0516"
                     /old_locus_tag="VF_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CpaF family protein"
                     /protein_id="WP_011261282.1"
                     /db_xref="GeneID:54163153"
                     /translation="MNNNKALYIQLRTQIFNALEPEALNKLTKQELTQQLSNAVDLLI
                     DREQLPVSLIMKNEYVESLVNELVGLGPLQNLMDDETITDIMINGHENVFIERDGLVE
                     KVSVNFIDEQQLIDIAKRIASRVGRRVDESSPTCDARLEDGSRVNIVIPPIAIDGTSI
                     SIRKFKKQSIAFSDLVEFGAMSKEMAQILMVASRCRLNILISGGTGSGKTTMLNALSQ
                     FISEGERIVTIEDAAELKLQQPHVVRLETRTSGIEGTGVVSQRDLVINSLRMRPDRII
                     VGECRGGEAFEMLQAMNTGHDGSMSTLHANSPRDALSRVEAMVMMATNNLPLEAVRRT
                     IVSAVDIVIQISRLHDGTRKVMSISEVVGLEGNNVVLEEIFAFKPNKEQNEDGKVKGN
                     YFTSGLMQRSVLMEKARFFGMEEKIQSAFRAPYAEVQ"
     gene            553405..554322
                     /locus_tag="VF_RS02630"
                     /old_locus_tag="VF0517"
                     /old_locus_tag="VF_0517"
                     /db_xref="GeneID:54163154"
     CDS             553405..554322
                     /locus_tag="VF_RS02630"
                     /old_locus_tag="VF0517"
                     /old_locus_tag="VF_0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_011261283.1"
                     /db_xref="GeneID:54163154"
                     /translation="MSWIAIGIGLILLGFAFGDKPVKKSQYLEKLNVTQFVDDLNSTE
                     QAINLASLTERTFRQKLEFIWKNIARQLGNGAALKLVFSICVFALIGLLINRSMIHAS
                     PYIVVFIAIVIGLIWGYVWLQEKEKKQFNERFPDALNMLSSAVSAGESITHAIAFVGK
                     KLEGDVGKEFKIMGERLQLGESPDEVFKKSCVRFPYPAFRFFVITLRANMNRGGQLRD
                     VISRLNRLMFDARAVERKKYALTSEARISAKIVCATPFFFLFILQFLSPENYEFVMFH
                     AEGRPILYYVLISEAIGMLIIWGLLKGTK"
     gene            554322..555194
                     /locus_tag="VF_RS02635"
                     /old_locus_tag="VF0518"
                     /old_locus_tag="VF_0518"
                     /db_xref="GeneID:54163155"
     CDS             554322..555194
                     /locus_tag="VF_RS02635"
                     /old_locus_tag="VF0518"
                     /old_locus_tag="VF_0518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_011261284.1"
                     /db_xref="GeneID:54163155"
                     /translation="MSDWYLFISITLISFGLMLIVYLSITKFLREKQLHVLSGNNQKI
                     KENELGGWLKNKASELNPDEEEIKQKLRQAGWENTQYVHLFMPIKYSVLLIGEVIFGI
                     AYYQSFLSSTAWVIAASLWMVFVIIAPDMYLQAKIKARVHRVSTQMPYLLDLMAVCVQ
                     TGMTVEASLSYLVKEMKGFNKDLTQVLTKMNERSRMVGLEKSLEEMYVEIPSNEMRSF
                     VMTLTQSMHYGSSIYNVLTTLASDIREVQMLELEERIGKLAAKMSVPLIVFIMIPIVI
                     LIAAPGVMRLMLNA"
     gene            555187..555927
                     /locus_tag="VF_RS02640"
                     /old_locus_tag="VF0519"
                     /old_locus_tag="VF_0519"
                     /db_xref="GeneID:54163156"
     CDS             555187..555927
                     /locus_tag="VF_RS02640"
                     /old_locus_tag="VF0519"
                     /old_locus_tag="VF_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261285.1"
                     /db_xref="GeneID:54163156"
                     /translation="MLKKLLLVSTVLLLSACSSRQYSESSLTQSKIDIYEQTQNYVAL
                     SDLYKAELKKEDSEEIREALAAALLHLEDPESALFYLKPNIENGASFQSYYLQASALG
                     DLGKYPQAIKAALLSLEENPDNPETENLLGILYGHEYQYEKSRRYFQKAQLHFYDSNT
                     IANNLAVLDIAEGNYKRAAQRLLPVYRSGQANEQVMANLILSMAKEQNLEFIQAVLGD
                     KHTKKEIERIYQSLQRFNSLDIDTKKSV"
     gene            555936..556421
                     /locus_tag="VF_RS02645"
                     /old_locus_tag="VF0520"
                     /old_locus_tag="VF_0520"
                     /db_xref="GeneID:54163157"
     CDS             555936..556421
                     /locus_tag="VF_RS02645"
                     /old_locus_tag="VF0520"
                     /old_locus_tag="VF_0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_011261286.1"
                     /db_xref="GeneID:54163157"
                     /translation="MRNKQNGSASIEFVMGFMAFWFMCMAWVEMSYMSYISAINDLAI
                     SEVSRSAKKGEERYLDIVDEVLYRDNSIWNTVISADNFRVSIQYLPTIEALESEKKGC
                     PIPEGQRTRECGDEGNNALAIYRIDYDFHPIFSYVFSRSANLSREMIVVQEYERSQFE
                     I"
     gene            556396..556944
                     /locus_tag="VF_RS02650"
                     /old_locus_tag="VF0521"
                     /old_locus_tag="VF_0521"
                     /db_xref="GeneID:54163158"
     CDS             556396..556944
                     /locus_tag="VF_RS02650"
                     /old_locus_tag="VF0521"
                     /old_locus_tag="VF_0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011261287.1"
                     /db_xref="GeneID:54163158"
                     /translation="MNDRNLKSKQRGIFSIEFAIVGICFSLLLAFSGDVIIKLSIKGK
                     LDRLSYSLVNVLKERTQLYGMDYQLTSEEVDSLNKIAKNSLSRTFGNFDANKYGMLVE
                     ELSFSEVDVPNPVISEHRGAETCHVNKSIGQLKELTVLSVRGRTMPLYRVALCYESDN
                     WFGDLVDKIYTTVMSDSIVIGR"
     gene            556947..558338
                     /locus_tag="VF_RS02655"
                     /old_locus_tag="VF0522"
                     /old_locus_tag="VF_0522"
                     /db_xref="GeneID:54163159"
     CDS             556947..558338
                     /locus_tag="VF_RS02655"
                     /old_locus_tag="VF0522"
                     /old_locus_tag="VF_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017021080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TadG"
                     /protein_id="WP_047863656.1"
                     /db_xref="GeneID:54163159"
                     /translation="MKLKKQQSGHAAILFVMCIPVLFGVFTLASDGARALQSKARLED
                     AAEAAVLAVSAYGEEDEVSTQTGKDYVAHYMHDMSNLVDIEVEKLECSELPECTADDN
                     DRPFVEYQVSGRTKHKSWFPGNDVTVGFGESFDVTGMSKARKFQSSQPMDITFILDFS
                     GSMNYDWEGHAPSYMEEEVPKVPGRYSPPSRLSDLKDVVQMVTDELQVYNNSTTGPKH
                     RVAMTGYNRRTVNESSNGKFVIRDQRITKYNSDGYDAGDKFYPKKTINKQFMVKGAAA
                     RVPNGDEKAEFTDIMYTSDFASFNHKIKSFEAFGGTASLQGIIRASQIVSYHITNDGE
                     EANPKQLIIILSDGEDFNHYLGQTETLVDYGMCDNLRNAIEGGPVSSEDNKADKIVFS
                     SGSSSGLPTNTGEDPSVRIAMIGFGDGYDIHANTGLLNCVGEENAFSANNKDEILNLI
                     MSLVSEEVGHLAQ"
     gene            558354..559013
                     /locus_tag="VF_RS02660"
                     /old_locus_tag="VF0523"
                     /old_locus_tag="VF_0523"
                     /db_xref="GeneID:54163160"
     CDS             558354..559013
                     /locus_tag="VF_RS02660"
                     /old_locus_tag="VF0523"
                     /old_locus_tag="VF_0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_011261289.1"
                     /db_xref="GeneID:54163160"
                     /translation="MKKICVLLALFSANVLSAEKNNNQEFNQLLDYYCGTESVEFQEQ
                     VTIGEGKQILFHQGPFMQVNTELSPDVIKRTFSNAMQQANLSSQCSEYLLSYAEVVED
                     NVEQKLFARVLFNFDQYSLTERSKYILQSVTEKLETQKDTVLLNGHTDNKGRENYNIN
                     LGLARSNSVKAFLLAQGASKEQLESYSFGEQQPIDDNTTLEGQHHNRRVDIEKKANET
                     N"
     gene            complement(559068..559904)
                     /locus_tag="VF_RS02665"
                     /old_locus_tag="VF0524"
                     /old_locus_tag="VF_0524"
                     /db_xref="GeneID:54163161"
     CDS             complement(559068..559904)
                     /locus_tag="VF_RS02665"
                     /old_locus_tag="VF0524"
                     /old_locus_tag="VF_0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GHKL domain-containing protein"
                     /protein_id="WP_047863659.1"
                     /db_xref="GeneID:54163161"
                     /translation="MTVGTLLSFIVFIYFSYQWAIKPIKKRKRELKRIQNMKEGFFTQ
                     PSDTESELTSIYHSTNRALFQAKEKEEQYKKTLDDLAHSLKNHVIASKLLLQDLQAES
                     TEKLSQQLTLMDDVIQGQLQRATLNIKELKPTTTVVSEPLQGLLSMFSKIYHEKEIEV
                     CCFINEEQKLPIEKNDLMEILGNTLENSFRFASTKIVITIKQYSNDYILSIENDGPSI
                     PEEQKESLFLRGVRADKLNAGTGLGLALCADIIEKYNGSIWFDTPENKRLGALLKIKL
                     PI"
     gene            complement(560037..561380)
                     /locus_tag="VF_RS02670"
                     /old_locus_tag="VF0525"
                     /old_locus_tag="VF_0525"
                     /db_xref="GeneID:54163162"
     CDS             complement(560037..561380)
                     /locus_tag="VF_RS02670"
                     /old_locus_tag="VF0525"
                     /old_locus_tag="VF_0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_011261291.1"
                     /db_xref="GeneID:54163162"
                     /translation="MKRLVQNQFRRRILFSFLAVVIGFLILNGYLRYQTARSDLITEY
                     TLDITYQFPSIFNEMVSSNYIMPLQEGNKSQYYSSSSDDITIVICDNNDNLLWDSMQK
                     GPPSHVENICTDLPKDENKPILIEKPSGAAFISHSMSIESNNDLPPRRVILLSRMEDK
                     ISRLHTLKLQLAIAYTTLILIAIFGVLWGYKRSFFPLNKLHIELKSIKDSEQEKLIYS
                     YPEELEPIAKTINRLLEQQDEQSSKYKKAMDDLAHSLKTRIATCDALLYQKEPPIADI
                     MEQLNDMDSVIQHQLKRALMGSRGISKHHTLLSPIVDKLTKMFTKVHKERHIEFIPNY
                     NDAQTLPINYNDLMEILGNILENSYRFADNYIILSIVERSEGFNIHIENDGEPLPQDK
                     IESVFQRGIRADEKNPGTGIGLAVCEEIISSYNGQIWFHTQDTGSRLEIFLPHQI"
     gene            complement(561383..562063)
                     /locus_tag="VF_RS02675"
                     /old_locus_tag="VF0526"
                     /old_locus_tag="VF_0526"
                     /db_xref="GeneID:54163163"
     CDS             complement(561383..562063)
                     /locus_tag="VF_RS02675"
                     /old_locus_tag="VF0526"
                     /old_locus_tag="VF_0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_011261292.1"
                     /db_xref="GeneID:54163163"
                     /translation="MQIALVEDNEILNHHLSSQLKDQGHVVYSDKTASAFLQTVQKKE
                     HIDVMIVDLGLPDFDGITLIKQIRRKEIHSPILILTARGNWQDKVEGLEAGADDYLVK
                     PFQSEELIARLYALARRAAGFTQSKVTAENIELDIKAKTIHVDGQFLQLTSFEYDIAA
                     YLIKNSLKIISKQQFVDALYQEDSEVQLNNIEVIISRLRKKFAAVGHNELITTVRGQG
                     YQFQIKAK"
     gene            complement(562177..564522)
                     /locus_tag="VF_RS02680"
                     /old_locus_tag="VF0527"
                     /old_locus_tag="VF_0527"
                     /db_xref="GeneID:54163164"
     CDS             complement(562177..564522)
                     /locus_tag="VF_RS02680"
                     /old_locus_tag="VF0527"
                     /old_locus_tag="VF_0527"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilZ domain-containing protein"
                     /protein_id="WP_011261293.1"
                     /db_xref="GeneID:54163164"
                     /translation="MQQEEYQSYVEQLIPVFGEPDFNLVCEQVMSHEHPSVHLIVKIE
                     LKRIMAPCTKHIDLRGRVKGQCHQYELDGYTHWLDDVAINTYHKSIERFGSYTVGVWE
                     ALTNTRNNFRVLHKNKEQLAATDDKDENNLFKAKLIRFGHYLTRSENRLRMSTQVTVL
                     LPNGNLIHGTSSDLSSSGARIKVPTAFEYGLGQIIQVSFPNLAKDTGIKELNGDFPYR
                     ILGIHDSEESDSYRWLRLKMESNHDVIAQAIEEKLNKNKRRTVHDQKDQIVRARTQGY
                     EHCFLKHTTNIPLFFSGDTLKYAVITDHNESLWKHWHDEKNQPVIHHLFKSERMQFLT
                     KPGLRASRTHFYSFKHDHEDKELFYSMMSSEATQQERQLFWHVGAKRKSWKVIRLSLF
                     ELEKGDKERLLTVAPEMEKVLATLTHMGILTELSLPDTQKDYLLTEKPNLEAKVLNPY
                     RHSLTPMAQDPALYYDSTPRRTEPRFNYETLITLTHPTIGEIKGRTQDISTNGLSILL
                     DKPALLTKKSDVKITFNELQSLDKNTPLSRITYRVLKVNSNGLNLQLQIEDSLQTQKS
                     KAFLSRLIQHNIERLPVDYEQLPSIDMLKIMHQLLLNKLTTTPFFIEKDNHKIKTRCI
                     GVNFPLNRLNKIWLQLGNEQHLNLEPIFKSRVQQLLVNPLKTPANQRSHHHEIYIAVV
                     IKDGKIKSVFTRMLQEFSSYNDRLTFIKKAKEHGEFLAIRVTTTAVKNALSTTSEVEL
                     SQLAQYAIHYARALEDELSSIVGCGEIADITDEVLIRLELG"
     gene            564644..566026
                     /gene="radA"
                     /locus_tag="VF_RS02685"
                     /old_locus_tag="VF0528"
                     /old_locus_tag="VF_0528"
                     /db_xref="GeneID:54163165"
     CDS             564644..566026
                     /gene="radA"
                     /locus_tag="VF_RS02685"
                     /old_locus_tag="VF0528"
                     /old_locus_tag="VF_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017035767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_005417762.1"
                     /db_xref="GeneID:54163165"
                     /translation="MAKAKRAYVCNDCGADFPRWQGQCNACGAWNTITEVRLAASPQV
                     ARNERLSGGYAGSTTDSEVQTLSSIDLQEVPRFSSSFKEFDRVLGGGIVPGAAILIGG
                     NPGAGKSTLLLQTMCRLAAEMPTLYVTGEESLQQVAMRASRLGLPKDNLKMLSETNID
                     KICQVAEKEQPKIMVIDSIQVMHVADVQSSPGSVAQVRESATALTRYAKQNNVAIFLV
                     GHVTKDGTLAGPKVLEHIIDCSVLLDGSADSRFRTLRSHKNRFGAVNELGVFAMTGQG
                     LKEVNNPSAIFLSRGEEETSGSSVMVVWEGTRPLLVEIQALVDYSQLSNPRRVSVGLD
                     QNRLSMLLAVLHKHGGLQMADQDVFVNVVGGVKVAETSADLALIMALLSSFKDRPLAK
                     DVVVFGEVGLAGEIRPVPSGQERLMEAYKHGFKKAIVPAANMPKGGIEGMQIHGVKKL
                     SEAIDAFDEL"
     gene            566222..568309
                     /locus_tag="VF_RS02690"
                     /old_locus_tag="VF0529"
                     /old_locus_tag="VF_0529"
                     /db_xref="GeneID:54163166"
     CDS             566222..568309
                     /locus_tag="VF_RS02690"
                     /old_locus_tag="VF0529"
                     /old_locus_tag="VF_0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017040336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011261294.1"
                     /db_xref="GeneID:54163166"
                     /translation="MTDLSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKIGDTHDGS
                     TTTDFMEQEAERGITIQSAAVSCFWNDHRLNVIDTPGHVDFTVEVYRSLKVLDGGIGV
                     FCGSGGVEPQSETNWRYANESEVSRLIFVNKLDRMGADFFSVVDQVKKVLGATPLVMT
                     LPIGREEDFVGVVDVLNRQAFVWDDSGLPENYEIQDIPADMVDDVEAYREELVETAVE
                     QDDDLMEAYMEGQEPSIEELKRCIRKGTRDLAFFPTFCGSAYKNKGIQLILDAVVDYL
                     PAPNEVEPQPLTDKDTGEETGEVATVSADEPFRALAFKIMDDRFGALTFVRIYSGKLN
                     KGDTVLNSATGKTERIGRMVEMQADERNELTSAQAGDIIAIVGMKNVQTGHTLCDVKH
                     ECTLEPMIFPVPVISIAVAPKDKGGSEKMGIAIGKMVAEDPSFQVETDEETGETILKG
                     MGELHLDIKVDILKRTYGVDLVVGQPQVAYRETITQAIEDSYTHKKQSGGSGQFGKID
                     YRIKPGEAGTGFTFSSTVVGGNVPKEFWPAVEKGFASMMETGPLAGFPVLDVEVELFD
                     GGFHAVDSSAIAFEIAAKGAFRQSMPKAGAQLLEPIMKVDVFTPEDHVGDVIGDLNRR
                     RGMIKDQQAGLTGVRIKGDVPLSEMFGYIGTLRTMTSGRGQFSMEFSHYAPCPNSVAE
                     EVIAKAKEEKAAK"
     gene            complement(568375..568605)
                     /locus_tag="VF_RS02695"
                     /old_locus_tag="VF0530"
                     /old_locus_tag="VF_0530"
                     /db_xref="GeneID:54163167"
     CDS             complement(568375..568605)
                     /locus_tag="VF_RS02695"
                     /old_locus_tag="VF0530"
                     /old_locus_tag="VF_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2132 domain-containing protein"
                     /protein_id="WP_005417766.1"
                     /db_xref="GeneID:54163167"
                     /translation="MTQQNNPLHGITLQKLLTELVEHYGWEELSYMVNINCFKKDPSI
                     KSSLKFLRKTDWARERVENIYLKLQRHKERNQ"
     gene            complement(568710..569987)
                     /locus_tag="VF_RS02700"
                     /old_locus_tag="VF0531"
                     /old_locus_tag="VF_0531"
                     /db_xref="GeneID:54163168"
     CDS             complement(568710..569987)
                     /locus_tag="VF_RS02700"
                     /old_locus_tag="VF0531"
                     /old_locus_tag="VF_0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017819865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_005417767.1"
                     /db_xref="GeneID:54163168"
                     /translation="MTNLLIKNVALRDQEGLFQILIEDGQFKTITNNEQALSYSGDIL
                     DAEGGLANAPFCEPHIHLDTTQTAGEPSWNISGTLFEGIERWAERKELLSIEDVKTRA
                     KQTLKWQIANGIQHVRTHVDVSDPTLIALKAMLEVKEEMKEWVDIQIVAFPQEGILSY
                     PNGKELLEEAVQLGADVIGAIPHFEFTREYGVESLHYIFELAKKYDRLIDVHCDEIDD
                     EQSRFVETVAALAHKFNMGEKVTASHTTAMHSYNGAYASRLFRLLRMSGINFVANPLV
                     NIHLQGRFDDYPKRRGITRVKEMLANNINVCFGHDDVFDPWYPLGTANMLQVLHMGLH
                     VCQIMGYDQINQGLDLISYKSARTLNIQDNYGIEEGKPGNLIILPAENGFDALRRQVP
                     VRFSIRHGKVISETQPATTTITLDKAETVSFKR"
     gene            complement(569999..571240)
                     /gene="codB"
                     /locus_tag="VF_RS02705"
                     /old_locus_tag="VF0532"
                     /old_locus_tag="VF_0532"
                     /db_xref="GeneID:54163169"
     CDS             complement(569999..571240)
                     /gene="codB"
                     /locus_tag="VF_RS02705"
                     /old_locus_tag="VF0532"
                     /old_locus_tag="VF_0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine permease"
                     /protein_id="WP_011261296.1"
                     /db_xref="GeneID:54163169"
                     /translation="MSHDNDYSLGPVPKTARKGVVSLTLVMLGLTFFSASMWTGGSLG
                     TGLSFNDFFLAVLIGNLILGIYTSFLGYIGASTGLSTHLLARFSFGSKGSWLPSLLLG
                     GTQVGWFGVGVAMFAIPVQKATGIDTNALIVISGLLMTVTVYFGISALMVLSMVAVPA
                     IAILGGFSVFSAVDSIGGIAELQKIQPAEPMDFSVALAMVVGSFVSAGTLTADFVRFG
                     KKPMGAVAITMIAFFIGNSLMFIFGAAGASVTGQSDISEVMIAQGLLIPAIIVLGLNI
                     WTTNDNALYASGLGFSNITGLPSKYVSMLNGLIGTVCALWLYNNFVGWLTFLSLAIPP
                     IGGVIIADFFSNRKRYMNFDNAAFQTINWAGIIAVAIGVAAGKFLPGVVPVNAVLGGA
                     ISYLLLNPMINKKSISETETV"
     gene            complement(572179..573855)
                     /locus_tag="VF_RS02710"
                     /old_locus_tag="VF0533"
                     /old_locus_tag="VF_0533"
                     /db_xref="GeneID:54163170"
     CDS             complement(572179..573855)
                     /locus_tag="VF_RS02710"
                     /old_locus_tag="VF0533"
                     /old_locus_tag="VF_0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-binding protein"
                     /protein_id="WP_011261297.1"
                     /db_xref="GeneID:54163170"
                     /translation="MNQPFFDHKTNPQLPHEAMLEWAEKKPHDLFLRQIKNREFTDYS
                     FADVVDKALRLVSALQEMGIKPKDRVALISKNCAEWFITDLALMLGDFVSVPIFPTAG
                     LDTIEHCLTHSESKVLIVGKLDNSEATQQAITNLPDILTIAFDYDSAAKCQYQFEVLL
                     TTHNPSSFKAEHNDNTLMSIVYTSGTSGLPKGAMLTFGGFSHASKHLINHIGMQQDDR
                     LFSYLPLAHITERVYILGSAFFGGIQTAFPESLDTFIEDVKMHRPTLFISVPRLWTVF
                     QQRIQDKLPQKKLAILLKIPFVSGLIKRKLADGLGLDKARVLGCGSAPVSASLLKWYE
                     SIGLNITEAWGMTETFAYSTLNHPYRSDKVGSVGAAGPGVELKIADDEEILVRGDSLF
                     AGYYKNDEATAETFNKDGWLHTGDIGSIDSEGFLTIQGRKKDTFKTAKGKFVAPVPIE
                     KHIFDLSNLEMMCLIGSGLPGPILLAVPHAYPNFDQARYERTALKNLETINDGLESHE
                     KLKGILMIKEPWSIENGILTPTLKIKRHVLEKKYHDFASNWPQDKKIIWE"
     gene            complement(574065..576623)
                     /gene="mutS"
                     /locus_tag="VF_RS02715"
                     /old_locus_tag="VF0534"
                     /old_locus_tag="VF_0534"
                     /db_xref="GeneID:54163171"
     CDS             complement(574065..576623)
                     /gene="mutS"
                     /locus_tag="VF_RS02715"
                     /old_locus_tag="VF0534"
                     /old_locus_tag="VF_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019277980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_047863660.1"
                     /db_xref="GeneID:54163171"
                     /translation="MKSTEKHTPMMQQYLRLKSENPDILLFYRMGDFYELFYDDAKRA
                     SQLLEISLTKRGSSAGEPIPMAGIPYHAVEGYLAKLVQQGESVAICEQVGDPATSKGP
                     VERKVVRIVTPGTVTDEALLPERFDNLIAAIYHHKGQFGYATLDITSGRFKVSEPNTE
                     EAMLAELQRTAPTELLFSEDFEPVHLLEKRNGNRRRPVWEFELDTAKQQLNNQFGTRD
                     LVGFGVEKAEFGLCAAGCLIQYVKDTQRTTLPHIRSIIMDHQDDSVILDAATRRNLEI
                     TQNLAGGFNHTLAEILDHTSTAMGSRLLKRWLHQPVRTHDVLNQRLDAIGELKESGLF
                     ADMAPQLKNIGDVERILARLALRSARPRDLARLRNALQQLPELSQTTQEFQQDHLLTL
                     AASAQPIDSICELLERAIKENPPVVIRDGGVLADGYNEELDQWRDLANGATQYLEKLE
                     QEERERHDIDTLKVGYNNVHGFYIQISKGQSHKAPAHYVRRQTLKNAERYIIPELKEH
                     EDKVLNSKSKALAIEKRLWEELFDQLLPHLEQLQSMANAISELDVLSNLAERADTLNY
                     CRPVLTKETGINIEGGRHPVVEQVMSDPFIANPIKLNPDRKMLIITGPNMGGKSTYMR
                     QTALIALMAHVGCYVPADSAEIGTLDRIFTRIGASDDLASGRSTFMVEMTETANILHN
                     ATKHSLVLMDEIGRGTSTYDGLSLAWASAEWLATKINAMTLFATHYFELTELPNLFTG
                     LANVHLDAVEHGDEIAFMHAVQEGAANKSYGLAVASLAGVPKSVIKKAKQKLQHLESG
                     QVPVPATSTTVKEEHQLSLIPEISEVEEALAHVNPDDLTPRQALEELYRLKALL"
     gene            576737..577234
                     /locus_tag="VF_RS02720"
                     /old_locus_tag="VF_2591"
                     /db_xref="GeneID:54163172"
     CDS             576737..577234
                     /locus_tag="VF_RS02720"
                     /old_locus_tag="VF_2591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide-nucleotide amidohydrolase family
                     protein"
                     /protein_id="WP_011261299.1"
                     /db_xref="GeneID:54163172"
                     /translation="MDMTQNIQLAQKVGELLVHQEKMMSCSESCTGGGVAFCATENAG
                     SSAWFDRGFVTYSNEAKQDSLGVKLDTLIRYGAVSEEVVREMADGALLNSKSDITVSI
                     SGIAGPGGATEDKPVGTVCFGFADKNEWSNETTVYFTGDRSEVRMKAIEYAFLTIKNR
                     LEELN"
     gene            577375..578421
                     /gene="recA"
                     /locus_tag="VF_RS02725"
                     /old_locus_tag="VF0535"
                     /old_locus_tag="VF_0535"
                     /db_xref="GeneID:54163173"
     CDS             577375..578421
                     /gene="recA"
                     /locus_tag="VF_RS02725"
                     /old_locus_tag="VF0535"
                     /old_locus_tag="VF_0535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_005417772.1"
                     /db_xref="GeneID:54163173"
                     /translation="MDDNKKKALAAALGQIEKQFGKGSIMKLGDNRTMDVETVSTGSL
                     SLDIALGAGGLPMGRIVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVY
                     AKKLGVNIDELLVSQPDTGEQALEICDALARSGAVDVMVIDSVAALTPKAEIEGEMGD
                     SHMGLQARMLSQAMRKLTGNLKQSNCMAIFINQIRMKIGVMFGNPETTTGGNALKFYA
                     SVRLDIRRTGAVKDGDEVVGNETRIKVVKNKIAAPFKQAETQIMYGQGFNREGELIDL
                     GVKHKLVDKAGAWYSYNGDKIGQGKANASKFMRENTEVAAELDKKLREMLLTPAEEKP
                     ETDAAPEIEENEEF"
     gene            578664..581243
                     /gene="alaS"
                     /locus_tag="VF_RS02730"
                     /old_locus_tag="VF0536"
                     /old_locus_tag="VF_0536"
                     /db_xref="GeneID:54163174"
     CDS             578664..581243
                     /gene="alaS"
                     /locus_tag="VF_RS02730"
                     /old_locus_tag="VF0536"
                     /old_locus_tag="VF_0536"
                     /EC_number="6.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017449169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_011261300.1"
                     /db_xref="GeneID:54163174"
                     /translation="MYMSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGM
                     NQFKDCFLGSEKRNYTRATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDY
                     FKQDAIKYAWEFLTERLELPADRLLVTVYETDDEAFEIWNKEMGIPADRIVRIGDNKG
                     APYASDNFWQMGDTGPCGPCTEIFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFN
                     RHADGTMEPLPKPSVDTGMGIERIAAIMQGVHSNYEIDIFQTLIKEAAKVIGYDDLSN
                     QSLRVVADHIRSCSYLIVDGVMPSNEGRGYVLRRIIRRAVRHGNKLGAKGSYFYKLVG
                     PLAEIMGTAGEELKKQQALVEKVLKIEEENFGRTLERGMAILNEALDNLEGTVLDGET
                     VFKLYDTYGFPADLTNDVARERELTIDEDGFEKAMEEQRQRAREAGQFGTDYNAVIKV
                     ESETVFHGYDSTEAKASVVALFREGEEVDALSAGDDAILILDQTPFYAESGGQCGDAG
                     IITVETGKFVVTDTHKIGNAIGHHGKLVEGVLSKADHAMAQVDETRRAAIILNHSATH
                     LLHAALRQVLGEHVTQKGSLVKAENLRFDFSHLEAVKAEELRQVERIVNQQIRLNHTI
                     ETDLMDIDAAKEKGAMALFGEKYDDEVRVLSMGEFSTELCGGIHASSTGDIGLFKITS
                     EGGIAAGIRRIEAVTGEAALDAIEAQQKAADKKLNEAASKAKQLEKEIQQLKDKLASQ
                     ESASLINKVQEIAGTKVLVAQLDGAENKALRGMVDELKNQIGSGIIMLGNVSEGKVGL
                     IAGVTKDLIGQVKAGELVNMVAQQVGGKGGGRPDMAQAGGTDAEALPNALASVEAWLT
                     ERL"
     gene            581256..582425
                     /locus_tag="VF_RS02735"
                     /old_locus_tag="VF0537"
                     /old_locus_tag="VF_0537"
                     /db_xref="GeneID:54163175"
     CDS             581256..582425
                     /locus_tag="VF_RS02735"
                     /old_locus_tag="VF0537"
                     /old_locus_tag="VF_0537"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="WP_011261301.1"
                     /db_xref="GeneID:54163175"
                     /translation="MALIVQKYGGTSVGSVERIQSVSERIISTLQQGHDVVVAVSAMA
                     GETNRLLHLANQISEVPEPRELDMLLSAGEQVSIALLAMSLNQKGIKAISLTADQAGI
                     HTNNSFNDATIKHIETDLITQWVDKGYVVIVAGFQGRDDQGNITTLGRGGSDTTAVAL
                     AAALDADECQIFTDVDGVYTSDPRFVSNTRRLEEVSFSDMHALAKSGAKVLQEHSVAH
                     AWNSSVALRVLSSFEDGEGTLICENPKQPLAVTGLALKQDLSLVECENISSEEQAELY
                     KQYRVLNERCDCFQIVVPKATFLQLKLAFDTKIRNISSLSILTLVGDNVEGMAESACN
                     QLLANDIDVHQYDIEPKSVSVIVNQADLHRAAEILHKTFVITEQSQDNDLLVAVS"
     gene            582507..582704
                     /gene="csrA"
                     /locus_tag="VF_RS02740"
                     /old_locus_tag="VF0538"
                     /old_locus_tag="VF_0538"
                     /db_xref="GeneID:54163176"
     CDS             582507..582704
                     /gene="csrA"
                     /locus_tag="VF_RS02740"
                     /old_locus_tag="VF0538"
                     /old_locus_tag="VF_0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002537591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator CsrA"
                     /protein_id="WP_005417777.1"
                     /db_xref="GeneID:54163176"
                     /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHR
                     EEIYMRIQAEKGTPAASQGNF"
     gene            582920..583011
                     /locus_tag="VF_RS02745"
                     /old_locus_tag="VF_T0017"
                     /old_locus_tag="VFT0017"
                     /db_xref="GeneID:54163177"
     tRNA            582920..583011
                     /locus_tag="VF_RS02745"
                     /old_locus_tag="VF_T0017"
                     /old_locus_tag="VFT0017"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:582954..582956,aa:Ser,seq:gct)
                     /db_xref="GeneID:54163177"
     gene            583065..583141
                     /locus_tag="VF_RS02750"
                     /old_locus_tag="VF_T0018"
                     /old_locus_tag="VFT0018"
                     /db_xref="GeneID:54163178"
     tRNA            583065..583141
                     /locus_tag="VF_RS02750"
                     /old_locus_tag="VF_T0018"
                     /old_locus_tag="VFT0018"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583099..583101,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163178"
     gene            583181..583272
                     /locus_tag="VF_RS02755"
                     /old_locus_tag="VF_T0019"
                     /old_locus_tag="VFT0019"
                     /db_xref="GeneID:54163179"
     tRNA            583181..583272
                     /locus_tag="VF_RS02755"
                     /old_locus_tag="VF_T0019"
                     /old_locus_tag="VFT0019"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583215..583217,aa:Ser,seq:gct)
                     /db_xref="GeneID:54163179"
     gene            583323..583399
                     /locus_tag="VF_RS02760"
                     /old_locus_tag="VF_T0020"
                     /old_locus_tag="VFT0020"
                     /db_xref="GeneID:54163180"
     tRNA            583323..583399
                     /locus_tag="VF_RS02760"
                     /old_locus_tag="VF_T0020"
                     /old_locus_tag="VFT0020"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583357..583359,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163180"
     gene            583467..583543
                     /locus_tag="VF_RS02765"
                     /old_locus_tag="VF_T0021"
                     /old_locus_tag="VFT0021"
                     /db_xref="GeneID:54163181"
     tRNA            583467..583543
                     /locus_tag="VF_RS02765"
                     /old_locus_tag="VF_T0021"
                     /old_locus_tag="VFT0021"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583501..583503,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163181"
     gene            583611..583687
                     /locus_tag="VF_RS02770"
                     /old_locus_tag="VF_T0022"
                     /old_locus_tag="VFT0022"
                     /db_xref="GeneID:54163182"
     tRNA            583611..583687
                     /locus_tag="VF_RS02770"
                     /old_locus_tag="VF_T0022"
                     /old_locus_tag="VFT0022"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583645..583647,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163182"
     gene            583755..583831
                     /locus_tag="VF_RS02775"
                     /old_locus_tag="VF_T0023"
                     /old_locus_tag="VFT0023"
                     /db_xref="GeneID:54163183"
     tRNA            583755..583831
                     /locus_tag="VF_RS02775"
                     /old_locus_tag="VF_T0023"
                     /old_locus_tag="VFT0023"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:583789..583791,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163183"
     gene            584153..>584263
                     /locus_tag="VF_RS02780"
                     /pseudo
                     /db_xref="GeneID:54163184"
     CDS             584153..>584263
                     /locus_tag="VF_RS02780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417778.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase subunit gamma"
                     /db_xref="GeneID:54163184"
     gene            584378..584454
                     /locus_tag="VF_RS02785"
                     /old_locus_tag="VF_T0024"
                     /old_locus_tag="VFT0024"
                     /db_xref="GeneID:54163185"
     tRNA            584378..584454
                     /locus_tag="VF_RS02785"
                     /old_locus_tag="VF_T0024"
                     /old_locus_tag="VFT0024"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:584412..584414,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163185"
     gene            584519..584595
                     /locus_tag="VF_RS02790"
                     /old_locus_tag="VF_T0025"
                     /old_locus_tag="VFT0025"
                     /db_xref="GeneID:54163186"
     tRNA            584519..584595
                     /locus_tag="VF_RS02790"
                     /old_locus_tag="VF_T0025"
                     /old_locus_tag="VFT0025"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:584553..584555,aa:Arg,seq:acg)
                     /db_xref="GeneID:54163186"
     gene            584919..585170
                     /locus_tag="VF_RS02795"
                     /old_locus_tag="VF_2592"
                     /db_xref="GeneID:54163187"
     CDS             584919..585170
                     /locus_tag="VF_RS02795"
                     /old_locus_tag="VF_2592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxaloacetate decarboxylase subunit gamma"
                     /protein_id="WP_011261302.1"
                     /db_xref="GeneID:54163187"
                     /translation="MTDIGSLLWEAATLMLTGMCVVFAFLTILVYLVQLMSKLLPVEL
                     PPKQALAVQKVQNPDQTTVQPQIIAAISAAIKLHREKNK"
     gene            585207..586994
                     /gene="oadA"
                     /locus_tag="VF_RS02800"
                     /old_locus_tag="VF0539"
                     /old_locus_tag="VF_0539"
                     /db_xref="GeneID:54163188"
     CDS             585207..586994
                     /gene="oadA"
                     /locus_tag="VF_RS02800"
                     /old_locus_tag="VF0539"
                     /old_locus_tag="VF_0539"
                     /EC_number="7.2.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-extruding oxaloacetate decarboxylase
                     subunit alpha"
                     /protein_id="WP_011261303.1"
                     /db_xref="GeneID:54163188"
                     /translation="MSKPLSITDVVLRDAHQSLFATRMRVEDMLPIAEQLDKIGYWSL
                     ETWGGATFDSCIRYLGEDPWERLRLLKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKF
                     VERAHANGMDVFRIFDAMNDVRNFQKAVKATIDVGAHAQGTLSYTTSPVHNTDTWVDL
                     AKRLEDLGCHSLCIKDMSGLLKPYEAEELITRIKASCDVPLALHSHATTGLSTATAIK
                     AVEAGIDILDTAISSMSQTYGHTPTETVVAMLEETGRDTNLKLDQLAPIASYFREVRK
                     KYAKFEGQLKGVDSRILIAQVPGGMLTNMESQLKEQGAADKMDEVLAEIPKVRKDLGY
                     IPLVTPTSQIVGTQAVINVLTGERYKSITKETAGVLKGEYGAAPAEVNAELQARVLDG
                     KEAVTCRPADLLKAELHTLTDELLEKAKEENIELAEQQVDDVLTYALFPQVGLKFLKN
                     RNNPEAFEPAPGTEKEAEKEEVKVSAAKGSVEAYSVKVDGQVYNVEVGPQGVISSVEQ
                     ISAQAAPVQSPQLSAMDAESVDAPLAGNIFKVLVQAGAEVVEGDVLLILEAMKMETEI
                     KASRSGTVQDILTKEGDAVTVGTPLLSLA"
     gene            587010..588140
                     /locus_tag="VF_RS02805"
                     /old_locus_tag="VF0540"
                     /old_locus_tag="VF_0540"
                     /db_xref="GeneID:54163189"
     CDS             587010..588140
                     /locus_tag="VF_RS02805"
                     /old_locus_tag="VF0540"
                     /old_locus_tag="VF_0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017084286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium ion-translocating decarboxylase subunit
                     beta"
                     /protein_id="WP_005417780.1"
                     /db_xref="GeneID:54163189"
                     /translation="MDGLLTLWNETAIANFKFEQLIMMAVGCGLLFLAIKKGFEPLLL
                     LPIGFGAILANIPNAGFTDPGGLLYYVYYVGIETGIFPLLIFMGVGAMTDFGALIANP
                     KTLWLGAAAQVGIFATLFGAILLNYVPGMEFTLADASSIAIIGGADGPTAIFLSSQLS
                     PDLLGAIAVAAYSYMALVPIIQPPIMKALTTPEERQIKMAQLRHVGKAEKILFPLAVL
                     LMTILFLPSATPLVGMFCLGNLMKESGVVDRLSSTAQNELINIVTIFLGLGVGSKLKA
                     DTFLNVETLGILALGAVAFSIGTAGGVIMAKVLNKFSKEDINPLIGAAGVSAVPMAAR
                     VVNKVGLEANPQNFLLMHAMGPNVAGVLGSAVAAGILLALVG"
     gene            588237..588668
                     /locus_tag="VF_RS02810"
                     /old_locus_tag="VF0541"
                     /old_locus_tag="VF_0541"
                     /db_xref="GeneID:54163190"
     CDS             588237..588668
                     /locus_tag="VF_RS02810"
                     /old_locus_tag="VF0541"
                     /old_locus_tag="VF_0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="WP_047863657.1"
                     /db_xref="GeneID:54163190"
                     /translation="MFDWFNADSALWVLFSSGFLSATLLPGASEASLIATLQLNSFST
                     WLVVFVATLGNTLGGITNYWLGLLLPDKTSSQKHGHKAIQWIKKYGYWTLLFSWLPII
                     GDPLCLAAGWLRMRFWPCIFLIGVGKAARYALLSLAVNGIL"
     gene            588678..591530
                     /locus_tag="VF_RS02815"
                     /old_locus_tag="VF0542"
                     /old_locus_tag="VF_0542"
                     /db_xref="GeneID:54163191"
     CDS             588678..591530
                     /locus_tag="VF_RS02815"
                     /old_locus_tag="VF0542"
                     /old_locus_tag="VF_0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insulinase family protein"
                     /protein_id="WP_011261305.1"
                     /db_xref="GeneID:54163191"
                     /translation="MKKILSLSIVLALAGCSKSEFEAPKATDLPKGVTLVEQVLPKEG
                     STVIPYQKYTLDNGLTVILSPDHSDPLVHVDVTYHVGSAREEIGKSGFAHFFEHMMFQ
                     GSENVGDQQHFKIITEAGGTLNGTTNRDRTNYFETVPANQLEKMLWLESDRMGFLIDA
                     VSQKKFEIQRSTVKNERGQNYDNRPYGLIYEKMGEALFPQGHPYSWQTIGYVEDLDRV
                     DVNDLKAFFLRWYGPNNAVITIGGDLDSKQTLEWVNKYFGSIPRGPEVENAPKQPVTL
                     KENRYITLEDRIQQPMVMIGWPTTYRGEETEASLDMLATLLGDGKTSLLYQELVKTGK
                     VVDAGAFHDCAELSCTMYVYAMTDSGKNNDLSTAYKEVMDVLEKFDKEGVSKADLEEV
                     QGSAEAGAIFGLQSVSGKVSQLASNETFYGNPNQLEKQLAELKAVTPEKVSQAFDTYM
                     ANKYKVTLSVVPKGKTQLEVQKPNFVTPKRDLPEYKKIDENSLDVRRAVDDFDRSIMP
                     QPSKGVTAKAPDIYRANLSNGIEVLGTEAVETPTIQLQIAIPAGNRYVPKGKEGLASL
                     TAAMMEEGTTTSSSEELQKKLDKLGSSVSFNSGSYTTTISVASLTKNIDQTLAIVNEM
                     LFEPAFEQADFDRLQKQAVEGLVYEHQRPSWLASQATREILFKGTIFDRSPDGSLTSV
                     QALTLDDVKAFYKQTYTPIGTQIVSVGDINKSDLINKLAFLSDWKGATPEILAPQRLP
                     TLNEQKIYLINKPNAPQSVVRFVRQGMPFDATGELYQTQLANFNLGGNFNSRINQNLR
                     EDKGYTYGAGGYLMGNKEIGMSIFYAQVRADVTVESIKEFISEMNKFKKDGMTVDELN
                     FMRLAVGQQDALKYETPGQKAHLLGKILTYSLDDDFIDEQNELIETLGRDKLNSLAAK
                     WFDPAQYQIVVVGDEKELLPKLKSLGVPVEVMTVKK"
     gene            591662..593227
                     /locus_tag="VF_RS02820"
                     /old_locus_tag="VF0543"
                     /old_locus_tag="VF_0543"
                     /db_xref="GeneID:54163192"
     CDS             591662..593227
                     /locus_tag="VF_RS02820"
                     /old_locus_tag="VF0543"
                     /old_locus_tag="VF_0543"
                     /EC_number="6.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012532880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_011261306.1"
                     /db_xref="GeneID:54163192"
                     /translation="MTEFINRLQKVASNPNAFKKTGRGIERETLRFTLGASLSTKPHP
                     EGVGSALTHKYITTDFAESLLEFITPVSNDVDTVLKQLEDVHHYTVSHMGDEKLWPLS
                     MPCFVTHDDDITLAQYGESNVGKLKTTYREGLKRRYGSVMQVISGVHFNFSFSTEFWD
                     ELFGEQSEDQRKESVSDAYFALIRNYYRFGWLIPYFFGASPALCSSFIQGRETSMDFE
                     SLGKTYYLPYATSLRLSDLGYTNDAQSNLKISLNSVNEYVDGLNKAIRTPSEEFAKIG
                     LKEGDKHIQLNSNVLQIENELYAPIRPKRVTKSGERPSEALERDGVEYIEVRSLDVNP
                     YSPIGVNEDQVRFLDMFLTWTVLSDSAPMNDSEMACWKDNWNKIIEKGRKPGLELKIG
                     CQGERLTQKAWAERVFEDLLVIAKEMDRVNGDDAYQQTHKRLSAMIDDPELTISGRLL
                     AETKAAGGIGVIGCKLAVEHRETHLAHQYRFYTKQELDAEVERSVQAQKEIEANDKLS
                     FSEYLEEYFSYLK"
     gene            593294..593893
                     /locus_tag="VF_RS02825"
                     /old_locus_tag="VF0544"
                     /old_locus_tag="VF_0544"
                     /db_xref="GeneID:54163193"
     CDS             593294..593893
                     /locus_tag="VF_RS02825"
                     /old_locus_tag="VF0544"
                     /old_locus_tag="VF_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_011261307.1"
                     /db_xref="GeneID:54163193"
                     /translation="MKYKLPLAAIALLGLSGCATAPPTKQDNLCDIFREKSGWYDDAK
                     DMTEEYGTPINVAMAIMKQESSFRATVRPPRTKLLGFIPWSRPSSAYGYAQAQDPVWG
                     EYEDETGGGSRSSFDDAIMFIGWYTDGSQKQLGISKWDPYNQYLAYHEGRGGFKRKSY
                     KNKPQLIKIARKVESQAKTYGWQLKQCKAELERQSSWWW"
     gene            593925..594443
                     /gene="luxS"
                     /locus_tag="VF_RS02830"
                     /old_locus_tag="VF0545"
                     /old_locus_tag="VF_0545"
                     /db_xref="GeneID:54163194"
     CDS             593925..594443
                     /gene="luxS"
                     /locus_tag="VF_RS02830"
                     /old_locus_tag="VF0545"
                     /old_locus_tag="VF_0545"
                     /EC_number="4.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteine lyase"
                     /protein_id="WP_011261308.1"
                     /db_xref="GeneID:54163194"
                     /translation="MPLLDSFTVDHTRMEAPAVRVAKTMQTPKGDTITVFDLRFTAPN
                     KDILSEKGIHTLEHLYAGFMRNHLNGSGVEIIDISPMGCRTGFYMSLIGTPAEQAVAD
                     AWVSSMEDVLKVEAQNKIPELNEYQCGTYEMHSLDEAKAIASTVLASGISVNKNDELA
                     LSDSMLKELSNH"
     gene            complement(594535..595809)
                     /locus_tag="VF_RS02835"
                     /old_locus_tag="VF0546"
                     /old_locus_tag="VF_0546"
                     /db_xref="GeneID:54163195"
     CDS             complement(594535..595809)
                     /locus_tag="VF_RS02835"
                     /old_locus_tag="VF0546"
                     /old_locus_tag="VF_0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF21 domain-containing protein"
                     /protein_id="WP_047863658.1"
                     /db_xref="GeneID:54163195"
                     /translation="MDDISTGALFTLLAILIVISGYFSSSETGMMSLNRYRLKHLSNQ
                     GHKGAKRVEKLLSRPDRLIGLILIGNNLVNILASAIATILGMRLYGDLGVAISTGVLT
                     LVILVFAEVTPKTLAAMYPERVSYSSSIVLNVLMKLLSPLVILVNLITNGFLKILGLG
                     SGHDDKDKLSSEELRTVVHEAGGLIPRRHQDMLISILDLEHVTVNDIMVPRSEITGID
                     INDDWKSISRQLTHSPHGRIVLYRDQIDEVVGMLRLRESYRLMLEKNEFTKETLLRAA
                     DEIYFIPEATPLNSQLLKFQRNKERIGLVVDEYGDIQGLITLEDILEEIVGEFTTSMA
                     PSLAEEITPQPDGSFMIEGSANIRDINKGLKWDLPTDGPRTLNGLILEHLEEIPETEI
                     SLEIEQHNMEIVAVEENKINLVKVFPSTEDDK"
     gene            complement(595943..596737)
                     /locus_tag="VF_RS02840"
                     /old_locus_tag="VF0547"
                     /old_locus_tag="VF_0547"
                     /db_xref="GeneID:54163196"
     CDS             complement(595943..596737)
                     /locus_tag="VF_RS02840"
                     /old_locus_tag="VF0547"
                     /old_locus_tag="VF_0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YpjD"
                     /protein_id="WP_011261310.1"
                     /db_xref="GeneID:54163196"
                     /translation="MDTITAIGAALSYFLALGFVIPGLASKNKIQTKVVFVCAFLALL
                     LHAWQLKELILNTAGQNLSILNVASLISFIISLVMSVSMLKFRVWFILPVVYSFSAIN
                     LLAATFLPGAFITHLETHPSLLIHISLALFAYSTLMIATLYALQLAWLDHKLKSKKSL
                     MLNPNLPPLMMVERQLFKIILVGLLLLTLTLMTGFTFIQDMFAQGKAHKAILSFIAWI
                     IYATLTWGHYQRGWRGQKALWFSLSGAFLLTLAYFGSRFVQEIVLT"
     gene            596889..598262
                     /gene="ffh"
                     /locus_tag="VF_RS02845"
                     /old_locus_tag="VF0548"
                     /old_locus_tag="VF_0548"
                     /db_xref="GeneID:54163197"
     CDS             596889..598262
                     /gene="ffh"
                     /locus_tag="VF_RS02845"
                     /old_locus_tag="VF0548"
                     /old_locus_tag="VF_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_011261311.1"
                     /db_xref="GeneID:54163197"
                     /translation="MFDNLTDRLSRTLKNISGKGRLTEDNIKETLREVRMALLEADVA
                     LPVVRDFVKRVKEGAVGVEVSKSLTPGQEFIKIVQAELEAVMGDSNEALNLACQPPAV
                     ILMAGLQGAGKTTSTGKLAKLLKERDKKKVLVVSADVYRPAAIKQLETLAADVDVDFF
                     PSSADQKPIDIVDAAISHAKLKFFDVVIVDTAGRLAVDTEMMDEIKQLHAHVNPIETL
                     FVVDAMTGQDAANTAKAFGDALPLTGVILTKVDGDARGGAALSVRHITGKPVKFLGVG
                     EKTDALEPFHPERIASRILGMGDVLSLIEDLEKNVDKEKAEKLAKKFKEKKGFDLEDF
                     REQLGQMKNMGGMMGMMDKLPGMSQLPSDVKDKVDDKMFNQMEAIINSMTMKERQRPE
                     IIKGSRKKRIAAGSGVQVQDVNRMLKQFTQMQKMMKKMQKGGMKGMMRNMQGMMGGMG
                     GMGGFGR"
     gene            598520..598768
                     /gene="rpsP"
                     /locus_tag="VF_RS02850"
                     /old_locus_tag="VF0549"
                     /old_locus_tag="VF_0549"
                     /db_xref="GeneID:54163198"
     CDS             598520..598768
                     /gene="rpsP"
                     /locus_tag="VF_RS02850"
                     /old_locus_tag="VF0549"
                     /old_locus_tag="VF_0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017023810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_005417799.1"
                     /db_xref="GeneID:54163198"
                     /translation="MVTIRLARHGAKKRPFYQIVVADSRFKATGRYIEKVGFFNPTAQ
                     GQEEGLRLDLDRVGHWVEQGAGLSDRVAKLVKDAKKAA"
     gene            598796..599323
                     /gene="rimM"
                     /locus_tag="VF_RS02855"
                     /old_locus_tag="VF0550"
                     /old_locus_tag="VF_0550"
                     /db_xref="GeneID:54163199"
     CDS             598796..599323
                     /gene="rimM"
                     /locus_tag="VF_RS02855"
                     /old_locus_tag="VF0550"
                     /old_locus_tag="VF_0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimM"
                     /protein_id="WP_011261312.1"
                     /db_xref="GeneID:54163199"
                     /translation="MSKQDEVIVVGKFGASYGIRGWLKVVSFTDQPESIFDYKPWLIQ
                     VKGEWVEFSVESWKRHKGLVCKLKGLDVREEAQTYTNLEIAVKADALPELSEDEFYWR
                     ELFGMEVVTTKGYALGVVDDIFETGSNDVLVVKANLKDAFGKKERLIPFIDEQVIKLI
                     DREAQRIEVDWDPGF"
     gene            599346..600095
                     /gene="trmD"
                     /locus_tag="VF_RS02860"
                     /old_locus_tag="VF0551"
                     /old_locus_tag="VF_0551"
                     /db_xref="GeneID:54163200"
     CDS             599346..600095
                     /gene="trmD"
                     /locus_tag="VF_RS02860"
                     /old_locus_tag="VF0551"
                     /old_locus_tag="VF_0551"
                     /EC_number="2.1.1.228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="WP_005417802.1"
                     /db_xref="GeneID:54163200"
                     /translation="MWVGVISLFPEMFRSVTDFGVTSQAIKKGLLSIETWNPRDFTHD
                     KHRTVDDRPYGGGPGMLMMVQPLRDAITAAREASPGKTKVIYLSPQGRTLNQAGVEEL
                     ATNENLILICGRYEGVDERIIQSEVDEEWSIGDFVLTGGELPAMTLIDSVSRFVPGVL
                     GDFASAEEDSFADGLLDCPHYTRPEVLDGKEVPSVLKSGNHKDIARWRMKQSLGRTWL
                     RRPELLGNLALTDEQELLLAEFVREERQNSK"
     gene            600137..600490
                     /gene="rplS"
                     /locus_tag="VF_RS02865"
                     /old_locus_tag="VF0552"
                     /old_locus_tag="VF_0552"
                     /db_xref="GeneID:54163201"
     CDS             600137..600490
                     /gene="rplS"
                     /locus_tag="VF_RS02865"
                     /old_locus_tag="VF0552"
                     /old_locus_tag="VF_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017054174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_005417803.1"
                     /db_xref="GeneID:54163201"
                     /translation="MSNIIKALEDEQLKQDLPKFAPGDTVVVQVKVKEGDRERLQAFE
                     GVVIAIRNRGLHSAFTVRKISNGEGVERTFQTHSPVVNSIEVKRRGAVRRAKLYYLRE
                     RSGKSARIKEKLAKK"
     gene            600707..601780
                     /locus_tag="VF_RS02870"
                     /old_locus_tag="VF0553"
                     /old_locus_tag="VF_0553"
                     /db_xref="GeneID:54163202"
     CDS             600707..601780
                     /locus_tag="VF_RS02870"
                     /old_locus_tag="VF0553"
                     /old_locus_tag="VF_0553"
                     /EC_number="2.5.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008077190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="WP_011261313.1"
                     /db_xref="GeneID:54163202"
                     /translation="MRKSELSNINIIDEQVLITPQELKNKIPLSENARQFIQQSRQTI
                     SNIIHKKDHRLLIVCGPCSIHDIDAAKEYAKRLKVIAEDLKDQLYIVMRVYFEKPRTT
                     VGWKGLINDPHLDGSFDIEQGLHSARQLLVDLAEMEIPLATEALDPISPQYIGDTFSW
                     AAIGARTTESQTHREMASGLSVPVGFKNGTDGSLSTSINAMQAAASGHRFMGINSEGQ
                     VALLTTQGNPNGHVILRGGKQTNYDSVSVTECEEELANSNLDAALMIDCSHANSRKDY
                     RRQPLVAEDVIHQIREGNKSIIGLMIESHLNEGNQPSDIPLSEMKYGVSITDACINWE
                     STEALLRHTHKELTPILEERLKG"
     gene            601787..602920
                     /gene="tyrA"
                     /locus_tag="VF_RS02875"
                     /old_locus_tag="VF0554"
                     /old_locus_tag="VF_0554"
                     /db_xref="GeneID:54163203"
     CDS             601787..602920
                     /gene="tyrA"
                     /locus_tag="VF_RS02875"
                     /old_locus_tag="VF0554"
                     /old_locus_tag="VF_0554"
                     /EC_number="1.3.1.12"
                     /EC_number="5.4.99.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional chorismate mutase/prephenate
                     dehydrogenase"
                     /protein_id="WP_011261314.1"
                     /db_xref="GeneID:54163203"
                     /translation="MAVELSHLRDQIDAVDKQMLDLLAQRLHLVELVGEVKSAHGLPI
                     YDPSREAAMLASRRSEAEKKGVPPSLIEDILRRTMRESYSSENDSGFKCLKPELRPIV
                     VVGGNGQLGGLFAKMFKLSGYQVRILGSKDWDNSDEILDNAGMVVVTVPINLTIDVIN
                     KLSRLPEDCILCDLTSIKQKPLAAMMEVHKGPVVGLHPMFGPDVPSLAKQVIVMCDGR
                     GKEHYSWLKNQFEIWGAIVRDISANEHDHGMTLIQALRHFTSFAYGQHLAKENPDIEQ
                     LLNLSSPIYRLELLMVGRLFAQDPNLYADIILSSDENIEMIKRFHQRFGDAISLLEEH
                     NRSGFIKNFEEVEAWFGDYAEQFLIESKSLLRQANDSIHRERN"
     gene            complement(602994..604007)
                     /locus_tag="VF_RS02880"
                     /old_locus_tag="VF0555"
                     /old_locus_tag="VF_0555"
                     /db_xref="GeneID:54163204"
     CDS             complement(602994..604007)
                     /locus_tag="VF_RS02880"
                     /old_locus_tag="VF0555"
                     /old_locus_tag="VF_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M23 family metallopeptidase"
                     /protein_id="WP_011261315.1"
                     /db_xref="GeneID:54163204"
                     /translation="MPDKIRISVSHNKGTRLFAISQRRKKLVILSLVLGVSSFALSGF
                     GLHYFYQQQESAKVAIAELQNKNNVLNQLIVDNNNSNHELTQQLEAKENELLVISQRV
                     DDVESVLGLQEISEEDSSLAEKTLEQRLDVAAIDSAVRATMFRLIPNDTPLHYTRESS
                     SFGRRTNPISGKRQRHLGVDLTCKRGTEIYAPADGVVELARASNKGYGNLLKVQHSFG
                     FMTMYAHLQKFKVRSGQFVKKGELIATCGNSGNSTGPHLHYEVRFLGRVLNPRSFMDW
                     TPEKFDSLFEKERSVKWTPLVDVINNVVKLQLKLTQKPTVEQVEAINTAKAENESSQQ
                     LTQ"
     gene            complement(604032..604394)
                     /locus_tag="VF_RS02885"
                     /old_locus_tag="VF0556"
                     /old_locus_tag="VF_0556"
                     /db_xref="GeneID:54163205"
     CDS             complement(604032..604394)
                     /locus_tag="VF_RS02885"
                     /old_locus_tag="VF0556"
                     /old_locus_tag="VF_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilZ domain-containing protein"
                     /protein_id="WP_011261316.1"
                     /db_xref="GeneID:54163205"
                     /translation="MIERRKFSRVIYQADVALIQGAQQYSGSLIDLSLHGLLIKLNDD
                     NALNSAGKLIVHFALNDSDINIIAECEIVNDTNNLLRLCIRHIDIDSISHLKRLVELN
                     VGNSELLLRQLSELTETH"
     gene            complement(604509..606176)
                     /gene="ettA"
                     /locus_tag="VF_RS02890"
                     /old_locus_tag="VF0557"
                     /old_locus_tag="VF_0557"
                     /db_xref="GeneID:54163206"
     CDS             complement(604509..606176)
                     /gene="ettA"
                     /locus_tag="VF_RS02890"
                     /old_locus_tag="VF0557"
                     /old_locus_tag="VF_0557"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017106764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy-dependent translational throttle protein
                     EttA"
                     /protein_id="WP_011261317.1"
                     /db_xref="GeneID:54163206"
                     /translation="MAEYVYTMSRVSKIVPPKRQILKDISLSFFPGAKIGVLGLNGSG
                     KSTLLRIMAGLDTDIDGEARPQAGLNVGYLPQEPVLDESKTVREIVEEAVSDVAGALA
                     RLDAVYAAYAEEGADFDALAKEQGELEALIQAKDGHNLDNALERAADALRLPEWDAKI
                     EHLSGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLEHFLVDYSGTVVAITHD
                     RYFLDNAAGWILELDRGEGIPWEGNYTSWLEQKDDRLKQEAAKENARQKTIEKELEWV
                     RQNPKGRQAKSKARMARFEELQSSDHQKRNETNELFIPPGERLGDKVLEVNNLTKSFG
                     DRVLIDDLSFSMPKGAIVGIIGANGAGKSTLFKMLSGAETPDSGTIELGETVKLASVD
                     QFRDSMDDTKTVFQEISEGADIIKINNFEIPARAYCSRFNFKGNDQQKIIGELSGGER
                     NRVHLAKLLKTGGNVLLLDEPTNDLDVETLRALEEALLEFPGCAMVISHDRWFLDRIA
                     THILDYRDEGQVNFFEGNYTEYSEWLKKTLGAQAAEPHRIKYKRMTK"
     gene            606364..608298
                     /locus_tag="VF_RS02895"
                     /old_locus_tag="VF0558"
                     /old_locus_tag="VF_0558"
                     /db_xref="GeneID:54163207"
     CDS             606364..608298
                     /locus_tag="VF_RS02895"
                     /old_locus_tag="VF0558"
                     /old_locus_tag="VF_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase SLT domain-containing protein"
                     /protein_id="WP_011261318.1"
                     /db_xref="GeneID:54163207"
                     /translation="MKYTQYKLGMMTALCIGMNVQVVDASPVDTWRAQYQEAKTLLNE
                     KKYDEYKKVRAELDGYSLAPYLDYRELRMDLSSKTPDDIRLFKHNHQSLPIGNSLSYQ
                     YLVILGLNERWAEFIDYFPNEPSSKNLQCYYYQAKNKLGDKATAWKGAEQLWLTGSSV
                     TYECDDLFQDWAEAGKLSDDLIIERMLLVYKARNNNLFSYLEKMLKADAAKEKAQHIV
                     TLFNDPDLLESFSKSNKKTEFSKQLTLISMEREARKNPKKAIEILPDIAKKQLFTQEE
                     LVQVKRRIVSSIMSTESAELAQWRDKELAANPEDSFIERRIRVAIRAADWDDVSNWIE
                     YLTPTAKNSLRWQFWTAQIESKEGEQDKADARLKKLLGQRNFYSVAAANILGEPIQYP
                     MNTAPRNIKPIKDKYSVELARIKELIAIDEIPTAKSEWEYLLNRASKTEVKELASYAA
                     QHRWHHFTVLATIKGRMWGYLSLRFPIAHQWWFNHYSKELGLDKVTLMSLSRQESALY
                     AEAQSPVGARGLMQIMPATAKYTAKKIDYDKYEGVDSLNDVDVNIHIGSNYLKGLLDD
                     YDGNRIFALAGYNAGPHRVKRWRAVSDEKLDAYAFIEAIPFKETRGYVQNILMFETYY
                     RSLLGEKGAFLSEKELNLKY"
     gene            608394..608720
                     /gene="trpR"
                     /locus_tag="VF_RS02900"
                     /old_locus_tag="VF0559"
                     /old_locus_tag="VF_0559"
                     /db_xref="GeneID:54163208"
     CDS             608394..608720
                     /gene="trpR"
                     /locus_tag="VF_RS02900"
                     /old_locus_tag="VF0559"
                     /old_locus_tag="VF_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trp operon repressor"
                     /protein_id="WP_011261319.1"
                     /db_xref="GeneID:54163208"
                     /translation="MSGSAKYSDWSQVMTLIANAAEQGNHQPLLTMLMTPDEREALVA
                     RVNIFHELLQGELSQRQISQLLGVGVATITRGSNELKSHTDEEKVWLMDLLEKSTKSE
                     LDVEKE"
     gene            complement(608689..609201)
                     /gene="yjjX"
                     /locus_tag="VF_RS02905"
                     /old_locus_tag="VF0560"
                     /old_locus_tag="VF_0560"
                     /db_xref="GeneID:54163209"
     CDS             complement(608689..609201)
                     /gene="yjjX"
                     /locus_tag="VF_RS02905"
                     /old_locus_tag="VF0560"
                     /old_locus_tag="VF_0560"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine/xanthosine triphosphatase"
                     /protein_id="WP_011261320.1"
                     /db_xref="GeneID:54163209"
                     /translation="MKVIIASQNPAKIAAVESAFNLAFPNDTFSFEGVSVKSGVPDQP
                     MSCEETKQGAMNRINNAKIKLPNCDYYVGLEAGIEGNSTFAWMIIDNGLTVGESRSSS
                     LPLPPQVIDEVKKGKELGDVMDEQFNTDNIKQKGGAIGLLTNNLLTRTSVYQQALILA
                     LIPFLHPTRF"
     gene            complement(609224..610402)
                     /gene="pheA"
                     /locus_tag="VF_RS02910"
                     /old_locus_tag="VF0561"
                     /old_locus_tag="VF_0561"
                     /db_xref="GeneID:54163210"
     CDS             complement(609224..610402)
                     /gene="pheA"
                     /locus_tag="VF_RS02910"
                     /old_locus_tag="VF0561"
                     /old_locus_tag="VF_0561"
                     /EC_number="4.2.1.51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="WP_005417818.1"
                     /db_xref="GeneID:54163210"
                     /translation="MTDTHYSLDDIRLRLNELDNELLKLFSERRKLSLDVAKSKVKTA
                     KPVRDPKREQQLLVKLIENGKDFDLDAYYITQLFHTIIEDSVLLQQEYFQNLANPDLS
                     RKPVARVAYLGSKGSYSNLASRRYFSKKNIELAELGCENFKEVIKTVESGHADYGVLP
                     IENTSSGSINQVYDLLQHTSLYIVGELTQKIDHCLLTTTETSLESIKTLYSHPQPHEQ
                     CSEFLNRLNNVELISCASTADAMITVKELNSPEVAAIGNSDSGKLYGLQSLITNISNQ
                     TENQTRFIVVARKPVDVSEQIPAKTTLIMSTAQDAGSLVESLLVLQKYGINMSKLESR
                     PIMGNPWEEMFYVDLEAHLKSDAMTSAIEELTAITRYLKVLGCYPIENVEPTAIPLSN
                     "
     gene            complement(610517..610870)
                     /gene="raiA"
                     /locus_tag="VF_RS02915"
                     /old_locus_tag="VF0562"
                     /old_locus_tag="VF_0562"
                     /db_xref="GeneID:54163211"
     CDS             complement(610517..610870)
                     /gene="raiA"
                     /locus_tag="VF_RS02915"
                     /old_locus_tag="VF0562"
                     /old_locus_tag="VF_0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated translation inhibitor RaiA"
                     /protein_id="WP_005417819.1"
                     /db_xref="GeneID:54163211"
                     /translation="MKVEITGNNIDITPGIRERIEGKFKKLEAKRNLDIIGRHASVTK
                     RANGKHKVEAYATIAGGKVVASAEQEDLFGAIREMYQKLERQLDKLQHKGEARRATHA
                     QAPGVEEPEVELEEE"
     gene            complement(611309..612034)
                     /gene="bamD"
                     /locus_tag="VF_RS02920"
                     /old_locus_tag="VF0563"
                     /old_locus_tag="VF_0563"
                     /db_xref="GeneID:54163212"
     CDS             complement(611309..612034)
                     /gene="bamD"
                     /locus_tag="VF_RS02920"
                     /old_locus_tag="VF0563"
                     /old_locus_tag="VF_0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004410322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="WP_005417820.1"
                     /db_xref="GeneID:54163212"
                     /translation="MKRLTISSLLAVSLLVGCSSSDDVIPDIPPSELYAQAQVSLQAG
                     NWTSAIERLEALDSRYPFGAYSEQVQLDLIYVYYKNDDLALGLATIERFTRLNPTHPK
                     ADWVLYMRGLTHMAQDRSFMHDLFRVDRSDRDPEPARSAFKDFKRLLERYPNSLYAED
                     AQTRMYALKNRLADYELATADFYLRREAWISAINRCQELQRTYPDTEAARKSLTIMLS
                     AYKELKLEDAIKRTEELIALNPQ"
     gene            612196..613170
                     /gene="rluD"
                     /locus_tag="VF_RS02925"
                     /old_locus_tag="VF0564"
                     /old_locus_tag="VF_0564"
                     /db_xref="GeneID:54163213"
     CDS             612196..613170
                     /gene="rluD"
                     /locus_tag="VF_RS02925"
                     /old_locus_tag="VF0564"
                     /old_locus_tag="VF_0564"
                     /EC_number="5.4.99.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine(1911/1915/1917) synthase
                     RluD"
                     /protein_id="WP_005417821.1"
                     /db_xref="GeneID:54163213"
                     /translation="MAQQIELTSTVKESQLGQRLDQAAAELFSDFSRSRIKEWLLAGN
                     MTVNGEVVTKARLKVMGGEEITVKAELEDEERWLAQDIPLDIVYEDDDLLVINKPRDF
                     VVHPGAGTPDGTVLNALLFHYPNIAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVR
                     ALQKRKITREYEAVVVGRMTAGGMIEKPIGRHPNKRTLMAVHELGKDAVTHYRVAEHF
                     RIHTRIRLRLETGRTHQIRVHMSYLQHPLVGDTAYGGRARIPKGASQELIDMIRGFDR
                     QALHAAMLRFEHPITGETMEFHAPIPDDMIALSQALRDDERLMHEEEY"
     gene            613173..613907
                     /gene="pgeF"
                     /locus_tag="VF_RS02930"
                     /old_locus_tag="VF0565"
                     /old_locus_tag="VF_0565"
                     /db_xref="GeneID:54163214"
     CDS             613173..613907
                     /gene="pgeF"
                     /locus_tag="VF_RS02930"
                     /old_locus_tag="VF0565"
                     /old_locus_tag="VF_0565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017020354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan editing factor PgeF"
                     /protein_id="WP_011261321.1"
                     /db_xref="GeneID:54163214"
                     /translation="MSLISPKWSAPKSVKVFSTTRIGGVSSSPFDSFNLGDHVGDDHK
                     DVVLNREKLITLGQLPTAPTWLNQIHSTRVVHLPNQDFFETPPSADAVYTNQAKQVCC
                     VMTADCLPVVICNKEGTEVAAAHAGWRGLLDGVLENTVEQFASHDLIAWCGPAIGEKA
                     FEVGNEVKELFCEKDPQAINAFIPSSNEGKWLANLAMLATQRLNSVGINDVHYSNLCT
                     YQNTDTFFSYRKEGITGRQATLIWFE"
     gene            614013..616598
                     /gene="clpB"
                     /locus_tag="VF_RS02935"
                     /old_locus_tag="VF0566"
                     /old_locus_tag="VF_0566"
                     /db_xref="GeneID:54163215"
     CDS             614013..616598
                     /gene="clpB"
                     /locus_tag="VF_RS02935"
                     /old_locus_tag="VF0566"
                     /old_locus_tag="VF_0566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent chaperone ClpB"
                     /protein_id="WP_011261322.1"
                     /db_xref="GeneID:54163215"
                     /translation="MRLDRFTSKFQMAISDAQSLALGQDHQYIEPTHLMVALLNQDGS
                     TIRPLLTLLNVDVTQLRSKLTEILDKTPKVTGIGGDVQLSSNMGVIFNLCDKVAQKRK
                     DAYISSEIFMLAAIEDKGPLGNLLRELGLTEPKISKSIDEIRGGEKVNDQNAEEKRQA
                     LEKFTVDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGQPGVGKTAIVEG
                     LAQRIINGEVPEGLKNKRVLSLDIGALVAGAKFRGEFEERLKAVLNELAKEEGSVILF
                     IDEVHTMVGAGKGEGSMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDPALERRFQ
                     KVLVDEPTVEDTVAILRGLKERYEIHHHVEITDPAIVAAASLSHRYISDRQLPDKAID
                     LIDEAASSIRMEIDSKPESLDKLDRKIIQLKIEQQALVKESDDASLKRLDSLNLELMQ
                     KEREYAELEEVWKAEKAALSGTQHIKTELETARSNMEIARRAGDLNRMSELQYGRIPE
                     LEKQLDLAAQAEMQEMSLLKNKVTDAEIAEVLSRQTGIPVNKMLEGERDKLLKMEEVL
                     HHRVIGQAEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKSLANFMFD
                     SEDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVLLLDEVEKA
                     HPDVFNILLQVLDDGRLTDGQGRTVDFKNTVIIMTSNLGSEKIQQHFGELNYAGIKEV
                     VMDVVSQHFRPEFLNRVDETVVFHPLAQEHIKNIASIQLQRLEKRLNEKDYQLQVTDE
                     ALNLIAEAGFDPVYGARPLKRAIQTYIENPLAQDILSGKLRVGEVIKLKVKNEQLIAT
                     QNDDF"
     gene            617037..618600
                     /locus_tag="VF_RS02940"
                     /old_locus_tag="VF_R0007"
                     /old_locus_tag="VFR0007"
                     /db_xref="GeneID:54163216"
     rRNA            617037..618600
                     /locus_tag="VF_RS02940"
                     /old_locus_tag="VF_R0007"
                     /old_locus_tag="VFR0007"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:54163216"
     gene            618944..621859
                     /locus_tag="VF_RS02945"
                     /old_locus_tag="VF_R0008"
                     /old_locus_tag="VFR0008"
                     /db_xref="GeneID:54163217"
     rRNA            618944..621859
                     /locus_tag="VF_RS02945"
                     /old_locus_tag="VF_R0008"
                     /old_locus_tag="VFR0008"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:54163217"
     gene            621937..622052
                     /gene="rrf"
                     /locus_tag="VF_RS02950"
                     /old_locus_tag="VF_R0009"
                     /old_locus_tag="VFR0009"
                     /db_xref="GeneID:54163218"
     rRNA            621937..622052
                     /gene="rrf"
                     /locus_tag="VF_RS02950"
                     /old_locus_tag="VF_R0009"
                     /old_locus_tag="VFR0009"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:54163218"
     gene            622134..622210
                     /locus_tag="VF_RS02955"
                     /old_locus_tag="VF_T0026"
                     /old_locus_tag="VFT0026"
                     /db_xref="GeneID:54163219"
     tRNA            622134..622210
                     /locus_tag="VF_RS02955"
                     /old_locus_tag="VF_T0026"
                     /old_locus_tag="VFT0026"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:622168..622170,aa:Asp,seq:gtc)
                     /db_xref="GeneID:54163219"
     gene            622247..622323
                     /locus_tag="VF_RS02960"
                     /old_locus_tag="VF_T0027"
                     /old_locus_tag="VFT0027"
                     /db_xref="GeneID:54163220"
     tRNA            622247..622323
                     /locus_tag="VF_RS02960"
                     /old_locus_tag="VF_T0027"
                     /old_locus_tag="VFT0027"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:622281..622283,aa:Trp,seq:cca)
                     /db_xref="GeneID:54163220"
     gene            complement(622707..623114)
                     /locus_tag="VF_RS02965"
                     /old_locus_tag="VF0568"
                     /old_locus_tag="VF_0568"
                     /db_xref="GeneID:54163221"
     CDS             complement(622707..623114)
                     /locus_tag="VF_RS02965"
                     /old_locus_tag="VF0568"
                     /old_locus_tag="VF_0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011261323.1"
                     /db_xref="GeneID:54163221"
                     /translation="MISRQKGFNLLEIMISFTIIGIGALGLLKLQTFIELKSEYATRS
                     IEALYNAEAQLEKFRSRSTSGAGGTITYDSITTSSDEVTINGITYTLTWNVDSIISAS
                     AKHITISSAWDTRYGNQEFITLETIISKYNEFD"
     gene            complement(623104..624411)
                     /locus_tag="VF_RS02970"
                     /old_locus_tag="VF0569"
                     /old_locus_tag="VF_0569"
                     /db_xref="GeneID:54163222"
     CDS             complement(623104..624411)
                     /locus_tag="VF_RS02970"
                     /old_locus_tag="VF0569"
                     /old_locus_tag="VF_0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011261324.1"
                     /db_xref="GeneID:54163222"
                     /translation="MKTKSEKGAVVLIMTSLLILAALILSLGTYKSTFYQIKRAQNEV
                     LAKQGHWRAEGAIECLLSNLITKNISPILTSTPSECDIYAQPIESFKVELNDKIYTAE
                     TTSSNQTIQKSFIANSSIGNGSIQTVGDLKFIGTVAIRPDALNEKVSGNNYKCVSVAF
                     SNSITFKHNSTHGSSSRTNGLEVSDPMPNGPFDGFNGNCHSDYKTIISKTTNGSDTIE
                     TINAHDILPGESNPLPFKNDFVPDLNLDPFYNLFNLPKNTENILKVSQNTEEFVYKKI
                     TSATSCSQEINNHFTGTNKNKGLWLHGHCYINSPLDLQSNDSQILVIQDGAFALFGAM
                     NFKGTTYHIVDMSNSIVANNISNYWNKSHGSTASSALSEFVEPTTTSIMFYSSAPKGG
                     VIYDVSGGISTIVGDISLEFHAESNPYFQDGKYQWKKGSWNDL"
     gene            complement(624411..625031)
                     /locus_tag="VF_RS02975"
                     /old_locus_tag="VF0570"
                     /old_locus_tag="VF_0570"
                     /db_xref="GeneID:54163223"
     CDS             complement(624411..625031)
                     /locus_tag="VF_RS02975"
                     /old_locus_tag="VF0570"
                     /old_locus_tag="VF_0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047863691.1"
                     /db_xref="GeneID:54163223"
                     /translation="MAITPVHKYKQKGASLIELLIASFIGIIAISLVGSIFINGQRVA
                     KERGLELLLTQNLTSTMQIIKEDIQRAGYDGADGQSIKLSGAVNIIEITSDSIGFAYH
                     RKMSGAQKTYQNIVYKYSSIDKKLKVCEEKTLITQRKEIADVGDCNSLFDSQNIHVTA
                     FSIVSTPLITSAAMSSIIDVRLDAKLVNIPTMTKSLSFRAKQRNWQ"
     gene            complement(625009..625524)
                     /locus_tag="VF_RS02980"
                     /old_locus_tag="VF0571"
                     /old_locus_tag="VF_0571"
                     /db_xref="GeneID:54163224"
     CDS             complement(625009..625524)
                     /locus_tag="VF_RS02980"
                     /old_locus_tag="VF0571"
                     /old_locus_tag="VF_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011261326.1"
                     /db_xref="GeneID:54163224"
                     /translation="MNRGFTLLELLITVTVLAILLSVAAPNFNTINNSVKMERLATEL
                     NGFLIQAKSEAVLKNKDLWVHISFPKTEENKVGSWSLVLRDSSALSGNMIAYLDGSNF
                     KGITLKHTYTYQKTKFEGIRGRPAPGSFTFHPNTDTTKTLKVFLSNPPGRIKICYDNT
                     SGTLYGYNSCS"
     gene            625622..626059
                     /locus_tag="VF_RS02985"
                     /old_locus_tag="VF0572"
                     /old_locus_tag="VF_0572"
                     /db_xref="GeneID:54163225"
     CDS             625622..626059
                     /locus_tag="VF_RS02985"
                     /old_locus_tag="VF0572"
                     /old_locus_tag="VF_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011261327.1"
                     /db_xref="GeneID:54163225"
                     /translation="MEMILINKCNSKYNHTRGMTLIELMIAIAVIGLLSAIAYPAYTN
                     HILKANRIAVLADIAKIQLEIEEKYINSYSSIASSIISGGTCSFCDTQLDKYTLSFED
                     LTATTYTIKAVPKNEQQNDTCAGNSYNEITLNQFNVASPSECW"
     gene            complement(626108..627259)
                     /gene="chrA"
                     /locus_tag="VF_RS02990"
                     /old_locus_tag="VF0573"
                     /old_locus_tag="VF_0573"
                     /db_xref="GeneID:54163226"
     CDS             complement(626108..627259)
                     /gene="chrA"
                     /locus_tag="VF_RS02990"
                     /old_locus_tag="VF0573"
                     /old_locus_tag="VF_0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005594137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate efflux transporter"
                     /protein_id="WP_011261328.1"
                     /db_xref="GeneID:54163226"
                     /translation="MFEIFKRFFLLGWVSFGGPAAHIGYFRNEFVQKRGWISEEEYAQ
                     LIALSQFLPGPGSSQVGFALGYHRKGLLGALLASISFTLPSILIMVLLANISHSFFGN
                     DVFEGVIHGLKLLAVVVVADAIMGMYKSFCKDKLTVFLCIMTATLLLILPSITTQLLA
                     LFIAALIGRFYLKSDDKEQIEQDSKGINWLPLIIFALCFFVLPTVVSYSPLLGLFSDF
                     FQAGSLVFGGGHVVLPLLQNIVGDQVSTDSFLTGYAAAQAVPGPMFTFATFLGYELWS
                     EQPVLGAIIATVAIFLPGFLLVLGVFNHWQVLAKKPALSGAIIGINAAVVGLLISALY
                     DPVFTSAVNSGLDMALVLIGFALLKVAKLPIVGLVSFFIIAGGVLAFVA"
     gene            627309..628301
                     /locus_tag="VF_RS02995"
                     /old_locus_tag="VF0574"
                     /old_locus_tag="VF_0574"
                     /db_xref="GeneID:54163227"
     CDS             627309..628301
                     /locus_tag="VF_RS02995"
                     /old_locus_tag="VF0574"
                     /old_locus_tag="VF_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011261329.1"
                     /db_xref="GeneID:54163227"
                     /translation="MSSRLRVTIKLFKSIVLLLTMNEINWKAVDLNLLVAFSTLMETK
                     SVSLAANKLFVGQSAMSHSLSRLRELLHDPLFERQGHQMIPTAKAIQLYPLVNKVLQT
                     ISGDILKVDTFEASEFTGTFKIGMTDYAELLFAADIFDAIHQLAPNAQLCFTTVDKAN
                     YQDRFDSEPLDLVIGSMKPELKEFQYQTLYTEKHVCMWDGQRHLFSSPITLDDYISLP
                     HALVSPDGALKTGVDKELKALGVGRSVSVASKHFLTIRHLMKKRDLICVVPELMAQLD
                     LFSEKLVHSEPPINVGEFDIQLIWQTRNKENKRYQWLKELLIQTIEKSVAVYRA"
     gene            complement(628320..628508)
                     /locus_tag="VF_RS03000"
                     /old_locus_tag="VF0575"
                     /old_locus_tag="VF_0575"
                     /db_xref="GeneID:54163228"
     CDS             complement(628320..628508)
                     /locus_tag="VF_RS03000"
                     /old_locus_tag="VF0575"
                     /old_locus_tag="VF_0575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqaE/Pmp3 family membrane protein"
                     /protein_id="WP_005417846.1"
                     /db_xref="GeneID:54163228"
                     /translation="MRLLLALLLPWLQFFTIGRPFSGIICLILQITLIGWIPAAIWSV
                     YALSQYKTDEKIKDAFGR"
     gene            complement(628625..629656)
                     /gene="dapD"
                     /locus_tag="VF_RS03005"
                     /old_locus_tag="VF0576"
                     /old_locus_tag="VF_0576"
                     /db_xref="GeneID:54163229"
     CDS             complement(628625..629656)
                     /gene="dapD"
                     /locus_tag="VF_RS03005"
                     /old_locus_tag="VF0576"
                     /old_locus_tag="VF_0576"
                     /EC_number="2.3.1.117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019274127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="WP_011261330.1"
                     /db_xref="GeneID:54163229"
                     /translation="MAHFALAFGTATKNRDNKIIEAFFPHPVLNPSDALVSAIAQASG
                     YAEGNQAIEISSEVCTELANAFAASGDVANAAFAEKAVQSKQPLVLVVLATDEQPQSV
                     AEGFLKLQLISNRLVKPHGTVLDGIFGLLHNIAWTNQGPIDLPELADRQIEARLAGET
                     LTVDCVDKFPKMVDYVVPTGVRIADTSRVRLGAHVGEGTTVMHEGFINFNAGTTGVSM
                     VEGRISAGVVVGNGSDIGGGASIMGTLSGGGKMVISIGENCLLGANAGLGFPMGDRCT
                     IESGLYVTAGTKVSMLDNQGKEVEIAKARDLAGKTDLLFRRNSITGQIECLTNKSAVE
                     LNSELHSNN"
     gene            complement(629874..630164)
                     /locus_tag="VF_RS03010"
                     /old_locus_tag="VF0577"
                     /old_locus_tag="VF_0577"
                     /db_xref="GeneID:54163230"
     CDS             complement(629874..630164)
                     /locus_tag="VF_RS03010"
                     /old_locus_tag="VF0577"
                     /old_locus_tag="VF_0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YebG family protein"
                     /protein_id="WP_005417850.1"
                     /db_xref="GeneID:54163230"
                     /translation="MAVIVKYVVERNGEEKMTFTSKSEADAYDKMLDIADELFTFLGE
                     SELIEDEAKQEEMSLYLAKHKEDLLIALGAKRKPAPKKAKIKAVQDEESDAA"
     gene            630355..630990
                     /locus_tag="VF_RS03015"
                     /old_locus_tag="VF0578"
                     /old_locus_tag="VF_0578"
                     /db_xref="GeneID:54163231"
     CDS             630355..630990
                     /locus_tag="VF_RS03015"
                     /old_locus_tag="VF0578"
                     /old_locus_tag="VF_0578"
                     /EC_number="1.-.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidase"
                     /protein_id="WP_011261331.1"
                     /db_xref="GeneID:54163231"
                     /translation="MSNFELKHKATNKISEKIAYKITQCLKFLLNIFYGSKYAKRAVI
                     LETIAAVPGMVAGMFNHLKALRRMKDDQGWIQELLSEAENERMHLMIFLDIAKPRWIE
                     RLLVLLGQAVFIVVYSFIYLLSSKIAHRVVGYFEEEACKSYTEYLAKIDEGTVENEAA
                     PQIAIDYYQLPSDAMLRDVILKIRNDEAKHRDRNHSFADAYETHDLPAHQR"
     gene            complement(631019..631897)
                     /locus_tag="VF_RS03020"
                     /old_locus_tag="VF0579"
                     /old_locus_tag="VF_0579"
                     /db_xref="GeneID:54163232"
     CDS             complement(631019..631897)
                     /locus_tag="VF_RS03020"
                     /old_locus_tag="VF0579"
                     /old_locus_tag="VF_0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_011261332.1"
                     /db_xref="GeneID:54163232"
                     /translation="MRISLKQLNVFTVIAQEKTMTKAAERLYITKPAVSLSLSELEKN
                     LGYKVFDRVNNRLVLNSEGRQLLPLADELLERAEVIEHQFATDSQLTGSLNIGASDTI
                     GNHIAPVLLSKFQQQYPCDIQQLFISNTAQIINRLLEFQLDIGLVEGKAHHPKLNMIE
                     WRRDDMYLVCSPSHPLATKAQVTLDDLEHSTWLLREEGSGSREYFINHIAANLNDWHE
                     SLQLHTTEAIINCCAENMGLACLSQLAAQNAINDGRLVKLAYNKTLARQYWLLVHKEK
                     YQTPLLQYFMNFIQQK"
     gene            632033..633022
                     /locus_tag="VF_RS03025"
                     /old_locus_tag="VF0580"
                     /old_locus_tag="VF_0580"
                     /db_xref="GeneID:54163233"
     CDS             632033..633022
                     /locus_tag="VF_RS03025"
                     /old_locus_tag="VF0580"
                     /old_locus_tag="VF_0580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TDT family transporter"
                     /protein_id="WP_011261333.1"
                     /db_xref="GeneID:54163233"
                     /translation="MLNYTKQKIAGAPTPMAGLALGIASLGWCWENALPLNGYAQWIS
                     AAIASVLLLVLAVKFLLHPAVLWNELAHPVVGSVAPTFAMGTMVVSASIGHFYRAAGD
                     ALWLAAVAIHVIFLISFIYHRAKDFELHHMVPSWFVPPVGLIVADVSFSGSASLTSVA
                     HWVLMFGLVSYAIMLPIMIYRLIFSHEVPDAAKPTIAIMAAPASLSLAGYLTVTASPS
                     PVIIALLFGIAVLMTSVIYMAFFKLMRLPFSPGYAAFTFPMVIGATALFKTANWMLSQ
                     GVAANYVYQVRMLAVVELVIATCVVSYVAIHYLAHYRPITRMTNRLANMSHAH"
     gene            633104..636523
                     /gene="recC"
                     /locus_tag="VF_RS03030"
                     /old_locus_tag="VF0581"
                     /old_locus_tag="VF_0581"
                     /db_xref="GeneID:54163234"
     CDS             633104..636523
                     /gene="recC"
                     /locus_tag="VF_RS03030"
                     /old_locus_tag="VF0581"
                     /old_locus_tag="VF_0581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit gamma"
                     /protein_id="WP_011261334.1"
                     /db_xref="GeneID:54163234"
                     /translation="MFTVYHSNQLDVLKSLVVELIRLNPLDNPFEQEQILVQSPGMSQ
                     WLKIELAKELGIAANLTFPLPATFIWDLFTQVLDDVPKRSAFHKEAMTWKIVTLLPEL
                     LKQEEFAPLQRYLENDKNQLKCYQLAAKIADIFDQYLVFRPEWIQQWEAGEEVVELEG
                     EHPWQPTLWRALYDQTLALGHSPYHRANMFEHFIETLDNYLQTGTLSKGMPKRLFVVG
                     ITSLPPRYLDALAALGQHIDVHLMFTNPCRYYWGEIRDRKYLARLEARNRLQVKWLDD
                     HSEHIGDTEQLKGSIEANFEDELHTSEVGNSLLASWGKLGRDNLCLLSEMEAQEIDAF
                     VDVGNDNLLHSIQSDILNLEERSRDDVLDNSQHKQPISSDDRSILLHSCHSPMREVEV
                     LHDQLLDMFASDPDLKPRDIIVMVADINVYSAAIQAVFGNAAFDRYIPFAISDQSAEQ
                     ENPVLLAFMTLMALPENRCGLSELLTLLEVPAVMSRFKFNAEQFEIVKRWAEETGIRW
                     GLDNSTSAQFDLPEHNQNSWLFGIQRMLLGYAMEQGAGLFEGMASYEQVQGMNAEIAG
                     NLAQFIDQLLTYQIILGQPHAITKWRTTINQLMDDFLDVELEGELVVKSIRDQLQKLE
                     ENLEDAGFDAPISAPIINNYLKNNLSGGKASQRFLAGQVNFCTLMPMRSIPFDVVCLL
                     GMTDGSYPRTMPVEGFDLMQKRMKPGDRSRRDDDRYLFLEALQSANKAFYLSYIGRSI
                     RDNTEKAPSVLVSELLEYCQQGYCLEGDNELNPEASAKRLVKQLTIEHPLVPYSQQSF
                     IGDNISYASEWLPTAKLEGAAAPEFQTAPLVYAPETKELELTELQRFWRLPVAYFFNR
                     GLKVFFESVESRVEDDEPFTIDGRTGYGMKSDLLEDLLAYDDPNHVSQISRDFYQQQK
                     AQGKLPIGSFGEITADKEVNTVKDLVAHIQPLTTLPLDDQEVRLRFAFPHGEMELQGW
                     LKQRYQAGMLRYRGGKIRSHEILATWIDHLCLCAMGQQQLTHLFGTDAIYHFGTIEKE
                     KAYQELETILSLYISGNCAPLAYLPKAALAGLEAHVDKKGVWNDDEETHQKALKKMAD
                     EYNGTRFAGENSNDYVIRMWPEWNDEFGQVIFDNAQKVLRNALLHSEKEKL"
     gene            636815..640441
                     /gene="recB"
                     /locus_tag="VF_RS03035"
                     /old_locus_tag="VF0582"
                     /old_locus_tag="VF_0582"
                     /db_xref="GeneID:54163235"
     CDS             636815..640441
                     /gene="recB"
                     /locus_tag="VF_RS03035"
                     /old_locus_tag="VF0582"
                     /old_locus_tag="VF_0582"
                     /EC_number="3.1.11.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit beta"
                     /protein_id="WP_011261335.1"
                     /db_xref="GeneID:54163235"
                     /translation="MTTIAAPNQLNAMTFPLHGTRLIEASAGTGKTFTIASLYLRLLL
                     GHGDEGTRHQEELTVDRILVVTFTEAATAELRERIRAKIHDARLAFARAVHNNGYKSG
                     DPVIDPLLASIGDHKSAAQILLNAERSMDEASIFTIHGFCQRMLTQNAFESGAQFESE
                     FVTDQAKLMHQVAADFWRRSFYHLPKMVAESVYDCWSSPSALLGDMGNSLTGVPKHLT
                     VEPLENSLEEFCQQGIARIDELKKQWSEHCADFEALIAGSGVDKRSYTKKNLPNWLEQ
                     VSSWANNPTTSLQVHDKLEKFSQELLIEKTKKGEAPEHAVFKLIDDFLAQSLEIKQPL
                     LSLAIHRCRKTLQQAKEQKNWLSFDDLLTQLSQATENQDNALLLEKIREQYPVALIDE
                     FQDTDPLQYSIFSTLYQDQPQCGLFMIGDPKQAIYAFRGADIFTYIQARRQVVDHYTL
                     DTNWRSTADMVSSVNRIFEHGKQPFLYDDDIPFYPVKYNPVNAEQKSWALDNHTQPAM
                     TFWLQESKDGNPVNKTSYQRVMAESTAAQIQTILTGAQQGSAYLQNGEKKQAIKAGDI
                     AVLVRTGKEGKLVREALSKQGIASVYLSNRDSVFSSPLAKDVLRLLQAAMTPTDARAV
                     RSALASSLFAYTADQLHQFNVDEMQWEQAVNEFRAYRKHWQQRGIMPMLHQIITQQGI
                     SERLLAENGGERQLTDLLHIGELLQQTSQTLDSDYGLLRWLSDSISEPNGDSEEQTVR
                     LESERNLVQIVTIHKSKGLEYDLVFLPFVCLYRAVDKKGEVSFYDEDNRYSVLDLLKE
                     DDSVEKAEKERLAEDLRLIYVALTRAVYACYIGMAPITKGISKKPPTGVHLSGLGYLI
                     QQADECNVEELQACLEKLIVGNSPMVIQSPQTIIDELYQEVQDEHIELYANKLIEPVK
                     SNWWMTSYSGLVKQGNHHNDTSLELINLDIDSAEDKDDKELDLEPERTIFTFPRGARA
                     GTFLHSLFEEVEFTQPITSEENTQIIIKLLEKENYDAEWLEVVQTMMQRVLDCPLDGE
                     NLRLASKGPTQRLVEMEFLLPIELLNSSLVNKTIAKHDEVSARAGELGFSTVSGMLKG
                     FIDLVFEHEGKYYVLDWKSNHLGDSPECYGGESLVEAMRDHRYDFQYQLYALALHRFL
                     KSRIADYDYDTHFGGAYYIFLRGVEETHEGHNANSNGVFYSKPSKALLEELEKLVDGE
                     TVDA"
     gene            640434..642452
                     /gene="recD"
                     /locus_tag="VF_RS03040"
                     /old_locus_tag="VF0583"
                     /old_locus_tag="VF_0583"
                     /db_xref="GeneID:54163236"
     CDS             640434..642452
                     /gene="recD"
                     /locus_tag="VF_RS03040"
                     /old_locus_tag="VF0583"
                     /old_locus_tag="VF_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="WP_011261336.1"
                     /db_xref="GeneID:54163236"
                     /translation="MLKQLQHLMDHGVLRPLDLQFAKFIAQQEKNSDSNLLMLLSAIT
                     SHELGRGHVCIDIEQIEQGELFTLPAKYRDALLELVPERSAWAEQLINASTVSNGTEA
                     TPLAFDGTRLYLQRYWAFEQRVSNRITKAAQSVAVNPQLSNTLDELFARQYHFLFSAL
                     KKLENNNQVSRQQLVCDMLDVVQSDDLDWQAIDTVLLAATKSSELETLDQLIPNNHCV
                     NWQKVAAAVALTRRFSVISGGPGTGKTTTVTKLLASLVTQAKQDNKNIAIKLVAPTGK
                     AAARLTESIGQAVQSIGLAPEVKEAIPTDASTLHRLLGYIPNQVDFRHNKSNPLHLDV
                     LVVDEASMVDLPMMARLLDAVPEHARVILLGDKDQLASVEAGAVLGDICQFTKMGYSQ
                     NQAQQLSQLTGFNLSAQLHNNAVADSLCMLQKSYRFDARSGIGQLAKAINEGSKFKVE
                     AVWDKGFSDIRFHDLSNNSYNAMITMMVNGYRSYLGHIHAGDKPEIVLKAFSQIQLLC
                     AMREGDFGVVGLNQRIEKALKKSDLIPHGDEIWYSGRPVMVTQNDYGVGLYNGDIGIA
                     MPDPIDQRLRVYFDMPDGSIRGVLPSQLPEHETVYAMTIHKSQGSEFEHTVLALPAEF
                     SPILTRELIYTGVTRAKKKLDLFATEKVVARGVMIKTQRNSGLVSLMN"
     gene            642663..643016
                     /locus_tag="VF_RS03045"
                     /old_locus_tag="VF0584"
                     /old_locus_tag="VF_0584"
                     /db_xref="GeneID:54163237"
     CDS             642663..643016
                     /locus_tag="VF_RS03045"
                     /old_locus_tag="VF0584"
                     /old_locus_tag="VF_0584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux SMR transporter"
                     /protein_id="WP_011261337.1"
                     /db_xref="GeneID:54163237"
                     /translation="MFKLLVSMPPAMALIIAIISEVIATSFIPKTEQFTKLTPSLIVA
                     VGYGIAFFLLSVTVKSMPVGIVYAIWSGAGIVLVAAIGYFAYGQKLDLAGIIGISLIL
                     SGVLVVNLLSKTAGH"
     gene            complement(643099..644439)
                     /gene="argA"
                     /locus_tag="VF_RS03050"
                     /old_locus_tag="VF0585"
                     /old_locus_tag="VF_0585"
                     /db_xref="GeneID:54163238"
     CDS             complement(643099..644439)
                     /gene="argA"
                     /locus_tag="VF_RS03050"
                     /old_locus_tag="VF0585"
                     /old_locus_tag="VF_0585"
                     /EC_number="2.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid N-acetyltransferase"
                     /protein_id="WP_011261338.1"
                     /db_xref="GeneID:54163238"
                     /translation="MKFRSTALVKGFRQSAPYVNAHRDKTVVIMLGGEAIADPNFANI
                     VNDIALLNSLGLRIVIVYGTRPQMRSLLKQTEHHAPFHKGIRITDEQTLELVKQIAGQ
                     LQLDITARLSMSLNNTPMAGAQINVISGNFVIAQPLGVDDGIDYCHSGRVRRIDTQGI
                     NRMLDQQSIVLLGPVASSVTGECFNLLSEDVATQLAIRLNADKLIGFCSEQGVLNEKG
                     QILAELFPSEAEEILQRLEKELTPENGKLTGTMRFLKGAISACKAGVPRSHLISYKED
                     GALIQELFSFDGIGTQVVMASSEQVRDAEIDDIGGILDLIRPLEEEGILVRRSREQLE
                     QEIAQFTIIEKDGLVIACAALYPFPEEGMAEMGCVAVHPDYRDGDRGVTLLNRLRSKA
                     KQFKLSQLFVLTTRSLHWFREQGFIEVDVSHLPIKKQKLYNFQRKSKILVLKGL"
     gene            644592..644975
                     /locus_tag="VF_RS03055"
                     /old_locus_tag="VF0586"
                     /old_locus_tag="VF_0586"
                     /db_xref="GeneID:54163239"
     CDS             644592..644975
                     /locus_tag="VF_RS03055"
                     /old_locus_tag="VF0586"
                     /old_locus_tag="VF_0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2850 domain-containing protein"
                     /protein_id="WP_011261339.1"
                     /db_xref="GeneID:54163239"
                     /translation="MSQAQEKELQKRKVRLLVLIGLVAVGLVAGTIAAMYRAGMFAKM
                     PSTQLYGNWVELGVPSYAQDSFTISSAGIYTHGRLINTQYEFDGTILRYMHGDTEYVY
                     QVEDEDGEQLLRIKPTHYKSSFRKQ"
     gene            645166..646266
                     /gene="mltA"
                     /locus_tag="VF_RS03060"
                     /old_locus_tag="VF0587"
                     /old_locus_tag="VF_0587"
                     /db_xref="GeneID:54163240"
     CDS             645166..646266
                     /gene="mltA"
                     /locus_tag="VF_RS03060"
                     /old_locus_tag="VF0587"
                     /old_locus_tag="VF_0587"
                     /EC_number="4.2.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase A"
                     /protein_id="WP_011261340.1"
                     /db_xref="GeneID:54163240"
                     /translation="MFRKLSFVCVLLGLAGCADQPTDRAQQYLDGGFSSNLNKVGEIN
                     SDKPSDFSAFKKQSAEVLERSESMSLRYEELYVQLQKWIDESSNPAELSNYGIQFAQM
                     GGGDKKGNVMFTGYFSPVIEMRHTPNETFKYPVYDKPDCGSDCPTRAEINAGALAGLG
                     LELGYADNMIDPFIMEVQGSGFVHFGDDDKLEYFAYGGKNNHPYVSIGRILIERGEVE
                     RKDMSLKAIKEWVAKNDEATVRELLETNPSYVFFSPKEAHHVLGTAGIPLHAGAAVAA
                     DRTLLPMGTPILAEVPQLDKDGKWTGKHVLKVLLALDTGGAVKENHLDQYYGMGTEAG
                     IAAGHFKHFGRVWKLGLQDTETENPWEMPKSE"
     gene            646360..647169
                     /gene="tcdA"
                     /locus_tag="VF_RS03065"
                     /old_locus_tag="VF0588"
                     /old_locus_tag="VF_0588"
                     /db_xref="GeneID:54163241"
     CDS             646360..647169
                     /gene="tcdA"
                     /locus_tag="VF_RS03065"
                     /old_locus_tag="VF0588"
                     /old_locus_tag="VF_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA cyclic N6-threonylcarbamoyladenosine(37)
                     synthase TcdA"
                     /protein_id="WP_005417869.1"
                     /db_xref="GeneID:54163241"
                     /translation="MRELTTPASESYDQRFGGTRRLYGNSEVEIMRAAHVCVVGIGGV
                     GSWAVEALVRTGLGEITLIDMDDVCVTNINRQIHAMTGTIGQSKIEVMAERIKLINPE
                     CKINLIDDFITPENLSEYISKEFDYVLDAIDSMKPKAALLAYCKSNKIKVITTGGAGG
                     QTDPTQIQITDLTKTIQDPLAKKLRDTLRRHHNFTKNPKRKFGIDCVYSTEHLKYPQA
                     DGSVCATKATAEGPKRMDCASGFGAATVVTATFGFVAVSRIVEKLIEKHSK"
     gene            complement(647251..647676)
                     /gene="csdE"
                     /locus_tag="VF_RS03070"
                     /old_locus_tag="VF0589"
                     /old_locus_tag="VF_0589"
                     /db_xref="GeneID:54163242"
     CDS             complement(647251..647676)
                     /gene="csdE"
                     /locus_tag="VF_RS03070"
                     /old_locus_tag="VF0589"
                     /old_locus_tag="VF_0589"
                     /EC_number="2.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase sulfur acceptor subunit
                     CsdE"
                     /protein_id="WP_011261341.1"
                     /db_xref="GeneID:54163242"
                     /translation="MSTFPSSPFGFDITHSTVLDLMSNAKGWEDRYRNVIQLGKKLPS
                     MPEELQQENVTISGCESKVWLQHEIVDGVYFFCADSDARIVRGLIALVMAAVNNKTAE
                     EIKAFDMDGYFAQLGLIEHLSPSRGNGLKAIIETINGLI"
     gene            complement(647700..648917)
                     /gene="sufS"
                     /locus_tag="VF_RS03075"
                     /old_locus_tag="VF0590"
                     /old_locus_tag="VF_0590"
                     /db_xref="GeneID:54163243"
     CDS             complement(647700..648917)
                     /gene="sufS"
                     /locus_tag="VF_RS03075"
                     /old_locus_tag="VF0590"
                     /old_locus_tag="VF_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017022989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SufS family cysteine desulfurase"
                     /protein_id="WP_047863692.1"
                     /db_xref="GeneID:54163243"
                     /translation="MTAFNVELVRSQFPALLQEVNEQPIAYFDSAATTQKPLAVLNAI
                     QDYYQKSNANVHRGSHSLTASATLQFEQARETVQHFINAKSSKEIIWTRGATEAINLI
                     AQTYARNTLQVNDEILVSELEHHANIVPWQIVAEQTGAKVIKIPMKSNCTLDMDAFES
                     LVTQNTKIVAVAQVTNVTGTLNPIEEIIKIAHNVGAIVVVDGAQGIVHHTIDVQAMNA
                     DFYVCSGHKLFAPAGIGALYGKQHLLESMPVWHGGGKMVEKVSFEKTTFAELPGKFEA
                     GTPNVAGAIAFATAINWVKQFAHDDLNAHINELRQIAIDGIKDIEDLRFIGLQDNASL
                     FSFVIDGVHHQDIATLLDQQGIAVRSGNHCAHPMLDALGLTGTVRVSFALYNTKQDVQ
                     RFIDALNKAADML"
     gene            649287..650195
                     /locus_tag="VF_RS03080"
                     /old_locus_tag="VF0591"
                     /old_locus_tag="VF_0591"
                     /db_xref="GeneID:54163244"
     CDS             649287..650195
                     /locus_tag="VF_RS03080"
                     /old_locus_tag="VF0591"
                     /old_locus_tag="VF_0591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009603174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator GcvA"
                     /protein_id="WP_005417875.1"
                     /db_xref="GeneID:54163244"
                     /translation="MSRRLPPLNSLRVFEAAARHLSFTRAAEELFVTQAAVSHQIKAL
                     EEFLGLKLFRRRNRSLLLTEEGQSYFLDIKEIFSSLSEATDKVLERSAKGALTISLPP
                     SFAIQWLVPRLSDFNNQEPDIDVRIKAVDMDEGSLTEDVDVAIYYGRGNWPGLRVELL
                     YQEQLLPLCSPQVLLNEKPLATIDDLRFHTLLHDTSRKDWKQFVKHYELAGMNVNQGP
                     IFSHSTMVLQAAAHGQGIALGNNVLAQPELDAGRLVAPFEEVLVSKNAFYLVCNEKQA
                     DTGRIATFREWILSKARSEQEIVDDE"
     gene            650185..650574
                     /locus_tag="VF_RS03085"
                     /old_locus_tag="VF0592"
                     /old_locus_tag="VF_0592"
                     /db_xref="GeneID:54163245"
     CDS             650185..650574
                     /locus_tag="VF_RS03085"
                     /old_locus_tag="VF0592"
                     /old_locus_tag="VF_0592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017019839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF423 domain-containing protein"
                     /protein_id="WP_162200317.1"
                     /db_xref="GeneID:54163245"
                     /translation="MMNSRLCLLIASISGALTVGLGAFGAHGLKAFLSPYLLDVYETA
                     VQYQMWHTLALFGCGILLRNSFSKGVSYAALLFTIGMLFFSGSLYALVFTGIKWFGPI
                     TPLGGFCFIIGWLTLAVSTYRLTEVSK"
     gene            650571..651662
                     /gene="rlmM"
                     /locus_tag="VF_RS03090"
                     /old_locus_tag="VF0593"
                     /old_locus_tag="VF_0593"
                     /db_xref="GeneID:54163246"
     CDS             650571..651662
                     /gene="rlmM"
                     /locus_tag="VF_RS03090"
                     /old_locus_tag="VF0593"
                     /old_locus_tag="VF_0593"
                     /EC_number="2.1.1.186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017060773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (cytidine(2498)-2'-O)-methyltransferase
                     RlmM"
                     /protein_id="WP_005417879.1"
                     /db_xref="GeneID:54163246"
                     /translation="MKQVMFYCRSGFEKECAGEIQDKATQLEVFGFPRLKNNTGYVLF
                     ECYQEGDADRLIREIKFNELIFARQMFAVAAEVSDLPKDDRISPILDALSDVDGVPCC
                     GDIRIETPDTNEAKELLKFCRKFTVPMRQALRGKKMLTERDSNRIPVLHICFIAPGHC
                     YVGYSYTNNNSQFFMGIPRLKFPADAPSRSTLKLEEAFHVFIPKEEWDDRLASGMWGV
                     DLGACPGGWTYQLVKRSMFVHAIDNGMMAQSLMDTGQVKHHMVDGFKFEPPRKNVTWL
                     ICDMVEKPARVAHLMGEWLIKGWAKEALFNLKLPMKGRYDEVLQDIENLKDFLKKNGF
                     QYKLQAKHLYHDREEITVHIQAISNISPH"
     gene            complement(651924..652703)
                     /gene="xni"
                     /locus_tag="VF_RS03095"
                     /old_locus_tag="VF0594"
                     /old_locus_tag="VF_0594"
                     /db_xref="GeneID:54163247"
     CDS             complement(651924..652703)
                     /gene="xni"
                     /locus_tag="VF_RS03095"
                     /old_locus_tag="VF0594"
                     /old_locus_tag="VF_0594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flap endonuclease Xni"
                     /protein_id="WP_011261344.1"
                     /db_xref="GeneID:54163247"
                     /translation="MAIHLVIIDALNLIRRVHSAQPNQDDIQAVITTTTRTINKILKE
                     TEPTHIIAVFDHHLQDRGWRAEILPQYKEDRKPMPEALQKGMDDIQEAWWKLGIDSLL
                     SDGDEADDLVATLANKVAMHNEQVTIISTDKGYCQLLSPTLRIRDYFQHRWLDAPFVE
                     KEFGLKPEQLADYWGLAGISSSKITGIPGVGPKAALEILTQFPTIEAANESEDLPKKY
                     RKKFDEHYETAILCRQVAGLRTDIELGFNLQDIRYEKGTRD"
     gene            complement(652798..654156)
                     /locus_tag="VF_RS03100"
                     /old_locus_tag="VF0595"
                     /old_locus_tag="VF_0595"
                     /db_xref="GeneID:54163248"
     CDS             complement(652798..654156)
                     /locus_tag="VF_RS03100"
                     /old_locus_tag="VF0595"
                     /old_locus_tag="VF_0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LOG family protein"
                     /protein_id="WP_011261345.1"
                     /db_xref="GeneID:54163248"
                     /translation="MITHISPAGSMDLLSQLEVDQLKKTASSELYRMYRNCTLAVLNS
                     GSHTDSSKELLDKYQSFDVAVTRRDRGIKLELNNPPEHAFVDGTIIKGIQEHLFSVLR
                     DMVYVNMQIADHNRLNLTKATHLTNLVFSILRNAKALHTGIEPNLVVCWGGHSINPVE
                     YQYTREVGHELGLRELNICTGCGPGAMEGPMKGAAIGHAKQRYNDSRFVGLTEPSIIA
                     AEPPNPIVNELIIMPDIEKRLEAFVRMAHGIVIFPGGPGTAEELLYILGIMMNPANRQ
                     QPMPIVLTGPKESEAYFRSIDTFIRDTLGEEATHYYDIVIGDPAKAAVFINHGIKKVK
                     EYRKATDDSYSFNWALKIEPEFQLPFEPTHEAMSALDLHLNQPKETLAANLRQAFSGI
                     VSGNVKAEGIAEIEKHGVFKLHGDPALMKKMDRLLQDFVKQGRMKLPGSKYEPCYKIV
                     MD"
     gene            complement(654308..655870)
                     /locus_tag="VF_RS03105"
                     /old_locus_tag="VF0596"
                     /old_locus_tag="VF_0596"
                     /db_xref="GeneID:54163249"
     CDS             complement(654308..655870)
                     /locus_tag="VF_RS03105"
                     /old_locus_tag="VF0596"
                     /old_locus_tag="VF_0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017022994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_011261346.1"
                     /db_xref="GeneID:54163249"
                     /translation="MIEVSIVASELNQLKQQLDQTRLSHRDTTLKSRREIMLLKRIIL
                     RFCAACKHHDSELDKEIVELATSIEQVENTSDLTVRIATFERLINRYKQNVQKEHSMM
                     EDHISYCGETLQRVIGLPAGLKRDLRNLLQHPSHDGSKHIHRIVRLIELYERAIKFIS
                     VGQLSSEINSNEIIDVDTQEQLSNELQHLISELDFDSTSGKDLLEIRNKLLTGVDAVS
                     LIDLALQTLKLVLEGTNNERKASQAFVGEMNTQVAQIIKTSEQNQEKSQAYLEQRSLL
                     NEEYSLLVKQAENLLNSKVSMQEHKAQMALLLSEMSDLSERNKAMQEREAALIERHEY
                     ATKKLNTLYEETLEYRRQLNNQQQRIFKDPLTKVYNRAAMHERLDLEYKRWVRHQHSL
                     VLSIIDIDQFKRINKNYGHLAGDKALSIIAKTIENQVSDTNFVARFSGEEFLILFTET
                     TEDERKKVLANIQSAIAKLPFKFKDNHVKITVSICSSEFTNSDIPEKVIERSIQALYK
                     QKTKGIEQLISA"
     gene            complement(656046..658265)
                     /locus_tag="VF_RS03110"
                     /old_locus_tag="VF0597"
                     /old_locus_tag="VF_0597"
                     /db_xref="GeneID:54163250"
     CDS             complement(656046..658265)
                     /locus_tag="VF_RS03110"
                     /old_locus_tag="VF0597"
                     /old_locus_tag="VF_0597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047863693.1"
                     /db_xref="GeneID:54163250"
                     /translation="MSFRQCLLFIFVFFPLSAWAKFFSAPILNDAYQLLDTKPAQSLR
                     IVNQYLEQRQISPGQNPNQIPINNDSERTIRTPISTVEAFQIKALANKRLNKNREAIE
                     AIKEAISLAKDFQLKSGYLESKLIYAYLWWNLTKDVDETNSILAIIEQELLETGNTIG
                     IHDKLYFGFALIHAEVESEQGNNSKAQKYYKQAMTHGAKLKDPSSLIFYHISYGRHFL
                     KNKQFDQALTELLSAYWQSIEADQSGQLARANFLLGELFFQRKVLDKALEHASQSAEF
                     YGRYNNSEQLSNVLTLIAQIHLKQGRFNLALVQYFNALDQEKEKNNVNKLISLRLDIA
                     NTYFLLYNYALSEHYLKQANNLNEYVKLPKQKARAALLQAKLNLINNKPDLAINDIQT
                     AIVYSKKDNDKPLKLQSQKLLSETYEKMGLFEAALKAQREYETLNSSIQAVQNEINEE
                     VFRQQKSIIEQSLHYQGLEAQLKENHLQTLKIQKIAGFLVALLTIISIYAFRKQQVNR
                     FLKKRLHLLLNKYYTHPRSGLRNLRLLTERLPSSLQQSSSNIEQWHLGELINEPLSDR
                     LRFTLFHIPMLQELYLTHGYQEGLSIEKAFGDYLSSVVTSPSRIYHFSDASFLYIEHK
                     SDSTCSVQEMAETVQSWINNFDSNILTDKTVNIGMVEYPFLPRAYTAINDRELIDILL
                     MATNAAQHLSEELSSSQWVNYRAIDNAPAASFASNNIRLACEQAINQGLIKVITSRN"
     gene            complement(658364..659209)
                     /gene="queF"
                     /locus_tag="VF_RS03115"
                     /old_locus_tag="VF0598"
                     /old_locus_tag="VF_0598"
                     /db_xref="GeneID:54163251"
     CDS             complement(658364..659209)
                     /gene="queF"
                     /locus_tag="VF_RS03115"
                     /old_locus_tag="VF0598"
                     /old_locus_tag="VF_0598"
                     /EC_number="1.7.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent 7-cyano-7-deazaguanine reductase
                     QueF"
                     /protein_id="WP_011261348.1"
                     /db_xref="GeneID:54163251"
                     /translation="MTKYTNADELKSLTLGQKTEYKHTYEPELLQAVPRSLNRDDLAL
                     GDELPFVGCDVWTLYELSWLNQNGLPQVAVGEVALPATSPNLVESKSFKLYLNSFNQT
                     KFTSWDEVKETLVKDLSACAGETVKVDIFPVQRYSQQPIVDMQGECIDDQDIIIDDYE
                     FNAAYLESSTSDVNIEETLHSHLLKSNCLITNQPDWGSVEIQYKGKKIDREKLLRYLI
                     SFRQHNEFHEQCVERIYTDIMKYCAPESLTVFARYTRRGGLDINPFRSSHLLAPKDNL
                     RLARQ"
     gene            659314..659865
                     /gene="syd"
                     /locus_tag="VF_RS03120"
                     /old_locus_tag="VF0599"
                     /old_locus_tag="VF_0599"
                     /db_xref="GeneID:54163252"
     CDS             659314..659865
                     /gene="syd"
                     /locus_tag="VF_RS03120"
                     /old_locus_tag="VF0599"
                     /old_locus_tag="VF_0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SecY-interacting protein"
                     /protein_id="WP_005417891.1"
                     /db_xref="GeneID:54163252"
                     /translation="MPLSVEQALANFSQRYVEAWKAQHDCLPINEELVGLASPCIEET
                     RDLEISWQPIVRDEAIRLHNIEQGIELDLHDDFHAFYGTQYSADMTAKFEDMNIELLQ
                     VWSDEDLERLQGNMLGHLVMQRRLKLVPTLFVAVTDDEMEVVSICNQSGEVILDRVGT
                     KNRTVLAANMAEFLNKLEPVIAA"
     gene            659947..660720
                     /locus_tag="VF_RS03125"
                     /old_locus_tag="VF0600"
                     /old_locus_tag="VF_0600"
                     /db_xref="GeneID:54163253"
     CDS             659947..660720
                     /locus_tag="VF_RS03125"
                     /old_locus_tag="VF0600"
                     /old_locus_tag="VF_0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-ribbon-containing protein"
                     /protein_id="WP_005417893.1"
                     /db_xref="GeneID:54163253"
                     /translation="MFVTELDFEVYCDTSMAAVEKAINYCLDCLRYNGQVIGRELPVV
                     MKGTNFVARVVCPEVDSLHPDNHSPQVKLAFKQLSEFGLLQPKVKVVGQDMNSDPSDE
                     SETVSWQILYTSHLHTCSPIRHGETFQPIPLYRLPAVANGDQKQLIKWQEDWSACDQL
                     QMNGSVVEHPSLHEISSSKSHLFKRGWDLCRRMAVVSGIPTYLYIYRVAGESKEKEQA
                     RRCPVCDGDWALKEPLHEVFDFKCDECLLVSNLSWDFKD"
     gene            complement(660762..661211)
                     /locus_tag="VF_RS03130"
                     /old_locus_tag="VF0601"
                     /old_locus_tag="VF_0601"
                     /db_xref="GeneID:54163254"
     CDS             complement(660762..661211)
                     /locus_tag="VF_RS03130"
                     /old_locus_tag="VF0601"
                     /old_locus_tag="VF_0601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YaiI/YqxD family protein"
                     /protein_id="WP_005417894.1"
                     /db_xref="GeneID:54163254"
                     /translation="MQIWVDADACPKVVKEVLFRAATRTGIQLTLVANHYIPVPSAAN
                     IRSMQVEAGFDVADDEIVKRSEAGDLVISADIPLAAELIEKKVQVLNPRGELYTEATI
                     KARLNIRDFMDTMRASGIQTGGPAPLSQTERREFANQLDRILAKAKI"
     gene            complement(661211..661480)
                     /locus_tag="VF_RS03135"
                     /old_locus_tag="VF0602"
                     /old_locus_tag="VF_0602"
                     /db_xref="GeneID:54163255"
     CDS             complement(661211..661480)
                     /locus_tag="VF_RS03135"
                     /old_locus_tag="VF0602"
                     /old_locus_tag="VF_0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005417895.1"
                     /db_xref="GeneID:54163255"
                     /translation="MKNVTDELQKVLQDLTNEGKKPTTALVRARLTTQIPMPAIIAAV
                     KSFKSTSHVPKIEVRETSLTADERIAQLEEQVKELTERLIALENK"
     gene            662465..663820
                     /locus_tag="VF_RS03140"
                     /old_locus_tag="VF0603"
                     /old_locus_tag="VF_0603"
                     /db_xref="GeneID:54163256"
     CDS             662465..663820
                     /locus_tag="VF_RS03140"
                     /old_locus_tag="VF0603"
                     /old_locus_tag="VF_0603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIC"
                     /protein_id="WP_011261349.1"
                     /db_xref="GeneID:54163256"
                     /translation="MGTQAVNLQSTIMEKVNKFLPKILKVVNSKPIVAIKEGFMLTMP
                     LTIIGSVFLLLAFVPIDGYNEFMAGIFGAEWSTPLFQVVGATFDILALIGAFGIAYTY
                     VKYEGHNGVNAGVLAIVSLLIVMNAFVVAPDGVTQIGGVIPKAFLGGKGMIAAIVIGL
                     VVGIIYSMAFNRNWVIKLPDSVPEGVSNAFKSLIPGFLIITLAFLTYIFFEVVFERTF
                     IETIYHIIQTPLQSMSDSFFGAVGIALLISLLWWCGVHGPVIVMGIMGPIVTANALHN
                     QSIVNAGEALIAGENGKVVTNQFVDQFITVGGSGLTFGLVCCMVLFARSIQFKQLGRL
                     SFIPGIFNINEPVIFATPIIFNPIMFIPFVTAPVLSAIMVYTSINMGFVGPFTAVQVP
                     WTTPMVLSGFIVGGWSAALLQIAVFCMTVCVYFPFFKYQDKLAAQDEAKAAAPTSQAT
                     A"
     gene            663853..664158
                     /locus_tag="VF_RS03145"
                     /old_locus_tag="VF0604"
                     /old_locus_tag="VF_0604"
                     /db_xref="GeneID:54163257"
     CDS             663853..664158
                     /locus_tag="VF_RS03145"
                     /old_locus_tag="VF0604"
                     /old_locus_tag="VF_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_005417897.1"
                     /db_xref="GeneID:54163257"
                     /translation="MKKILLLCAAGMSTSMVVKKMRESAEQKGLDIHIEAHGVETIQD
                     YLSEYDLFLLGPQIRFKKDELQKLADEVNKKVEVIDMMDYGMMKGEKILNDALALLD"
     gene            664198..665607
                     /locus_tag="VF_RS03150"
                     /old_locus_tag="VF0605"
                     /old_locus_tag="VF_0605"
                     /db_xref="GeneID:54163258"
     CDS             664198..665607
                     /locus_tag="VF_RS03150"
                     /old_locus_tag="VF0605"
                     /old_locus_tag="VF_0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 1 protein"
                     /protein_id="WP_005417898.1"
                     /db_xref="GeneID:54163258"
                     /translation="MKFAHDFLFGAATASYQVEGAWDQDGKGPTNWDEFTKIPGKTFE
                     GTNGDVAVDHYNRYKEDIALMAEMGLESYRFSISWARIFPNGTGEINQKGIDFYNNLI
                     DECLKYGIVPFVTLYHWDLPLALEKEGAWLNKATGDAYVEFAKLCFNEFGDRVKHFIT
                     FNETVVFCALGYMAGAHPPGIQNDPKKYFQATHNVFYAHAKAVIEYKKLNQFGEIGLS
                     HVFSPAFGVDDSEESHFAAMHANQFSMNWFYDPILLGKYPEYVVKQLQEEGNLPDWTD
                     EELQTIFEAAPLNDFMGLNYYQPQRVEKIQGDVEARTITRENSTGSPGNPSYDNVYRT
                     VKMADKKYTKWDWEISPEGFVGGLEMLKEHYGQIKLYITENGLGDEDPIIEGEVCDIP
                     RINFIKEHLGAVKEAVRRGVHIKGYYAWSAIDLLSWLNGYKKQYGFIYVDHQNGLARK
                     KKASFHWFKDVIATRGEDI"
     gene            665634..666569
                     /locus_tag="VF_RS03155"
                     /old_locus_tag="VF0606"
                     /old_locus_tag="VF_0606"
                     /db_xref="GeneID:54163259"
     CDS             665634..666569
                     /locus_tag="VF_RS03155"
                     /old_locus_tag="VF0606"
                     /old_locus_tag="VF_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="WP_011261350.1"
                     /db_xref="GeneID:54163259"
                     /translation="MATYISFDIGGTDIKFGVLNEQGKVLEQGKVKTETCGEKIIATL
                     VDIKEQWSKKYTFDGAAFSLPGFVDVNTGYLKTGGAIDDFYGFQFKDELTKKLSLPVE
                     LENDVNCVALAEKWLGKAQHVENFICITIGTGIGGAIYINNQMVRGHGFMAGEFGYMF
                     TRNVFDIEDKATASMSFTASVREGLRRRYSTLKNINSIDNISGKDIFELASTGDEVAI
                     KVIDDFYNNIAIGLYNLTFILNPEKIIIGGAISSREDLISNIEKKFNQIIKSQSSINE
                     FNVKELVSIEKSTFNNDSGLIGAVYHFLTMKNKFK"
     gene            666581..666904
                     /locus_tag="VF_RS03160"
                     /old_locus_tag="VF0607"
                     /old_locus_tag="VF_0607"
                     /db_xref="GeneID:54163260"
     CDS             666581..666904
                     /locus_tag="VF_RS03160"
                     /old_locus_tag="VF0607"
                     /old_locus_tag="VF_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011261351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose transporter subunit IIA"
                     /protein_id="WP_011261351.1"
                     /db_xref="GeneID:54163260"
                     /translation="MLVGEELETTVMELIINAGESKSCAMEALRAAKSGEWDKVDDLL
                     KQSAEASKRAHDVQTQLIGMDEGEGKVPVNLIMVHAQDHIMTSMLAKEMIQELIEIHR
                     ALQNK"
     gene            666974..667978
                     /locus_tag="VF_RS03165"
                     /old_locus_tag="VF0608"
                     /old_locus_tag="VF_0608"
                     /db_xref="GeneID:54163261"
     CDS             666974..667978
                     /locus_tag="VF_RS03165"
                     /old_locus_tag="VF0608"
                     /old_locus_tag="VF_0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_011261352.1"
                     /db_xref="GeneID:54163261"
                     /translation="MATINDVCKLAGVSKATVSRVMNGKGPVKEETKKLIFDAMETLD
                     YKPSLVAQALATNSSNSIGLIVSFFDGYYFGILLKEATRIAEESGKQLIVTDGHNQVE
                     TEIEAINSLVARKCDAILIYSRTMTADDYCEIQKKLPIPLVVINRTLPDGLGHAVAFD
                     QYNASQMAIEHLVGLGHKNIAIITLNMTSSTGQIRLKGAKETLEKHGIAYDDNLTIIK
                     NGKLEDGYQACKELLKRSQDISAIFCFNDHLALGAIKALKEMNIRVPEDISIVGIDND
                     EISAFLSPALTTINIPIQKVTQLAMDKALRLISDKEVKATTEILKGNIIVRESTKNIN
                     "
     gene            668239..669516
                     /locus_tag="VF_RS03170"
                     /old_locus_tag="VF0609"
                     /old_locus_tag="VF_0609"
                     /db_xref="GeneID:54163262"
     CDS             668239..669516
                     /locus_tag="VF_RS03170"
                     /old_locus_tag="VF0609"
                     /old_locus_tag="VF_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017023007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate porin"
                     /protein_id="WP_011261353.1"
                     /db_xref="GeneID:54163262"
                     /translation="MKLLPVALAVTATLSSFSTFAETDPLDNIQLDDQQPLVISPQSD
                     IPDGIVFSGYARYGFHFSDDTQKYVSADGQLIGNAAGRLGNESNGGEFQFAKGFVSDN
                     GTIWDVVVMLEHWGDEVGLKKFYAGATNVFESQPNAYIWAGRDFHNRPQTGLNDYFWM
                     MNDSQGAGIKNLEFGNVKFDMAAVAQVVDGGGTGDSGNYAITSKLHGINLTDALDLSF
                     YANYGFSSKNTETDKDTQTCTGTGADKQCYVDDIDSYQLALELNHSVGMLSNKFVARY
                     GNNVDNNIFNKTEDLSTLLMQLEGKLVMSNQTNIEYLVGYQSLEDKNASQDDRANYSA
                     IVRPTYAWNNIHSTWLEAGYSLVDFDNQSGQNDAWKVTLSQNISFDMDSGARPMLRFY
                     ATVGDSNTEVDLTRGETSKQDTFAVGAMWEAWW"
     gene            complement(669583..669891)
                     /locus_tag="VF_RS03175"
                     /old_locus_tag="VF0610"
                     /old_locus_tag="VF_0610"
                     /db_xref="GeneID:54163263"
     CDS             complement(669583..669891)
                     /locus_tag="VF_RS03175"
                     /old_locus_tag="VF0610"
                     /old_locus_tag="VF_0610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3301 domain-containing protein"
                     /protein_id="WP_011261354.1"
                     /db_xref="GeneID:54163263"
                     /translation="MDNLLAILALTLFCFLFWQQRRQSEYAHQAIQHYCKKMELQLLS
                     VARGSYGIQLPDGKKRLHTIYEFEFSSVGDDHYTGKLIMIGFKAAKFNLPPYRMAEEY
                     "
     gene            complement(669895..670932)
                     /locus_tag="VF_RS03180"
                     /old_locus_tag="VF0611"
                     /old_locus_tag="VF_0611"
                     /db_xref="GeneID:54163264"
     CDS             complement(669895..670932)
                     /locus_tag="VF_RS03180"
                     /old_locus_tag="VF0611"
                     /old_locus_tag="VF_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3549 family protein"
                     /protein_id="WP_011261355.1"
                     /db_xref="GeneID:54163264"
                     /translation="MDQIYTLTQLIQQSDCEYTIYDLGRRVQPISNKQFESIEAGQQP
                     YPYPLQRHAHLAIAYWNDTKQPWIWFLKLPLDERSLLQQADIGNFIKYVIEAIGVSLS
                     GDLSEEQQQKLSNNPYTFKPKDDKMAMFHSLLRAELAQPMSQYYEHAKTYLSGTNGWD
                     NWQFVGMQGLADVCANLNKDNNSTALRKALSHLPTTVLYATLGCLEHINLPEKLAQKQ
                     LETIQDLCNDKESDLFLLSAHIRALSGADKNTLIKALTLILASERLSHPEVLVAIAGR
                     CWSGLEELSAANLFLLRLAQTGDQQLFNQLFADLVMQPKLRMCMLQILHGEADPKLAN
                     ALLKLQQTTKS"
     gene            671035..671349
                     /locus_tag="VF_RS03185"
                     /old_locus_tag="VF0612"
                     /old_locus_tag="VF_0612"
                     /db_xref="GeneID:54163265"
     CDS             671035..671349
                     /locus_tag="VF_RS03185"
                     /old_locus_tag="VF0612"
                     /old_locus_tag="VF_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqcC family protein"
                     /protein_id="WP_011261356.1"
                     /db_xref="GeneID:54163265"
                     /translation="MTTSLELSTLLEQLALQLEHHGHWQRTSPSIADLSSTEPFAIDT
                     LSASEWLQWIFIPKMNYLIENNKPTPKGVSIAPYIEEALKDIEGYNEIVRLCHAIDAL
                     GK"
     gene            671351..672130
                     /gene="truC"
                     /locus_tag="VF_RS03190"
                     /old_locus_tag="VF0613"
                     /old_locus_tag="VF_0613"
                     /db_xref="GeneID:54163266"
     CDS             671351..672130
                     /gene="truC"
                     /locus_tag="VF_RS03190"
                     /old_locus_tag="VF0613"
                     /old_locus_tag="VF_0613"
                     /EC_number="5.4.99.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(65) synthase TruC"
                     /protein_id="WP_011261357.1"
                     /db_xref="GeneID:54163266"
                     /translation="MNTEEMTAVNDELLEEQAEPIELEIVYRDEHLIAINKPAGMLVH
                     RSWLDKHETVFAMQTLRDQIGQHVFPLHRLDRPTSGILFFALSSEIAAQVSPLFASRE
                     IKKTYHAIVRGWIEEANTLDYPLKKELDKIADKKASQEVEAKEAITEYKPLAKVELPY
                     STGKFPTTRYCLMELKPHTGRKHQLRRHMAHLRHPIVGDTSHGDGKHNRLFKEKLDSH
                     RLLLHASELNFTHPITGEDIVIKADFDETWKKLFTEFGWDF"
     gene            complement(672196..672999)
                     /gene="suhB"
                     /locus_tag="VF_RS03195"
                     /old_locus_tag="VF0614"
                     /old_locus_tag="VF_0614"
                     /db_xref="GeneID:54163267"
     CDS             complement(672196..672999)
                     /gene="suhB"
                     /locus_tag="VF_RS03195"
                     /old_locus_tag="VF0614"
                     /old_locus_tag="VF_0614"
                     /EC_number="3.1.3.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002536929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol-1-monophosphatase"
                     /protein_id="WP_011261358.1"
                     /db_xref="GeneID:54163267"
                     /translation="MHPMLNIAVRAARKAGDFVAKSFEQTDKIETTKKGNNEFITNIE
                     ADAQYILVDMIKKSYPDHSIISEESGLIEGKDTDIQWIIDPLDGTTNFVKGIPHFSVS
                     IAVRIKGRTEVACVYDPIRNELFTAQRGAGAQRNNQRMRVKELKDLSEAIISTGFPYR
                     HKQHTESFMKVVGALFIEGSDVRRSGCASLDLCYLASARMDGFVELGLKPWEMTAADL
                     IAREAGVICTDFVGGTDYLKSGNLVAGSPRVVKAMLKKVRENGNEAMMK"
     gene            673207..673932
                     /gene="trmJ"
                     /locus_tag="VF_RS03200"
                     /old_locus_tag="VF0615"
                     /old_locus_tag="VF_0615"
                     /db_xref="GeneID:54163268"
     CDS             673207..673932
                     /gene="trmJ"
                     /locus_tag="VF_RS03200"
                     /old_locus_tag="VF0615"
                     /old_locus_tag="VF_0615"
                     /EC_number="2.1.1.200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ"
                     /protein_id="WP_011261359.1"
                     /db_xref="GeneID:54163268"
                     /translation="MLDKIRIVLVGTSHSGNIGSAARAMKVMGLTNMVLVAPECEVDG
                     QAIALAAGASDIANNARVVDTLDEAISDCGLVIGSSARSRTLEWPMLEPREAGIKAIE
                     EAPTHPIAFVFGRERVGLTNEELQKCHFHVCIPANPEYSSLNLAMAVQTISYEARVAW
                     LDSQAYKGESKEVDYPLNHELELFYEHLEKVMTNTDFINKAHPGQVMNKMRRMFNRTR
                     PETQELRILRGVLTAVERSMKDK"
     gene            674040..674546
                     /gene="iscR"
                     /locus_tag="VF_RS03205"
                     /old_locus_tag="VF0616"
                     /old_locus_tag="VF_0616"
                     /db_xref="GeneID:54163269"
     CDS             674040..674546
                     /gene="iscR"
                     /locus_tag="VF_RS03205"
                     /old_locus_tag="VF0616"
                     /old_locus_tag="VF_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009602411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly transcriptional regulator
                     IscR"
                     /protein_id="WP_005417910.1"
                     /db_xref="GeneID:54163269"
                     /translation="MKLTSKGRYAVTAMLDVALHAQEGPVPLADISERQGISLSYLEQ
                     LFSRLRKAGLVASVRGPGGGYRLGLKAEQIAVGMVISAVDESVDATKCHGKEGCQGGT
                     RCLTHTLWRDLSSRISTFLDGITLGELMQDNEVQQISDRQNVDLAITNGLTTNSKLTN
                     SVGVNVRS"
     gene            674578..675792
                     /locus_tag="VF_RS03210"
                     /old_locus_tag="VF0617"
                     /old_locus_tag="VF_0617"
                     /db_xref="GeneID:54163270"
     CDS             674578..675792
                     /locus_tag="VF_RS03210"
                     /old_locus_tag="VF0617"
                     /old_locus_tag="VF_0617"
                     /EC_number="2.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012127087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IscS subfamily cysteine desulfurase"
                     /protein_id="WP_047863694.1"
                     /db_xref="GeneID:54163270"
                     /translation="MKLPIYFDYSATCPVDKRVADKMVQYMTMDGYFGNPASRSHRYG
                     WQAEEAVDTARENIADLLNADPREIVFTSGATESDNLAIKGAAHFYNKKGKHIITCKT
                     EHKAVLDPCRQLEREGYEVTYLEPESNGLIDLAKLEAAMRDDTVLVSIMHVNNEIGVI
                     QDIAAIGELCRSRKIIFHVDAAQSAGKIPLDVQEIKVDLISLSAHKIYGPKGIGALYV
                     RRKPRIRLEAQMHGGGHERGFRSGTLATHQIVGMGEACRIAKEEMQKDYDHCLAMRDR
                     LLDGIKDMEAVHINGDLDQRVPSNLNISFEFVEGESLLMALKDLAVSSGSACTSASLE
                     PSYVLRALGLNDELAHSSIRFSFGRYTTAEEIDHAVSQISQAVNKLRDMSPLWDMYKE
                     GIDLNTVEWAHH"
     gene            675827..676210
                     /gene="iscU"
                     /locus_tag="VF_RS03215"
                     /old_locus_tag="VF0618"
                     /old_locus_tag="VF_0618"
                     /db_xref="GeneID:54163271"
     CDS             675827..676210
                     /gene="iscU"
                     /locus_tag="VF_RS03215"
                     /old_locus_tag="VF0618"
                     /old_locus_tag="VF_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005424883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly scaffold IscU"
                     /protein_id="WP_005417914.1"
                     /db_xref="GeneID:54163271"
                     /translation="MAYSEKVIDHYENPRNVGSFEKDDPSVGSGMVGAPACGDVMKLQ
                     IKVSPEGVIEDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAAALKNAEIAEELELPPV
                     KVHCSILAEDAIKAAVSDYRNKHQD"
     gene            676335..676658
                     /gene="iscA"
                     /locus_tag="VF_RS03220"
                     /old_locus_tag="VF0619"
                     /old_locus_tag="VF_0619"
                     /db_xref="GeneID:54163272"
     CDS             676335..676658
                     /gene="iscA"
                     /locus_tag="VF_RS03220"
                     /old_locus_tag="VF0619"
                     /old_locus_tag="VF_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012989415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly protein IscA"
                     /protein_id="WP_005417916.1"
                     /db_xref="GeneID:54163272"
                     /translation="MAISVTEAAASRVQKFLENRGKGVGLRLGVRTSGCSGMAYILEF
                     VDELNEEDQVFEQFGVKIIIDPKSLAYMDGTELDFAKEGLNEGFKFNNPNVKSECGCG
                     ESFNV"
     gene            676674..677189
                     /gene="hscB"
                     /locus_tag="VF_RS03225"
                     /old_locus_tag="VF0620"
                     /old_locus_tag="VF_0620"
                     /db_xref="GeneID:54163273"
     CDS             676674..677189
                     /gene="hscB"
                     /locus_tag="VF_RS03225"
                     /old_locus_tag="VF0620"
                     /old_locus_tag="VF_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone HscB"
                     /protein_id="WP_011261361.1"
                     /db_xref="GeneID:54163273"
                     /translation="MNHFELFGLPNQFELDGGLLSLQFRELQKRFHPDNFATSSERDR
                     LLSIQKAAQINDAYQTLKNPVSRAEYILSEQGHDIRGEQTTMQDPMFLMQQMELREEL
                     ESLPSSSDPESALFDFAENVTAMRKSQLVQLQELLKNEAWIEAAQSVRKLKFIEKLNQ
                     EVEQLEEKLLG"
     gene            677228..679078
                     /gene="hscA"
                     /locus_tag="VF_RS03230"
                     /old_locus_tag="VF0621"
                     /old_locus_tag="VF_0621"
                     /db_xref="GeneID:54163274"
     CDS             677228..679078
                     /gene="hscA"
                     /locus_tag="VF_RS03230"
                     /old_locus_tag="VF0621"
                     /old_locus_tag="VF_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S protein assembly chaperone HscA"
                     /protein_id="WP_011261362.1"
                     /db_xref="GeneID:54163274"
                     /translation="MLLQIAEPGQSAVPHQHKLAVGIDLGTTNSLVASVRSGEAKTLP
                     DMKGNVILPSVVQYQEDKICVGMNAYQSAAMDPQNTIISVKRLMGRSLKDIQARYPEL
                     PYQFSESENGLPVIQTAQGEVNPIQVSSEILKSLSRRAQDTLGGELEGVVITVPAYFD
                     DAQRAGTKDAATLAGLNVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDISILR
                     LSKGVFEVLATGGDSALGGDDFDHVLAQWIKEQAGITSPLSSQEQRELLTLATQTKVA
                     LSDSDNVKISFKDWSGEISVELFNSLIQPLIKKTLMACRRALKDADITSEEVMEVVMV
                     GGSTRTPFVRTSVGDYFGQTPLTSIDPDQVVAIGAAIQADILVGNKPDSEMLLLDVIP
                     LSLGIETMGGLVEKIIPRNTTIPVAKAQEFTTFKDGQTGMMVHVVQGEREMVEDGRSL
                     ARFSLKGIPPMAAGAAHIRVTYQVDADGLLSVTAMEKSTGVQSHIQVKPSYGLSDNEV
                     ANMLKDSMTYAKEDMKARALAEQQVEADRVIEGLVVALNNDGDALLSKEEQAEILQAI
                     EALITLRQGTDAQAIEDGIKKADEASQEFAARRMDASIRAALAGQSIDEV"
     gene            679081..679419
                     /gene="fdx"
                     /locus_tag="VF_RS03235"
                     /old_locus_tag="VF0622"
                     /old_locus_tag="VF_0622"
                     /db_xref="GeneID:54163275"
     CDS             679081..679419
                     /gene="fdx"
                     /locus_tag="VF_RS03235"
                     /old_locus_tag="VF0622"
                     /old_locus_tag="VF_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017629863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISC system 2Fe-2S type ferredoxin"
                     /protein_id="WP_005417920.1"
                     /db_xref="GeneID:54163275"
                     /translation="MPKIIVLPHEELCPEGAVLEANEGDSVLDVALKNGIGIEHACEK
                     SCACTTCHVIIREGFDSLEESDELEDDMLDKAWGLEPESRLGCQALVAQEDLVVEIPK
                     YTLNLASEDH"
     gene            679542..679742
                     /gene="iscX"
                     /locus_tag="VF_RS03240"
                     /old_locus_tag="VF0623"
                     /old_locus_tag="VF_0623"
                     /db_xref="GeneID:54163276"
     CDS             679542..679742
                     /gene="iscX"
                     /locus_tag="VF_RS03240"
                     /old_locus_tag="VF0623"
                     /old_locus_tag="VF_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017008623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly protein IscX"
                     /protein_id="WP_005417922.1"
                     /db_xref="GeneID:54163276"
                     /translation="MSLKWIDSRDIAIELLDKYPDTDPKTVRFTDLYQWVLELEDFDD
                     DPKHSGEKVLEAIVLCWMDEWD"
     gene            679973..681259
                     /gene="pepB"
                     /locus_tag="VF_RS03245"
                     /old_locus_tag="VF0624"
                     /old_locus_tag="VF_0624"
                     /db_xref="GeneID:54163277"
     CDS             679973..681259
                     /gene="pepB"
                     /locus_tag="VF_RS03245"
                     /old_locus_tag="VF0624"
                     /old_locus_tag="VF_0624"
                     /EC_number="3.4.11.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase PepB"
                     /protein_id="WP_011261363.1"
                     /db_xref="GeneID:54163277"
                     /translation="MSQKMTVQLSSTAAPAHWGDKAILSFTSEAAVIHCIESDVYSLI
                     QRAARKLNSQGLTAVELEGVDWDLESIWSFIQGFRDSKNSDDVSWTALSENDEKELNA
                     RILTTNWTRQIINKTAEEVAPRQLATMAAEFIKSVAPEGTVTTKIVKDKDLLTQGWTG
                     IYAVGRGSERTSAMLQLDYNPTGDENAPVFACLVGKGITFDSGGYSIKPSAGMASMKA
                     DMGGSALVTAGLAMSILRGLDKRVKLILCCAENMISGRALKLGDIITYKNGKTVEILN
                     TDAEGRLVLADGLQFASEQKPELIIDCATLTGAAKMAVGNDFHSLLSFDEALSQKALN
                     AAQEENEGLWRLPLMEFHRAMLPSNFADLANIGSGPYSPGASTAAGFLSYFVEDYQKG
                     WIHMDCSATYRTAPSDKWAAGATGVGVRTLANILTK"
     gene            681548..681982
                     /gene="ndk"
                     /locus_tag="VF_RS03250"
                     /old_locus_tag="VF0625"
                     /old_locus_tag="VF_0625"
                     /db_xref="GeneID:54163278"
     CDS             681548..681982
                     /gene="ndk"
                     /locus_tag="VF_RS03250"
                     /old_locus_tag="VF0625"
                     /old_locus_tag="VF_0625"
                     /EC_number="2.7.4.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="WP_005417926.1"
                     /db_xref="GeneID:54163278"
                     /translation="MTIERTFSIVKPDAVKRNLIGAIYRRIEKTGMQIVAAKMLRLTK
                     EQAEGFYAEHEGKEFFDELVAYMMSGPVMVQVLEGENAVVRYRELMGKTNPEEAACGS
                     LRADYAISMRYNSVHGADSPESAAREIAYFFAEDEICPRPAE"
     gene            682216..683334
                     /gene="trmG/rlmN"
                     /locus_tag="VF_RS03255"
                     /old_locus_tag="VF0626"
                     /old_locus_tag="VF_0626"
                     /db_xref="GeneID:54163279"
     CDS             682216..683334
                     /gene="trmG/rlmN"
                     /locus_tag="VF_RS03255"
                     /old_locus_tag="VF0626"
                     /old_locus_tag="VF_0626"
                     /EC_number="2.1.1.-"
                     /EC_number="2.1.1.192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012534128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tRNA
                     (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA
                     large subunit methyltransferase RlmN"
                     /protein_id="WP_005417927.1"
                     /db_xref="GeneID:54163279"
                     /translation="MTTAKINLLDFDRKGLRAFFSEELGEKAFRADQVMKWMYHFGCD
                     DFDQMNNINKKLREKLKHKCEIRAPYVSEAQHSSDGTIKWAMKVGDQDVETVYIPDGD
                     RATLCVSSQVGCALECKFCSTAQQGFNRNLKVSEIVGQIWRAAREIGLEKETGRRPIT
                     NVVMMGMGEPLLNMKNLIPALEIMLDDLGFALSKRRVTVSTSGVVSGLDQMTGKIDVA
                     LAISLHAPTDELRSQIMPINDRWDIDAFLASVRRYIASSNANRGRVTVEYVLLDHVND
                     DMDHARQLAELLKDTPAKINLIPFNPYPGSPYKKPSNSRIDRFMKTLMEYDYTVTIRK
                     TRGDDIDAACGQLVGDVIDRTKRTKVKQQGEAIPVKTV"
     gene            683365..684136
                     /gene="pilW"
                     /locus_tag="VF_RS03260"
                     /old_locus_tag="VF0627"
                     /old_locus_tag="VF_0627"
                     /pseudo
                     /db_xref="GeneID:54163280"
     CDS             683365..684136
                     /gene="pilW"
                     /locus_tag="VF_RS03260"
                     /old_locus_tag="VF0627"
                     /old_locus_tag="VF_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018640.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis/stability protein PilW"
                     /db_xref="GeneID:54163280"
     gene            684117..685031
                     /locus_tag="VF_RS03265"
                     /old_locus_tag="VF0628"
                     /old_locus_tag="VF_0628"
                     /db_xref="GeneID:54163281"
     CDS             684117..685031
                     /locus_tag="VF_RS03265"
                     /old_locus_tag="VF0628"
                     /old_locus_tag="VF_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017018639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4115 domain-containing protein"
                     /protein_id="WP_011261365.1"
                     /db_xref="GeneID:54163281"
                     /translation="MTTEHIEETVETFIAPGLLLKEARKELNLTLEDISSRLRLRVEV
                     LEQIEADQFDMGKLATFTRGYYRSYAKVVNVPEQKVLDALDQLGKAQIEQHDMQSFSR
                     KTKRDKHDNRIMKLTWVIFALILGMSVLWWWQEQAQLESANDAELIAEVETAKSMEQV
                     EENKTDAPQTEETAPTLDEAEMLQLDTNISELETDSKTLEKETIKESEAPVEIKKEEP
                     VAEKAVVTEDVVMTFSSDCWLQVQDASNNRLYSGVKKSNQTLKLTGKAPYKLVIGAPS
                     AVTLTYKGKPVDLSVYPAGKVARLTLPQ"
     gene            685044..686162
                     /gene="ispG"
                     /locus_tag="VF_RS03270"
                     /old_locus_tag="VF0629"
                     /old_locus_tag="VF_0629"
                     /gene_synonym="gcpE"
                     /db_xref="GeneID:54163282"
     CDS             685044..686162
                     /gene="ispG"
                     /locus_tag="VF_RS03270"
                     /old_locus_tag="VF0629"
                     /old_locus_tag="VF_0629"
                     /gene_synonym="gcpE"
                     /EC_number="1.17.7.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012549534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin-dependent
                     (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase"
                     /protein_id="WP_011261366.1"
                     /db_xref="GeneID:54163282"
                     /translation="MHIESPIKRRQSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVDAT
                     VAQIKSLEKVGADIVRVSVPTMDAAEAFKVIKQQVSVPLVADIHFDYRIALQVAEYGV
                     DCLRINPGNIGNEQRIRSVVDCARDKNIPIRIGVNGGSLEKDIQAKYKEPTAEALLES
                     AMRHVDILDRLNFDQFKVSVKASDVFLAVDSYRLLAKQIAQPLHLGITEAGGARAGSV
                     KSAVGLGMLLSEGIGDTLRISLAADPVEEIKVGFDILKSLRIRSRGINFIACPTCSRQ
                     EFDVIATVNELEQRLEDLITPMDVSLIGCVVNGPGEAEVSHMGIAGSNRKSAFYEDGV
                     RQKERFDNDNIVDQLEAKIRAKAATLSKENQIDINQID"
     gene            686201..687469
                     /gene="hisS"
                     /locus_tag="VF_RS03275"
                     /old_locus_tag="VF0630"
                     /old_locus_tag="VF_0630"
                     /db_xref="GeneID:54163283"
     CDS             686201..687469
                     /gene="hisS"
                     /locus_tag="VF_RS03275"
                     /old_locus_tag="VF0630"
                     /old_locus_tag="VF_0630"
                     /EC_number="6.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005300737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_005417932.1"
                     /db_xref="GeneID:54163283"
                     /translation="MAKTIQAIRGMNDCLPTQSPLWQKVEGSVKRVISAYGYNEVRMP
                     IVEQTHLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIENGLLYNQE
                     QRLWYMGPMFRHERPQKGRYRQFHQVGVEVFGLNGPDVDAELIMMTARLWRELGIDQH
                     VRLELNSIGSLEARANYRTALVAFLEQHLDVLDEDCKRRMHTNPMRVLDTKNPDVQAI
                     LGDAPKLSEYLDDDSKAHFSGLCELLDAAGIQYQVNERLVRGLDYYNRTVFEWITESL
                     GAQGTVCGGGRYDGLVEQLGGKTTPAVGFAMGLERLVLLMETLELTDVRRSVDVYMVT
                     AGEGTLMAGMKLAESLREQVPGLRVMCHFGGGNFKKQFKRADNAGAAVALILGETEVA
                     EQTVNVKDLRNGEQVTLPQSDVFTKLAELI"
     gene            687481..688092
                     /locus_tag="VF_RS03280"
                     /old_locus_tag="VF0631"
                     /old_locus_tag="VF_0631"
                     /db_xref="GeneID:54163284"
     CDS             687481..688092
                     /locus_tag="VF_RS03280"
                     /old_locus_tag="VF0631"
                     /old_locus_tag="VF_0631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_011261367.1"
                     /db_xref="GeneID:54163284"
                     /translation="MEAYETEEQQVEAIKSWWKENGKAVVIGGVVGIGAILGWKYYQS
                     SQITAKETASAAYERALTALQASGADAVESTQAFIDANKSSEYASLAALQLAKVQVEA
                     GQLENALEQLNWVASNSKDESLTAMAQVRSARIQAEQGNFDAALATLANVKPASWAAR
                     VAELKGDIALRQGDIATARSSYTEALQAGMNQAVQMKLDDLAE"
     gene            688103..689260
                     /gene="bamB"
                     /locus_tag="VF_RS03285"
                     /old_locus_tag="VF0632"
                     /old_locus_tag="VF_0632"
                     /db_xref="GeneID:54163285"
     CDS             688103..689260
                     /gene="bamB"
                     /locus_tag="VF_RS03285"
                     /old_locus_tag="VF0632"
                     /old_locus_tag="VF_0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamB"
                     /protein_id="WP_011261368.1"
                     /db_xref="GeneID:54163285"
                     /translation="MRKVLKKAALCTFGFSMLFGCASEEDTIVMAPVPVVQNQFEPTT
                     EWTSSIGDGVGHYFSRLTPVYAYQKIYVASRDGLVKALDPENGKTIWERDLEQDDTAR
                     LSGGLTLTYGKVFIGSENGELITLDAETGEELWREKVDGEVLAKPLADEGYVMVHTSR
                     GALIAFDAETGVEQWQINSEVPNLTLRGDSAPVSISGGVFWGMSNGRLAAALISKGQL
                     LWQQPVGTPKGATEIDRLVDVDASPLILGSRLYTVGYNGQLIALDLRTGQPVWKRNYS
                     SAMNMSSDGKRLFLVTEKDHVVAVDARSGTELWSNEELEYRQLTSPMIIDSYIVLADS
                     EGYLHWLDRDTGLFMSQQEIDSDGIAVSPILVEDSFLVVTREGDIKKMRIK"
     gene            689442..690944
                     /gene="der"
                     /locus_tag="VF_RS03290"
                     /old_locus_tag="VF0633"
                     /old_locus_tag="VF_0633"
                     /db_xref="GeneID:54163286"
     CDS             689442..690944
                     /gene="der"
                     /locus_tag="VF_RS03290"
                     /old_locus_tag="VF0633"
                     /old_locus_tag="VF_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase Der"
                     /protein_id="WP_011261369.1"
                     /db_xref="GeneID:54163286"
                     /translation="MIPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGR
                     AKLEEQEFILIDTGGIDGTEQGVETKMAEQSLAAIEEADVVLFMVDGRAGLTSADEAI
                     AKHLRSREKPTFLVVNKIDGIDADAASAEFWQLGMNKVYQIAASHGRGVTSLLELALA
                     PFMEELVEESLKDENGEITDLTEFEDFEDEEKDLTEEDAEKDFARLQDQPIKLAIIGR
                     PNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMEREGQEYVLIDTAGVRRRGRINE
                     TVEKFSVIKTLKAVEDANVVLLVIDARENISDQDLSLLGFALNAGRSLVIAVNKWDGL
                     DNDVKEKVKSELDRRLGFVDFARIHFISALHGTGVGHLYESVQEAYVSATKRVGTSVL
                     TRIMKMAQDDHQPPLVRGRRVKLKYAHAGGYNPPLIVIHGNQVKELPSSYKRFLMNYY
                     RKSLEIMGTPIRIQFQNSENPFEDRGGKLTMSQERQRKRLLGAVKNRNKK"
     gene            691024..691899
                     /locus_tag="VF_RS03295"
                     /old_locus_tag="VF0634"
                     /old_locus_tag="VF_0634"
                     /db_xref="GeneID:54163287"
     CDS             691024..691899
                     /locus_tag="VF_RS03295"
                     /old_locus_tag="VF0634"
                     /old_locus_tag="VF_0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005417950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_011261370.1"
                     /db_xref="GeneID:54163287"
                     /translation="MTQLAATEILFCHNTWQSDSTVQLIKETEQGKWIITKATPFHPV
                     SHIWPDHPEDKGVILINNEEYSVLACQTGAIELATGELYIGKDIPIKRGEEGWVFVVS
                     HLISKDADIAVENTVTLRVDEEYQKALSRGHSAGHIAYLALNKVLHANYWRKDADRKD
                     ELGHYNFNSYAQETSFVSEDHCEDVYRLGKTLRKRGLNSAEMMADLKTIEEAVNHQII
                     EWLALESQVTMQCDGKALTDSRYWIVDFGIDGIAKLPCGGTHVSSFKEYATIIVKLEE
                     KSEQELLMLTTSIKK"
     gene            692217..692450
                     /locus_tag="VF_RS03300"
                     /old_locus_tag="VF0635"
                     /old_locus_tag="VF_0635"
                     /db_xref="GeneID:54163288"
     CDS             692217..692450
                     /locus_tag="VF_RS03300"
                     /old_locus_tag="VF0635"
                     /old_locus_tag="VF_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012533706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ribbon domain-containing protein"
                     /protein_id="WP_005417952.1"
                     /db_xref="GeneID:54163288"
                     /translation="MQENQCPKCQSELRWQKEGYHCDFCQIDFKKVAYCPDCNKEMEK
                     LNACGAASYFCHDCNELKSKSRAKTEFSEIAIS"
     gene            complement(692443..693792)
                     /gene="xseA"
                     /locus_tag="VF_RS03305"
                     /old_locus_tag="VF0636"
                     /old_locus_tag="VF_0636"
                     /db_xref="GeneID:54163289"
     CDS             complement(692443..693792)
                     /gene="xseA"
                     /locus_tag="VF_RS03305"
                     /old_locus_tag="VF0636"