GenomeNet

Database: RefSeq
Entry: NC_007244
LinkDB: NC_007244
Original site: NC_007244 
LOCUS       NC_007244             355712 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 2.
ACCESSION   NC_007244 CP000078
VERSION     NC_007244.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 355712)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 355712)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796398.
            On Jun 1, 2012 this sequence version replaced NC_007244.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..355712
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="2"
     gene            complement(<4431..>6875)
                     /gene="SCG3"
                     /locus_tag="LMJF_02_0010"
                     /db_xref="GeneID:12981682"
     mRNA            complement(<4431..>6875)
                     /gene="SCG3"
                     /locus_tag="LMJF_02_0010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 3"
                     /transcript_id="XM_003721558.1"
                     /db_xref="GeneID:12981682"
     CDS             complement(4431..6875)
                     /gene="SCG3"
                     /locus_tag="LMJF_02_0010"
                     /note="previous protein_id=AAZ10010.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 3"
                     /protein_id="XP_003721606.1"
                     /db_xref="GeneID:12981682"
                     /db_xref="GOA:Q7YXV2"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q7YXV2"
                     /translation="MQEENNVPAEWAPRDTHRLDPLQLLPSSQRHCGRSSAAGSGQGC
                     HSRSRGKPEVHSTRASSGGKRGAGTLPRSDDCLNDVARTPLFRFCGHPWRPAAHCLCL
                     HTRQRRLVALAVLLALIVMVHWVIIEFTTNIDAQQKPSIELLNEADREYESSSPFSVL
                     VQHESAVERLTTTQRGLAASGAGSLARLEQDQLPSWTLRVIDEDCTMCFDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTDDVDVAAELPRWQWV
                     TWSYAQQRRFVHASQSRSTGERPRHLIVVGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAEHDSEDSTHSTVDMVQLAPTVSEYAAATEQHLAVEGGDVN
                     NAPPYLQCRVVLRDGWRDIPRSDDAVWRSPCAGVRTTVVTAASLVAGTSSLTALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNLLWLDFLTDRKPTTEKQMGMRMSWGIP
                     TEVGMSQKTVLWLNYAYTAFPDVPYIMKGDDDMYLKVPQYLSDLRHVRGGWQKPRNLT
                     VTIPHRGVIPPTLAIDDAEECLYRVWWLYRSKLAYGNGAGYALDRRLIQAALNPFDGS
                     NALLMKLLTNPYDYRLEKEYLSLNMQHEDKHIGTQIRDHHDAVERFCPKKRVCYMADR
                     RFRAHQILRPTPVKLTWISVMAHFGMSAIPYYVHYFHKNEFKVAEEAKRLIAQGIDVN
                     TIEENATQRMHEWVASQVPSTLVGLGASFDLDWVRGDPRTAYTVAEGDEVAVYDVRYK
                     FRRRDDVACVLESGKR"
     gene            complement(<8751..>9053)
                     /locus_tag="LMJF_02_0020"
                     /db_xref="GeneID:12981674"
     mRNA            complement(<8751..>9053)
                     /locus_tag="LMJF_02_0020"
                     /product="histone H4"
                     /transcript_id="XM_003721559.1"
                     /db_xref="GeneID:12981674"
     CDS             complement(8751..9053)
                     /locus_tag="LMJF_02_0020"
                     /note="previous protein_id=AAZ10011.1"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_003721607.1"
                     /db_xref="GeneID:12981674"
                     /db_xref="GOA:Q4Q277"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4Q277"
                     /translation="MAKGKRSTDAKGSQRRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKTVTACDVVTALRKQGHILYGYA"
     gene            complement(<9863..>11008)
                     /locus_tag="LMJF_02_0030"
                     /db_xref="GeneID:12981547"
     mRNA            complement(<9863..>11008)
                     /locus_tag="LMJF_02_0030"
                     /product="tagatose-6-phosphate kinase-like protein"
                     /transcript_id="XM_003721560.1"
                     /db_xref="GeneID:12981547"
     CDS             complement(9863..11008)
                     /locus_tag="LMJF_02_0030"
                     /EC_number="2.7.1.144"
                     /note="previous protein_id=AAZ10012.1"
                     /codon_start=1
                     /product="tagatose-6-phosphate kinase-like protein"
                     /protein_id="XP_003721608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981547"
                     /db_xref="GOA:E9AC77"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:E9AC77"
                     /translation="MRVCPLRRDVSLIVLLFGLTPTTFSFSATSHDASRTKATRTHTH
                     THTPLFPARPMGSPLIAVIGPNPAFQKTLALDELRVDEVNRAATVHSYTGGKGTNFCR
                     ASACCKESPHFCRTTLHTFVGGKTGERVIDLLHQEGIAVYPVTVPAETRTCITCLDTQ
                     NSTMTELIEPSAAVPDDAAKDMDRALLKALEHAGGMAIMGSLPDGSSPDLYTRWTEMA
                     AAAQKPVLIDAVKGIEASLKVPGVHSILKVNMRELNKLTGQSTPESAFEYAMQMWTVR
                     VLAVTDGPRSAYIQERGQPLQVVHIPKVDGVVSPLGAGDTADAIFLAKYIHGTTPVEA
                     FRLALAAASANCLQKEAGVFAQHEMRRIADGITIGSSRPHSSSNTRA"
     gene            complement(<11678..>13537)
                     /locus_tag="LMJF_02_0040"
                     /db_xref="GeneID:12981548"
     mRNA            complement(<11678..>13537)
                     /locus_tag="LMJF_02_0040"
                     /product="metallo-peptidase, Clan MG, Family M24"
                     /transcript_id="XM_003721561.1"
                     /db_xref="GeneID:12981548"
     CDS             complement(11678..13537)
                     /locus_tag="LMJF_02_0040"
                     /EC_number="3.4.11.9"
                     /note="previous protein_id=AAZ10013.1"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MG, Family M24"
                     /protein_id="XP_003721609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981548"
                     /db_xref="GOA:E9AC78"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:E9AC78"
                     /translation="MIMKASGAAVLHAVREKMQEATVAALIVTSSDAHNSEYVATHLQ
                     SRAFISHFQGSAGTALITMEKALLWTDGRYWLAAEEEKYPEFDLMKQGQPEVPSLEEW
                     IAANLGSKAVVGMSPYVATVAEWERLSKKINLRPVANIVQDMMPPEKSVRKMYVRPAE
                     FCGATCQERRAAILAELEKKDCDMIILSALDEIAWFTNLRGGDVDYNPVFYAYAVIDK
                     HYENVRLYVNLDKVTDAVRQACEDHIDFYPYEQFEADLKQLPRGRKALVDERQTSEAV
                     FRILKDVGTVTVRVVCGPAQKLKAIKNEVELKGFRDCHVRDGAALTRYLAWLHDQVAN
                     KGVTDLNEYDAATKLEEFRAQGEHFVQLSFGSISSIGPNGAMCHYSPAETGSAAIRRD
                     QLYLIDSGAHYWDGTTDVTRTICFTAPSDEQREAYTLVLKGHIALNSIIFPKGTSGVR
                     LDTLARMALWGVGLDYAHGTGHGVGSFLNVHEGPHGISTRPVATGANMELHSIVSNEP
                     GYYKDGHYGIRIENLEEVVECRTKYSATGFYTMSHLTMAPLCRDLIDVSLLTETERAW
                     VDRYHAKVVASIMPHLQQAGDQNAVEYLKYHTRPLFAVNEAYTLLSPDGKGAK"
     gene            complement(<18849..>19505)
                     /locus_tag="LMJF_02_0050"
                     /db_xref="GeneID:12981549"
     mRNA            complement(<18849..>19505)
                     /locus_tag="LMJF_02_0050"
                     /product="putative cytochrome b-domain protein"
                     /transcript_id="XM_003721562.1"
                     /db_xref="GeneID:12981549"
     CDS             complement(18849..19505)
                     /locus_tag="LMJF_02_0050"
                     /note="previous protein_id=AAZ10014.1"
                     /codon_start=1
                     /product="putative cytochrome b-domain protein"
                     /protein_id="XP_003721610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981549"
                     /db_xref="GOA:E9AC79"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:E9AC79"
                     /translation="MPTFYTRDQVAEHNKKKSGWLIINNGVYDVSDFYDDHPGGRDIL
                     LAHIGTDATEGFEAVNHSKGAVRKLDKLKVGELPENERRRYISMEQVAAKKSADSAWF
                     VINNKVYDVTPFLDLHPGGRDILLYNAGGDATQAFTDNGHSDTAYEMMGKYVVGDVEP
                     SERKTLVNRKATRTTQAATTEMVCVKSENASLLAHIQEQLKLLMALALFVIAGVFLLS
                     "
     gene            complement(<20184..>20759)
                     /locus_tag="LMJF_02_0060"
                     /db_xref="GeneID:12981550"
     mRNA            complement(<20184..>20759)
                     /locus_tag="LMJF_02_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721563.1"
                     /db_xref="GeneID:12981550"
     CDS             complement(20184..20759)
                     /locus_tag="LMJF_02_0060"
                     /note="previous protein_id=AAZ10015.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981550"
                     /db_xref="UniProtKB/TrEMBL:E9AC80"
                     /translation="MPAPSTAAVRVPFYYTASGVNAAAEARADRASAPEDAVFITNVF
                     IEVVAFGTRFFWVHVSESPTNQSVPQLGACSVAVGLQLSGDGGRLSISSSQLMEFEAA
                     RQQDMPTGTNSSVQSTFSTSLGQRLVRGIAKRLGAQATVYVNCAIEGERCLPLLGTDG
                     GSGFDMTFQFGALVYEESYRLIAQRCVCACV"
     gene            complement(<21413..>22606)
                     /locus_tag="LMJF_02_0070"
                     /db_xref="GeneID:12981551"
     mRNA            complement(<21413..>22606)
                     /locus_tag="LMJF_02_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721564.1"
                     /db_xref="GeneID:12981551"
     CDS             complement(21413..22606)
                     /locus_tag="LMJF_02_0070"
                     /note="previous protein_id=AAZ10016.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981551"
                     /db_xref="UniProtKB/TrEMBL:E9AC81"
                     /translation="MLKKVLKIKGVEGRTALVEFAVNKRVKYLEYLKELHSVEGTLWM
                     NTVHLDLHEIGKYFNIADGCLPTDRDGASKEGLIQLPAEKPVTVVARATGALASSSSS
                     ASAEPGATGADFINVSIANAPAAIRQRNSSAADWARYYLPCYAALAISLSEILVIPIG
                     GEEFVECFYGLLLELEVAYASGAASKALAQRNLRQFRQHMSPGLKSLLQTSTDAETPD
                     ATPAFPVVTTSSDLDAQIKYLFLNQRHLEYTVASPSYDAVIPALCSVLMFAYRKLCDY
                     ELMREEGCVRRILSIDKRLERLFFAHVSHEVAKIAKQKLLREAYILSTGVLFADLVDA
                     SGRSGASGASGIDGGADFVADLLIRQQQRRGSSSPTATEKKGSDSSDDDENDGTVWFG
                     PEEDR"
     gene            complement(<24871..>27861)
                     /locus_tag="LMJF_02_0080"
                     /db_xref="GeneID:12981552"
     mRNA            complement(<24871..>27861)
                     /locus_tag="LMJF_02_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721565.1"
                     /db_xref="GeneID:12981552"
     CDS             complement(24871..27861)
                     /locus_tag="LMJF_02_0080"
                     /note="previous protein_id=AAZ10017.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981552"
                     /db_xref="UniProtKB/TrEMBL:E9AC82"
                     /translation="MAPQILRQASAAASSEALMRELGVLERAECQTAAKATDVKESPG
                     ASTDSDDAAVDVISLMGTSSLVLHVCQTGIRAQVPSVVILRHLWRPFSAAQAVTHSQL
                     GALEDKSADEPLRAPTMEWAASLPVSVRELLLSHELQRVHRRRRYINRGVRGDVAVST
                     EEISHDTDRTPVYALSEMWTQTVQESRAVVLCCCAPWLLHHSTQASSVIESSEAASSL
                     LRALFSPLERRVLEAGMRLCAVCQAEDVARALMAVFIRGVDSATSGASDQSRNIDALT
                     EEGAFTAWYATEAGTLYESAMIAAAAPRTHAGLLASCTYFPTSGGFALAYSYLIHRGL
                     AMARLAAASGEDRDNEEVPAAPEASSRSARSSRSWLSSFMQQPRCAMRLVCALAGAVD
                     ANADHFDVVLQLYLRLVEEAGAGYTADSVDDTRVALCAVLNALARVPLKTQVYLDFLE
                     DVHRRTLVHSTIDVTEHPDVLASCLRVCSAARVPSRAVTLFNKLCEPSSRAIAAEERN
                     VAAVLLSTPTAAMALQRLVSYMHTKLPVTADAVHAAAAQALIASTELVCSASSTMFAF
                     FDLLELKVAAQHHVTSRTAAYYANRTFFLRLLTLLAGVHEQRCGGGALREALSTPAAA
                     AVFRQWVASAVEHQPRTTSWASALPPVLVGVLQELALELHRAARADSQVGSDSFPAVP
                     ASSLLAAVEEVLHAAAGGLPTSVRPIGSVDEDTAKDCCTLYCLPEPLQWRQVQADWQL
                     EEQRRFVEGASSLLQAPNADATAATSCLRYQDWAMLRDLQLRCASATSQEHLADAWAN
                     ATSRGPKQPQPSASTSTWSRTPGGVAADRATLCVLTPLAEVEWWFMQDSASPSHALRM
                     KTASLSETLGVAVPPAVGCPAHTWASEQAAAHGGARQRCTRVVKYWLQRWVDSVEDNR
                     ALPLHSVFRTSVVRVLQQSVSAVFVAEEKADAAEQDAELDTPSASSGEPWNASSPDVF
                     SGRVKRSCVETMLVRGPSSVVYNT"
     gene            complement(<28965..>29909)
                     /locus_tag="LMJF_02_0085"
                     /db_xref="GeneID:12981553"
     mRNA            complement(<28965..>29909)
                     /locus_tag="LMJF_02_0085"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721566.1"
                     /db_xref="GeneID:12981553"
     CDS             complement(28965..29909)
                     /locus_tag="LMJF_02_0085"
                     /note="previous protein_id=AAZ10018.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0085"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0085"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981553"
                     /db_xref="UniProtKB/TrEMBL:E9AC83"
                     /translation="MPRRYRHMILPLGRSRACGSGMLRTSRNAVRRWPSLQPSWTRRS
                     LATLSTILLNSSRCTATSGSGLWGTHPRHSPVRTSFVPSDISSAAVHKAKGAQLGKSP
                     QRSDTTRSPAGVPPPTRFTLDPPFTRVAGEEELSPGPCAYVCRRCRAPVFHSDCFADT
                     SRVGWHASGWPTFLAPSTPSALRLSTVLQRSVIARLSDTPRDGPVSNISAGLTTPQRT
                     LDIAVPPNSVAQRGLAVEGDLVRKRGSTISLQETRTWRETCLRDENHRADPVLVLAVC
                     SACDTPLCHVTQSAAVGTLYVSTAACIMAEAAGATRRE"
     gene            complement(<31234..>32292)
                     /locus_tag="LMJF_02_0090"
                     /db_xref="GeneID:12981554"
     mRNA            complement(<31234..>32292)
                     /locus_tag="LMJF_02_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721567.1"
                     /db_xref="GeneID:12981554"
     CDS             complement(31234..32292)
                     /locus_tag="LMJF_02_0090"
                     /note="previous protein_id=AAZ10019.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981554"
                     /db_xref="UniProtKB/TrEMBL:E9AC84"
                     /translation="MPAKTSGLRKLAEEKTLLSGLSKMFHLIKASHKEQRNGREAVAA
                     AAATAAASAASVKASKKTKVDPRRGSRRRSQRGGSVWIVLKGGFSPRSVPTAVQTERV
                     DARAGGRARLSEKRRAAALREAEAYIESAWQQAQEAKLLTSDGAPTEEGDAYLAEQYA
                     LASRMLRPPTTGAHLHQLVASHCNSGLDDAVTGVAHGRPEYTLTRSEWEDICTREAAI
                     LFRYRTSATPSGTAEDYFKEQQQARENLYHFATAEPMTKAGDIVPTKCLVRIRDSQRD
                     KHTCILSTAKSVNYFKSNFGQVLRKELSASRLPRGGAADEGEAATRTNTGKGNHQTTP
                     QSGAAANNSNSSKKRRRR"
     gene            complement(33424..36189)
                     /locus_tag="LMJF_02_0100"
                     /pseudo
                     /db_xref="GeneID:12981555"
     misc_feature    complement(33424..36189)
                     /locus_tag="LMJF_02_0100"
                     /pseudo
                     /db_xref="GeneID:12981555"
     gene            complement(<38538..>42038)
                     /locus_tag="LMJF_02_0110"
                     /db_xref="GeneID:12981556"
     mRNA            complement(<38538..>42038)
                     /locus_tag="LMJF_02_0110"
                     /product="exportin T (tRNA exportin)-like protein"
                     /transcript_id="XM_003721568.1"
                     /db_xref="GeneID:12981556"
     CDS             complement(38538..42038)
                     /locus_tag="LMJF_02_0110"
                     /note="previous protein_id=AAZ10020.1"
                     /codon_start=1
                     /product="exportin T (tRNA exportin)-like protein"
                     /protein_id="XP_003721616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981556"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9AC85"
                     /translation="MPRTENFTEALQLTHNFDPSVPYSARLEAERYLMDLLESAEGLK
                     LSFHIISNEAVDELRSFWAFNTVMHHLPKLAVTVDAEQAQEFYHTLFSFIHRYLFASP
                     AVTPIDYVINKHAQMMVAGLQLFYPARWPSIFDDLFEMLHRRSTSPCLPTADLVTIYV
                     LRIFEYIDERVVCVRDRQERGKQQQARDMELKDAMRERVLPKAADMWYNILISDACVR
                     NPDMAKLCLSVMQTYIEWADVNLFMTENWIHLLYFLLTVPPLRVAACECLLSLVEKKQ
                     LPGLKMRSLRTLSVVDSVPRMMSLFELPPPSEAAVLFMEAVAKFAVAVAGQFLSLLDT
                     CASLAQQQPSTRSAATVEVSGVVLHDEPFTVTADLLDGLAGALHAVVGQVILVLHLNL
                     FDVRDALLPFLQVYLKSAYLLESEAAELLATLFHQTRIPGVAYDEDRIWDDTVIDQRK
                     TLHNLLRLLHRRRPDLVMSHLHSLVLTGLSRLSEGGDVARASTAKDDADFTDPEVLEA
                     ALRYLYEIGESLRLESLKDPNDSITQLLQRVLTTEAVVSGEATCVHLAFFEVLGRYYL
                     FFTYHPEFIPLLLQRLLLQPCGVMSRSDRVRARICYLFGYLLQLLKSRIGTYAADMIK
                     ALHSIVTTAPQLQPGDRRELYEAIGILLSICSEEASPALDGGSSEALRLLTASASIDD
                     YGATAVSSAVLAEAAPLLGRKAELVHTVVGSALQTLQQASASCAGMNGGAAGCSGHAA
                     ARSVAVAERTVADVISFLSALAKGLGSTGSSSGAGSAAGSGVSNRSVSPPNGSVPGPW
                     RIGTNPNASGVAVDGLLAACGASSDASLSTSSAMSATGLLVTQMFLQVTQRVMEVANQ
                     MAGSAAVRDVVGQFFHQLINTLPYEMLRPYIEGYVTVCLNWMEAVPELSKVLRLMFQY
                     ANKAGSRGVLSVARLTPLLWHRLCAVGELSEASPVVCMGVVSESARERVNVYKQLFTF
                     LFSVSTWGCVAAFALMPSACWMSILRQLCYALTLPTELELPKSALQVLEKLTQELTDP
                     VVAQAVAQYSSATDVVDAATAQRNQHVFSECLLQEALPTAFGALADPSFDLDDAKNFL
                     LLGEVLQFFRVLVARYGEPAMQVLYERVAPYVGEATAMECCTVIRDQPRVNAALKVKM
                     KQLLSRVHEYQRRTPANRLS"
     gene            complement(<43915..>58632)
                     /locus_tag="LMJF_02_0120"
                     /db_xref="GeneID:12981557"
     mRNA            complement(<43915..>58632)
                     /locus_tag="LMJF_02_0120"
                     /product="putative phosphatidylinositol kinase related
                     protein"
                     /transcript_id="XM_003721569.1"
                     /db_xref="GeneID:12981557"
     CDS             complement(43915..58632)
                     /locus_tag="LMJF_02_0120"
                     /note="previous protein_id=AAZ10021.1"
                     /codon_start=1
                     /product="putative phosphatidylinositol kinase related
                     protein"
                     /protein_id="XP_003721617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981557"
                     /db_xref="GOA:E9AC86"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:E9AC86"
                     /translation="MESFLANVDSAHLKARLNKIMADVNAVTSDAAAAVVSVKSSEEA
                     GQCVLEFVKFFASVAEQHGTTPHAVLGQHVVSNVLIFVLERIVKPNLMTYCRVAERHA
                     AIAVAASGDATSSARCPATKLGSGAASAATGRRDALEARRRRLRRDIIHPFTQLFQSL
                     HTSLAEEGEPLMSWTTEGGGRTPGATRRAAALRAGGRHEELLASASPGDAPPKSSSAF
                     GGSQTGEQCAGERRGRDDVWGTGDSAHEDGLLISGASDALSQAPLLWKSASPLNMLCN
                     HILEVLESQWLVAVVGADYAALLIEVLRWSGYARLITPTYLVRLSACLVTLIQRVSTA
                     EEADADTLTVAPNLVAQTVADGRLWVAAPCADDACLYAQVLMRLCALPQITTAYPPSS
                     STGTDAGMHGGGGAAAALAFVQRVIEVVKARHRAPTPDLRLEAYCIAALRQLCHRFRY
                     DHPIAARAPVEVVKLVCDFFFLHHHTPRHDVWRLETMQFLTVVLSVALSDVVGEELWQ
                     DLHAHSRRAAADADAGAAMVSPDAREMIYTAKSSERADLVDRRGTTGAAAVANRLLQP
                     PTRHLVVLLHQSVFPTMQLIFTQHRHEYSFTSRRELFSFPCSPLQEVFDFGAVVLYVT
                     SITHSAYCRWKAAQENRCGGGGTTRCGTATHQEKEWAEDDEDEEQMQRRGAGTGARRA
                     CKRLRDTESGYGDAVDEVARDKAVDASDAARAPPPASPHPAQLLAGALQEEFFIPAGP
                     LENCATAGRATTAGHNDQKRPPQSAATVTRRRAGGAPLVLRIGTSSIRASSAAVQDVV
                     SDAALFLLHLFAQPCATLRVPETVADGLVEDVLLPLCGYFGLRLGQLLLAAVQAVMPR
                     CSLATQQYAFAVVAQRALPTVPPVVARWAGCLDSVSSSRVPVARNDEDVLAPSEPVYH
                     VLVVLLEQHLHRRHELRLSTATPDGAPRSGQSAGAVGSGQPDVSSGSLLSGLLLSWGD
                     HHRALIQRGVARLHAWEQDMRRVCESAGATAVPAGVGSGAPDAPLPLLAASLALLLTR
                     FAALVQCTRLWETTLCPSTAMPADPGTTEAEPPRRHVVDDDHTWGLSDGPAGDVGLSF
                     LCHVAANATLFHGSVPVLTRASDGGRHTGDVAGGGVRVAGQAIGIGTDVLTVTSASPG
                     ARNALTGADTVALFSAAQFTAWLDLAETYACVALRMCLARQQVAEQTEMANSLRLGQV
                     PELGGMPSLSTSSEAMAPHLQGPLRREVGAYVEHVCTLLDAAVTSPSSQVPAVLCDAA
                     DAHWMLRLPLRKGVDCTDVRNSSVAAEEVAAIGEDAKTDTDAAAFGTGVSPLQMAVPR
                     RAAPQAFQVMLTLSAQASVAWLMRRAQLRHALAALTPAAVSRQEGYRRGGGGPPDTHT
                     AVRTGLDASAMALTLSVQCVQLLHLLLRWRRAALWSPPEESAHARDGVDAAGERGAAT
                     AGVAKVTPFLRPAADGTHASAASGCAEGAAADFDVGEEASAAREDLRLLRTSPDLYAA
                     PLSLLERFSAAGGGRLYYAVLWLCHHVAAELDQAHAVGVFFPLWTALHILFRDVGTVL
                     LDPAFACVDSRHTIARFTAALTARIFEDGVRGLSRWRPSNPTSREVTHIMAVSLHTSV
                     DTLRTVLWAISRTRIDAYVIEPLADTSAICRTIVALLRDQHLLDTAAADSCSTGDSAR
                     GSGEGDAAALGDILLPSHHRLLERLPFLPTILLALPPLLHLLALIGCLPPPPAKEDTG
                     AAEGLLCCRAVVQVLQVLFVRYRYQLGPGLCSGFLCGTVADIRWLDVRRRPATLRDAG
                     AQGSQGCSEAATFLYAHEGRLLERWTAQLTDPSRVDMPVCTPAWQRALLQAAFAVLPR
                     CEPGVAEVLGRFSFEFLAEKTPYEVRHHAALQVGTLFRTFSARRTQVFHSLLTKAREG
                     MLSSTETLCSTSLLALSEAVRAAPELLVDVLYTLLECWATRGFRHHPLVVACLERVSA
                     WVLEGAGLAVALASGASLPRSLPYTHLCRMHVRPLLFKWLCEYRHPPAALPVECFGYP
                     TQTAFVVQHLDVLSPLALLLLTEATEEQWSLVATRRGGGRCDAASAEGSLYERLVAAY
                     ADTLVAKAAKEGERAGEALGAARRRRRTEASGSDATAKQDEVPEAELQTDATAVSDAG
                     VLHRLAPLCMLLAYFPGIVTQLLVLASHAPVSPFTGDAAGLADPGKERDSRERAGWPR
                     RMGHADAAVEYRGSGGGHPSRASASDMTPTWAAVAQRCLYWLEAQFNTAEATMLAQSI
                     GLVLTTGRRQVSGDSAQPTFSAAAARAVLCNPATASSAAEVLLYYLQHRSAWPHKRRA
                     FDVVLAAQADAVMEALVVLHRTTAEVGTLVYGTPEQLQRALSWVAEKITSVPLPMPDL
                     RDPRTQHASSAEGCGAATAEEETTQGLVPRCTSSDLAYWEAYCLALLVPPAAAPNGEL
                     HSPVTDMPSARQSVDAAALTEDVMTRFLLQGNSTYLYALLHAAYRSSAALPSLELQFR
                     ALQQLSLLAHIATCWCSARVLAEPQALRLVLSHLLHWLRRSPAAAVRQLVCNALLHVW
                     QVARAGRGNVPRQRGRGPTPATQQRHCRLMLARSLAPLTAVSPLIAATWAALCRSDPD
                     LKRSDWQQRILAYLADTESQRATRVVAATAAEGKERVLARGAISFDEPTDDEAERNEE
                     GVARDGAPGASAGAGAVESEAAPGGCSLPLDGEQWTWAMYEAQRSACLAPLSSPRARG
                     RLLGLQRLLRYVSRHDEEDSDEALEDVPGTVEEHGSNADLDELAPPESCAVSMQLIVE
                     HASALPLPSAPLLQDITVAVDSAQALLVRCLHVASVCLRAGHVPPVAAGPTARCRSRV
                     RTGGSLRPAEWSALDVRAVLLDTIQHLYRVCHCNMAALPTEYADAADRFRPLSPVYVA
                     DEDAHGVHATRLQMLSADAADEQLLSAFRLLRALALCVVLSGEAATLPPCAAAKSSAP
                     SGMGSGSEWLRHEAQRSGASASTLLAASESGMADDSMPSNQTAEEMVAGMLAQAYAHQ
                     LRTLEQLVWCGDADASELGMCALRTWVLCIASSLDKKDGAELIRPAEPLSNFDEAVAQ
                     LVVSAWRQQLIMPSAATAAAAGARVGASGREQMPSPKARVRCCLQRHLAWVTRSGSCG
                     SLACRRRTEGGTRGGAADTHLRSPSVWAPLRQCPPNQRAFLCRFVLAAANTYGILKKS
                     LLWAALVPLLMAELRTAEGPTAVPTSSAGLPACDLDGVHAACNSAGSNVRIAEQLLLP
                     VLLHALCLRESEGQRAVRQEWSRQLDRYVFQQAERCTHTTRLFLHVVEQCHAVLLRST
                     RQRGLKGATTASAGRAKPTASSSAASAAASSDGARAEAVLWPSTLGSVPSLQDMGECY
                     WLSDIPAARLARAAVRVGEPHVALLFSQLSGESLYGPRTGAAALCGESETTQSAVMLR
                     DGAGAGEAVLAVSSAPYSILFPFAKPGDYPSAASVTHAVGGGATRSGGRARDRHDAVR
                     QQTRSFAEDIFDLYTSVQGQLELDDVVGVSLMIRLQSVTSAQPHGDGAKWCSLVGGGP
                     ALSASLLGSARSRSSGRAICRVASYRESGVMSATSLASGADDSLAAAPSAAAAWLDEM
                     RLLEESETHHASGRLCGGDVPRAGAAADSGLGGATVEVARHSAALTGEVQERRPDPGT
                     AHLQRAALLLQHGFSSTALDVLLSLHRTERRREAAVRHRSATVAAERGVTDDSVRACS
                     APERAAGRGAAVLGPEAFLTGATGEAIDAAAGDTDTLSSWTPAHEASLQALLAEATWK
                     CGRWSCGGGVAGDCPGSCPSECVPRAVLDRLSLCGNTGRPESRGASLMPASAGRFYVH
                     LLSAFITLTNEQPLLSMQYVRRAEWALRQQLSPTTFVTTIVAAEALNEVRDCAARFLA
                     ADAAAKKGETAKPSRGRGAAPQWTRGNRVVELPMWLQSLRDDSVARGSGRDAAELQTA
                     RVPSTVDYASRELLDSVRHALCQVYGDGEGWYQFVLGATEQALLNQDAAAAHRFLCDW
                     KEQHVEGTAGEGEPASPSPAIGGTVVTEVRGRARQLDLVLRTAQIAYGLGRWQEALAL
                     LQPAAAAARGEARLAHCNVALPRTAPWHAPQEPRVIQQLMVWHRELRLLPPSQLVRDP
                     FLSRAAASDSSGACSFLLARLCHTLAEDIAARLTSHEHRQLCESVEESKRLKADLEAQ
                     LEAATQPSTGRAAAPLHRPPSVAELDATTGATTAAVPPALVKSAGVAPLRETRGRSAV
                     ADAAAEAAVGAAPTVILSEDQLRVIRRRIRELAGDIKRLEDEWQSEKSNFGLYRRSAI
                     NAYSRFLQFNQVAQQGAARGVTEHTHRGAAARSEVKCLPVDHEEDVVHAVFGFVELWV
                     NAADMEQGGGEVLSRVLDKAVERIPTAVFVPLAGQLTAQLGDHREGERLAFLVARLAR
                     DYPMHVVWPLLALYHGHTFGKSRDVNTLHNVDEAKITAARQLLAGLASAQSTASALSR
                     AGHSTSTAALLPTQIRHAQLLSSAYLELALDRSAATAQVGKRHAICKDFMLIKDACHL
                     AIPPPCSVDPFVTPAVAGGATLAVPRVMRYRDYFTTPGGVNVPKVLQCELSDGTVVRQ
                     LLKAGDDLRQDALIEQVFATANRLFRRRSATRPLQIRTFTIVPLAPTAGILQWVEHTI
                     PLGEYLTGRYTGKEEVPGAHERYFPGEPNTRECRIQLQNAPQSSKCQVLLSLYEKFTP
                     ALHYFFLEEYLSAQVWVDRQQTFTRSVAASSIVGYTVGLGDRHINNILLHKGTAEVVH
                     IDLGIAFDQNKLLPVPELVPFRLTRNMIDGLGVRGTEGSLRPCAEAAMHLLRGKRELI
                     RTILSSIMHDPLARWAIGSPTHANHIMGAGAGDMPQESNTRQPAPVRTHGSSADAART
                     LARIDAKLRGYDGGDMLSVPTHVRKLMEDAQRVESLAVMFPGWSQWV"
     gene            complement(<60185..>60904)
                     /locus_tag="LMJF_02_0130"
                     /db_xref="GeneID:12981558"
     mRNA            complement(<60185..>60904)
                     /locus_tag="LMJF_02_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721570.1"
                     /db_xref="GeneID:12981558"
     CDS             complement(60185..60904)
                     /locus_tag="LMJF_02_0130"
                     /note="previous protein_id=AAZ10022.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981558"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:E9AC87"
                     /translation="MTSGPNNTTNIYDPIEVARANPYFKRNHMGQVTCTLCGIYCPEE
                     NNFLKHIAGKTHALQLERRQHKELRHLRLQEEERLNTEAEERARKEEALLALSGGQAG
                     SGAAGGAGALSSAAAAAANARFGTPLYSFRTEHDEVAYRTKVWIEVMFTQAEEGTRPL
                     HRWLSAREQHVEKPPDDYFVYLLFACEGYTTVALKFPAKANRSQPRDVLEEADGSTSE
                     AYWCSWDPLQKVYTLFFALSR"
     gene            complement(<61959..>64646)
                     /locus_tag="LMJF_02_0140"
                     /db_xref="GeneID:12981559"
     mRNA            complement(<61959..>64646)
                     /locus_tag="LMJF_02_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721571.1"
                     /db_xref="GeneID:12981559"
     CDS             complement(61959..64646)
                     /locus_tag="LMJF_02_0140"
                     /note="previous protein_id=AAZ10023.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981559"
                     /db_xref="GOA:E9AC88"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9AC88"
                     /translation="MEFRWAAEGKTEELRQWLRKHPERVNVPSKDSNMTLLYTCISNS
                     DHTNLASLQAGWSCCLSTVRMLCEEYKADVLAPNGGTCNTALHLAASTGAVSILRYLV
                     EVLRTPVDCTNTFGERPVQVAERHGQTECARILAAAAATAASAQSRERAAERCMPVQQ
                     TPPGGPHDAAAGALEGGSGRFQKVTVSDSDDDDAWRKTSNGGAGAALSQGGLGRERST
                     DGAGPPSLSTQAMQRGGSSNGATAPFISLDGRSVSAVVGEARPPPPSRNPNEASAGNA
                     PGSVGVPFMRASSDCSAFSTLPTPVRSRKEYDISSSRILANPDLQGFRFAYGDGFKYI
                     QCSDHYEIRGILPYTYRGTVYYTPVIISVYAPTSATDSSENPTGGGPAGGSGAADAAL
                     SNRDRPFPFMGPAGARASKAVSPASNTTAKTYVYCRYRVCINIQSLNGFAISRRAEYV
                     DPISGAIIPAPGDDKYQTLTTYIRNVVVRNFEAVPPLILPTSSYAFPARPNVSQLGSS
                     GSADVYHHHHSHNAPAFMKSALPKRSAAHIRCATLLRDLSRFGDGLARYVPSKHRIIA
                     YVPIFSEHKAAVLAMPQERPYATTVGQSPQPAVANAAAAGATTFSAESVAPVAGGKAG
                     VTQQVAVEAVAELQVRVVIQFSPTRIGGAAGEGDAATDGEACVYAQPPRIYLVDAAAS
                     PSTILRDGAAPATAGAAGAPLFSSAPSSLTAQCFAGIIKDRETGEVFAEVLRLSQDSW
                     SASGSVYDILVELQRALRGVLESFAMSYTGRNAGSPPARQEQPSSGSVDCMADSPRGA
                     PVVPSTLDILFSSPTTQAQLSPSGASGDVSGAVQRSSAGYCLYCVQPLHPSRVLLQPC
                     GHGGLCGLCVQRLQSHCREEVFACPVCRGAVQNVLEVFL"
     gene            complement(<65898..>71780)
                     /locus_tag="LMJF_02_0150"
                     /db_xref="GeneID:12981560"
     mRNA            complement(<65898..>71780)
                     /locus_tag="LMJF_02_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721572.1"
                     /db_xref="GeneID:12981560"
     CDS             complement(65898..71780)
                     /locus_tag="LMJF_02_0150"
                     /note="previous protein_id=AAZ10024.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981560"
                     /db_xref="UniProtKB/TrEMBL:E9AC89"
                     /translation="MAMEEAAQEVRRILCQNDVEETLNYLSTVTRCIEDNQHDLRAVI
                     GNSYRDLLGACDGVVGMERDCADILTIEEAMERASATRDGDGRGNAEMDTEPFLPPSW
                     FAVRLRRQRRAAATTLTTTADNNNTASSDKSPRLSATKGFAVTNGGTRSEGDRGASAT
                     TAAAAADHGAHRGRKTEFNAALALPTVDLPLPHAAPTHTSTQCAHRDAVVVDEETGPA
                     ALAAQRMRLDDELQALHLDYMTLASATASMARGAAAADAELSSLLADSSALTSLLRPA
                     HQHDEQQDRHSPGPSHHAASDAVALSAASGEKREAPLRALERDQPLVRLARRLHRVQA
                     SLRVYAGGNSGAQSAQCVSDPATASSAALAGLSVDSTLHSANRPPSWATGIQRRATAL
                     EARLVKLMLLRLRRAADDYASLTEQVSKVPSGADLGEPLTEARAMRAAEERHRMYVWV
                     VFTQCHAALWALRDSPTLVNALVACAPGAALPAKRACPSGIAGTESAAAPPTMASLDS
                     AVDTLFQLATQDVRVVVSAVMDGAVSVASVPAGRTAGDEALPGAADPCRMLLAFLAVL
                     LLRESQLSAARWAAVAPSLLPAALPSSGAQPAVTPADASPQPPPVLPDGSVGNQSTNA
                     VVGRTSNCAKSEGGAPPSSHTATSPEARVFATATHLWALGLAAATADGPKASTAASVA
                     TGSGTSNTAWALRCFSGLAHLLRAFADYVDLVQAALAEVASTPAVLDKETAALYLLQR
                     ICVAAAAAAEEQLGATDYGTSAAALARREDERPTFPTPAMASGARSLDELLQWRLRTV
                     CGSAAAEGVPGDGPGTPHGSLMAAGAGVLPPPIGSNGTPMTPMGGPDGVTSAKVLSGV
                     APSHSGAVARRRAYVELLRASVNTVDELQASGASATALGGRSLSVRADVAATENTSAT
                     SAAAELVPPLRLVCHQLLAPFVSSLVVLLARDPVALAVYGEGQSNPDIRPAMQAARDA
                     LERLLPNGTQQCSLSGTQGTRMPSSFSGLGQTWAAVSAARWWELVEQTTMRAALQRCV
                     TVALESVGFVEACISQGLAASAYRMLQSSAESSQTKLEHRVSSAGGGGDTSRGPTGAS
                     ALECTWSALFSVLRLHALSTVDSLSGAGGAGSLEGAEISSGTETGHGAVHECDGATTS
                     ASISGHTGRRGERGSLSSAMTGICWDRFRPRTATGAADSAHRSFGTTSGDSIFREEGL
                     EWGRAAYQAAQLPLSALPDATNAKRTEQQQQQQQQQQTRGGAAVDAGLSASQQAQLAK
                     ILSGMRDKLFPDWVVRGIDENETTSGTRPGALHMNGHAAELLHRCLLTLVEAVQAQTA
                     SVQASASKDSAGSLPSTPPLLHMRIVGWLKDALHRVEVQLRDAEPSAPLNGANATVVH
                     SYELSLLVRVYLEVLQRLQMVALPSEATKVRQLCTEAEDLYERAQTPWQDMLTQFYRA
                     ALQQAYHSVLRLRESGAEELRHSAAASRAGAALRRMTHLMDSAAWVRAPMAGPTAPDG
                     NNPSGSHGVAYPVQPTPAVMTLTQVVLRYFHQALYGAPSVFSDWPVPFMSFPSRTGAA
                     YSAASVPEQGQSGAASAAASVGFRDDRGCRLHVLVTGKVQQRALERLAATSAELYEFE
                     LCPLVDVVGGNGDSGVAARFSALPAGNAAPTTAAAKQNQADDLRLQWYMDVLFTSSVW
                     CAGSVSEGGSSSSAGLFAPDTGGSGVGVDATACVAEGLLRRVVRHLESTCDPVRWRSG
                     VPLILAAYRQFVSASALLWVAHSKERRDAAAGDTRNEGAPCATSVAAAAAARPFSATG
                     AMAAEPPLTERLLLPREEVNRLALLPIAASSSAALAAASIGAGGTPSEAAARAAALAP
                     QTYSLLSPRASELNPCAPSSSSSVGVPPAGPYCFGGPSSALAAAAAAGASGGVGINSL
                     LRPANGGHSASEALLLGGIGAADMIGVGEVSVPAGSSSAAAASSLWGTTQRGWSQLWG
                     TS"
     gene            complement(<72164..>72463)
                     /locus_tag="LMJF_02_0155"
                     /db_xref="GeneID:12981561"
     mRNA            complement(<72164..>72463)
                     /locus_tag="LMJF_02_0155"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721573.1"
                     /db_xref="GeneID:12981561"
     CDS             complement(72164..72463)
                     /locus_tag="LMJF_02_0155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0155"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0155"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981561"
                     /db_xref="UniProtKB/TrEMBL:E9AC90"
                     /translation="MPSRARTHTCEHMCVYSVPSFSPSTPFPLPVARDTSVYTRCKLP
                     AISTYACRHILFFLAKSVLAHQQLQHIDTHTHTHTHTPVLTTTPCPTNTIFLQLT"
     gene            complement(<77219..>79672)
                     /gene="SCGR6"
                     /locus_tag="LMJF_02_0160"
                     /db_xref="GeneID:12981562"
     mRNA            complement(<77219..>79672)
                     /gene="SCGR6"
                     /locus_tag="LMJF_02_0160"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721574.1"
                     /db_xref="GeneID:12981562"
     CDS             complement(77219..79672)
                     /gene="SCGR6"
                     /locus_tag="LMJF_02_0160"
                     /note="previous protein_id=AAZ10025.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981562"
                     /db_xref="GOA:E9AC91"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC91"
                     /translation="MSHLTSPILLKRRASTFRVCAVGDVINVQSLGMEGSESSASFMG
                     HDAFTYSSQLPDTVSAISPGDSVSHEPSTCVFTSSPGTRRFRPASLTLRRNFLKQFSG
                     GACRAILRAVLVLVLLIMLYTLVATNLSEDAFADSVRDPIGYLLNLRDPEHDPWSVLV
                     QHEDAVSRLNIAPQQNCRIGSMLCSPLRIGAAFLPSWTLRVVERDCADCMDTYTYRTT
                     VKGVRLHKRHGVYATSSAPLGRVGPMLLAMTSVTDDVNVRTELPQWEWLRHVYGEGFP
                     TVGGAGEGAAQPRRPYLAVMGIPSTDQPARAALREAQRRTWLTYQEVARTENHFDAAL
                     LALYVFAAVEPKAAPDASESSSASAHNGTSAAEPRRGRLSALLPTTTEYKAATEALLT
                     ATAQAEGIGDLAAEGIVQRRMELRRNWNIAAVEDTPCADVISRRVTVGAETSALLYLS
                     GALSLPVTPAFTSPAEYVCHASSALWQEALTHRNVVWIDMMTDRRPTTNKKLGEDGKW
                     GLPVEVGMSQKLILWLEYAYHAFKNVPFIIKGDDDSYVKVPQFLSDVRYVMGGAQKRV
                     PPPAVDGVQNSAYAVDVNATECAYWGSTRVFKNAQFNAGMTFMVHRLLAQVVLEQRGE
                     EKQVDAVKMAMMEFDANLSKVYRAARFHQEDILMGLLIRGSLRRAREICPNNRVWYVR
                     EGFARFHDLHRGRMHDVTWSTVVAHRCTPADYYYLHHFFQKELGATLAGLNGRSRAEK
                     DAVAQAAEWVAERRRSTGPAVVGWDTLPEVRWVRALKRTPAYDMAEADGVPVYHNKYE
                     YWANPATSVDDGYCSLPQK"
     gene            complement(<84201..>86732)
                     /gene="SCGR5"
                     /locus_tag="LMJF_02_0170"
                     /db_xref="GeneID:12981680"
     mRNA            complement(<84201..>86732)
                     /gene="SCGR5"
                     /locus_tag="LMJF_02_0170"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721575.1"
                     /db_xref="GeneID:12981680"
     CDS             complement(84201..86732)
                     /gene="SCGR5"
                     /locus_tag="LMJF_02_0170"
                     /note="previous protein_id=AAZ10026.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981680"
                     /db_xref="GOA:E9AC92"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC92"
                     /translation="MEEEFTSSAAKRRGNAGVGAGYAPLHNHTFPHLTAPFMCSDECA
                     GERTKLQHELSNAANEFAVSSLLTWPLLFMARTWAPASLEHRAHASATPDPHLPCPKC
                     PASSDATAKTRYRQSFLHVGKRRPLRLVMVMAVAACILFLSLIVLLFRGSALPLKPRG
                     VLNITTLQPMKELRGRAQGTGVLVQHEDAVSRLNLTAAQRACIVAGAAYGACGLVHLS
                     ANELPSWTLRVVERDCADCMDTYTYRTTVKGVRLHKRHGVYATSSAPLGRVGPMLLAM
                     TSVTDDVNVRTELPQWEWLRHVYGEGFPTVGGAGEGAAQPRRPYLAVMGIPSTDQPAR
                     AALREAQRRTWLTYQEVARTENHFDAALLALYVFAAVEPKAAPGASESSSASAHNGTS
                     AAEPRRGRLSALLPTTTEYKAATEALLTATAQAEGIGDLAAEGIVQRRMELRRNWNIA
                     AVEDTPCADVISRRVTVGAETSALLYLSGALSLPVTPAFTSPAEYVCHASSALWQEAL
                     THRNVVWIDMMTDRRPTTNKKLGEDGKWGLPVEVGMSQKLILWLEYAYHAFKNVPFII
                     KGDDDSYVKVPQFLSDVRYVMGGAQKRVPPPAADGVQNSAYAVDVSATECAYWGSTRS
                     VKSVAFNAGMTFMVHRLLAQVVLEQRGEEKQVDAVKMAMMEFDANLSKVYRAARFHQE
                     DILMGLLIRGSLRRAREICPNNRVWYVREGFARFHDLHRGRMHDVTWSTVVAHRCTPA
                     DYYYLHHFFQKELGATLAGLNGRSRAEKDAVAQAAEWVAERRRSTGPAVVGWDTLPEV
                     RWVRALKRTPAYDMAEADGVPVYHNKYIKYSSKRLGIEHGIVSLP"
     gene            complement(<90005..>92833)
                     /gene="SCA2"
                     /locus_tag="LMJF_02_0180"
                     /db_xref="GeneID:12981679"
     mRNA            complement(<90005..>92833)
                     /gene="SCA2"
                     /locus_tag="LMJF_02_0180"
                     /product="phosphoglycan beta 1,2 arabinosyltransferase"
                     /transcript_id="XM_003721576.1"
                     /db_xref="GeneID:12981679"
     CDS             complement(90005..92833)
                     /gene="SCA2"
                     /locus_tag="LMJF_02_0180"
                     /note="previous protein_id=AAZ10027.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,2 arabinosyltransferase"
                     /protein_id="XP_003721624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981679"
                     /db_xref="GOA:E9AC93"
                     /db_xref="UniProtKB/TrEMBL:E9AC93"
                     /translation="MLHSRARTKPKLQQTESSAGAEARRGRDRGACVHGRRCLRGPLP
                     FSCCPVLPTPTSFSRADTLLFSRLPLAVRHAGSFQWPDLRHSHDFQRSVLRCCCIFLV
                     QRREHTTSMRGDITASFGLTARAFETHSCAEGRNQTGTQATRLSHAHRRPFFPRRHHC
                     CAILVSCITIMYLLSTLHFLVMEPDVSRENAAVSGNETSTNISSPGIRLLTNELELPP
                     IRVMAADHTCAMCTNGVVYTQTGEEGGPAAAASRPENVTAMVCRKVSKEEVDVLTSAE
                     ECVARLHRLGMLHAVAAREEDVNASCVRVTVPAIVGRMSGGSDSCPAFLAEIRPGIDK
                     HAKLQVWFPRMPSWPLPGSRALPYVGTAAVRDTDIDRDVAPPVSVEITSDGSTIVLQF
                     GRDATSTVPEAFELRCPTHFFSVLVGRWGRQHNQLQELLHSLAFARASNRTYVLPSFT
                     PDTNLPYVRYSASNLYGFNAIRREGQYCLVTNAEVKPIFAQLQAMGVVMDMRRVDYMG
                     VVKPHLSPQQMAQEIVRRWWVLPPVRDGVRKYNLESWFADSRSFSPPLRSVADYRADS
                     VLFRESVEPLMGDDLFRTPTEAEQYSSWDRIKMFASRMLEVLGGDHVGDDAAGGAAQV
                     RMAVISGKVAYFFHPQLEEVTRLFGLLRPSAHVSAEVDRMYSKSAAALGWPTTGSTKD
                     ADGQLVMRDTLRLANFKGVIGIHARLRERTCRAEAMRLWDTNLALTVDRYTVDSTDPN
                     WAGVKSMVSSIESDCSWTAESAVELYLQYAHWLRSTMPATFGHDYVPTTYVAYDDQSG
                     PMADDMERIIQLLPEEVVVKDIGNLTAQYPRRFVASYDGRIKTSLRAVYNAARAKAVE
                     QLEVHASSPNYYALLQKALLNMLYEPGLREMQAMSLDYIVLTNTEVFRGNIISSVATN
                     VMLRRWGRGLPAHGLLAGYLESFYTGLY"
     gene            complement(<93562..>97107)
                     /gene="SCGR4"
                     /locus_tag="LMJF_02_0190"
                     /db_xref="GeneID:12981673"
     mRNA            complement(<93562..>97107)
                     /gene="SCGR4"
                     /locus_tag="LMJF_02_0190"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721577.1"
                     /db_xref="GeneID:12981673"
     CDS             complement(93562..97107)
                     /gene="SCGR4"
                     /locus_tag="LMJF_02_0190"
                     /note="previous protein_id=AAZ10028.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981673"
                     /db_xref="GOA:E9AC94"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC94"
                     /translation="MYICIRSLRSSARFLEETFFVLRERERGRGGGRGGGGRLHFRVF
                     WQSSARVRKGGVHARACGPADTCSYTHTHRRHLAAEVRGCIAPLVVFSLPPLPLPPSP
                     PGHCLRIPLVFRSDSRLWLCVCVCVAGGFVYSFSSPPPTFSFFFVSHCSAACVCARTR
                     TGAPAPSLSLSVCVCVTLAFPVSVAQELAMSDEEHLRQGHLSSLALVLNRYGADDSEG
                     GGGPAAYKCKASSVDGALASSATAQSVMVTGRTDLGGWRGTSSQHPSGRGSQHASAHT
                     VNSAPTLPLLPQPPHMFAATTIASVAPTTPPEPSMKAHGSTHSIWGELRMAAGAAAVE
                     GSVQPHRRDRAGLEENDARLLPVFLPPGPSAAAAAPSSVLRGSSWHRRPCACWRGRCS
                     QVSLRMGSAAQTGHRWLRRYLRGTLEDAEREKDTSRRQKRRLGVRGLLLVSIVCIALM
                     VFDVYSCVVRRLRRPHVPSWNGTLSILVQHEDAPRRMRLQYSRKVKWIHLPSWTLRVV
                     PARCEDCLDNDTYVIALQRAVDGLERMQREDNARQRAELQAPHQQQQQPHAFGVGSGA
                     ASNVGAHGETAAPLTTVALEDLLRAKGGPYAVFANIGAPLGTIGPMLFAMCSLTDGVD
                     VAAELPRWSWLRHASISSEARAAGPSPYIAVMGIHSADTVSHAQLRDAQRSTWLRYTV
                     VARSENDFQGRLLPLYILAAQEREAATDPTWVGQDEDTGPVAAAEFCRPTLQEFADAT
                     NFYRALAVSASSGGAALGSFSYRQRRMSLRPEWRTSDLTSSPCDHIISSTLHGSADSP
                     RPPLAVLAEHLRLPIIPAFTAAARFLCEASSGLWTEALQHSDVLWIDMLADRRETAKT
                     ERGDSRWRMAAQVGMTQRTVLWLEYAYHAFPDVPFIVKCYDDVYVKVPQIVSDFAYVL
                     SGRRHRDLDANLMDNDGNAPLPVDAVRGAGDTLRTDAPLAAASQLRLPRSPESECVHW
                     GLRDEKHFLQRQHMMTRTLARVVLEKPQEAYGTKGLRDVALLSLRDFNPIFADIYTDV
                     AMTEEDRFIGSVLHDRRARAAQLCPHRRITRVEETMSRFHDLRRDARGIVTWASVALH
                     RCTPADMYYLHKNYFVEEHRLSGGTTPAEAAAAERVAQERGAQWIRANINASLGPGWD
                     NLNPVLRVPYSAHPEDAKPGILLLQDGVAVYNITF"
     gene            complement(<99209..>101530)
                     /gene="SCGR3"
                     /locus_tag="LMJF_02_0200"
                     /db_xref="GeneID:12981678"
     mRNA            complement(<99209..>101530)
                     /gene="SCGR3"
                     /locus_tag="LMJF_02_0200"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721578.1"
                     /db_xref="GeneID:12981678"
     CDS             complement(99209..101530)
                     /gene="SCGR3"
                     /locus_tag="LMJF_02_0200"
                     /note="previous protein_id=AAZ10029.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981678"
                     /db_xref="GOA:E9AC95"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC95"
                     /translation="MRLDATRMWRRRAGPRKRPAGLLVDMALYLSCLLVMWWLLRWLK
                     RSHQPSEAQLVRHLGRLSHPWAVVVQHEDAVGRLSTRVLEEERRARCGRGPAVRVGAC
                     NASLLLSPHMLPSWTLRVVERDCADCTDRQTHDSAVQGVELQPQHAVYATSSAPLGRV
                     GPMLLAMTSVTDDVNVRTELPQWEWLRHVYGEGFPTVGGAGEGAAQPRRPYLAVMGIP
                     STDQPARAALREAQRRTWLTYQEVARTENHFDATLLALYVFAAVEPGVSLDTPTNGKT
                     TAAEPVRGVAHVTDSAKRCYNRSALLPNFTEYGAASQALAAGSATAGGLVEGVERRRV
                     ALRSSWQLEDVVSSPCDRVIRLPYAEEGAATPALLYLSGALSLPVTPAFTSPAEYVCH
                     ASSALWQEALTHRNVVWIDMMTDRRPTTNKKLGEDGKWGLPVEVGMSQKLILWLEYAY
                     HAFKNVPFIIKGDDDSYVKVPQFLSDVRYVMGGTQSRQASLQLYRFVSGARDEAVGFR
                     GVTKAVAPAAADADAYANVTPTLKAPSLVEEAECVYWGSLRHHLHTQFNAGMTFMMHR
                     RVAQALLEPKASRHRLDIVRLAVEDFATRRTAAYRRIMFHHEDILIGLQIYRALPRVK
                     ELCPNGRLWYVKEWYARFHDIHVGRTHNVTWSTVVAHRCRPSDSYYLHYYFREEHRIA
                     AATGRYATEEEHEAAAVQMAARWVTEMQKDPLMMTLNWSGLPDVQWARNISRRPPFTL
                     AEGDGVAVYENRYEYWTHEATNIHDGYRSLPQW"
     gene            complement(<103804..>106395)
                     /gene="SCGR2"
                     /locus_tag="LMJF_02_0210"
                     /db_xref="GeneID:12981677"
     mRNA            complement(<103804..>106395)
                     /gene="SCGR2"
                     /locus_tag="LMJF_02_0210"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721579.1"
                     /db_xref="GeneID:12981677"
     CDS             complement(103804..106395)
                     /gene="SCGR2"
                     /locus_tag="LMJF_02_0210"
                     /note="previous protein_id=AAZ10030.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981677"
                     /db_xref="GOA:E9AC96"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC96"
                     /translation="MEEEFTSSAAKRRGNAGVGAGYAPLHNHTFPHLTAPFMCSDECA
                     GERTKLQHELSNAANEFAVSSLLTWPLLFMARTWAPASLEHRAHASATPDPHLPCPKC
                     PASSDATAKTRYRQSFLHVGKRRPLRLVMVMAVAACILFLSLIVLLFRGSALPLKPRG
                     VLNITTLQPMKELRGRAQGTGVLVQHEDAVSRLNLTAAQRACIVAGAAYGACGLVHLS
                     ANELPSWTLRVVERDCADCMDTYTYRTTVKGVRLHKRHGVYATSSAPLGRVGPMLLAM
                     TSVTDDVNVRTELPQWEWLRHVYGEGFPTVGGAGEGAAQPRRPYLAVMGIPSTDQPAR
                     AALREAQRRTWLTYQEVARTENHFDAALLALYVFAAVEPKAAPGASESSSASTRNGTS
                     AAEPRRGRLSALLPTTTEYKAATEALLTATAQAEGIGDLAAEGIVQRRMELRRDWNIA
                     AVEDTPCADVISRRVTVGAETSALLYLSGALSLPVTPAFTSPAEYVCHASSALWQEAL
                     THRNVVWIDMMTDRRPTTNKKLGEDGKWGLPVEVGMSQKLILWLEYAYHAFKNVPFII
                     KGDDDSYVKVPQFLSDVRYVRNGVKRGRFSPPLPRPPAMARARGSSATKAATSRRARH
                     TYDRLPVDRTKCFYWGSGRRMLGVRFNAGMLFMLHRRLAQVILEPPQSSSDVDLRTLA
                     VADYSNDRRSLYRQAGLHHEDVMIGVTLRNRYNRSMELCTDETIWYVKESYNRFHDLH
                     RGKLNPVTWSTVVAHRCRPADAYFLHYYFQNEYSASTVEIARGDDREEVAIEAAAEWV
                     AEQRNAFSDSVPGWDDLPSVLWTHRASAAPEYVVATGDDVAVYNYSYQYWRDNSTFVW
                     NGYRSSR"
     gene            complement(<109659..>112487)
                     /gene="SCA1"
                     /locus_tag="LMJF_02_0220"
                     /db_xref="GeneID:12981676"
     mRNA            complement(<109659..>112487)
                     /gene="SCA1"
                     /locus_tag="LMJF_02_0220"
                     /product="phosphoglycan beta 1,2 arabinosyltransferase"
                     /transcript_id="XM_003721580.1"
                     /db_xref="GeneID:12981676"
     CDS             complement(109659..112487)
                     /gene="SCA1"
                     /locus_tag="LMJF_02_0220"
                     /note="previous protein_id=AAZ10031.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,2 arabinosyltransferase"
                     /protein_id="XP_003721628.1"
                     /db_xref="GeneID:12981676"
                     /db_xref="GOA:E9AC97"
                     /db_xref="UniProtKB/TrEMBL:E9AC97"
                     /translation="MLHSRARTKPKLQQTESSAGAEARRGRDRGACVHGRRCLRGPLP
                     FSCCPVLPTPTSFSRADTLLFSRLPLAVRHAGSFQWPDLRHSHDFQRSVLRCCCIFLV
                     QRREHTTSMRGDITASFGLTARTFETHSCAEGRNQTGTQATRLSHAHRRPFFPRRHHC
                     CAILVSCITIMYLLSTLHFLVMEPDVSRENAAVSGNETSTNISSPGIRLLTNELELPP
                     IRVMAADHTCAMCTNGVVYTQTGEEGGPAAAASRPENVTAMVCRKVSKEEVDVLTSAE
                     ECVARLHRLGMLHAVAAREEDVNASCVRVMVPAIVGRMSGGSDSCPAFLAEIRPGIDK
                     HAKLQVWFPRMPSWPLPGSRALPYVGTAAVRDTDIDRDVAPPVSVEITSDGSTIVLQF
                     GRDATSTVPEAFELRCPTHFFSVLVGRWGRQHNQLQELLHSLAFARASNRTYVLPSFT
                     PDTNLPYVRYSASNLYGFNAIRREGQYCLVTNAEVKPIFAQLQAMGVVMDMRRVDYMG
                     VVKPHLSPQQMAQEIVRRWWVLPPVRDGVRKYNLESWFADSRSFSPPLRSVADYRADS
                     VLFRESVEPLMGDDLFRTPTEAEQYSSWDRIKMFASRMLEVLGGDHVGDDAAGGAAQV
                     RMAVISGKVAYFFHPQLEEVTRLFGLLRPSAHVSAEVDRMYSKSAAALGWPTTGSTKD
                     ADGQLVMRDTLRLANFKGVIGIHARLRERTCRAEAMRLWDTNLALTVDRYTVDSTDPN
                     WAGVKSMVSSIESDCSWTAESAVELYLQYAHWLRSTMPGTFGHDYVPTTYVAYDDQSG
                     PMADDMERIIQLLPEEVVVKDIGNLTAQYPRRFVASYDGRIKTSLKAVYNAARAKAVE
                     QLEVHASSPNYYALLQKALLNMLYEPGLREMQAMSLDYIVLTNTEVFRGNIISSVATN
                     VMLRRWGRGLPAHGLLAGYLESFYTGLY"
     gene            complement(<113216..>116194)
                     /gene="SCGR1"
                     /locus_tag="LMJF_02_0230"
                     /db_xref="GeneID:12981672"
     mRNA            complement(<113216..>116194)
                     /gene="SCGR1"
                     /locus_tag="LMJF_02_0230"
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /transcript_id="XM_003721581.1"
                     /db_xref="GeneID:12981672"
     CDS             complement(113216..116194)
                     /gene="SCGR1"
                     /locus_tag="LMJF_02_0230"
                     /note="previous protein_id=AAZ10032.1"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase"
                     /protein_id="XP_003721629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981672"
                     /db_xref="GOA:E9AC98"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:E9AC98"
                     /translation="MSDEEHLRQGHLSSLALVLNRYGADDSEGGGGPAAYKCKASSVD
                     GALASSATAQSVMVTGRTDLGGWRGTSSQHPSGRGSQHASAHTVNSAPTLPLLPQPPH
                     MFAATTIASVAPTTPPEPSMKAHGSTHSIWGELRMAAGAAAVEGSVQPHRRDRAGLEE
                     NDARLLPVFLPPGPSAAAAAPSSVLRGSSWHRRPCACWRGRCSQVSLRMGSAAQTGHR
                     WLRRYLRGTLEDAEREKDTSRRQKRRLGVRGLLLVSIVCIALMVFDVYSCVVRRLRRP
                     HVPSWNGTLSILVQHEDAPRRMRLQYSRKVKWIHLPSWTLRVVPARCEDCLDNDTYVI
                     ALQRAVDGLERMQREDNARQRAELQAPHQQQQQPHAFGVGSGAASNVGAHGETAAPLT
                     TVALEDLLRAKGGPYAVFANIGAPLGTIGPMLFAMCSLTDGVDVAAELPRWSWLRHAS
                     ISSEARAAGPSPYIAVMGIHSADTVSHAQLRDAQRSTWLRYTVVARSENDFQGRLLPL
                     YILAAQEREAATDPTWVGQDEDTGPVAAAEFYRPTLQEFADATNFYRALAVSASSGGA
                     ALGSFSYRQRRMSLRPEWRTSDLTSSPCDHIISSTLHGSADSPRPPLAVLAEHLRLPI
                     IPAFTAAARFLCEASSGLWTEALQHSDVLWIDMLADRRETAKTERGDSRWRMAAQVGM
                     TQRTVLWLEYAYHAFPDVPFIVKCYDDVYVKVPQIVSDFAYVLSGRRHRDLDANLMDN
                     DGNAPLPVDAVRGAGDTLRTDAPLAAASQLRLPRSPESECVHWGLRDEKHFLQRQHMM
                     TRTLARVVLEKPQEAYGTKGLRDVALLSLRDFNPIFADIYTDVAMTEEDRFIGSVLHD
                     RRARAAQLCPHRRITRVEETMSRFHDLRRDARGIVTWASVALHRCTPADMYYLHKNYF
                     VEEHRLSGGTTPAEAAAAERVAQERGAQWIRANINASLGPGWDNLNPVLRVPYSAHPE
                     DAKPGILLLQDGVAVYNITF"
     gene            complement(<118452..>121166)
                     /locus_tag="LMJF_02_0240"
                     /db_xref="GeneID:12981675"
     mRNA            complement(<118452..>121166)
                     /locus_tag="LMJF_02_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721582.1"
                     /db_xref="GeneID:12981675"
     CDS             complement(118452..121166)
                     /locus_tag="LMJF_02_0240"
                     /note="previous protein_id=AAZ10033.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981675"
                     /db_xref="InterPro:IPR021067"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:E9AC99"
                     /translation="MPKASASSSAAAATAVHGRGHLRPLKRLLCCASRAHYTLRALGF
                     ASDDDTPAKMSQTLACLCAAVGVLLVLLLISFAALVVVLVVVVPDARQHLSQTIGPLL
                     DSNTRRDGNTAGGGGGGDAASRASAFDRKIRRLLASEGLEAFFREAHRAAELRRRVLR
                     NATLLAALRKANAARGKDGGHGVNLVSLAQTLPELEYLSFLLAQVSAHVRAVQEHDPV
                     MGLVELSDFLLNATGRKEALEKAAERALAEVADARPAARGASTIGDAAAEWNAALKES
                     FAGRSEAARLRAQLRGFVGVSSFETERLTEQPFDDLALLQYRHAWAKSEVLPIMRARL
                     RRAGAQADEEGPNAAALRNNAVSHTPQNRPGHESSAPLRPQDVANRMAMKADLYEVAS
                     IFNHIHYYPLRRYSAIRPYGGDSVANTDAWYSAIAAVVQTRFGVPITSNTAQTAEAAA
                     LPLIQRDSPLSVLALPRLGLERVDEVAHLYTREDRQLMPHALNSKSAESTHTIFVSIA
                     SYRDMECAPTLLNLFRTARNPHRLYVGVAQQNRAGDTPCLVPELYTPYLCPSDGVQGA
                     AGDGSVGAARELRARARTLYGKGVDLTTSTEGPEARYFDARVCLVAEQVRLREIDSSQ
                     AKGPTYGRYMAMLLYRGEDMTLVLDSHNRFRPMWDVLGATMLRRLEDPKAVLSHYPES
                     YRGEEADFQPYRTTTAYLCRAHFMNKFGYLRLNGIVIRSASEFAKNNVYNDPYVRVQS
                     AEIDPATNHRLPQPWVAGGFLMSFATIFRDVPFDPHLPYIFDGEEVLYSMRLWTHGYN
                     IYTPARGLCFHIYTRSSAPKVWSETPQWYTTQTRVRQRIQFFLQTRPLNKEDVLVPAN
                     TTNPYVIIDSSRYGMGKQRTVAQWYDYAGVDPIKYKLDGRWCGVDKPD"
     gene            complement(<122781..>126104)
                     /locus_tag="LMJF_02_0250"
                     /db_xref="GeneID:12981563"
     mRNA            complement(<122781..>126104)
                     /locus_tag="LMJF_02_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721583.1"
                     /db_xref="GeneID:12981563"
     CDS             complement(122781..126104)
                     /locus_tag="LMJF_02_0250"
                     /note="previous protein_id=AAZ10034.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981563"
                     /db_xref="UniProtKB/TrEMBL:E9ACA0"
                     /translation="MWRTMHGRGEDAQVGGKATRHPLTPGNPTVSLVPGAGADGDAPP
                     SGSDRGADPYTGSLEELVRLLRIYAAHRGVRVNHTYDTLPAGIAAAAGLTDSGNNSQR
                     DAGARVAGLQLPGVELLHGLYGDGGEAGGHLSANWVLDEPEMITAEQETYVERYLVPT
                     QAEVELTPLRVISSYYSMQGSRSLHRMAADTEKAMNGDGYAKYIQRSRTFYDVSHAAR
                     RGYGQEGSIFVAVPFTLTDITAAMVDTIRRRASTVETSSQAQQPASSSPLEARDDGFH
                     ELRFTAARCAMTVESLFRQAHRGVAVTVGTLDVVTVSGVSSAAELDFSKPSNVTFPLR
                     AEDRAGLPHTRRYSRITCEPPDFASGWDDASYGFRWKDNLRRRRVVVPLTQLDAASAA
                     QADLPHVDGAAAALERYFAFPYVGNYATLQLYRGESYVFFLRTGSLALPNWDLKLRLL
                     YLRTPARNRAVLSSRPTPRVAWTALAASVAKMWDTEPFLRLSLATASRQRNGEDATGD
                     DMAVVATAPPPDKMGSRLLAALPADVSSWLIAARTEAELVLWLVTPSWLWPTMVETLA
                     AVRQLAASPDSPPPATASSALRLLFASDAVRGVLGDGLSTLMQADLNTVQVDPVRRSE
                     GAAAAAASPRGQRVVNLRGGKSPTTNNTSQAVLSASLTASEVYELLFLAEKRPPMQEQ
                     PVVRMPQSESTIKWVPSSDSGAAAERLCGEATSEAPYYSVADKALLKRSFEYCWLKRH
                     RKAVRQRLNRLVHATTAATVLKATPGTKASAAGAAAAAKCSRKRGFVEAEVVPRSSVC
                     LADMRYLEPMETTWLAGAGGGTLGDGDSADREWHAADLRSPRQENSWFTSAVNAGKVH
                     GVATAASLVSQAADGTEEPQLNSPRSPKDAASTPVEPTPYVLQAVASSDLLFGPAEVF
                     FEFDTEHQLRTGARSLSEQLAERRLHRQGLTATAAHARVPEAVELDPSLQFMDSDLED
                     VYMTQALWTRGWNIFGLTEPVAVGTGEEELSSSASATAPTSSSARDDGPCTVDEAADG
                     VPSELSNARTFTQDKFWALVMAHRDAGTLLGATAARNHSSTPPGSSPPLYPLRRTMKE
                     WELFADMQLTTLRDALRSP"
     gene            complement(<127085..>127909)
                     /locus_tag="LMJF_02_0260"
                     /db_xref="GeneID:12981564"
     mRNA            complement(<127085..>127909)
                     /locus_tag="LMJF_02_0260"
                     /product="small GTP binding protein rab6-like protein"
                     /transcript_id="XM_003721584.1"
                     /db_xref="GeneID:12981564"
     CDS             complement(127085..127909)
                     /locus_tag="LMJF_02_0260"
                     /note="previous protein_id=AAZ10035.1"
                     /codon_start=1
                     /product="small GTP binding protein rab6-like protein"
                     /protein_id="XP_003721632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981564"
                     /db_xref="GOA:E9ACA1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACA1"
                     /translation="MNSAGTGAPAKAAGVSASSLSMPKHKLVLLGDQSVGKTSIITRF
                     MYDTFDQQYQPTIGIDFFSKTVHLDDDRDVRLHLWDTAGQERFHSLIPSYIRNSAATV
                     VVYDITSRPTFFSAFKWIDEVRSESGADVVIMLVGNKVDQASERREVSAEEAMKKASE
                     CSVLFMEVSAKHGTNIKHMFRQVAAALPAPASTGGGAGVTGATSSSAGGVGAAGASGS
                     GASAPGISAGQFGGIVRSPFLITPSAMQAASNGTGGAGEADGANPNAQGGRGGACC"
     gene            complement(<129244..>129438)
                     /locus_tag="LMJF_02_0270"
                     /db_xref="GeneID:12981565"
     mRNA            complement(<129244..>129438)
                     /locus_tag="LMJF_02_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721585.1"
                     /db_xref="GeneID:12981565"
     CDS             complement(129244..129438)
                     /locus_tag="LMJF_02_0270"
                     /note="previous protein_id=AAZ10036.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981565"
                     /db_xref="UniProtKB/TrEMBL:E9ACA2"
                     /translation="MFGIFLVGFSLGLVLEVFACKTHLYESVMMKKDARRHEFDEFVV
                     DFRQNVERWQREDMGKRRSL"
     gene            complement(<131592..>132101)
                     /locus_tag="LMJF_02_0280"
                     /db_xref="GeneID:12981566"
     mRNA            complement(<131592..>132101)
                     /locus_tag="LMJF_02_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721586.1"
                     /db_xref="GeneID:12981566"
     CDS             complement(131592..132101)
                     /locus_tag="LMJF_02_0280"
                     /note="previous protein_id=AAZ10037.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981566"
                     /db_xref="UniProtKB/TrEMBL:E9ACA3"
                     /translation="MRLELKDFVQATRSMHQQPGGVRRTRLMLRLRPYQSRKTFVLKA
                     TDGRVTMTTRVEHQGHIKMVESLVNEFVTECTRASVGSPVPSTATASAGEQQAASAAA
                     MSSISAASGHKGRSPGAAAAAAAATGQAGASGSASHRQQTQLASAQASSHSSGNAGRQ
                     GKGRKGKRH"
     gene            complement(<133019..>134611)
                     /locus_tag="LMJF_02_0290"
                     /db_xref="GeneID:12981567"
     mRNA            complement(<133019..>134611)
                     /locus_tag="LMJF_02_0290"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721587.1"
                     /db_xref="GeneID:12981567"
     CDS             complement(133019..134611)
                     /locus_tag="LMJF_02_0290"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ10038.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981567"
                     /db_xref="GOA:E9ACA4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACA4"
                     /translation="MEERFDWMTFGDDVSGAQAGSAAPPSTGADEDVPIFLREDAGMA
                     QAGASHATVASGSTGIGAENGTPAFLAVCPAADVAPRLCGGWSSEGSPVWDGSLRQQQ
                     KPSSTAALGHPGGAGDVPAATSAVLYADQPSAAVLHFTGDSGRSWGALHRVRILGKGS
                     YGCATLYSMKDAASGAVEPTHAVVVKDINMQTMLNPAEEVPAVQNELKVLRTVLGHPN
                     LVQYVDALFDTRPPTYPMSFIMMEYCAGGDLAAVMDGRRPDSTTTNGAPSSPPSIPLA
                     TTTASTAAGPDILTEPCVASLFIQVAVALQSLHTEYGILHRDVKPHNIFLLEDGITVR
                     LGDFGISTQLDRVGDTAKEACGSPYYMAPELFEERAYGAAADVWSLGVVFYQLMARQL
                     PFTAASAAELRSLVCRGRCTPLHDLQNESTSRYSRQFKELVSSLLTADAAARPTLRRV
                     LRHKYVRESLKYVPVSVLTAKKPLPAARVPSTGATPSSSSQRFSADGLYASLFGSDVV
                     GQAVSQAVHAGVHPIVSRVHSA"
     gene            complement(<138486..>145658)
                     /gene="ABCA1"
                     /locus_tag="LMJF_02_0300"
                     /db_xref="GeneID:12981568"
     mRNA            complement(<138486..>145658)
                     /gene="ABCA1"
                     /locus_tag="LMJF_02_0300"
                     /product="putative ATP-binding cassette subfamily A,member
                     1"
                     /transcript_id="XM_003721588.1"
                     /db_xref="GeneID:12981568"
     CDS             complement(138486..145658)
                     /gene="ABCA1"
                     /locus_tag="LMJF_02_0300"
                     /note="previous protein_id=AAZ10039.1"
                     /codon_start=1
                     /product="putative ATP-binding cassette subfamily A,member
                     1"
                     /protein_id="XP_003721636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981568"
                     /db_xref="GOA:E9ACA5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACA5"
                     /translation="MSPPSAVASLSSGGQLPSAAPAAERPQEQSRAPPAATALISTSQ
                     AAHDPGAGAPGLSHFDVATPLLLEDRRFARRDAGICGTDSYTMHSDSTHSSNLTMSSA
                     YADAEGHRNAGNAAVNRGGSSSRSMESDVGDFASEYYGSMPTSGLGHDGHGRADDVHT
                     GNLRAPFDRSSALDYWDTVTTTSFSESHTLTTKHGGGADDLASPTAGGAGWTHKDSST
                     WLDQLGATISRDMIERRRRWGSVVLEIAIPLVCTVCVVALWAAFGVTSSPDYSSLASI
                     GDKGYNFAAGRYLAELCYNETWFGERNYIDGLRPCSSLDAASLRSVICNTVGEEELPV
                     KGLCYRQGGRGLADFLSGMRNGLARVMPLDDIIARQWMAKKLSLTDSAAMALLIGAGF
                     FSHTRINAIASSGKLYFAPSENVPLDMLQYLSNNSRFFQYVYNDTFDTVEEAHRVIKS
                     GERGPTWALVNIRQLDENGLDLSIEMASTALPALTGMVDKAYSGGGGYDRSNMYYTSG
                     YPSLMDALVKYYLMSLYAAGATRAETGSVQALAERRAEQQQRQQAQAAADDSVDVVLD
                     THKLLNAVRAAREPVGSGTQFFTDVAELGNSSAAVTSQKASRILATSAALRAKTSFTI
                     FLGSMPWVPFKTSQVLTSANTIIGFVIVMAFLYPVSQLTRRLVLEKERRVREATLIMG
                     LRPVYFWCSWFLYSVALMLTISLFMTLLMCTTFLTKSDASCVLLVLVMFSLTCVPLSG
                     LMATLYNTSHMAVLMTPLLYFAMSLLVFAIYSASPAVYLGLSIFSPTCFAIILQIMLA
                     RESGDGFATRIFLDPNDNPNTATLLGFLVLDFGVYLLLMFYLDAVLPKAVGVSKHPLY
                     FILEPARHCRRRRAERAWQAEQRRRQAASATDGGSGAREAPQPPPTQRRRTHDPKEGT
                     HGGSDGSCCTGYNVATDDADEDLCDGEDARDPNGVYEAETFTPEQLSVRIIGLRKCFE
                     HGGRRFVAVRNFCWQLPNAGISVLLGHNGAGKSTLINMMTGMLYPDGGDCYIGGHSIR
                     SDLARARHQIGFCPQHNILWPELTCREHLEFFARLKGLRGAALEDAVMYTLKEVDLVA
                     RQSDTTRVLSGGMKRKLSVAIAFVGGSSLVFLDEPTAGMDVAARRHTWRLLLRMSRSR
                     SVLLTTHFMDEADLLGDRVAIMSRGQLKCAGSSLFLKSRLGIGYNITISVDELLRVRD
                     LDVFLQQHVPQAERLTSSGGEVGYRLPAKHVERFPGLLSALDRVGPLIGIRGYAISPT
                     TLEEVFLTIARDAAEDDKRRAKAESAAAVAAVADKKSCPPDLWHRSRYCCFCRGGGKG
                     QSDHSSSDEFDWGDDDEDSHRNAGYLRDTSGVHPPEVSLYSALDRNISPMQHQSASLA
                     AVSEQLPSCSSPTRTGYTGGCNRNNTRTSGSCTPSMSSLWLARPATSAASKAGDRASQ
                     EDVVGSGEPMQSTAEHAMTASSADVEHSLPRVPAAAAATTTVALTRAKDALPGDIIWN
                     CEVAFSTAAVSLLQTEAMMRKRFCNMKRDRKALCFQMVCPAACILLAMLLNVAGTYTV
                     RELRLNTSNYPYDTLWDTTGCAGYFNGSFSDVAASLARNQRTRDLRMTSLSDFYYFLQ
                     DEWFAHGKVGKYSGLACGDPVVAMLPSIDLNPVVLLTNYSAYHEFPIAMSNFYNLLLK
                     EARGPSVSITASAGTLPSSFALASERSIKLLLTAIIILVPFTFLPANCVAWVVKEREC
                     RSRHLQDICGLRYLVYWFSNFVFDFTAYAVTMLLVVTILAVFRREEYIGVDTAGATFT
                     LLSVFGFCSTTTAYFLQFFFATHSSAQSIVMATGFITGFLLVIIVFVLRLLPSTEATS
                     HRLGWAFRIFPTYAVSEGIVNLALLSHFQSSDESLTAFSMQTIGWPCVYMAVEGPLFL
                     ILTLLIDHPHWRMRLLLRGGDAHRRRHGSHQHGEQPDASESTDDGVDEDSDVEDERVE
                     VQRRIEAYREDLKRQENMYKVSDAADSASVEMAATSTAGGTGGDFSSFGAKLPIIDAV
                     AVVGLRKQYDNGKVAVHDLSFGVVPGEVFGLLGTNGAGKTTTMSILCQEFYPTTGHVY
                     VCGYDIVEESRDALRCIGYCPQFDATLDLLTVEEHLSVFAGIRGIVREQQKDVVRALL
                     QLTGLREYRHTTSAALSGGNRRKLSVALSLIGGPPVVIFDEPSAGMDPVARREIWTSM
                     QAIRHRCSIILCTHHLEEVEALADCVAIMVDGRLRCIGSKVHLRQKYGSGFEMTIRVQ
                     PPTTVDVSSSTAADARQRKRAAEAALEAIKARLIVFVASSFPSSQVSEVRGKRLVFTL
                     PKNTNLPSVFECLQANRDALCISDYTVSQTSIEQIFMRVSGEVEKAEKVRTALSERRR
                     DVENALRRKHEQLHLKREESSEGQRA"
     gene            complement(<150192..>152276)
                     /locus_tag="LMJF_02_0310"
                     /db_xref="GeneID:12981671"
     mRNA            complement(<150192..>152276)
                     /locus_tag="LMJF_02_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721589.1"
                     /db_xref="GeneID:12981671"
     CDS             complement(150192..152276)
                     /locus_tag="LMJF_02_0310"
                     /note="previous protein_id=AAZ10040.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981671"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:E9ACA6"
                     /translation="MSSSAPLSTQQPAPLPLQRQQQQQSTQSMLDAIRQQGWGSASSG
                     GGDAMPSDASSRGMEGHSGAKLACPQMHEGHSAISSRPFNSEGADKPFAAVAATREAS
                     EAAKNSYDSMQPSADSQQLRGAEGECALPGHANAAAAAATLRNTNGVCEAIVTAARYG
                     RSMEPSASVPAVTATAALVNVVAEEKERRRLSGPFGSYSTTDEVFHQKCNDVQRGSAI
                     ESADSRTDASGGALVVSPAYAAVPARVSEAPSPVDAEMQQLLADARRAYTAAEERLLS
                     DGLALREDWMGTRDLFFAAGSLFAAVGEAADAARCLLHATFINRAFQNDSEAMVTLAM
                     SVEQLKQSHPRIAVDSLLRLAPCYAQQDLRYQAARCHRDAAEILENILEAKEEAVVQY
                     RAALDMYAETKVAAAETARRWERQQQQQRTAAIWGDLTGTPPLPPSAGASATNGDLTS
                     PTAPGGVEATSLGSEQPFVSPKSTAPVPSSGGDSLTSSVNGQKPHSLEFPAHGPPQYR
                     VSTTVQRSLADSCRWRLMILLTLLGRYDEAREAALDCAANVPRTLPKTKYLLYATLCV
                     LARGASVKTDSTANSVSDPAAAAEAAQAPETPTTPFTAAAADTVYFDSLYDTEKFFLG
                     LQDEDRTFQRGKENALVRALLAANRACSLTAFDEAVRAYKEYSTTEPCAAFELLAGEC
                     RRSLFEHMERFA"
     gene            complement(<153478..>154452)
                     /locus_tag="LMJF_02_0320"
                     /db_xref="GeneID:12981569"
     mRNA            complement(<153478..>154452)
                     /locus_tag="LMJF_02_0320"
                     /product="putative ribosomal RNA processing protein"
                     /transcript_id="XM_003721590.1"
                     /db_xref="GeneID:12981569"
     CDS             complement(153478..154452)
                     /locus_tag="LMJF_02_0320"
                     /note="previous protein_id=AAZ10041.1"
                     /codon_start=1
                     /product="putative ribosomal RNA processing protein"
                     /protein_id="XP_003721638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981569"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:E9ACA7"
                     /translation="MAVVYVRRDGRTALELRGKEMKLSDMTTFDGSSWYAQGQTAVMV
                     SIHGPTIAKNDEYDTCIVQVRIQHAGVLAPAAGGAEKALYEERKLELLTRTDALALGS
                     LLESTLNAVFLRERFPRCVLVVDVIVVRDDGSLPAVALNAVMSALLDAGLPCRTTMAA
                     VCVAVLTHDGGADSNSGPAPDRHSSVEGSSSAGSVYEYLLDPTSAEESLGVGYAVPAS
                     SAAEKAAVTGASSVATSSAAPMSLRGGNAAQQVQGQYRCVSTGVFAFSNPACGGGLLA
                     QLVRSVGSGSAEMCGPGVSVQAYAEMVALAERASAVLFEFFRQCNVAE"
     gene            complement(<155154..>159773)
                     /locus_tag="LMJF_02_0330"
                     /db_xref="GeneID:12981570"
     mRNA            complement(<155154..>159773)
                     /locus_tag="LMJF_02_0330"
                     /product="putative glycosyl transferase"
                     /transcript_id="XM_003721591.1"
                     /db_xref="GeneID:12981570"
     CDS             complement(155154..159773)
                     /locus_tag="LMJF_02_0330"
                     /note="previous protein_id=AAZ10042.1"
                     /codon_start=1
                     /product="putative glycosyl transferase"
                     /protein_id="XP_003721639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981570"
                     /db_xref="GOA:E9ACA8"
                     /db_xref="InterPro:IPR001503"
                     /db_xref="UniProtKB/TrEMBL:E9ACA8"
                     /translation="MMKRRTGERHPGAAAVRSVSSCGGGELVCVSARVSTTPFLDEVH
                     HHNHGEERDDETEVTCVGVGADSAFSSAAPSAAPSSCRWNRCLRLPSVRPSLLSSLCA
                     ARRGWTRLLSLRPVCSVASRSSALASAPSWCASLARAAARLLCMPDRPQAVRDADNHE
                     ACDTQAVEGGGRHHRSGQRRRHETRATSLTRLLCRAAFIGASSVALLVLSVMLLDIVL
                     GVTFRVLGSDLSGGGLDQLEELQAPWLDCDCAGKDLIGDVTLANTVSPYVAQTLERRL
                     GVVTVATDAGCSICVPSAVRISAAGELVAVEDDEGSSLHALSRLRPMAPLVRAARGLM
                     AYGYDALADVAAVLYPRLAMMVVWCRHTHGVSVERHRVSQLRQRQNRGVAGGAVTRAL
                     TDAPLTPLLPPTSLLGVPDGPWANLSAAVAAEAVVAVPYKSSFLVVADQAEARLACVL
                     RAPLSRLFLHRQALPWMTIAAAAHRTQKEWQADPRGRESLLPFPVPPSEEERRRLRDT
                     SRGALRHSDGDGEAPEITIAVTDQAKAFHSYLCTDVPNVSTADAIYHLDPLRALLLRQ
                     TDASAKDRAKTAARCTGCVFHCVHPRLARRHGRRAAPAGARGAAEDGIDGGSSAEPLS
                     WDVALEDVDAGHVYVTTGSNAAAGATVTVTREDLFTCKVLNPIRGLGTPKRRGHEAQD
                     DTNRALLLSVDVWLSHAGGGTPLFFSNNTGTSPWLHMDNGSGEASVVRLLPLHTAAIY
                     GESLQSFPNYAMRPSYWLQYDAVYLQNKVRRPDRLSRLLAVASRRRGGGGAAKPRTEF
                     ATWTVTHYYMRDFQLVVHLNQLRRQRLLLMRLQGEPANASVSVTAQDAPVALPWVPRP
                     RRGAAKPAIATGALARLAFEVLHGADPLLLPMRGENLHVPPLPVSWSPPTSAEWGSGR
                     PMSVDDRRLPFSGTTGRIPAIAVAISHCWHGRMWWLSELSRYYPVHNYGRCIIPPPAP
                     LPGDATPTRGIPQRAHLSFPSECAVDALRRHHYSALASMQATYGRVGGRRSTSSAARP
                     MFHVGRDHELRCVFRKYRYVLAFENTIEDDYVTEKVYNALLSGALPLFIGAMNIADYV
                     PRASSSVPSRGLSVIPVLQMFPLLNETAWRTEERRVLDLLEEDEAVSRHVLRTHAAVL
                     QARSASAQGADVTTGMTTKRRDGAIRMARTVATALEEVAAQTPHAVASHHYLLYPSQE
                     TAVPAVPTADNNELPQAVPHGAGYLGNCSSDSGAAVQPFMSPIGVWPPASALTHLCLL
                     DKEAVVTANKSGGAAPRPAALQSPSTDAYCVGYGQREYLRRVHTDVREAAEAAATMSA
                     RFLRTTETLRRTLTSSPPPRHDAKDARRRRPPAVANAGRRPLRRVRYQYDEDWVLTAN
                     TAWGFSVDVNCTARQSRRSGATTEYLPRAVQRFQEAPDTTPAQQDYNTPGDMYSQYFH
                     RRSVPPTLAYERELAATAAPAGSRDAPPPPPMSGFAQLAAYLRSLDADPTLVEEAGYF
                     DWWRAERMEDYGDAFLSKLYMPHPVCSICAAALEKKVQSRASGGA"
     gene            complement(<161011..>163932)
                     /locus_tag="LMJF_02_0340"
                     /db_xref="GeneID:12981571"
     mRNA            complement(<161011..>163932)
                     /locus_tag="LMJF_02_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721592.1"
                     /db_xref="GeneID:12981571"
     CDS             complement(161011..163932)
                     /locus_tag="LMJF_02_0340"
                     /note="previous protein_id=AAZ10043.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981571"
                     /db_xref="GOA:E9ACA9"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:E9ACA9"
                     /translation="MDRQRCLFPSVGVDSHETMLPQQPDGQQPSSSSCPPPPRQPTTQ
                     RLCAHAAGVLVFHVLTSALQEMIFHLPGFTNLLLLSCGETFCTTVLVGLLLVWGWYHQ
                     LPRRAASEHQGPHGRSAATALGAETAEATPHKPLSNPVHGMDGSSNKQGWWCLGDAVD
                     HAPGAVCAAGHLPHGQERSRPHGDGRGAPTSVVDAVPVAVAVDRGKGSALTPGAAHDS
                     VSASGASWRSTICRVFHPSTVATHWYVRIAVLLSCSLYLTNCTSFFLSYPLQVIFKSS
                     KLLCMVVVHRWWMRDSHEAAAAGSENETDSDDDADSAVHRWSAVAAPDRCGGASSEGG
                     GSERLAHDKAPDTGERHLRDESQRRGHGCSSSSPPTDFSTVVVDVSPAAGRTLAFSHP
                     LEDDQRRSWWSARRSSSSSSSSGSRRRSWWWPRFWCQHAIDDVSRWCTSGRWACACAC
                     ASSLAQRYAFRSATSAIDERGHVPAATGLRQPVSDNGGGDGGLSAFEMVRVAGARLVW
                     RLRRLLRDTEVMACVVIVAGLISFTYAFQRDLHAAAEGSGSDERPAALAKAAPAEVAA
                     ERHPLAERPRTHAPASLIGRYDVAVDAAAAANLRDSRCIATGLAQAGASLPLPLSSPF
                     ALPPLSPLQSVAAEVSRLSALWIVTLIGVAGVLTSNALDCIIYVLEEVHCFHATAGSS
                     RRSNRAAPRQERAAGETARPLADVQRGAVLLPHHTSHRQHSLPPCPPMLSCRTQASVP
                     PSSERPTAAPTASATEPPTRIPASPQELLFMVNGIATFLYAGGLSALWLCNRFLFFLW
                     TFTGPNAMSTAVEADGGVVGALATAEARQLAACESFLATSRRTGHGALPVEGAALMAR
                     RPQLQRLAALSTGPPWGAPSAPPPPSSTEPFSLSLLLLLIALASVTSLMGTLCLLRIV
                     AEFTGVMAVIVTSVRKALTILLSFLLYGRRFSLLHGVGMVGVMGGVVWYELQRRRRCG
                     V"
     gene            complement(<165087..>168242)
                     /locus_tag="LMJF_02_0350"
                     /db_xref="GeneID:12981572"
     mRNA            complement(<165087..>168242)
                     /locus_tag="LMJF_02_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721593.1"
                     /db_xref="GeneID:12981572"
     CDS             complement(165087..168242)
                     /locus_tag="LMJF_02_0350"
                     /note="previous protein_id=AAZ10044.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981572"
                     /db_xref="UniProtKB/TrEMBL:E9ACB0"
                     /translation="MMRTACFRALAPLARGSFLTPTRSGERATVAAARRVSCRGYVTH
                     NPSHDQCRGRRGARPQGQQHGYSASALGSASQVVTGADSSAASSSPHARDAFYVFLRA
                     RNAPFGCSGTTAVSQPASDPLSPTAPLYPHPSSHLHPSAHGLGSAARAGAPVEETRCA
                     RGGAARHTSSDGTTRRSSSPPPPSLSSRLSAGATPERALEEPRKQQQTPLEAEASRRG
                     ASAPPVLGEWSLDPPEASTRRAAAQGGPRSREHRSERDHNDVGTDGDANGSSAQRGRL
                     PDFRERRRRSLQRRGYDALELARRHTSAHIANRRLREYEQTCLHAYRILKQVEWSLAA
                     WARVRRQGQPQDASGRNRSSRSGSAGDGALSAHAAQSMEGQGATGAFRIPPTSEDIDA
                     VDARFFEYAGQIQRTLHQLTPRHFDAVRDYRLRVPSRSSSSSTAATPPSRPRRAEDST
                     SSAPESLGAAPRQLLLLRLLWRLVHIQQLFFSIGRRASLPRTAVDVYVQSSNCQYGIR
                     EVLRVLGSEMARWTLSADTHPHFHSPCGQQWREHDGRAASPSSSVAPLFSNKELFQLF
                     YAVLCIPSEEAPGVPLYDPSIHSTKPRHGGVPDWHAAASASADLPDAALDQFRRDCIA
                     TGADDFRMPLDEWCVRWWSHQYSAAGRTGAAGAPPLSMGEAMDVLQACMYATASVQVL
                     ATAALRHTAQQRHHPQQRLVTPFMYFETPPQGATNGARRPRTNAASATASEDNDVVEE
                     AEPSPLRVLDRRYRPQLPGALGGNRMALRIPYHLGQRYVEVFLTYLLSSVSAGPDPRE
                     AKEAATMATATVAAGIEHLLRCRDRDAVRDVALLCTAILFFEVFSPTTAAFMACAAPL
                     FREQVELLSGHEISCVLLAYASLQRWERAGGGCGGGASSPASGFSANAEVRAAGRRGG
                     PLDDPAVAVQSASTAAAGRSACGDAWRKGAPRAVAAPEPSPPLHADHQSDATRSSSSS
                     SSRAQVSTGPQFPSDEPWHLFYVTLASRAGQLSDTLSEDDVTRVLRAMELTGMEHDDL
                     RHALESSLRMRNMGRRILYEA"
     gene            complement(<170022..>171167)
                     /locus_tag="LMJF_02_0360"
                     /db_xref="GeneID:12981573"
     mRNA            complement(<170022..>171167)
                     /locus_tag="LMJF_02_0360"
                     /product="putative casein kinase II, alpha chain"
                     /transcript_id="XM_003721594.1"
                     /db_xref="GeneID:12981573"
     CDS             complement(170022..171167)
                     /locus_tag="LMJF_02_0360"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ10045.1"
                     /codon_start=1
                     /product="putative casein kinase II, alpha chain"
                     /protein_id="XP_003721642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981573"
                     /db_xref="GOA:E9ACB1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACB1"
                     /translation="MANVDAAAHSADGGRHGGGGGGSGDESKAKKTKPEEYEHPFWYV
                     YRQRGVSYWDYKNARVDFNANLAPYELLQKIGRGKYSEVFRGRNRNNGCLCVLKLLKP
                     VRYQKILREISILRNLCGGPNVVRLLDVLRDTESQTVVLVTEYVHNPTTLRNLLYSNK
                     LSNFDMRYYLYEILRSLDFAHRRGIFHRDIKPYNVMIDHERKILRVIDWGLGEYYIHG
                     QALNCGVATRHYKGPELLVGYRHYDYSLDIWCLGCVLAGMLFRSDPFFVGANNEDQLL
                     QIVAVFGTKALYRYLDKYQCRISRVVESSMSALPDEHVDWRRYIKRGSVQESWCDATA
                     LDLLDKMLQFDHQDRIMAHEAMQHPFFAPVRDALARDSQEHYPVARR"
     gene            complement(<172807..>174390)
                     /locus_tag="LMJF_02_0370"
                     /db_xref="GeneID:12981574"
     mRNA            complement(<172807..>174390)
                     /locus_tag="LMJF_02_0370"
                     /product="putative proteasome regulatory non-ATPase
                     subunit 6"
                     /transcript_id="XM_003721595.1"
                     /db_xref="GeneID:12981574"
     CDS             complement(172807..174390)
                     /locus_tag="LMJF_02_0370"
                     /note="previous protein_id=AAZ10046.1"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATPase
                     subunit 6"
                     /protein_id="XP_003721643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981574"
                     /db_xref="GOA:E9ACB2"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:E9ACB2"
                     /translation="MISGGSVDCAHTLEEAEDHYGRGDRATARELLQSIVTTDVAVDD
                     GDAIRAKEQAVYRLAELLTVTKDGEAAIQLLSDVRPFFQVLPKAKTTKMVRKLFEHIV
                     QCGVPLKQQEEVCLETVHWARKERRTFLRHRLQLRYVEILFAENRKSDALASLSALLK
                     EVRRLDDRTLLLDIYLLESKLYYAVMDIQKARAALVSARTTANSIYCPPLSQAEIDLQ
                     SGVLHAEEKDNKTAYSYLYEAFEGFHQLGDQARQARRSLRYMILSKISTDSPDELATL
                     LSSKSVLEYKGTDMDALRGIADAYNKQDTHLFNSILSKCRAEAEESGAGGSNDTNLLA
                     DEVVRRQVNDMYNTLLERHLLKVVSPYNRVQIAYVSNLLRLDAMVVEQKLSQLILDRK
                     LRGIVDQQHRCLIVFDDEAAEASKPGKDGSEAFYDNAADAAVDQAPTTLYQDALTALE
                     CYNTLVTALFDKVNGKFDGLVEENIAKHKGARAKEEDEEANRTNKRGGVGSGKDAAAD
                     RGGKSDSGNKQKRPGDKRK"
     gene            complement(<175517..>176896)
                     /locus_tag="LMJF_02_0380"
                     /db_xref="GeneID:12981575"
     mRNA            complement(<175517..>176896)
                     /locus_tag="LMJF_02_0380"
                     /product="putative FtsJ-like methyltransferase"
                     /transcript_id="XM_003721596.1"
                     /db_xref="GeneID:12981575"
     CDS             complement(175517..176896)
                     /locus_tag="LMJF_02_0380"
                     /note="previous protein_id=AAZ10047.1"
                     /codon_start=1
                     /product="putative FtsJ-like methyltransferase"
                     /protein_id="XP_003721644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981575"
                     /db_xref="GOA:E9ACB3"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9ACB3"
                     /translation="MGRASKDKRDIYYRKAKEEGYRARSAYKLLQIHEEFNILDPAEI
                     RTGAVDLCAAPGSWSQVLAQHFKMISANLTAASEGDSLPAQTPRVVAVDLQEMAPIDG
                     VTLLQGDITSEVTAREIIRLLNAPTSTGVVRTDDEQQQPQPASSSFSSSAPSPALGAS
                     PRKADIVLCDGAPDVTGMHELDEYLQHHLLLAALHITTFVLRAGGCFLTKIFRGPNTA
                     FLVAKSQLFFQQVRVVKPKSSRNASMESFLLCQGFRMPLGYVPRFVGAAAPAAASSAT
                     TGCSRGAASASAGCGSRVEADNEEGVKGERSETAIGSGGPLRASGFTPEAPLYCYDTT
                     ASFSHASDGGAAAAATVHDVAHHNQRTSCTLADGVLAPFLSCGDLSGFDADMCYDRDE
                     DADVLEPVQPPLQAPYLAAAAASPSQLAGVADGRDTEADASQKKKIRVESPTAIAGRD
                     SSTGGEEQQ"
     gene            complement(<178261..>178719)
                     /locus_tag="LMJF_02_0390"
                     /db_xref="GeneID:12981576"
     mRNA            complement(<178261..>178719)
                     /locus_tag="LMJF_02_0390"
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /transcript_id="XM_003721597.1"
                     /db_xref="GeneID:12981576"
     CDS             complement(178261..178719)
                     /locus_tag="LMJF_02_0390"
                     /note="previous protein_id=AAZ10048.1"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme e2"
                     /protein_id="XP_003721645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981576"
                     /db_xref="GOA:E9ACB4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:E9ACB4"
                     /translation="MTVSPSSATSGAGATAARDSAAAALPAGLDLLHWEAGIPGKPGT
                     PWEGGEFRLRLNFTEDYPTKPPKCVFTPVLFHPNVYPSGTVCLSILNEEKDWRPNITI
                     KQILLAIQELLDHPNIKDPAQEEPYKVYMRDIKEYEARVREEVQRHHWKG"
     gene            complement(<179356..>179523)
                     /locus_tag="LMJF_02_0400"
                     /db_xref="GeneID:12981577"
     mRNA            complement(<179356..>179523)
                     /locus_tag="LMJF_02_0400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721598.1"
                     /db_xref="GeneID:12981577"
     CDS             complement(179356..179523)
                     /locus_tag="LMJF_02_0400"
                     /note="previous protein_id=AAZ10049.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981577"
                     /db_xref="UniProtKB/TrEMBL:E9ACB5"
                     /translation="MCVRALLYWMLLLLLLSPMQLFISLFLHSFSSKLCHSAIILPVL
                     NALLLQLSLAR"
     gene            complement(<180246..>183215)
                     /locus_tag="LMJF_02_0410"
                     /db_xref="GeneID:12981578"
     mRNA            complement(<180246..>183215)
                     /locus_tag="LMJF_02_0410"
                     /product="putative RNA-editing complex protein MP81"
                     /transcript_id="XM_003721599.1"
                     /db_xref="GeneID:12981578"
     CDS             complement(180246..183215)
                     /locus_tag="LMJF_02_0410"
                     /note="previous protein_id=AAZ10050.1"
                     /codon_start=1
                     /product="putative RNA-editing complex protein MP81"
                     /protein_id="XP_003721647.1"
                     /db_xref="GeneID:12981578"
                     /db_xref="GOA:Q6T446"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017085"
                     /db_xref="UniProtKB/TrEMBL:Q6T446"
                     /translation="MHTAVLRQLSTPSTRPSGTANGGFGSSGVRDGSAPAPPSRGDGA
                     ATAPQQRSSHGVSSELCFYETFILSDVDVHLALLEEAHYKHGVWLNVPPQLAPSFPNV
                     GPPAVPEPIYPSAQRERLAAMTAVQNKRGRGASGGGSTTDAELIVEPSCLAYRPTHDP
                     PPFSTTGTRSLRIPEQRRAAAEAAAPGASDAVPRVPPSAPFSVTASTGEASFAEGTTT
                     TTSSMRAEVQTVAVRMPVVPSMLYHCSACSRPFRRREAAEEHVQQRHEPRGNCSGVSA
                     AAVVVEGPGPGEIIGYEEKAVVVAATTTATRTAAAARVTSSLPMKAAAKAKGVEASAE
                     VATAKGVACASSTVKPSAFDLAASYRATPRVDRPSDDLIDELLDAVWDDVALARDDIV
                     KPSDLPTTRADRLQHPKRRYDSCQGRCFIPSVLIVEGVADNRAELEAAVERAAVRATP
                     DGAAPGIKRRPSSLFSVFSPSTMAPRLLPTQRRNADGTLGAGGADAAAAGGGIGGGTL
                     GAAPTAQELSVAELSRHYPNPFGDSPNAVLMELEKEPINPFIDLEGQAAEVAAAAQSG
                     AADGSTADDAVSSPATKEMEWLSRWAARPYACPLCQRRALPDLMKIMAPLLPPSLVAG
                     SEAATSAAPTAGVYGDVQGASPHPRSGTKGAASTAAGETSAATAGASTSRPVEGVPPS
                     GSLEDEPLVADVEAWSWYAERVPRFRLLDSLEDHLQSKHAGYCGGDDEAAAALDDDDG
                     CTGRDGGDTLSEADWQFLYRVARHQQLLARAELLAVQQAYRVMCPKRHSTAAESFSSI
                     ESDGADLPNHVGGDAGKDGAANAAIHGAVGGASAGGSPTSGSAIGATTADGTDAPQVH
                     VRSAVNTVLIGTVRDVQEGFLGATRILQYVLAVRNTSAESLGSASADAMGSHVDAGNG
                     EDEGAGVDEDLIVVRCVGDLVPVALLKQQARLGSTIFVAGSLRLNRNVDTVSRRSHAY
                     PYVQVVPPLGCVRVLEA"
     gene            complement(<185835..>188837)
                     /locus_tag="LMJF_02_0420"
                     /db_xref="GeneID:12981579"
     mRNA            complement(<185835..>188837)
                     /locus_tag="LMJF_02_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721600.1"
                     /db_xref="GeneID:12981579"
     CDS             complement(185835..188837)
                     /locus_tag="LMJF_02_0420"
                     /note="previous protein_id=AAZ10051.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981579"
                     /db_xref="UniProtKB/TrEMBL:E9ACB7"
                     /translation="MGVASVKRRGGFRRDEDRRLRLSRRCGATVAVVMVFLRLLSGTS
                     PVAHAFNVCADISRCSECVFDQTDGLMPPPLMCGWCESTQTCKEINSTVLSYYRTTLA
                     TGGAGDAEVEHTPDEVAAFREQFCEDFRERNFNAVCPDMFCAASKTTNNIYICRAPSI
                     AALVLGCILFVLSILLYTWMQTIHQLPWKYEPFLSDLLAGRHRPPDPAGDDGDTEAIV
                     DDCRDTAAVPHITLPSAVQRGHSAASPFLDRDGGTEDFGERGSDDGDGGVSSSSTAQR
                     QQQQQQQGQHALLHRAASIVTTTAATGYCPICRCRHPVPLGPGNVCFWCNVARFAFVP
                     VSLVLLSSSIVIVLSFAVSLKPWFADAYFAEVLVVAYLSFGGFVWYVVRHHRRAPLFY
                     VETEEEREANEEVWPAARHRRPTSRLPSAAAGAASITGSASEVERESMPSPLHSRNAK
                     LQLLNDARRNMASTTYLRLALRLRGRSLLDQIPELKKYRAQIASMHLAPATLTRVGGA
                     LSAMCTPMTAAMAGSGAYGGDAGTTVVTTATAAATSAVAAAGAPMTPVTRADVDATAA
                     TPTASMPSCLSLPLQRTRLPQHPTPLPSAVAAAAVGSTDTAGVMAASAFSFDAQTSPA
                     AAAATGSASATVATSAAAATPMPLATTLPDRVARQKRAETAQLLNSDFLSPQYRKALK
                     ATLFRDELITWYSEPRLRSVLMENKWLLLDLLAGLLFGIWMLMLSSVSDKTFAIVRLS
                     GSTAVAACGLVVVLGFALLLVVVVRSCGRLYVLTDERLITVYESIIEPVVTATDLSSV
                     RFAALYGYHGIWAREPVLDFSWEVPATERKMPAIKSHKFSGITDLHEFLYYFRMMAPQ
                     TPFHLQQISESTRQDRAEWRMHVILCIGLFVALPIITVYPHAVPDFLAAYLYVVALLL
                     IGSTLLRGLRAQQMTCAPLNIAASWAPAPARNEVDGAEPLQPLPPSVVTHAPDGCSAP
                     KTTASSFGGHGGSQELGTASVSPISVPM"
     gene            complement(190625..191602)
                     /locus_tag="LMJF_02_ncRNA1"
                     /db_xref="GeneID:12981580"
     ncRNA           complement(190625..191602)
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460057.1"
                     /db_xref="GeneID:12981580"
     gene            complement(<192736..>193848)
                     /locus_tag="LMJF_02_0430"
                     /db_xref="GeneID:12981611"
     mRNA            complement(<192736..>193848)
                     /locus_tag="LMJF_02_0430"
                     /product="putative serine peptidase, Clan S-, family S54"
                     /transcript_id="XM_003721601.1"
                     /db_xref="GeneID:12981611"
     CDS             complement(192736..193848)
                     /locus_tag="LMJF_02_0430"
                     /note="previous protein_id=AAZ10052.1"
                     /codon_start=1
                     /product="putative serine peptidase, Clan S-, family S54"
                     /protein_id="XP_003721649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981611"
                     /db_xref="GOA:E9ACB8"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="UniProtKB/TrEMBL:E9ACB8"
                     /translation="MVRVDPICAAIHFSPILVLLTVHCSSGRWPTDADCAERVMRYGF
                     SVDLFTERPARVLTHLFVHISSKHFLSNVFSFAATLAEFGDVADTAAEGAVARRRVTS
                     RDDEEPSGSRGAAGSSAAQRMVWEMRTILGQRSRVQACVRSAGAFAVWAVGGATGGLC
                     CQMLYNSFKLALRRQCAARAAAAVADAKRNTTWGAADGCILTSLSRVAEALRQRAEAC
                     NSTLAVSAQEAVNNAMLMCGASAGICALSGFSAAYYGRSITAFCLVVPEALLLTKDLI
                     NHYIALLAPGLGATDYAAEAERRALQSTWRIVMPVQTVGHAAHVGGFAVGLGMGYCWL
                     WVRKCRRLRLAQSRRRAAPWLPRPGLQTHVYARSRF"
     gene            complement(196415..198530)
                     /gene="AAT18"
                     /locus_tag="LMJF_02_0440"
                     /pseudo
                     /db_xref="GeneID:12981581"
     misc_feature    complement(196415..198530)
                     /gene="AAT18"
                     /locus_tag="LMJF_02_0440"
                     /pseudo
                     /db_xref="GeneID:12981581"
     gene            complement(<200383..>201216)
                     /locus_tag="LMJF_02_0450"
                     /db_xref="GeneID:12981670"
     mRNA            complement(<200383..>201216)
                     /locus_tag="LMJF_02_0450"
                     /product="putative voltage-dependent anion-selective
                     channel"
                     /transcript_id="XM_003721602.1"
                     /db_xref="GeneID:12981670"
     CDS             complement(200383..201216)
                     /locus_tag="LMJF_02_0450"
                     /note="previous protein_id=AAZ10053.1"
                     /codon_start=1
                     /product="putative voltage-dependent anion-selective
                     channel"
                     /protein_id="XP_003721650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981670"
                     /db_xref="GOA:E9ACB9"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="UniProtKB/TrEMBL:E9ACB9"
                     /translation="MTTLFKDYTKGSNDLLTKNFSSCGEWKVESKGKAPRGAYALTTT
                     SNTHGNVNVDVEGLTDSGAYYGKLTFASKDLTDVKVTVRAEDLNNHRVEAIIGHKGPA
                     LCDISVEVNHQTMKPIAGGCLSINDKFTQKAVELALSMAAVDGVQVGCGTKYDFKSKT
                     IDWTAACRLEAKNGLVLTAQTCRLLDLTASVVSKAPLHPKFQPCVAATMTMNPQSMTW
                     DGSMAVEWGCQVILGNTAKVRVNKNLDWIASYIANLRGGWTLVLSIDKTMKTGLTLTR
                     N"
     gene            complement(<204892..>205767)
                     /locus_tag="LMJF_02_0460"
                     /db_xref="GeneID:12981582"
     mRNA            complement(<204892..>205767)
                     /locus_tag="LMJF_02_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721603.1"
                     /db_xref="GeneID:12981582"
     CDS             complement(204892..205767)
                     /locus_tag="LMJF_02_0460"
                     /note="previous protein_id=AAZ10054.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981582"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="UniProtKB/TrEMBL:E9ACC0"
                     /translation="MSHSQSAKGSAVKVYTTPSLFKDYNKLTKDLLAKDFPTANKWVL
                     ECKYKGPKDTFFINPKASSDGKISAEIEYVAACNGGLKVTVTPEIMREIKATAHYTIQ
                     GHKMEVALQRLHDKYHYEVSHETCVILSKRASINEKLTPTHVELGMGIDVAPNCQVGC
                     GATYDIGANDCNWNIGCRYAGRGCEMAIRTNRLQTYHTSASAPCSFMFNGNRCTVRAA
                     VEVVCGRGRGDKGVAVTAGMEATCPVHPANTIKARVDRDMRWVVAYIAKMADNWTACL
                     SLDENMRVGVQMTHS"
     gene            complement(<207099..>216566)
                     /locus_tag="LMJF_02_0470"
                     /db_xref="GeneID:12981583"
     mRNA            complement(<207099..>216566)
                     /locus_tag="LMJF_02_0470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721604.1"
                     /db_xref="GeneID:12981583"
     CDS             complement(207099..216566)
                     /locus_tag="LMJF_02_0470"
                     /note="previous protein_id=AAZ10055.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981583"
                     /db_xref="UniProtKB/TrEMBL:E9ACC1"
                     /translation="MPSVTSVAAGTAAVGMGNAGSGDLLFPFDASVPTLRSSNPEDEA
                     AAAELVRGQQRQQQQRRHQGSIGVSVDVSAVLDRREETGGAGDDRRHRQSWPRGSTSS
                     SSHATRARQQGPSLQPPESSRAADSEVKDQPARQNSRRAYDDPKVFMRDTENDAPGTL
                     LMRCEDEGNFALESVRVRRDVDRTAYHAKALGGSTANDSRVPEFAGFDALDDAVSAKA
                     PATVARGVAVQHQGESVPARSRSSSLLAFSQELQRTLPPSAVITASDHYRRLRQQAMA
                     HLPPSQASEAVDVEGPDTAQQNCPSPAAHRMHLHFSRCCSEPLCEAANSTRLRAGVPP
                     SVLPPRSTSGATHPLPTTPPAGDYERDRSGEEEVEDAARDCAHSGEAAPLVTAHSSLS
                     SVTDSSSRSPATTSVVQHIHSHHTAFVAAASSVRTHPPPPAPVTAASAAASTTPLEIP
                     AASWRRAKVQRLATPPLVGSGLLRPKLSATAPAAASMAQGRSPRTPGSQRESHLMSHV
                     RVALIDARGVRSHLDELRALLPKHRTGGAGATAAQDITGAIAGNSEPAGATRRVSAAA
                     TAADTQDGQHTNANSVAGVRGRDDEAGGIGEMLDGGEDSAGIVHCTTAMSPLNFSLLQ
                     EMLRDGKADDIGEDCGGGRNTLRARAGTGKASSQLQHSQGLHRNGNGVDGDGSNDGGR
                     SPSTTLSVRGLYTSSLNAYRHQRLTQLTEQHLQSLWLGVSAVAKSVCGVTVEQCVEMD
                     LIQGSTLIDGQALRFPSDTAAAAESAAPSLASSSFGAPLQQQLQYARPPSPYSTASTA
                     SPNSQGPLQPSGAAVSVQDREATATKKASQSASKPPPPADPPSPMPSFHFSEAPLTAA
                     TAEVTVQRLASTKRDNSPSDRHRDSQRRCLDEAAPLDSAAAGGNGCVPWPSLARAAVS
                     AIATRDSTVTCTRGEGDARINARSSAVASTSLTTRTNTSTNTTASTVMVHPCAHSDCH
                     RSGDRDRSGCHHSTTSPTLLSKWPNAPTSGIIYTHNTPANLSSATALPSALSNIGSSS
                     ENRMSNTPSASCSARGGSGGYAVGTAASLLSGLQSPAASTTATTAGGGRPLYTLPSTL
                     LQLQQQPPQHGSSPQSAPSASVDGAAPPSSYASPPVATVTHLFPSQHQPLAQGCTASA
                     SASAPLTALPQHSSSSVWHSETGGSSCPLAGSAPGPTWMPPPPPPSPASPLPPAAVHR
                     GASGVLVVAPTVPSALPSPYGATSSGVGAGASALRGLCTRSSGLAPETPFTSSLGSTL
                     TSSLLVAMPSPPPLKAPFIKVQREEVAADTAPDSHSNARVSGARRDAAASAVGTSSAA
                     AHARGECHGQSPASPALLLTSHERPGGGGVEARMGTAAQVGSAAAAAIEGMARGGMNG
                     ASNRVGAAAALPPAIVSPYGVLAEGELCVVAPIHESMELLARETHGSGGTPASSGATP
                     VMMPGSPLTWRGRLEARSSSPVRRSAATGASVTTAGLVPLAPSGSSEGVEELSEPFSL
                     MRSAATPLARGRIGVLDITTTTTARAITSKTTATTTTTTNTALPTTGNHLSLGGSMGG
                     VAMHFSLPSTSTLRRQPQLQHALSFSSHAGSHQQDVCLHDIRSHATTATEVQGGEAAS
                     TALASATEQPLPPSQQHRTRSRDKSVGHRDAQALPFLRSSLPSDGTTPASSTPSPSAA
                     SAVSANGDQQLVYNGESDGTDAAVQASHQLATHAAAEGARVGKALNKDFSTGAASEFT
                     AVHDSTASPPSPRQRPDEQDAASVAAHPRAASAASSSLSYTTISASTADATPAAVTAI
                     SVSGTRVPSSASSATLPAPLRAELQLEHGGNGASLTRPMATTGSALHDLGDDEDTNTV
                     VKRSSSSEISSSSASHTPSREALLMDGARHRPLHAVLPWAQLRPPPTRTSTTASLTMH
                     SADRADALLVRANDMEREVREVDVISALMCATSLPARPGGLATGTDGTHRPSSPTTST
                     LPARAEVVHDIPATEAEVRKADALVTQSKGEDGTADTPGPLAPSLAPRSWATRGGRHV
                     GVCTDSMAAALDTEHSGSLTATAQSSDRSHMVAYAGTCSGDDRGEAGEAKRRGGAVSA
                     DEPAASDSEGGRDLLSLYVNSDAHDLPSSPRRAAAYQQALQQQPYHQRHLMQTWFSIF
                     TISSSGHSAMTTSSLRTAITGVALSASVAALGPRLNMSSMSSGTPTTLASVAEVILGI
                     GAAGSTVGGGSAGGLSSGHAGAIPSIGAAATATAAAGSAAASSFTVTVIAPTTAATGN
                     STWTPSSTVTLSSDSASAAEFTSPSTYFGTTVSSSASYSLSPEGCGIIVSGGAGGGVT
                     AGVHSVSPTGEEGAVFLPWRSASAPAQTEYVFPVAVRAAGADAARAGGSGGGGAACDA
                     DFDALRLDATLNLTSASAESTQHVLSRLKPLPHLTPPHNYPFLLPEVTSPCPRDDDVF
                     GEDEDDVDAYDYAQDVDDAVLLDADSDVEPEERHRATARVRGGSDHSSRVETPCCDGA
                     GGTGRAYGDSNVEDHGAVVKSAASHSQHRGDGKVDVGASPTQPPPDSCSNGGPTLTTV
                     AASTRTATTEDGGASLYAAVVSRTAVAHASRVGEVGSAEDDSSTEGRTSSVHLSARSL
                     GIPTAPLTAPAGAGPATAVAAKTSSAAASAIEGNEDVRVVSLPGSGDDVPIAPSWPLL
                     CTNTASAAPRSPRIVSDSPLRLRGAVTITAGGDALVASTATTAMAAAERERAGAQTSR
                     SASRPHHLSGGGSALIQDGMPASNSNSGDVGGRLFPQNPTPPGAALEEGGGWAEVAAT
                     TVSEDTANALVTPGLPAMQHSSQRQTSSCATMASSVTPMAVGDGEGVAKLRDGGGRDA
                     DPAVTKGVRAASMASLFDARGIDQPNRKCVGHGENSVVGEGGGSTAVEGCSDRPRADR
                     SISIDGDAAAVSHSAETAEWKRRHDDRRAVGANAVLSGAAPDAGDEFPIASTPLSMTP
                     ALRAADDSDSDGAVLCLLPEAARSSTVPERTPSARQSESRGPPPPPPLPPAQFSIPSY
                     YLAQCEDGLADVAGSLHGWHAATSAFFSGADTAVAPGRTRDGWSRPSSRASDLYTSMS
                     ALARRRLQQRAFYNDAGLSGTAAPSHTTATAADTPLSASAMPELSLRVGATADHTEKT
                     ATTPTSPTAAAGATHNDRLLALMRRTLRLADGESGAC"
     gene            complement(<219347..>220075)
                     /locus_tag="LMJF_02_0480"
                     /db_xref="GeneID:12981584"
     mRNA            complement(<219347..>220075)
                     /locus_tag="LMJF_02_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721605.1"
                     /db_xref="GeneID:12981584"
     CDS             complement(219347..220075)
                     /locus_tag="LMJF_02_0480"
                     /note="previous protein_id=AAZ10056.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981584"
                     /db_xref="UniProtKB/TrEMBL:E9ACC2"
                     /translation="MSSPSRLSSARSLAPHLSKSPHIKRHTPDTHTQAHPHTHITMAG
                     DKSSKRVKLRTKIARKQQTQHATGEHALSSSGLSSSPPPTSGAGEATAALPTEVDRQA
                     ALHIRDALRQRQGRTGRAPAVKVKEARGARATSAPGGAKRKLAMNAKKDKPSSQRTAA
                     LRRATVLGRRRLTLPRMSAAETRMAVAQAELQLFDAVQAVPAYAADPFAAVMQHLSAT
                     MDVLQPQTPDVGMAERAVGARRRH"
     gene            complement(<220848..>222980)
                     /locus_tag="LMJF_02_0490"
                     /db_xref="GeneID:12981585"
     mRNA            complement(<220848..>222980)
                     /locus_tag="LMJF_02_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721606.1"
                     /db_xref="GeneID:12981585"
     CDS             complement(220848..222980)
                     /locus_tag="LMJF_02_0490"
                     /note="previous protein_id=AAZ10057.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981585"
                     /db_xref="UniProtKB/TrEMBL:E9ACC3"
                     /translation="MPSAEVLDGAVGCIKRSRQRAQRLSRAGADKADTLRAVPRVDKA
                     YAIEDDEDMSVAQEDVLVGTVCSLHDYCRYLTGSGDLEDGETADVADEGAHLSPSHKN
                     QLTTDSPGSGGRSAHVPERASDRVSGTAGVSHCIPADAAAAASSAPSFPPPKINAAAP
                     ANVFCFAPPMSRGAETTGRGMCSTNLSKRWQVLGDDDGGKAAASELDEQQQVRRKHGT
                     ATAGIRPRRLCEDVGHHHWSCIASNAFLEEKVRICRRSHEPSRMAAAVSCAHPPAPPQ
                     RLHVAAPVPRRQERAAHNRRERTAPTTDAGVLPLSSTSCAALSPAASDVLEVGCSAAA
                     LSASHSVGVLLAHQHEWIYFSVLFHAHAVQLPRTSAESAAARLASNRSLDLSHLYCFL
                     DPPCRLYTEELEEWARAARERRRERERVRDDRHIRHGPLLSSSAHDAPARTHPTASRL
                     DRGTEASDRVTLVASAPLSPCAAPMASPRTWLVYVHPDVSLQTLPRLWSRAFREDASN
                     SGGGGAGQEAFEGGTTRVLDGHHEVDGRDGRAEHEGVVPSYFYAAAARKRRRQAAEVE
                     MLCRHLLSTTPPRRHASSALLVHPAEVSVSARARSRGRPIAAASTKADTGMTSSTPST
                     AALLMSDAAPQRLPTSATGLPHEVDRHREQQRQALACALLVSPLPRGTDLLKRRRWLV
                     KPFVLVEELKYGRVVKYSHAELAAPRVL"
     gene            complement(<224739..>227600)
                     /locus_tag="LMJF_02_0500"
                     /db_xref="GeneID:12981586"
     mRNA            complement(<224739..>227600)
                     /locus_tag="LMJF_02_0500"
                     /product="putative glycerate kinase"
                     /transcript_id="XM_003721607.1"
                     /db_xref="GeneID:12981586"
     CDS             complement(224739..227600)
                     /locus_tag="LMJF_02_0500"
                     /EC_number="2.7.1.31"
                     /note="previous protein_id=AAZ10058.1"
                     /codon_start=1
                     /product="putative glycerate kinase"
                     /protein_id="XP_003721655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981586"
                     /db_xref="GOA:E9ACC4"
                     /db_xref="InterPro:IPR004381"
                     /db_xref="InterPro:IPR018193"
                     /db_xref="UniProtKB/TrEMBL:E9ACC4"
                     /translation="MPAGSARASSAIQQPLSVTLEASPSMHPSSGAAAAAASAVTPSI
                     ASPVPQSPAPTHHEVHQDAPHSHRPVQPPLRISALPAATPHLGQLHHYHRHGDGASPL
                     RVLCACDTFKGTLPSDKVGEAVEKGYWQAWAKAHGSATAQSHVLPAVTAPSEEVPAPS
                     PTSSPLHLVVPPLAASLLPAQHPSVLPADAVRFLHTPMSDGGAGLLDSVTYASTQASM
                     TWGTMPDLSPSGGALRLRRVYIPASVPITGPLGAAITTDTGGARSAAPASRGVSFACD
                     VERRVLVVEMAEAAGLTRIARPQDRHPGRTTSYGVGELIRYALAYMAEAAHAQAETHV
                     ASKTPSPDSAPGNCGGVRLFLGIGGSSTNDGGLGALQALGLEVFVDAAHARATDCGHD
                     GARRAPASTAASDAHAAPTHVDDGAGVRLARPFRGEDLAHVTRVCIGEEMQRIFPYLP
                     EAATPPTATGTRGDGAHAVPPAHSSPPPARACYITEVCLICDVDNTLVGARGATYAFG
                     PQKCAAPHAAAPSSPATAAGTPPGSAHVDSAGVEAAEDAAVGAITSAAQQQMLDSLEA
                     GMRHASTRVVASVWRPLAAADATSAAHAQHAVGEARHMAAGSDKGDKVAEAAVLEDLL
                     YRRGGGGAGGMSGFFRYLLQARYVPGADVVGGLLGLYETPQVAQLLGGGDTGPLRRAA
                     ATAAGKRGGQRGGQRGDDALPVPAERSAHVSGQPTAFSLRCPRGCLFHACDVVVSGEG
                     SFDEQTILSHKTVGRLLEMCTVANAYRLWHHYCADVGEAAAAWSERHGCRCITDVVVV
                     CGRCGFDDYAHLQSATLQAVCTTLLPLHTPHRCAATAAATSTPREADGANADDARLWM
                     YLQDLVQSSAFRRACGESFSAPEDGQIWKYLLSAYCVPRVTVLPLTPTLFPVPAAMQQ
                     PYACVVSAVAHLLEESVRRMTSAQEAGVGACGRHAQGCL"
     gene            complement(<228900..>229412)
                     /locus_tag="LMJF_02_0510"
                     /db_xref="GeneID:12981587"
     mRNA            complement(<228900..>229412)
                     /locus_tag="LMJF_02_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721608.1"
                     /db_xref="GeneID:12981587"
     CDS             complement(228900..229412)
                     /locus_tag="LMJF_02_0510"
                     /note="previous protein_id=AAZ10059.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981587"
                     /db_xref="UniProtKB/TrEMBL:E9ACC5"
                     /translation="MLRPSLRMTTRTQTSLACSFHAGLASVTETPFSVLTSGAVHPQP
                     RSLAQSVRRGACLRRAETATTTRTSAFSPCCTSTAPLFTNAKKSYAHGTEEEQQARQE
                     AAAKEWRDFLDQPVDADGGNVPSARHVEARLPTMRQLNDELPTAAELEKALGEGSIDA
                     YATQPDRDED"
     gene            complement(<231085..>237054)
                     /locus_tag="LMJF_02_0520"
                     /db_xref="GeneID:12981588"
     mRNA            complement(<231085..>237054)
                     /locus_tag="LMJF_02_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721609.1"
                     /db_xref="GeneID:12981588"
     CDS             complement(231085..237054)
                     /locus_tag="LMJF_02_0520"
                     /note="previous protein_id=AAZ10060.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981588"
                     /db_xref="UniProtKB/TrEMBL:E9ACC6"
                     /translation="MQSFGHGVGEQPVCPRSTITLCSPNQHPPPAPRESSGGVSTAAA
                     PPTSSDARTGALTLARKAPKRSRVQIRSIRVRSAPRGPSGATRPVSGRDTAPPHWRCY
                     LSKSAEASTPSAPTRISSAAATMTSSPPAHANTTSSALPIPRLHTARTSASLEAFLLS
                     FQNCLHRQEILFQRVDTAVAQLESARVNAGGATVFPPSSAPTASLWGSGSLPRYVLPS
                     HLSSCAPAAAVAGASPTRPNKTVTFPGAVTGARRSDGVHDVASSDIPTDGAPVLSISS
                     SQQELPLADVFHHAQRHPLGQSTGSSTLSLSVVVMQPALERVGGNDVGSSMVCSSSQG
                     LLSPPQQTSPLLTLPTYVRLDGAALTPTSAAPSRLFHPHTLFPSSTPGTPLSPARLAT
                     TQQQLPMSNTGCRGSLPLNTKATSLVTESPPISGSGGVPGTQRYPAADAEIVAGDPAT
                     EDPMLPAPAEGKDAQEAAAPCCMASTAAENTAREDAEGSAGGRRKGAAATKLSGDESA
                     SASPLTHSVPMPYLTTAISGADQSFNSGCCGAGSDGVPTWSSATPGHAKSGSLRIGGI
                     PDSSVVSVFSESADSVSLSPLSRPPSIWVGSPRARSTLGPTSPHQAPLQLQQHSSLGG
                     SSISTAWISPRRVANSHNSRSSSNTAGAMQASANRSPRTAAALENPRHPSTAVNSASS
                     LPSTSQQQPQQRSSGDVLSPLSGQWLLSPSPTPRVSRRTSGVAHRSSVQMTSVNFSGS
                     GTQNIGGNSTSGNGGGLVTVMSSIIVEGNVVSSLSSTSPLVPPCFPDSGGVVTGAAQA
                     VTSPVPTCRQLTLSPSPSAEEADRDDSFQEISLRSPIDLAEEADEEDAQQLQQLANRY
                     APPPPPPSLTELQQQQNQRRRWSAPPVPTMRRPPMAPLRHPDAACPAALRNEEERLRS
                     STPPVARPEQWLSFEQQHERLHLPECWRDSEVIVVDHAKKDRERDSEEAERLLELEEE
                     LLRELRQNQSDQMDGSGLLRRGRRRGSRHRHLMAGANAAGETIDEEELDWGDDSVDEA
                     AADAAYEARLARYGRAMLLHRRGRSHASLYREGGEGCSCGSCPSTTSCCCRRRPVSGG
                     DRQGFPSDTTASLRGAPSGESTTLPAATGAPAGSPVLPARNFSRRHSAPATIWGADHG
                     AGWRDLQARFEELISIQQRSRGSERDGADGTTLGEQSLSTLANNTASSPMQEGLASGI
                     SRRRRSRSFGQEVTACPPHLVGRRAPSAAPPTTDLLSSYRDNMPHGGDGSSGLPAPSP
                     HAAAAAPTPLERTHTHSGSSGYRRVQWGREAEADAAPSPPSQAPEKQRISSAALSPYS
                     STPPSPPEQDDTPGQSSHARVSAVCTNPPAFLTSPRHPSVTVNAAHAASTRGSAEARK
                     EAATYDSDVEEDERDPKSAMAARTPVASTAQRTLRLHFTRPSHTASSMGILGRPRRAM
                     GLHSAPGKGRQNTKAPQAGRTDGESKTGATPSTTRTLSARQKSHAAAASSAVPAASGR
                     RGNTAASRSGSCGSARGPRIVGSGGGRCARCSGASPASLDTAAAASIVPTKEADDGAP
                     TAATESNSHGTTRADTGTTMSATHPSDHALDGGELVEPFSAVFVVAAPAAAPSPPTTT
                     QKNARDSGTQRGRLRDSKASSSRDADKDHDAHDASLSSPPRHRHRRHAGAEGETAVSA
                     RPPHKASARHAPGLPENEARHPDGGAAAGTTALEGADSRALLRRLAQQKDRTRAMEER
                     LRFGVNSTALANPNSGSHSACSGCGSGVVWNDGHITGRWGLESESCTPTSGAARACVA
                     ADLARQDFSTPSNMYSVSAATGDTTLDIPATRASTARHGGSPAADAPHVTVVDPAEAT
                     TVGGVHAVHPGAGAGAQQTSSNPRRRRVDLRSRLVSRLTAVSSSLSASPAKRHKGCTA
                     TVTSATNATVAATAVLAQGFRRAESAYSIRSRSPTYVNMMHHAGYGDRRRHSIGGDVL
                     PPTTLSISERQLRSSRAPVASQLIDWVRGGE"
     gene            complement(<241987..>244575)
                     /locus_tag="LMJF_02_0530"
                     /db_xref="GeneID:12981589"
     mRNA            complement(<241987..>244575)
                     /locus_tag="LMJF_02_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721610.1"
                     /db_xref="GeneID:12981589"
     CDS             complement(241987..244575)
                     /locus_tag="LMJF_02_0530"
                     /note="previous protein_id=AAZ10061.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981589"
                     /db_xref="UniProtKB/TrEMBL:E9ACC7"
                     /translation="MSAVSPPSGQLAQPTAFIATPSGFNASGAAPSFVKVYCGNDECV
                     PFSKQCTSDVFQGVLSDLANRVSKHEAQDQASRSHRVKTVGSAAAADGAASASGTVAG
                     SGGSDGKGESTPPASEDRVGTAGTRSRVVKGGGAGAKKKQSAPPLSTSPPLLLPSKGV
                     APAAPSTEPFHSTNTSPTTDTAAALVGDPLAGESGVRVACDVYRRAELLPLSFVREVA
                     SNSRVTALYKQHLQLQEELQRHQLEQQQIQQQREEDDDAASAAAAKAAKNDAADAASN
                     QSTAGRAGGKGGKTPSSKPAPRRCGMPSVGRAGSAVSGNRVPCSASSAATSAVAATAL
                     AAQIRTQLWTALRNTIPFFGVLTMPVHTPMEPLISLPASASASGASTAAARAAAATTT
                     PPAAGVASAATAVCSGSYVLLGCRERPREERISADASPVASQAGRCASGALSVIGGAA
                     ACASMSTVERLVEQAHEASVTRLPPLSSDAVLRSNGGTNAFGANGEGGKRSPRKQRLH
                     PRDLQAQMSQQSLPLRCTLHPTTNRVVPMLPPLPDDIAAGYGSARLVTRSLGPSAADP
                     SGDADDSTTPSGTYISRIAANGRGCGNPDRAHRRSLDEPADDFVSAVSASAAAGLRRP
                     LSSCKDALPTGVAKGSAGAGPLSDEVGIEGDEEATLMNAQQPSNAAAASYDPLSPSTL
                     LHASSAVGPSGSTHRDGDGPGKGMEPGVPLSAAAIARLAPSTRFTVQLSSCSVTLTTQ
                     PRKGAGMNAADAASANTTGAANSISGTGRIATGCGEVDTYADELTLVFDGLDVLWHGP
                     NGEEALLQWVLDEYSILLKQRMAAAMAQWTSMVHARDTSAGAASESSSKANKMRRQLP
                     SERVRA"
     gene            complement(<246041..>247027)
                     /locus_tag="LMJF_02_0540"
                     /db_xref="GeneID:12981590"
     mRNA            complement(<246041..>247027)
                     /locus_tag="LMJF_02_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721611.1"
                     /db_xref="GeneID:12981590"
     CDS             complement(246041..247027)
                     /locus_tag="LMJF_02_0540"
                     /note="previous protein_id=AAZ10062.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721659.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981590"
                     /db_xref="UniProtKB/TrEMBL:E9ACC8"
                     /translation="MAVAWALGTFSGYGWLYSSTGLVLPTSSSSSSLSSSANAGAQVM
                     PSAVRPSWLWLVVSLLTGLFSGILCKVKDIVDGKHACDTHLFPLLERYEEFEDTELRC
                     AAGAGDDHQDDRGAGYPFVAVAAPPSSPLSGVLRYRRICMSTSHHLVSLGDRLYMVVP
                     FCTGQWFSFILHNGWRGIIVENGTILLSLSLVGYTMLSYKFLKRQVLRVSGRVTLSTT
                     ARSRNRRNKRRLQQQHQQQGGAAVVSEEDAAEDANGADFPEDVGEVAVVDVMDLISKL
                     FTTSFGVVVLVVLGLNLFMTSLCIPFLKALFKLNALVSGVGIGIELIMYEVA"
     gene            complement(<249521..>250012)
                     /locus_tag="LMJF_02_0550"
                     /db_xref="GeneID:12981591"
     mRNA            complement(<249521..>250012)
                     /locus_tag="LMJF_02_0550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721612.1"
                     /db_xref="GeneID:12981591"
     CDS             complement(249521..250012)
                     /locus_tag="LMJF_02_0550"
                     /note="previous protein_id=AAZ10063.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981591"
                     /db_xref="UniProtKB/TrEMBL:E9ACC9"
                     /translation="MPNVIVTCTFNPPCVSIQGANIRQDTIDALQRALPKQTTTSLPT
                     QRPGEPAKFLLTNGSGVVESGTVNRIEDGSAAAGGAEEGSQENTSPHHSSHGVAPGEG
                     AKEYKSWRIDLGQHYCDQTGRAMIFLVIIEALEEEGFALRGTHTLMMDREKDATQLIF
                     VRS"
     gene            complement(<251143..>253692)
                     /locus_tag="LMJF_02_0560"
                     /db_xref="GeneID:12981592"
     mRNA            complement(<251143..>253692)
                     /locus_tag="LMJF_02_0560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721613.1"
                     /db_xref="GeneID:12981592"
     CDS             complement(251143..253692)
                     /locus_tag="LMJF_02_0560"
                     /note="previous protein_id=AAZ10064.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981592"
                     /db_xref="UniProtKB/TrEMBL:E9ACD0"
                     /translation="MRSSANAAAAGNGYRSSSAADLGWSSASGLRSGVEVKASIAPHS
                     VPAGVTPPLRYGGDPVAATTAVPPAGHVTFPAADLVDRSAFLFGLLQSEHLVHDVHDA
                     IVGLNNVAADKTDDGDAKSRTAGGQSSSDGALSAVFYFIARSPSPDMPWRPIYTSAVL
                     LCVFSTVEAAQRAIARVDGVVLHTVQTEVLGSASTASTAPMSSPYLVLRPAREFVLGP
                     ENTDTALLTYLTTPRLVDLLLRRQRMQKPNDRVADDAEQRSAMELYARANLPPAYLCG
                     SAARLYAAILSPQSPYAVDWAAARVAMARGDGIVVPEMSVVEPWACGGAGEYDRDKGA
                     TPGAAGSPPADRGSPPLLQGADIERRRRASVSGAAHYVPVTLQEEEYYRRYGVGSPRR
                     TTSSRARCGSVEGLTELMPSRGSLYRGAQGVLRGVSWFWRRAYESLSGKEAALISGPS
                     SLPVAPAVPIAPPQASAGAIGTSDQVPFPASTTAPSEGRVIYEPPRVRHRAEGRGVDG
                     VSGTRGGGGQPIMIPRYNAVGSALSWMPGFHYVAPLFVTGVFPLGGTAPPPPPPQRRR
                     MREEEGGDLESSAWSSKEAQMYGIASADAWRRDGGQGPSYSSLNHAPMPEPFSDSAVW
                     GAPLRRCEVSAAPQSAGLPPVSWSLPAQPSQLFPASLSLHAADEPQAAAGTAPHPNSL
                     LPTPTVSSIAPNRSYMPLHDSDLASSSEDASMSALWRSRAAEKSDAIAASSRGNRDFI
                     RVDGVHAAGAGSRPARHVRSVGSGTLLAAGTLGGSSGTKAGGARPSGTLADELRTFGS
                     GSVAGLRGRTDNQDEVRTTTADTTADAQREKKSSSRASRRTVEFSLPGETK"
     gene            complement(<257218..>261492)
                     /locus_tag="LMJF_02_0570"
                     /db_xref="GeneID:12981593"
     mRNA            complement(<257218..>261492)
                     /locus_tag="LMJF_02_0570"
                     /product="putative protein kinase"
                     /transcript_id="XM_003721614.1"
                     /db_xref="GeneID:12981593"
     CDS             complement(257218..261492)
                     /locus_tag="LMJF_02_0570"
                     /EC_number="2.7.11.1"
                     /note="previous protein_id=AAZ10065.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_003721662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981593"
                     /db_xref="GOA:E9ACD1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9ACD1"
                     /translation="MQTSEGGAHRQSAKASETGSGATVASVKAAQSPWQPSYAPGTNQ
                     LPEVDEARRCSSIRKENDGRVAGRCTARSRDIASKNSYFSEGCGNQRQAEGSDCKDRG
                     NLCGNGHTQHSCALASRSYMKSDISMDTFVPHRELSEHGSGKDGQVQINLESVEKSVF
                     TPEQPAFGDSTYASRNPHSCNASGTAAVGPFPKIETAVASTAYSESGSGARKSTTHAE
                     KSMQPLRNQLHRFSSSKDAPRRRSHEICRTALVASRTLPVVRVETELADSDRGGASGS
                     GDVAEAKVPSARTGCLPNPSVFAGDIVTTDTRESIGRDRRSAQFLREMLGVIDKDQVG
                     SSRECEGDGGNVNGAATVPNPLHHRNGASRASDSGSISDTHHGYGNEAFGTQSSATRR
                     ELHGRNADNVAGGDRDQSSTDSLVDGRSFGSYHGELEWLCVPSLFYFFANMIKWNELR
                     LQRRTSQTPLEENRSHSSDDSFSLASIWTPNCEQELHVLEDRISFSIFELEGVYLNPF
                     LVSWSKPKLRLLVADVASTWEKEGPYSAEFDCVSSRLFDAISTEQTCQLRSTCLLSVR
                     QWLGSAQHRWDVTCVLVALLTVSILCIVFLAVFGRTQAVCIVFSMMLSVAVVLMYVVA
                     VFVLHHNTYADAASRHFREEVVRAAQKKMEEEEMAEKRDVGSRSGYGHRGAAKASRDA
                     AGNGCRGYTAGDDDTGADDEYMEDEISIAVRNLRALTEGSTHPATNAPPYYRLSDRPH
                     SGKCDSGGAGDRFEDDMTLADGNYASLTSRSLQAGDKAKQQFEEDRENRLLLSRGTFE
                     QHQAHMDQCGSHRVHERMSTQPALRPTKQATPSSTSGATGAQARPSTADSCGRVGQEQ
                     ITRGGCDGEKIVMPEQQPLQQLADLPENVNVKALLFCKNVGVLSQVASSLWERNCMLL
                     RVSNLQALNSTFHHGFERFGLVLIHAPDVAEGSAELETALSWLQVERRPVFFFACSAM
                     AYPASVPFSARLLAPFSSTALNALLLAGIGVESEHGCVSSPLLPQQEQERHRQQCPSQ
                     PFQVPPYTLGRRLGGGAFGNVFEAEMEHTGAKCAVKRMYLKDDSNQDEEQQANSGVAG
                     ACAGGSGTLAAGANSTASPRAAEVGEEAGGATTAVGSQLRDIAQEVEIMSSLQHPNIV
                     RYYYCERDDNCISIFMELCTGGSLRSLIHSGKLVNPPEIKHLLLEIISAVSYLHNMRI
                     VHRDLKPDNVLFRQGHIKITDFGTAVHKHGGDLRLIRGTFAYMAPEILVGDPYGRACD
                     VWSIGCIAAEVLSVELPQHALGLPEMCEYYRAMGENSELPIECDVPGVRDFLLACLQR
                     NPNQRSTAGELFYHPILQARDTSIHDWMVEVVARRRRMQQQQQALHRNGLGSRTGGGT
                     GGPGGNHQASSNGPNNDGGVNCANAGDRFDLHSVGSAQSLDSSKLV"
     gene            269834..270288
                     /locus_tag="LMJF_02_SLRNA_0010"
                     /db_xref="GeneID:12981594"
     ncRNA           269834..270288
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0010"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002459997.1"
                     /db_xref="GeneID:12981594"
     gene            270289..270743
                     /locus_tag="LMJF_02_SLRNA_0020"
                     /db_xref="GeneID:12981612"
     ncRNA           270289..270743
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0020"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002459998.1"
                     /db_xref="GeneID:12981612"
     gene            270744..271192
                     /locus_tag="LMJF_02_SLRNA_0030"
                     /db_xref="GeneID:12981613"
     ncRNA           270744..271192
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0030"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002459999.1"
                     /db_xref="GeneID:12981613"
     gene            271193..271650
                     /locus_tag="LMJF_02_SLRNA_0040"
                     /db_xref="GeneID:12981614"
     ncRNA           271193..271650
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0040"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460000.1"
                     /db_xref="GeneID:12981614"
     gene            271651..272105
                     /locus_tag="LMJF_02_SLRNA_0050"
                     /db_xref="GeneID:12981615"
     ncRNA           271651..272105
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0050"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460001.1"
                     /db_xref="GeneID:12981615"
     gene            272106..272560
                     /locus_tag="LMJF_02_SLRNA_0060"
                     /db_xref="GeneID:12981616"
     ncRNA           272106..272560
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0060"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460002.1"
                     /db_xref="GeneID:12981616"
     gene            272561..273009
                     /locus_tag="LMJF_02_SLRNA_0070"
                     /db_xref="GeneID:12981617"
     ncRNA           272561..273009
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0070"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460003.1"
                     /db_xref="GeneID:12981617"
     gene            273010..273464
                     /locus_tag="LMJF_02_SLRNA_0080"
                     /db_xref="GeneID:12981618"
     ncRNA           273010..273464
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0080"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460004.1"
                     /db_xref="GeneID:12981618"
     gene            273465..273910
                     /locus_tag="LMJF_02_SLRNA_0090"
                     /db_xref="GeneID:12981619"
     ncRNA           273465..273910
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0090"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460005.1"
                     /db_xref="GeneID:12981619"
     gene            273911..274352
                     /locus_tag="LMJF_02_SLRNA_0100"
                     /db_xref="GeneID:12981620"
     ncRNA           273911..274352
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0100"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460006.1"
                     /db_xref="GeneID:12981620"
     gene            274353..274798
                     /locus_tag="LMJF_02_SLRNA_0110"
                     /db_xref="GeneID:12981621"
     ncRNA           274353..274798
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0110"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460007.1"
                     /db_xref="GeneID:12981621"
     gene            274799..275247
                     /locus_tag="LMJF_02_SLRNA_0120"
                     /db_xref="GeneID:12981622"
     ncRNA           274799..275247
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0120"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460008.1"
                     /db_xref="GeneID:12981622"
     gene            275248..275702
                     /locus_tag="LMJF_02_SLRNA_0130"
                     /db_xref="GeneID:12981623"
     ncRNA           275248..275702
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0130"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460009.1"
                     /db_xref="GeneID:12981623"
     gene            275703..276148
                     /locus_tag="LMJF_02_SLRNA_0140"
                     /db_xref="GeneID:12981624"
     ncRNA           275703..276148
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0140"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460010.1"
                     /db_xref="GeneID:12981624"
     gene            276149..276594
                     /locus_tag="LMJF_02_SLRNA_0150"
                     /db_xref="GeneID:12981625"
     ncRNA           276149..276594
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0150"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460011.1"
                     /db_xref="GeneID:12981625"
     gene            276595..277043
                     /locus_tag="LMJF_02_SLRNA_0160"
                     /db_xref="GeneID:12981626"
     ncRNA           276595..277043
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0160"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460012.1"
                     /db_xref="GeneID:12981626"
     gene            277044..277489
                     /locus_tag="LMJF_02_SLRNA_0170"
                     /db_xref="GeneID:12981627"
     ncRNA           277044..277489
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0170"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460013.1"
                     /db_xref="GeneID:12981627"
     gene            277490..277931
                     /locus_tag="LMJF_02_SLRNA_0180"
                     /db_xref="GeneID:12981628"
     ncRNA           277490..277931
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0180"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460014.1"
                     /db_xref="GeneID:12981628"
     gene            278100..278547
                     /locus_tag="LMJF_02_SLRNA_0190"
                     /db_xref="GeneID:12981629"
     ncRNA           278100..278547
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0190"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460015.1"
                     /db_xref="GeneID:12981629"
     gene            278548..278993
                     /locus_tag="LMJF_02_SLRNA_0200"
                     /db_xref="GeneID:12981630"
     ncRNA           278548..278993
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0200"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460016.1"
                     /db_xref="GeneID:12981630"
     gene            278994..279435
                     /locus_tag="LMJF_02_SLRNA_0210"
                     /db_xref="GeneID:12981683"
     ncRNA           278994..279435
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0210"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460017.1"
                     /db_xref="GeneID:12981683"
     gene            279436..279877
                     /locus_tag="LMJF_02_SLRNA_0220"
                     /db_xref="GeneID:12981681"
     ncRNA           279436..279877
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0220"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460018.1"
                     /db_xref="GeneID:12981681"
     gene            279878..280323
                     /locus_tag="LMJF_02_SLRNA_0230"
                     /db_xref="GeneID:12981631"
     ncRNA           279878..280323
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0230"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460019.1"
                     /db_xref="GeneID:12981631"
     gene            280324..280772
                     /locus_tag="LMJF_02_SLRNA_0240"
                     /db_xref="GeneID:12981632"
     ncRNA           280324..280772
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0240"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460020.1"
                     /db_xref="GeneID:12981632"
     gene            280773..281218
                     /locus_tag="LMJF_02_SLRNA_0250"
                     /db_xref="GeneID:12981633"
     ncRNA           280773..281218
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0250"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460021.1"
                     /db_xref="GeneID:12981633"
     gene            281219..281664
                     /locus_tag="LMJF_02_SLRNA_0260"
                     /db_xref="GeneID:12981634"
     ncRNA           281219..281664
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0260"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460022.1"
                     /db_xref="GeneID:12981634"
     gene            281665..282113
                     /locus_tag="LMJF_02_SLRNA_0270"
                     /db_xref="GeneID:12981635"
     ncRNA           281665..282113
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0270"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460023.1"
                     /db_xref="GeneID:12981635"
     gene            282114..282559
                     /locus_tag="LMJF_02_SLRNA_0280"
                     /db_xref="GeneID:12981636"
     ncRNA           282114..282559
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0280"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460024.1"
                     /db_xref="GeneID:12981636"
     gene            282560..283001
                     /locus_tag="LMJF_02_SLRNA_0290"
                     /db_xref="GeneID:12981637"
     ncRNA           282560..283001
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0290"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460025.1"
                     /db_xref="GeneID:12981637"
     gene            283002..283450
                     /locus_tag="LMJF_02_SLRNA_0300"
                     /db_xref="GeneID:12981638"
     ncRNA           283002..283450
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0300"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460026.1"
                     /db_xref="GeneID:12981638"
     gene            283451..283896
                     /locus_tag="LMJF_02_SLRNA_0310"
                     /db_xref="GeneID:12981639"
     ncRNA           283451..283896
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0310"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460027.1"
                     /db_xref="GeneID:12981639"
     gene            283897..284342
                     /locus_tag="LMJF_02_SLRNA_0320"
                     /db_xref="GeneID:12981640"
     ncRNA           283897..284342
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0320"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460028.1"
                     /db_xref="GeneID:12981640"
     gene            284343..284797
                     /locus_tag="LMJF_02_SLRNA_0330"
                     /db_xref="GeneID:12981641"
     ncRNA           284343..284797
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0330"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460029.1"
                     /db_xref="GeneID:12981641"
     gene            284798..285242
                     /locus_tag="LMJF_02_SLRNA_0340"
                     /db_xref="GeneID:12981642"
     ncRNA           284798..285242
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0340"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460030.1"
                     /db_xref="GeneID:12981642"
     gene            285243..285694
                     /locus_tag="LMJF_02_SLRNA_0350"
                     /db_xref="GeneID:12981643"
     ncRNA           285243..285694
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0350"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460031.1"
                     /db_xref="GeneID:12981643"
     gene            285695..286149
                     /locus_tag="LMJF_02_SLRNA_0360"
                     /db_xref="GeneID:12981644"
     ncRNA           285695..286149
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0360"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460032.1"
                     /db_xref="GeneID:12981644"
     gene            286150..286604
                     /locus_tag="LMJF_02_SLRNA_0370"
                     /db_xref="GeneID:12981645"
     ncRNA           286150..286604
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0370"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460033.1"
                     /db_xref="GeneID:12981645"
     gene            286605..287059
                     /locus_tag="LMJF_02_SLRNA_0380"
                     /db_xref="GeneID:12981646"
     ncRNA           286605..287059
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0380"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460034.1"
                     /db_xref="GeneID:12981646"
     gene            287060..287517
                     /locus_tag="LMJF_02_SLRNA_0390"
                     /db_xref="GeneID:12981647"
     ncRNA           287060..287517
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0390"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460035.1"
                     /db_xref="GeneID:12981647"
     gene            287518..287967
                     /locus_tag="LMJF_02_SLRNA_0400"
                     /db_xref="GeneID:12981648"
     ncRNA           287518..287967
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0400"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460036.1"
                     /db_xref="GeneID:12981648"
     gene            287968..288416
                     /locus_tag="LMJF_02_SLRNA_0410"
                     /db_xref="GeneID:12981649"
     ncRNA           287968..288416
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0410"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460037.1"
                     /db_xref="GeneID:12981649"
     gene            288417..288873
                     /locus_tag="LMJF_02_SLRNA_0420"
                     /db_xref="GeneID:12981650"
     ncRNA           288417..288873
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0420"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460038.1"
                     /db_xref="GeneID:12981650"
     gene            288875..289323
                     /locus_tag="LMJF_02_SLRNA_0430"
                     /db_xref="GeneID:12981651"
     ncRNA           288875..289323
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0430"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460039.1"
                     /db_xref="GeneID:12981651"
     gene            289324..289772
                     /locus_tag="LMJF_02_SLRNA_0440"
                     /db_xref="GeneID:12981652"
     ncRNA           289324..289772
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0440"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460040.1"
                     /db_xref="GeneID:12981652"
     gene            289773..290227
                     /locus_tag="LMJF_02_SLRNA_0450"
                     /db_xref="GeneID:12981653"
     ncRNA           289773..290227
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0450"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460041.1"
                     /db_xref="GeneID:12981653"
     gene            290228..290681
                     /locus_tag="LMJF_02_SLRNA_0460"
                     /db_xref="GeneID:12981654"
     ncRNA           290228..290681
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0460"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460042.1"
                     /db_xref="GeneID:12981654"
     gene            290682..291129
                     /locus_tag="LMJF_02_SLRNA_0470"
                     /db_xref="GeneID:12981655"
     ncRNA           290682..291129
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0470"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460043.1"
                     /db_xref="GeneID:12981655"
     gene            291130..291583
                     /locus_tag="LMJF_02_SLRNA_0480"
                     /db_xref="GeneID:12981656"
     ncRNA           291130..291583
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0480"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460044.1"
                     /db_xref="GeneID:12981656"
     gene            291584..292032
                     /locus_tag="LMJF_02_SLRNA_0490"
                     /db_xref="GeneID:12981657"
     ncRNA           291584..292032
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0490"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460045.1"
                     /db_xref="GeneID:12981657"
     gene            292033..292478
                     /locus_tag="LMJF_02_SLRNA_0500"
                     /db_xref="GeneID:12981658"
     ncRNA           292033..292478
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0500"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460046.1"
                     /db_xref="GeneID:12981658"
     gene            292479..292936
                     /locus_tag="LMJF_02_SLRNA_0510"
                     /db_xref="GeneID:12981659"
     ncRNA           292479..292936
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0510"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460047.1"
                     /db_xref="GeneID:12981659"
     gene            292937..293378
                     /locus_tag="LMJF_02_SLRNA_0520"
                     /db_xref="GeneID:12981660"
     ncRNA           292937..293378
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0520"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460048.1"
                     /db_xref="GeneID:12981660"
     gene            293379..293833
                     /locus_tag="LMJF_02_SLRNA_0530"
                     /db_xref="GeneID:12981661"
     ncRNA           293379..293833
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0530"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460049.1"
                     /db_xref="GeneID:12981661"
     gene            293834..294288
                     /locus_tag="LMJF_02_SLRNA_0540"
                     /db_xref="GeneID:12981662"
     ncRNA           293834..294288
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0540"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460050.1"
                     /db_xref="GeneID:12981662"
     gene            294289..294737
                     /locus_tag="LMJF_02_SLRNA_0550"
                     /db_xref="GeneID:12981663"
     ncRNA           294289..294737
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0550"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460051.1"
                     /db_xref="GeneID:12981663"
     gene            294738..295183
                     /locus_tag="LMJF_02_SLRNA_0560"
                     /db_xref="GeneID:12981664"
     ncRNA           294738..295183
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0560"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460052.1"
                     /db_xref="GeneID:12981664"
     gene            295184..295625
                     /locus_tag="LMJF_02_SLRNA_0570"
                     /db_xref="GeneID:12981665"
     ncRNA           295184..295625
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0570"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460053.1"
                     /db_xref="GeneID:12981665"
     gene            295626..296067
                     /locus_tag="LMJF_02_SLRNA_0580"
                     /db_xref="GeneID:12981666"
     ncRNA           295626..296067
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0580"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460054.1"
                     /db_xref="GeneID:12981666"
     gene            296068..296516
                     /locus_tag="LMJF_02_SLRNA_0590"
                     /db_xref="GeneID:12981667"
     ncRNA           296068..296516
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0590"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460055.1"
                     /db_xref="GeneID:12981667"
     gene            296517..296962
                     /locus_tag="LMJF_02_SLRNA_0600"
                     /db_xref="GeneID:12981668"
     ncRNA           296517..296962
                     /ncRNA_class="other"
                     /locus_tag="LMJF_02_SLRNA_0600"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460056.1"
                     /db_xref="GeneID:12981668"
     gene            <298464..>309800
                     /locus_tag="LMJF_02_0580"
                     /db_xref="GeneID:12981669"
     mRNA            <298464..>309800
                     /locus_tag="LMJF_02_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721615.1"
                     /db_xref="GeneID:12981669"
     CDS             298464..309800
                     /locus_tag="LMJF_02_0580"
                     /note="previous protein_id=AAZ10066.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981669"
                     /db_xref="UniProtKB/TrEMBL:E9ACD2"
                     /translation="MLDISCESILFDEVAVNDIPAYRPVQVRNTSGSPLLVKLTTTSP
                     VVQFQLRNENYEAIKRVGFADTLSVYSEAFDLVGLISSIELAPFEEKDLIVYFRADAA
                     TFSHLVKGSQPVPYTGSLQVTVGTPAPASPLGNALRVDGKKRLAAQQPAAACITIPFR
                     ANVYVSCLKLSSTELHVTMAPNKTQVTDFVVTNTSCQPVHFVIRDQAMPLRGLDVALY
                     ESDKFEEPKLGHRLLLDSYACMTFSLILRSSTASSTAQQQYHTVFQCDNLRDNRNTTF
                     LYVSVNVVAESQGDLVVFHDTSVNFGDVYRGTKATAIIRVQSLDDRGEAVLRLGDVDR
                     RKCEGKVSLMKGNAAVDEMTIGSPKGNQLNAVTLMYQPFYDGDSKDESKVKFDVELLV
                     VSADRGHNQRVVIRCAAVLYTSNIVVSQRSINFGDCQVGQSKRFTLQIENRSPLPGKI
                     MVQLRSKIIRIEGVSTPQKLAGRELKEEFSVAPSASLPITLRITPQRVNPMYCKQLTI
                     INASNPAEDRQVINIEANNMAPLDAKLHDELYSWKCDLGNIDSANSRRGPSTLWAISG
                     VPLIVPYSVQSKVDYQVVLNLRSSCPEIEVFYSSDAVICGQLGKIAAEMRSFCVYSES
                     EDASYLTNESAEQLFSAREELLRLLNETSHNITNRITLEPLVSIKVYVLIIRTASPTE
                     PLTKEDGISIAVDGIEAPRFVRLSYRLCGTSFELNGQKTKNFGEVNIGVKKTTKLPIV
                     NRCNSFLYLHLSKSRSVTAEHIRMENSDKRSIFLTIRPYASREIELTLYPGIKGVFQE
                     KIRVSNILNIKNTITMTLKATVTKADTFEISPDSWTFEMMVPSSSSVPALMASSPPFL
                     KAEEAAAAANARVGAKFTVSNTSNARRQIVVRLELNSAAAANGVSAANPYLSFAGVKV
                     AVQLDMTLSGATSVSARKLEEQIEKLEQKLKIYVRKHKTEKAENAMRKIEAYRLALKG
                     EEVDLTALEAAQAGTQSATDHELSESEDDSSSAALQVWRNKTQQGDIVQLLRREGVAL
                     PSMDTGESVIITLFLGCKRVVEEPIPVSQTQAMNLLFYEARDQEANRIIPIDLILMRT
                     PGDVATQQLLAAPSVGATPQTVLPFAAAVSAVVAPSASPSLPSPSHRDSEPLQLSPDN
                     ATVASASASGGALQSGSFLPGSSGSASRAVQSRPPPCIRLITTDSHAGNSDGRPRSTF
                     MGHPLIVLHNCIVNDQTEFSFVVKANANTTIVVLEPRRCGGSVAVVLDARFKLFPRNG
                     HVRQQEPLRIVVECTARSVGPQKYFIPVKNICNAADVQYLTVEMNPTEEIEMLTTEPK
                     ELLFRDVITPCAASQLETQLVLIRCRFSFPHALIVRTNKPSQLALFEDASCTVPLLHP
                     IRHIFVKETVRVYVQLRPGARYVDPCARQIRAGVLVEAVAPNPAVSSTAYCVVGKAIL
                     RAMAYVGSGLLEVPRGSLDLGCVAPTQDYVTTHFTVRNTSHTFALRVALVPSSPLLEV
                     AEETSASSDIVVAPLQEHIVPLLVHLPAPGLTREFIDVMNRSSSQETMRVSLSALRMN
                     DGIVQVDPPVNTRLAFPVAAVVRGEQGRQLHLHQPVSYSVKLANYNHHREVVLATTTA
                     VHASCALPLWFHTPDEESKVCAAFEEEQRHALEAADDSPTSTPAQMSEPRAGTVALTT
                     TPVVDQPPAMYTRGRVELKANHTQIVTWTLTSLPTLTSEEVAAVLQYQMVTITTTLQV
                     YVTYTAHSARTSAAAGGWKPYSSGATLQESRYRGPTVGQCVLLVPITLSLAMSEGRAE
                     PAVVSLGLVGKATSLPTSPSSSASSVSSSNKEHDAATEHGLDAFASGREEEMVLAARQ
                     RRRRRSCVSKLRRPRNHTFSAFASKPGLPQSPSHNMVVSFRLINLSAVIPLPLKVECP
                     PVVRFSQTRLKIPPGESTVVQAALNMKLIATQGTFRYEAFFVNEWNPENDMAVCITGQ
                     HYWKVFQVLRADTQEEVRESLTLAPLRVEPSLRVPLAEMKLDFVATEPDVEFDLHLQP
                     NPQLEGLLELLLLHYDATSAVRHLSFRSNIVTPTSPAATSVAGGVAAASVVQGSAGAA
                     AAGMASLTTSGAAPPASGSAIAVAAAGAEAGLGGGLATSGSASPGIGLPSGGTPGNLQ
                     PGTPSGVAATATATGFPALGATSAVLPVAEFFGAAATTAAGAAGGASIAAAAAIKAKP
                     RKTGAGSAAGTANGGAATAATPSQTLRLRCLLRSGDLSSLVSLFYGYRKARAAGTSAQ
                     ATTATTNAKGIGAGAATTSSAVAAPLAPPEITALEAAGANSNAGAVAWTYDRVAELER
                     RSASLASNNVWLGTVVVENPFTEVEEVQVYSTLAPFRTFSAPSKVMLRPCRVSVESVP
                     RPSTSAAAPQASTHRGTPQVGYVGEISITNEFDVYVAELSVVVLVHERLAVPLRIDVR
                     GGCRHAVDTVSPDAVAGAIPPVPDATLEDEEATEADIATTSAFSASLRPGVPVATSFL
                     TEPATDGAGPVSLPHCIHLGPHETVVVTVAIRPADMRTLQPTPMSPTKAILTALPTPL
                     SLPSLEEFVSVVLVDENAPFSYVVSRVSVVTPTSGAEALPSIVLSSVTTTSNTAAAAT
                     SVAAASDASTKDGEAEARPSATLSPAAHREESTGPLATPSATLAGEGLTMVLTTPTAS
                     DEAPQQLSRSSSKQASDLVLAGGTAAAAETGEPEAAPAAEVLLPPRGSTPCGSEGPAE
                     GPWVSPAGVITTLAPSLAAAPRQWVLSLRNCDALPGCGGAYFFNFSVPRDDTYEPNIL
                     ITNHAPDRTVRYTVHVISQSPQVWLLLTTTTGVLEVGETQPLRLQVLSSEVGSFVGYV
                     AITNTCDTREVVYLRLNAEVFVPGTAEGFFDVVAMNDGHRLATTNAGHSVYMGALHGA
                     GTSRALMALEIVNKGSVALEFPVSVVHPMRQELRPIPQSVWYGTAVAASGHRRRHIAS
                     GVLPQRITLKDDGSVASLTFPRASRAALDQQADPTAVGAVAGTAAAATQKGAVDGTVR
                     TAGGIEEALPTKQLFGQPKPLLSPHHTSLHHQRGGVRPGSGVAAAPTPTALSSTASTS
                     ASPFEGKLTVCQIHGVPTRTGQRYFVVDPRSRMRLAFVLSCNALHDIPEGYGVFGQTD
                     VVFRCKQARDARFSFNVKFEAYRPTFAVALEYDMDATEKTAASAGAVAALRSEAVVSS
                     ADALEPAVGSASSKASVAPSLAPPALASTATSRWAEVEVAVTNLSRSHTQVFVLYTQS
                     EVLSLSVPGAGPSAHRVCAGSALLPPPSGAAAEDNGCGSGAAFVPSGVEIAVSPQSVG
                     VFAVRLDRLRAEALLNFDKDESMLARPALCEHAFLYSKGNPRERVQLLFRQQALLAQP
                     RRQARAAAGASSEVSPLSPALVDAKPVKGGGQHFREHHILGFAQRFSAVMTSLADRVP
                     FLTRPEDVAESVRSHKSVAGSSSTGVGGGGGGSGAASTTGGGGGDGVGSVANAGAAAG
                     VAAMRVSAGTAASTVAGVTSSVASSNFNVVHHSTGRNQRSHRDRNSGPVAHRGNTHRS
                     RRGDSFYDDTSDGGTASSSSGTSSTSSCSSDVADSDDFASEIAEVAADRTLDSTLTED
                     NFDQPSRDGCNDASATAVGEAIGESGESAATGCPTDARSSSDGASADLAPHALFRSSS
                     HPCMRSSEGPIGSVVASSLSSLLPLGTSLARSSSGGSHPSSEDPHWYDTLITLHDLLV
                     ELTWLCDELLFYAILLCNSRHVEACMAFLVSAVAQHPVMVAWRRRRGSAGRSRQYDIF
                     GQFLETLDALPRLSSTSSSSGS"
     gene            <310561..>312108
                     /locus_tag="LMJF_02_0590"
                     /db_xref="GeneID:12981595"
     mRNA            <310561..>312108
                     /locus_tag="LMJF_02_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721616.1"
                     /db_xref="GeneID:12981595"
     CDS             310561..312108
                     /locus_tag="LMJF_02_0590"
                     /note="previous protein_id=AAZ10067.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981595"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9ACD3"
                     /translation="MSTAADRQAFLRLMGLTDADVTDPDHQPCAMLHSQTSSSHNVTD
                     KVHRGVKYNSPTASSVAGLSHSASLGGDAIQFSLMNTTNTLRDTSPIVASGPSSSSSR
                     PLFSAPRSVHWEEESIATTSHSSQLPQRAGASGCTAAAISEELKDVGNRSFEAGAFRE
                     AVQHYTAAIDALAASTTHSSAEVLLLSALYSNRSAAYLQAAHQMPSVEDAYARALCDA
                     DRTVSLRTSWFKGYARQGDAYFKLKRYGAAAEAYEMALQLDPRNKTLMNALSESRQRA
                     RHAAREELELRRTMRSTTSTTSSLASSMTGQAGSSTWSEGDPRGGAAASQQAQTLSDV
                     YDGGRRRSGQAQQLWAALKHEVEATVHEVTGDAYRLQQLERFRARCSKGATPTARQAA
                     ERKTYVKGVTALASGAPASEPMREASVSGSRFSTATRPDVDVSTAAAAAAAERRHVSS
                     VSPFAATALSSEPHLPPRRRSSASAAFDGPVKNARDVPYEFSSAAASAYQQRLLEEFR
                     KRKATKQ"
     gene            <313084..>313800
                     /locus_tag="LMJF_02_0600"
                     /db_xref="GeneID:12981596"
     mRNA            <313084..>313800
                     /locus_tag="LMJF_02_0600"
                     /product="putative ARP2/3 complex subunit"
                     /transcript_id="XM_003721617.1"
                     /db_xref="GeneID:12981596"
     CDS             313084..313800
                     /locus_tag="LMJF_02_0600"
                     /note="previous protein_id=AAZ10068.1"
                     /codon_start=1
                     /product="putative ARP2/3 complex subunit"
                     /protein_id="XP_003721665.1"
                     /db_xref="GeneID:12981596"
                     /db_xref="GOA:Q19R45"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:Q19R45"
                     /translation="MRGGPSAHRARTRRYAFLPHTNRRGVRRMTVAKQPYYDCVERTL
                     LVALCLPSFAFDVTQGCTVPEVELVPPDTGTGAPPSSFLVHCATAHAALRCHALRLQW
                     SSGDECFIEASCDSTRVSFWFAAAHQPGDALSAQLLNEYMAFFCSHSAATGALPILRC
                     IPVRRTSAGKPAADAAGRTAYDVSFLVLAEHVCGYGRQHLARSILAFAQEVEAAVASL
                     KVSLNARRRAAAQAFFALPA"
     gene            <315240..>316205
                     /locus_tag="LMJF_02_0610"
                     /db_xref="GeneID:12981597"
     mRNA            <315240..>316205
                     /locus_tag="LMJF_02_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721618.1"
                     /db_xref="GeneID:12981597"
     CDS             315240..316205
                     /locus_tag="LMJF_02_0610"
                     /note="previous protein_id=AAZ10069.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981597"
                     /db_xref="UniProtKB/TrEMBL:E9ACD5"
                     /translation="MSEELILQWAKRVSDAEEELHRMEEDINAVKQQRKLLKADIRKY
                     EDVVASEKCDLLTSLERVEAQAKDLGAQCEATLTEKDRVEAEYMATLDAYENLHFLVR
                     EIKDAEEHLQSRDDLEACLQRESVTWAEEEHTLRRKLHELQQQQAQARRAQEAEVREL
                     EAQLSNVEQRQRDERAGRCVEVAQAARRVVHSSRQPTPASPKPVTSAEEDAFVSANAG
                     GAMPIRSAPLKSCLKTPVNGSTSGNAAPTAPRHTTAASAPVSRCASQSLVSDAAASGV
                     QRQGVDGGDQPSLRLLQEMRAYSYGAPCKAGARKREFLGDATNNQ"
     gene            <317353..>319047
                     /locus_tag="LMJF_02_0620"
                     /db_xref="GeneID:12981598"
     mRNA            <317353..>319047
                     /locus_tag="LMJF_02_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721619.1"
                     /db_xref="GeneID:12981598"
     CDS             317353..319047
                     /locus_tag="LMJF_02_0620"
                     /note="previous protein_id=AAZ10070.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981598"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9ACD6"
                     /translation="MGRDRTHCETSCMSESGCTVAMAAQVRGLSTVTLELNRVASVDT
                     TCTCNCLLAAPCSPSSEPGGLSAQPSAAPDGDKVQRPALRFLAASYELKAASSSATAP
                     APTEVSDGDEAAGPRHVGECALYQCVASEDGEAADEASLHVQRRTAALPGVFDAVLVP
                     SSFFSTAALLSAADAALCIMLACTDGSVRVLDPFTLSPVVDPLRDLHAEMLTSCTALH
                     CPTPHLLCSAHTGSVYLYSLAERCVTQELEGHEYDAWCTAMLPTGGWWPAASASLPSN
                     GGCSDHEHIDGEAEAVHMPARASTSALLASGGDDGYCKLYDMRTNPSRAVSRSRFGAG
                     VVSITPVLDTLDGLSAAHATPYLLVGSYDESISLVDVRSVRRPVAQRGGLGGGVWRTS
                     RCLLPLWDSGAAVSDNFGAAAGDGGNLNLSLLLASARTGCCRRGAKRPCTMQSLANGW
                     ANTSNVLVLPLMQRGVALLPYDVRASAEEVFGNADVPLTYFYNEAAESDSEAVPGAPL
                     IPTLTDNTLVYDAAVLRPLDRIDSHGAETAVDRSAAVVATVSFYERRIDVWTVATG"
     gene            <320083..>322062
                     /locus_tag="LMJF_02_0630"
                     /db_xref="GeneID:12981599"
     mRNA            <320083..>322062
                     /locus_tag="LMJF_02_0630"
                     /product="gamma-glutamyl phosphate reductase-like protein"
                     /transcript_id="XM_003721620.1"
                     /db_xref="GeneID:12981599"
     CDS             320083..322062
                     /locus_tag="LMJF_02_0630"
                     /note="previous protein_id=AAZ10071.1"
                     /codon_start=1
                     /product="gamma-glutamyl phosphate reductase-like protein"
                     /protein_id="XP_003721668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981599"
                     /db_xref="GOA:E9ACD7"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:E9ACD7"
                     /translation="MLRLSASRRSAQNILHDIQAAVESRSIMATSSFAQRRSFLVALS
                     EELHRNSEHIIHANRRDCDLFGRQQQQRGTPSVTIPPTLPSTSAATSLQPSSSLHGGP
                     AGYPPFLGRPGHRVGDAQGISVAAENPATATPAPNAAEGSGASSPRRQSSLDYVAGAS
                     PVGSPDPNGAGGAAAGGRAAASPAGAGPALGETAAGSRATSTSGTAAPVSPSRWAARA
                     SSASLQLVPTAVSGHATRTEAGGGGGHLLITPDNHFLISPLRLDKLHTTIEYLLCQPD
                     PIAIPPSCWLHDSAEGDSGAAANSLREQGSLGAAPGHNSPPPPSAAGSHAGCGRCTRR
                     TDRLEVYELSVPLGMVGILSRFRPRISIDTVAMGLFAGNTVLLDGGVSLYNTNMALMS
                     SVRRALTTAGLSPSAVVCVESYDAAHRSTSEWLQLSDCVDLAVVCGPPKLYQFASRYS
                     TIPLMRATGQFSSVYVDQSASFEVALEVILNSKFQKLGAANAVTTVIVHSDFPRYTEL
                     VLALAAEGAVLLGDVTAQERVPDCVLELASEEEYQGLSQYGLRDAARTLCLKTVDSLA
                     QALFFIESFGSKQSDCIVATDLEVCATYCRHVDTAVALVNASTRLSSGVPLGCGVDFA
                     ISTSKTHCRGPLTVEMMTTRKLVARSLSAHHGALR"
     gene            <323557..>327786
                     /locus_tag="LMJF_02_0640"
                     /db_xref="GeneID:12981600"
     mRNA            <323557..>327786
                     /locus_tag="LMJF_02_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721621.1"
                     /db_xref="GeneID:12981600"
     CDS             323557..327786
                     /locus_tag="LMJF_02_0640"
                     /note="previous protein_id=AAZ10072.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981600"
                     /db_xref="UniProtKB/TrEMBL:E9ACD8"
                     /translation="MSHQRSEEDNSFACACPNGVHSTPAGSADDHRTEAGLRLVRDVL
                     LTEDWFVERPPLALAFAHPYIRLWCEMWRTEYVGDLHAPAAHEPPHNTRGPAAQPASY
                     VRIGLRRLRNPIAFADPASAGGANILSGGVPLTSLSSVLSSSPHATAAQRTVRSLVAP
                     LPTYPEPVDAMESEPLYDAAAVRGIPVVDPTAPLYALEAYTEHVFRMPIGMRLGHVRL
                     LTLWLPCQCLSHATPVRQRARLVRGLFSHVPASVTHGAAMKATACIHTAEAQWAVRHE
                     PQPMPAPAVSSQHVKGSSGGVTALNIDADAGAAKADDSDSSAEQGSAHMEEEVKDDDW
                     EAMALEEEALLEQQPLSVSTAAATVAPRMSGSPGSQATPQARTCFSLSTTHHPSLPAA
                     ATSPATTASSDTSAVAAAPEPRGGASAVIEGVCVALPPPCGWWLRRGVRPSSALHGAP
                     LPLYAHCIDATRPWLDWLEATARGTSDALPDEDCGSATQTFLCGVSLSGWLPKYVQPT
                     IVSRAELARRSASVKLEDAISSTLPLRGLHIESSVGALKRLLGGRSGERGDPGGGAAL
                     LGTLVALDAPYLRDAEPDLLAGRDRLPASDDSDASSLASALCRLRRLRFLSMNHGRDV
                     LAEASSLSPGQTDVLSTCVEELLLHGVTGLAPRTLASVGRCCVSLRTVDMTSTSVTDD
                     ELRALVYGRWDTPCKESNPAVCPAKLSPLACLEEVRLTACRSLTCVDALAALPRLRRL
                     DLRASGVRQVADLAGCHLLEEVVLTRCEHVTELYPLWRLPRLRCVEADGVRQLQQYRA
                     LMPPTASTAEEDEGGDERFMAPLVRLNLSQAALIRGASVGYLARRLRDLSGHFTSLVV
                     LLLDHTDADDDTLRALAGFPTAEAESGHFTGRCLPVASSLRELSLVGCVRVHHLGPLG
                     MLPQLTRLVADHSGVEHVDGLQHSRSLDSLSLSHCTRLWAISPLAYVTSLRCVDLSYT
                     PLNDAALLRFVYPTVVEKLTARRHPHLGEIVASLQACTASPAPLVPSQVEELSLCHCM
                     SLLYISCVAHLPRLRRLDVGNTALFDRGFVGFFSRTKTLLCTQSWQTAHPAGATVDDG
                     EALRLVPLPDEAALLTAWRRDTQTGAAVPRDASSTSREISVDRAAATAGGPPHSLEFD
                     FSVGAVNTVTHVCLSYCVEVRCIAAFALFPQLVSLDVTGTAVDSASLLDFVNVLLEGC
                     RSGDADVPVMRLEMEGDSLRPRALPARRRKAAPAVSFSSRGSDADGATVEPSLRRRRL
                     FVLTTLTLAWCHYLTDVRCCAAVPSLRHLDVCGTPIDNLSVAAFSSREASALASAASE
                     EEAQWWQHHRCSILSLDVNCCRRVTDIAPLFAAPTNSLPGSGGSSGRRESLGYCRPLS
                     LMELRLRHSGVTSTKEELRALDPFGRCLFML"
     gene            <328326..>329273
                     /locus_tag="LMJF_02_0650"
                     /db_xref="GeneID:12981601"
     mRNA            <328326..>329273
                     /locus_tag="LMJF_02_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721622.1"
                     /db_xref="GeneID:12981601"
     CDS             328326..329273
                     /locus_tag="LMJF_02_0650"
                     /note="previous protein_id=AAZ10073.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981601"
                     /db_xref="UniProtKB/TrEMBL:E9ACD9"
                     /translation="MTNTATSSPPTETSPLPGNDSNLEPSSTTAGNSHAPASTAEFSE
                     ELKRLTALGTLLVNMGAASEEKIFGVKDSAPMLAYRQNRMHELLVINRPQDDAAVHMF
                     IWYKPWTWWSSGAQVSPIVVKRMLTEEGNAGEPRTTVPPQTTGSTQTEADVVAPPPPP
                     DAVEPKAAPLKRKKGLPAVDMRALTDEEVDALTPAVRDERSKLLLSEKHIHGTLQGME
                     DTRYRYLVPSRDLKCETEVMNVVRCYTERNQAKAASLAAEGGRAPPGAAAASHNRPSG
                     GGEKTVVRADLLACGPHVRRLKVCAESMVMQYSREGEAA"
     gene            <330066..>332858
                     /locus_tag="LMJF_02_0660"
                     /db_xref="GeneID:12981602"
     mRNA            <330066..>332858
                     /locus_tag="LMJF_02_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721623.1"
                     /db_xref="GeneID:12981602"
     CDS             330066..332858
                     /locus_tag="LMJF_02_0660"
                     /note="previous protein_id=AAZ10074.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721671.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981602"
                     /db_xref="GOA:E9ACE0"
                     /db_xref="InterPro:IPR007276"
                     /db_xref="UniProtKB/TrEMBL:E9ACE0"
                     /translation="MTSSRATSNAKLVKHHQRQQSTALARSSANKFTLRQSQFERQRE
                     EEQVRAQQQADAPGSTSCAVGDGLLSRSGHGRGAGGYTASEMEVRDTPNPFARSRSAP
                     ASGTFSTTTRSATMGLEKMQARTTRTTRRIDRFNLTTSAGSEAAPSPSLLMGVRRVRE
                     GEGRGVAGLAAEDREEGGLAAPPAKVTRAERFREMISNSKGQRAQLQRERAERDATTV
                     QLDAEINSLLHLLPKRNKAKEEQEAFAQSGTPEVRALLDSYRRNHQAKCLTLKSSGAF
                     EVRTLVDAARSTTNRSAPSAQTADPTAPASATARDAAPSFLDAADRALLARVRAGAAC
                     SSEDGINEVASTAGARVGAPSMPRQAAADIAEARAMVIPGGGGRPASCDDFDLMMHTF
                     QMDPRRAHAVDRTLTEEEEAAKSAQQTLLKEDREQVPLLHLQERDQTQLTRGEWVAQG
                     GDIAFHMDDDAENAGADEDNVDIPSSYEGDSDADVDSDEAAVVAESELGEDEEDAAVE
                     RVSGSATLDRLFEQLEQVATSETENATSRPQRLHALLVQLHRYAAHHVVEVTKAFRFV
                     LVEAERSFLRGTRRGGMRRSLLVYLYAISKIFPTSDYRHAVMTPFLLFLCSALMQMKL
                     DSLEAVHSYLVLATLLLHCLKAGSGRFCAEVVVAALNVLALQLPRVALEPARYQGTVL
                     PMPLLERTEQALLVSSAAAATLSESDDTTSQRPPYQVGLFDTTHSPERLLLCAYRLLE
                     EVCDLHRSTPAFPVMCARPFLALDALLLRPPSSSAASAWTPSVPVRLAHEVLTVKVRD
                     MAKHVEEHRTPLAMRTFRPRPLRQFDPLLAEREENAAKTEVRLMKRDIREDKKRLIRH
                     LTAEATVQRRAQEKRHAITDALREKRYHNVMSQLQQQQHSMNVVESLKARAKSKSRKG
                     LSGAPTTSSPAEAGKE"
     gene            <333743..>334684
                     /locus_tag="LMJF_02_0670"
                     /db_xref="GeneID:12981603"
     mRNA            <333743..>334684
                     /locus_tag="LMJF_02_0670"
                     /product="putative mitochondrial carrier protein"
                     /transcript_id="XM_003721624.1"
                     /db_xref="GeneID:12981603"
     CDS             333743..334684
                     /locus_tag="LMJF_02_0670"
                     /note="previous protein_id=AAZ10075.1"
                     /codon_start=1
                     /product="putative mitochondrial carrier protein"
                     /protein_id="XP_003721672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981603"
                     /db_xref="GOA:E9ACE1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:E9ACE1"
                     /translation="MSAKTAAAPSERSFVDRFVRSHAGAATAAGILEIGFFHPFDTIA
                     KRLMANKGSIMRGSTGETAANLNIIVFKKHADAGFLRKVVYLYPGSLYATVYKVFQRV
                     YKFAGQPLVRDFLSSNYRDGFKRYFGEAHKVMEDATAGCLIGLGEVFLLPLDRLKVLS
                     QTNEAAMRSGLLPLLRQEGFRGMYAGTVVTMCRNAPGSFCLFGGTAFTKGYIFGLSDY
                     RHATLFQNMCASTVGACVAIAISNPMDVVKTRVQQQTAAERCSGMAMATAMLKEEGML
                     SFFKGLTPKIIASAPKLIFAYTMTEFFFKVMNDSKKH"
     gene            <336526..>337659
                     /locus_tag="LMJF_02_0680"
                     /db_xref="GeneID:12981604"
     mRNA            <336526..>337659
                     /locus_tag="LMJF_02_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721625.1"
                     /db_xref="GeneID:12981604"
     CDS             336526..337659
                     /locus_tag="LMJF_02_0680"
                     /note="previous protein_id=AAZ10076.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981604"
                     /db_xref="UniProtKB/TrEMBL:E9ACE2"
                     /translation="MDTPQAVAERYADGRLGLTFVRALRRRIAPASGYTEAVRRDRSG
                     EPRMGTDNVPSSSVEAVQRCLQRLCQPIVFYRCDAAAPMSSAAGISPSFTTMPSTRAL
                     LVKPHSQSNFYAVDHVTAVHLLQEAVCERVVHSRYGVLGVRIMKLLLQHHFLEERTLA
                     EQSIATYVKVREVLHQMFKDGFLLQQEVPRTSALVERSAKASVYLWGLSWSATLLPVV
                     RERLAKTLTIAWAKLREAQQQASAVAKHAAGGRPTPAAGSSINSSAAHAEEIEAQWKY
                     GMSRNIQQALQAQRAVTGLQSCVMSLMRLLLIVDFFFFKGVRRTVERQTSVGVVGVAS
                     LSLSPYRCFGCHARQGDGAVRPARRPSPLFSPSCAPARVVRGA"
     gene            <338291..>339655
                     /locus_tag="LMJF_02_0690"
                     /db_xref="GeneID:12981605"
     mRNA            <338291..>339655
                     /locus_tag="LMJF_02_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721626.1"
                     /db_xref="GeneID:12981605"
     CDS             338291..339655
                     /locus_tag="LMJF_02_0690"
                     /note="previous protein_id=AAZ10077.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981605"
                     /db_xref="UniProtKB/TrEMBL:E9ACE3"
                     /translation="MQRLTRQRHAPPAAAGRAEDATVLPSLKKDPLPVRKRREAATRS
                     AQLTDLFDSLSAADARALQSTQLGEDFADGFTNEGAEGLLSATLLSRRPPLSTSEPSD
                     HAANGVSSSSTGGLVLRSSGVAALSTNSYGLPRPFHEQALAVRSVEVATTEMQSTLQQ
                     LQHDLAFHAKRRIEAEREAGGHLASAPRPRPSGDSESVTPLRAETTAAQQRRVADPDV
                     LSEAARIQRARAAAADEGLSDDQSVEDYGVDCEVPRLTSDSCLADEVAAIAVCMAKIK
                     ESAKVMYDTEAAAPSTSTAPWWCSALHMRDMKASAARLDYHARTALSWSHRSREQLLL
                     KAVMLNNVSVSTRTQLLEQQQHWQEFQTRLRDGQETVMHLQADIARYQARVQAEMARR
                     AALQEELRLCSQERGLVDPGEHNPLKAELALLLEEREWPSDALKKDASVVLDWLRSVS
                     TTLE"
     gene            <340367..>343180
                     /locus_tag="LMJF_02_0700"
                     /db_xref="GeneID:12981606"
     mRNA            <340367..>343180
                     /locus_tag="LMJF_02_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721627.1"
                     /db_xref="GeneID:12981606"
     CDS             340367..343180
                     /locus_tag="LMJF_02_0700"
                     /note="previous protein_id=AAZ10078.1"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981606"
                     /db_xref="UniProtKB/TrEMBL:E9ACE4"
                     /translation="MSVSSPLDGGGAGGTVVQSSATHRGASAPANTTAATAEPHTPLF
                     TAAENAELQAIEAECNTFHEYERQYQEVLMTLEGDDVLDKFRAEYEGLHSSLLRSHEG
                     EGRLLRKCTDLQSDIDACAEKAVAAAEMTLGDRDTIANLKSETERTSHRLTEVREKEA
                     QLKETIATLKREIAVQQAKAQDPIEMPEQEAALQSLRRLHETLQREEEQLTQQLRSTS
                     LDMAATQRRIATLVSSNSGNAAELRLVREAIVQSEEEVQRVLQSKSMKEQELQAVRDT
                     IARRIAYYTSQQHTLEALVEDHERNGQELRDVRQEEARLTDEYQGVCRQLQNVNTALQ
                     ECNEEHDLWQRRVYERAAELQAQQAAVASVHRRYVKAQKVVEALQRRNAVTEVQKSEQ
                     VEKQLDVAAQLKSEEAALALAKRAAHTAAQTAVSVRGEVNILQQQITGEAAEQHRNAA
                     WLAEKRGQLRALESVLTSFEEHIQQTHRELYVVTQEAEFSEARAKKQAFACAHLLSSI
                     ENKEAELAHYEGSLTEVEARIKQQQVLLESMVAERNTYTSHYNQLKQGLSEQQHRFSL
                     LLAKVQSMRSSIQKRGKDVKLEVAHIQLLRQQRKELEAHVTDYQRRAHTRQRCADALG
                     QEIQQLRAVLSDAADETARQQRRCHDVVHEKDRLDRQVTDRATELHALYEQARTQQSL
                     LQHHERLYNDQARQLEHLQYQTLQFAQQLEQLRMFVARLPELRVLLNNATRELQREKV
                     RVQALLDAAYHPVNVHPYHEVASAEPETYALLQRVQKLQRVLVQRRNQLEEKEAAIQS
                     VEQRYMKAKATVAHQPGPEIAEQLTAYQENLVKKGQHMRQMQEALEFFRSQTDQFKAR
                     HDVLRERLAEMGKTYAAGRAEDERRSRAGALTGATSATPRPDSPSVTAEPVVYRGFVA
                     PPRATMNTAATSALLLAPPPMRE"
     gene            <344949..>347402
                     /locus_tag="LMJF_02_0710"
                     /db_xref="GeneID:12981607"
     mRNA            <344949..>347402
                     /locus_tag="LMJF_02_0710"
                     /product="putative ATP-dependent Clp protease subunit,heat
                     shock protein 78 (HSP78)"
                     /transcript_id="XM_003721628.1"
                     /db_xref="GeneID:12981607"
     CDS             344949..347402
                     /locus_tag="LMJF_02_0710"
                     /note="previous protein_id=AAZ10079.1"
                     /codon_start=1
                     /product="putative ATP-dependent Clp protease subunit,heat
                     shock protein 78 (HSP78)"
                     /protein_id="XP_003721676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981607"
                     /db_xref="GOA:E9ACE5"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9ACE5"
                     /translation="MLRRCLAQASTALRCGSTAALAAPFAPFGCGATRTAAVDAVACS
                     RLASSTAAYPTLRTSCRWQSTGVTPWKSSGNSGGGGNGGQQQGRTWVNPNAVPPGEFL
                     KKYARDLTEEARTGRLDPIVGREEVIRRTIQVVSRRTKNNPVLIGEPGVGKTAIVEGL
                     AQRIVKGEVPESIKDRQVYALDMGTLVAGAKFRGEFEERLKGVLKDTIESHGKVILFI
                     DELHTLVGAGSSGDGSMDAANLLKPSLARGELHCIGATTLDEYRQHIEKDAALARRFQ
                     SVLVTEPTVEETISILRGIKEKYEAHHGCLIKDEALVYAAVNSHRYLSERRLPDKAID
                     LIDEAASRLRLQQESKPEALDLIERELIRLKIEAEAVKKDKDEVGKEKLENLYEQISQ
                     KQKEYDALEERWKKEKNLFQTIKQRTEELDVLRHHLEQAMNSGDFAKAGEIQHSQIPN
                     LLKQIEKDKHLASSKNFMVHDSVTSKDIAEVIARATGIPVAQLMTSEREKLIHMDAEL
                     KKTIMGQDAAIESITNVVRISRAGLHSHKRPLGSFLFLGPTGVGKTEVCKSLAKFLFD
                     DESFICRIDMSEYMERHSVHRLIGAPPGYVGYEEGGELTESVRRRPYQIVLFDEFEKA
                     HPSVSNILLQVLDEGHLTDSHGRRVDFKNTIIILTSNIGADVIARLPEGKPSISAMPA
                     VMEQVRQRLAPEFINRLDDIIMFNRLSREDIRSIVEILFAQVQKMLTEHNITLEESTE
                     VYDWLSVNGYSAVYGARPLKRLVQSELLNQLALMLLDGRVREGEHVRLSVQDGHVVVV
                     ANHALSPEKGPTDERLLDQ"
     gene            <348557..>348799
                     /locus_tag="LMJF_02_0720"
                     /db_xref="GeneID:12981608"
     mRNA            <348557..>348799
                     /locus_tag="LMJF_02_0720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721629.1"
                     /db_xref="GeneID:12981608"
     CDS             348557..348799
                     /locus_tag="LMJF_02_0720"
                     /note="previous protein_id=AAZ10080.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981608"
                     /db_xref="UniProtKB/TrEMBL:E9ACE6"
                     /translation="MSLIFSTTSPPPVEIAVDDSRWDALAAECQKCSESLYKCKQETE
                     RIVQSMDAVLFCAALEATPPSVCGARLLSSAPPPLC"
     gene            <349987..>350373
                     /locus_tag="LMJF_02_0730"
                     /db_xref="GeneID:12981609"
     mRNA            <349987..>350373
                     /locus_tag="LMJF_02_0730"
                     /product="dehydrogenase/oxidoreductase-like protein"
                     /transcript_id="XM_003721630.1"
                     /db_xref="GeneID:12981609"
     CDS             349987..350373
                     /locus_tag="LMJF_02_0730"
                     /note="previous protein_id=AAZ10081.1"
                     /codon_start=1
                     /product="dehydrogenase/oxidoreductase-like protein"
                     /protein_id="XP_003721678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981609"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9ACE7"
                     /translation="MDALRDTAMQPACCASEDAVPLMCKSVALELIPSNIFVNVKRLG
                     TGDTPMDEHLMLLTHQHPENLGEVLPIGRLQHPHVITEPVSFFDSDRTSCMLGADASI
                     DGNSAVKSHVQAAHRNAKAAYRREGG"
     gene            <351494..>353530
                     /gene="DCP"
                     /locus_tag="LMJF_02_0740"
                     /db_xref="GeneID:12981610"
     mRNA            <351494..>353530
                     /gene="DCP"
                     /locus_tag="LMJF_02_0740"
                     /product="putative dipeptylcarboxypeptidase"
                     /transcript_id="XM_003721631.1"
                     /db_xref="GeneID:12981610"
     CDS             351494..353530
                     /gene="DCP"
                     /locus_tag="LMJF_02_0740"
                     /note="previous protein_id=AAZ10082.1"
                     /codon_start=1
                     /product="putative dipeptylcarboxypeptidase"
                     /protein_id="XP_003721679.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.02.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.02.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981610"
                     /db_xref="GOA:E9ACE8"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:E9ACE8"
                     /translation="MSANPLLQQSPLQYQHPPFDQITMEHYAPAFEQGMAEQMAEIEA
                     IKSNPDAPTLENTVVALERSGAQLKRARLVFQNLCSAHTNPEMQNLEQAYAPKFSVHT
                     DKIYLDGALYNRIKAVWDERASLAGEDLRLVEHYEREFRKAGAGLHDADKEKLKQVNE
                     RLATLESDFAKKVMGTRKTASLVVDNVAELEGLSEDEIATAQMEAESLGHPGKYALII
                     VNTTQQPLLASLRSRETRRRLFEASVQRAARGDENDTSAIIVEIAQLRLKKAKLLGRK
                     CFAEWQLQNQMADPASAEALLRDMGNAAASKAKKEAADIKQMIREEGGDFELAPWDWR
                     YYAERVRKQRYDLDENETKPYFELNNVLERGVFYTAAKLYGVTMRRRTDLPVYHPDVL
                     SFEMFDCTGESLAIFCLDPYARASKRGGAWMTFYVRQSSLLGQKPVVYNVLNIVKPAE
                     GKPTLLSRSDVTTLFHEFGHGLHGMLSNLKYSTLSGTSVARDFLEFPSQINEHWAMYD
                     AVLKNYALHYETKEPIPQALVDRMKAAETYGAGFHTIEVVKAAYLDLCWHLVAEETAF
                     LPPAQMEEAAMRSFGVGMTEVPPRYHSGYFMHTFSGGYASNYYVYQWARVLDCDGFEW
                     FLENGGLTRENGDHLRACVLSVGNSVDANVAYEKFAGRKANMKAFLRINGLLDE"
CONTIG      join(FR796398.1:1..355712)
//
DBGET integrated database retrieval system