GenomeNet

Database: RefSeq
Entry: NC_007246
LinkDB: NC_007246
Original site: NC_007246 
LOCUS       NC_007246             465823 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 5.
ACCESSION   NC_007246 CT005244
VERSION     NC_007246.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 465823)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 465823)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796401.
            On Jun 1, 2012 this sequence version replaced NC_007246.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..465823
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="5"
     gene            <5474..>8221
                     /locus_tag="LMJF_05_0010"
                     /db_xref="GeneID:5649021"
     mRNA            <5474..>8221
                     /locus_tag="LMJF_05_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687425.1"
                     /db_xref="GeneID:5649021"
     CDS             5474..8221
                     /locus_tag="LMJF_05_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649021"
                     /db_xref="UniProtKB/TrEMBL:Q4QJK2"
                     /translation="MEKASLKHLEFQLQREKALAKDLEARCKSLSAQVAQLEQDKAEL
                     RREKLFLGEEAKKTSKLDDRIHILQKEVENRDAVIGSERAATQAARAEAEEIRRNANA
                     SIALWTAAEEQWTAEQTALNEAVAQYRLQIDDLKKEVKSQGDARAELTKQLHAEKERS
                     NRLTQGREAMEVEVKSLHSQVEKLQNKVCDLEQTIYKLDLAGDKQREAINLKDTEIKT
                     LEATVARHTEAEERLEQTISSLNDRINAAKMVILEGKCENEKLQCDLVDAKREAERLH
                     LQVESLKRDSNFLSQSHASVQKALEDLKEKHRLLQEDMRDKNVEIRRHELTISQLNME
                     LKKSENQGGEWSFQYSTLETELQQTKEALRKSSASVETLLRENSELVERLKEQKQLME
                     TKEEEMVVLQSQCDERAEAFLRDMKDLEKEITARQAVINELSGQLNSASEKNAVYHSK
                     ILEESEANGKMRQHRAEMLQRLESNEHQIFLLDCVAEKEQIFSSFLADWSEAPMLFCA
                     NLVGHFQMLQDKTCVLLEHEEELSRESSLKTSQLKELQCQNEEQREQIAFLQMERNAQ
                     AERLSALSQEIRASEKEANELRGALEASGNENLSLTSAVAGLQEQVAAKDAELVRKNA
                     TLAEFRSRVHAFLDAVSMLEGAMLRYVMAQMEEVQDLWKNRLEAVVLHFTSVLSYLVA
                     ERASLQSSKEQAEASCRELSAFAKEAKISMNKSDLAAAERQEALTSRAALLEGQMAVA
                     RREKDQATMQLATLLRRFEEDRNSFESFKREAKCTVQEERERREAAEKECVKLRGCID
                     AEVKRKCEYKQALENLKKLRSESEELRRAEKARAGEAIGKANTERNYWVMCFDHLKEM
                     IEKSHRTGDRLPSIDTDTIHRLEAAKTKISPMQVREVNKALSSLPKLKRVREEASDAP
                     A"
     gene            <8695..>9114
                     /locus_tag="LMJF_05_0020"
                     /db_xref="GeneID:5648863"
     mRNA            <8695..>9114
                     /locus_tag="LMJF_05_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687426.1"
                     /db_xref="GeneID:5648863"
     CDS             8695..9114
                     /locus_tag="LMJF_05_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648863"
                     /db_xref="UniProtKB/TrEMBL:Q4QJK1"
                     /translation="MLKCGGRLLKARLTAFNPWKRRPGGLQLNGRPQMINPSYFRGRY
                     KQQNPDDPCRLLKPSHVLLKRCPACKRTMFVQIKDKDTFHMCCEGVPMKVYSDMKTVM
                     NIEHKILTLTRQWDVENERPWSNPHRPRPKGRSKLKK"
     gene            <9650..>10237
                     /locus_tag="LMJF_05_0030"
                     /db_xref="GeneID:5648864"
     mRNA            <9650..>10237
                     /locus_tag="LMJF_05_0030"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001687427.1"
                     /db_xref="GeneID:5648864"
     CDS             9650..10237
                     /locus_tag="LMJF_05_0030"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001687479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648864"
                     /db_xref="GOA:Q4QJK0"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJK0"
                     /translation="MSWFSWLWDWLSYLGLSNKTGKLLFLGLDNAGKTTLLGKLATNQ
                     VHVHRPTFHPNSEDLTLGGIKLKTIDMGGHQQARRLWKDYFTKVDGVVFIVDAATPQR
                     FPEAKSELDMLLQSEELAKTPFLILGNKIDMPGCTCSEGQLVMEMGLDGALTGKATPV
                     TDPNVRPLEVYMCSVVKNVGYGDGFRWLSQYLKSS"
     gene            <11337..>13082
                     /locus_tag="LMJF_05_0040"
                     /db_xref="GeneID:5648870"
     mRNA            <11337..>13082
                     /locus_tag="LMJF_05_0040"
                     /product="putative paraflagellar rod component par4"
                     /transcript_id="XM_001687428.1"
                     /db_xref="GeneID:5648870"
     CDS             11337..13082
                     /locus_tag="LMJF_05_0040"
                     /codon_start=1
                     /product="putative paraflagellar rod component par4"
                     /protein_id="XP_001687480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648870"
                     /db_xref="GOA:Q4QJJ9"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ9"
                     /translation="MAVKKGKGKKGTAAKAKADELRLIQLRTLEAEAEEFQRSENERR
                     QHDEQEEHIAFLRDEQLRIMHQKDRRIDEVMQELTRVTSAMQDDKSSYESQIHQLSTL
                     RDALLNEENLLKVEMEELHGILQQERGSHAAYVQQLRETLETERGLHQEERQHLRCQV
                     CEATAGMEDSKRQLQLACELRESAEHEFKVKVRDLERELEKALTMNKALQDAVEGREI
                     EDRKNVTLLQLLNVQLESDKRRYEEDLCEERERTSRTQEEVSNLEAKLKETQRELETF
                     KEEARTARQLCVDELHECKLLTEQLKFDAKYLQSEMESMRAEHAAEVEKREATQGAMQ
                     AELQQCRVELEASQKKNDELEALLVCKEREHFDKVTFLNAQISNGRTAIAQLQGKMEK
                     ERVEHGNELQRHNDAIQQSMQELERINSAESAQARERHMYEQQLVTDLDTFKQTIRDL
                     RTRMMAKDEAYEQLRELKEGEIERLRGILDAHFIPHRQNVEISRESSRVDELLLVSEQ
                     LRGLKKEMALKETAAEETERWLRARIAEQVEVIDSLQLDLKRTELSRNEGIRTLKDEV
                     ERLRKTLEVHCIPCL"
     gene            <14278..>16779
                     /locus_tag="LMJF_05_0050"
                     /db_xref="GeneID:5648871"
     mRNA            <14278..>16779
                     /locus_tag="LMJF_05_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687429.1"
                     /db_xref="GeneID:5648871"
     CDS             14278..16779
                     /locus_tag="LMJF_05_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648871"
                     /db_xref="GOA:Q4QJJ8"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ8"
                     /translation="MQPSPRGKTTGVYGAERIPGNYVKTLTGVVRGEELFCRPDLERP
                     WRSADKQGSAATIALKEKEIEELMRLCSNLRTELSNTKSDSLFLEYSLTERTKLQLAE
                     KQNEVDALQRRVEVLEKEKKEAAAATESQIRLLRSQAENESIGFKNEARVAIERCAEL
                     VKTFQKQLEDVKAAGVREVEFLEARFAAKVNEVTTELKSVRESKKALEEHYRAVEAQS
                     SNMVHRVEADYKERLRSLEQRIEEQRLEYEAQLAKERKEKEAVVGESKRTTEKVAVLI
                     ADKEEFLQKQKLWNSYILSHLDTFYHSFIAVAPELAVDPTGVQLQQVPELYAPRCVLE
                     DPESKVNVERIAYRVAQLKLLKALQPLGEAAARRGAKPPSAAQLDQVVESQERLWRAL
                     RELEDQQSELEATVRNFTSRLYFFSDNLEESLRCGPRPVPPPLRDVVFLCLGVPNGRV
                     LWAANTELMRTSVQLLYSTLRLKMGEYGAYECYSDDVSMLLAFADATAACRFCTESQE
                     WLMRLPWPAALLKLPEAQEERAEGGRLVYRGLRVSMALHAGEAYVEPSGIPLNGVYRN
                     HYYGKAVSQLVHLCSLTQGGQIIVSIAAWNLCMRRQHELGAVVAKSLGTLPIVSFNSQ
                     SGVQEKQSIELLQILPIELEGRTFTPPGKAVVPPVSSLTGVKESVLAAEVAAVEAQRE
                     RVHDALAILQEECNSIQSSMGTLVARSRAALPHFHLLPPSEMVAQLNDLYSVMERVAV
                     RAEELYTDLQDVAHAQEELGAQAQSIKDYFQQQEASAAREDDLRTKTEVVRRSMNHTL
                     QLEKDRRRAETERLQLALQDRDQLIRKLHQESQSS"
     gene            <18037..>20538
                     /locus_tag="LMJF_05_0060"
                     /db_xref="GeneID:5648865"
     mRNA            <18037..>20538
                     /locus_tag="LMJF_05_0060"
                     /product="putative major vault protein"
                     /transcript_id="XM_001687430.1"
                     /db_xref="GeneID:5648865"
     CDS             18037..20538
                     /locus_tag="LMJF_05_0060"
                     /codon_start=1
                     /product="putative major vault protein"
                     /protein_id="XP_001687482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648865"
                     /db_xref="GOA:Q4QJJ7"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /translation="MSDSVIRIKRYHYIHILDNNTNVTRTISGPVVYTRKEHETCLFD
                     PCPCVSVPPRHYCVVKNPCVRDEAGEVVLESSGQVKLRLGDAEIRFEGEPFPLYPGEE
                     LDCRDGKGVQKLQLIPPNTGLHVRCVRDFKDADRLVGAGTEWMVAGPQTYIPRVEVVV
                     VEEVKATVIYPNTALMVQANVNFTDRGGVPRVAGEKWLVRALGAYLQSVEETVLGLIQ
                     GTMLSDLKALRLSAVRSFTDVYGKGRRAGEQWQVTLKDAPVHIIDAYEMKVADVAAVS
                     LSAKEYVIIHHPVDDTGHNRFGETLVRRGECTFFLQPGETMPRGVEQVLVVGKEEALL
                     LEAVCEYRDRGEKRQPGSRWMVRGPLEYIPANEVKLLEHRRMMALDKNEGIYVMNTTT
                     GEVRAVIGKPYMLDVNEVLWEKHLPLAVEELLESPNGSIQTSERNPGFVSHREKYRIV
                     RFNVQHNAAVQIYDYRKKQPRIVLGPNLVMLAPHEEFTVLSLSGGTPKVPNSLQSLQL
                     FLGPRFSSDTIVVETSDHARLRLRLSYNWYFDIDRVNPSQRTFSVPDFIGDCCKTIAS
                     RVRGAVASEDFDSFHRNSAKIIRTAVFGVDETGETKKNLRFTANDFVVTNIDVQSSEP
                     TDEKTRDSLQKSVQLAIEITTKSQEAAARHGNELKDQEAKGQLERQKLLDKIEVENAR
                     TKWLELQAKSEAVQASGQSVAEAKARAEALLIEVRSEMQQAEMRARAYRISAEAELQK
                     LQQRQALELEYTQRQNEIDVSKARAAAEAEAEKVKRMVDCIGRDTLVAIARAGPETQV
                     KLLSSLGLKGYLITDGNSPVNLFGTAQGMIGEPKK"
     gene            <22610..>22885
                     /locus_tag="LMJF_05_0070"
                     /db_xref="GeneID:5648866"
     mRNA            <22610..>22885
                     /locus_tag="LMJF_05_0070"
                     /product="putative dynein light chain"
                     /transcript_id="XM_001687431.1"
                     /db_xref="GeneID:5648866"
     CDS             22610..22885
                     /locus_tag="LMJF_05_0070"
                     /codon_start=1
                     /product="putative dynein light chain"
                     /protein_id="XP_001687483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648866"
                     /db_xref="GOA:Q4QJJ6"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ6"
                     /translation="MPLKYLEMSYNADMPKDMIKEAQNLIIEAFETESLENAVATHIK
                     REFVKRYKGVWHCVVGKNFGSFVTHEMKGYIYITWGQVSILLWKTLS"
     gene            <23824..>24429
                     /locus_tag="LMJF_05_0080"
                     /db_xref="GeneID:5648867"
     mRNA            <23824..>24429
                     /locus_tag="LMJF_05_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687432.1"
                     /db_xref="GeneID:5648867"
     CDS             23824..24429
                     /locus_tag="LMJF_05_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648867"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ5"
                     /translation="MAGKFRGDVGKLSKPKKNKAAKRAKSKKVVSLVKRSPKLAQDTL
                     QSRIAELTSRESAARANIGGPKASKAAAPPSAGKVRIGKAALEVVGKLKRERVVPEKD
                     APVQRSTAEAVGLKILHQAVKSQSHGRLLSHQNRHDYEYRLRSVATMGVVQLFNSLAQ
                     SRKASAALDTEKKMTSDKVMEKQQLVSKEVFLAALRQSQQH"
     gene            <25787..>26326
                     /locus_tag="LMJF_05_0090"
                     /db_xref="GeneID:5648868"
     mRNA            <25787..>26326
                     /locus_tag="LMJF_05_0090"
                     /product="putative NUDIX hydrolase dihydroneopterin
                     triphosphate pyrophosphohydrolase/hydrolase"
                     /transcript_id="XM_001687433.1"
                     /db_xref="GeneID:5648868"
     CDS             25787..26326
                     /locus_tag="LMJF_05_0090"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative NUDIX hydrolase dihydroneopterin
                     triphosphate pyrophosphohydrolase/hydrolase"
                     /protein_id="XP_001687485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648868"
                     /db_xref="GOA:Q4QJJ4"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ4"
                     /translation="MYRPNVCVFLFNEKVEFLGCQRMKTDHFQCVQGGIEAYDVDIRL
                     AALREVEEEIRLKPQDVSFVQEIPPPHGDPMNFAYTLASNANLRRFGYVGQKQRILLF
                     FTPSENISKVVLIPPPESHASQEFRKVEWMPIEQLISKSPPEKAHIFKTVGEVAPGIA
                     RAFLKKRGLLAEPQGAAKY"
     gene            <28177..>30087
                     /locus_tag="LMJF_05_0100"
                     /db_xref="GeneID:5648869"
     mRNA            <28177..>30087
                     /locus_tag="LMJF_05_0100"
                     /product="putative phosphoprotein phosphatase"
                     /transcript_id="XM_001687434.1"
                     /db_xref="GeneID:5648869"
     CDS             28177..30087
                     /locus_tag="LMJF_05_0100"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative phosphoprotein phosphatase"
                     /protein_id="XP_001687486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648869"
                     /db_xref="GOA:Q4QJJ3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ3"
                     /translation="MDPPPVPPSPQQAPIETPGGHHHAVALRTESSISLDTIQAVTIN
                     REKLSEWHHKIRAKLFPMVSGFFVRCRVEDSVDGRALYKVGRIKNLKPDWSVELDLLT
                     TDEIRAGRNNTNYDCISNAKLSAAECNSWLARVSPDLLPDITSTIYRMEERMHMLEAV
                     ILAEPAFHSRRRDERRRDEQATSSAPQLPEKYVFSQNVLLCEDDYVSLPQTVTIVDLF
                     QNAVGPKGVAEPDTPRAGCAPNTRSRVGDEAVASHSTMMQLQDMRNYMNSPTQPPVDP
                     TRLIDMIRRAANPSHNSFTYDNLPEFCKLVISVCSMCREVVAKEPLFVHLKSPITVFG
                     DIHGNFADMGYFLEKVIAFDDVMLKYTMQNLLFLGDYVDRGVFSLECVMYLFALKVIN
                     PAKVTLLRGNHESPEVNGDMDVYGYSSFKYQCLDKFGRDRGMDVWVAVNEVFQYLPVI
                     ADIDKKIFCVHGGLPQYSGGEDKRLEILSDPNFPRIPVVQCADPTNVAQRMMVNDLLW
                     SDPAPPEQQLDRYGFGPNPRGPDIKTFGSRAVDMFCERYNYQYIFRAHQEKADGLRLS
                     DNARVVTIFSTSDYAGHQNGAGCIFVANGKMRMAIKKPQRQEVQRETKGPVSPRTLSK
                     SAPGFVVRMKKP"
     gene            <33704..>34075
                     /locus_tag="LMJF_05_0110"
                     /db_xref="GeneID:5648872"
     mRNA            <33704..>34075
                     /locus_tag="LMJF_05_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687435.1"
                     /db_xref="GeneID:5648872"
     CDS             33704..34075
                     /locus_tag="LMJF_05_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648872"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ2"
                     /translation="MQTCGLRRLQFLLNTPFDHQPIAVPAVPTARSVIEDIVPPKSEL
                     SRVDEVGLLLKHLPAACDKAKQLQHDAQYASRYYRARFNRGTQLQWKRATQIAAASSP
                     AEVQQWARSRLHPISDPFQCQ"
     gene            <35071..>36087
                     /locus_tag="LMJF_05_0120"
                     /db_xref="GeneID:5648873"
     mRNA            <35071..>36087
                     /locus_tag="LMJF_05_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687436.1"
                     /db_xref="GeneID:5648873"
     CDS             35071..36087
                     /locus_tag="LMJF_05_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648873"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ1"
                     /translation="MLRRTPRQLRSVAAVGLAVVGAGDGTRQRNSLHRLLRDHDEGVA
                     ANAKGTITVASTYDVESALYYDQYNMAVMPCVSGGAARQALRAKLIDSGAVAGVRERL
                     LAPWQAEGERRVVVFGCRSVAYLKRQLLADTTHSFLVVDPSLKELMGAAAALTPVFAH
                     RVFFLRCESMFTCLQVLQPETADVAVVPMPVPFWSRHGSHRRLVHFDFYCAAHSVLRV
                     REAPTDPRGVVLFTDCEPYAAFMMEHLEEAKLVVPYTRKNPAQLFQRWLPQDELIEDV
                     EGGAQRRRREFPKQRDEEVVALAAAKSGATTPDARRLLSAYSYSRKYYRDFAEERVQQ
                     AGGV"
     gene            <37798..>39096
                     /locus_tag="LMJF_05_0130"
                     /db_xref="GeneID:5648874"
     mRNA            <37798..>39096
                     /locus_tag="LMJF_05_0130"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687437.1"
                     /db_xref="GeneID:5648874"
     CDS             37798..39096
                     /locus_tag="LMJF_05_0130"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648874"
                     /db_xref="GOA:Q4QJJ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QJJ0"
                     /translation="MTALPFPLIEDIGELYMLDDIYDFLGEGTFASVFKAVSTMNRDV
                     VQENQTVALKMIAKRNLSSDKLVRDVINEVHVLRQTAHPNCVRFIECVQTPVYVVIVT
                     EYIEGVELFQALKDQKFTEAMVLNVMRQLLSALAYLHNTLHIVHRDVKPENVIISTHE
                     APFRVVLVDFGLARSCERKRPRISRELATHFQRQRPIPVRNMSVESLDCDSPMLATPC
                     GTLKYAAPETVQSITQSAQLSTTKNLLSRLDVYAVGIIMYVMLSGALPFKNFANKASL
                     VMEMRNSLSFDGPRWAGISAEAIDLNKALLNFDAVSRPHAAEALQYPWFKIYGSALRP
                     MSAEEVQPTPGMLLDSSICERGAMTHAFEAMRATEAALYYNEEETASTSVPVTSRSGL
                     RTPNSRCVSVPFGTNTSAFSNSSSTTTAAQTAQSGYFDFA"
     gene            <41920..>43944
                     /locus_tag="LMJF_05_0140"
                     /db_xref="GeneID:5648875"
     mRNA            <41920..>43944
                     /locus_tag="LMJF_05_0140"
                     /product="putative nucleolar RNA helicase II"
                     /transcript_id="XM_001687438.1"
                     /db_xref="GeneID:5648875"
     CDS             41920..43944
                     /locus_tag="LMJF_05_0140"
                     /codon_start=1
                     /product="putative nucleolar RNA helicase II"
                     /protein_id="XP_001687490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648875"
                     /db_xref="GOA:Q4QJI9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012562"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI9"
                     /translation="MPRRAREEDGEEKPHRVTKLASSSADDEPVKASKISAKASDNDT
                     GAAAEKRKRTEGSSKVSATSATAPAEKKDEEVPNNGCAATARPFSEFEMNPIVVKALQ
                     SRGIESMFPVQALTFNAIMRNTDVLVQARTGSGKTLAFGIPIVERLLKLPSHLTRGRG
                     PAAVIFCPTRELAIQVQDVLCGISCGLVVTALYGGVAYANQERVLRSGVDIVVATPGR
                     AKDFLEKGTLHFDRVVMACLDEADHMLDIGFKDDIELLLSQVAEQNGSVGAERPAHQT
                     LLFSATVPEWVHTCSFIAKDKEFIDMVGKEAVRTASTIKFYRRKCNFSEISSMLADLI
                     KVYSGAHGRTLVFTNTKKDCHDLSINNTKLDSQCLHGDMQQEQRESTMKSFRDNKFSV
                     LIATDVAARGLDLPMVDLVIQCAPPSDIDAFIHRAGRTGRAGRKGVCVLLYQPREEYV
                     VERIERHAKMKFDVLPAPTREEILKAVARDAAEDLARVERRATDLFMEQAAELLKDAD
                     PVEILASALAVMSGYTSNITARGLITGTPGYVTVQMTSDRPLPVPVYCSILRNNLGDD
                     TFMRCRDITLLQDDPGCVFDVLEQFAERVMSTPMRGITFQRIEALPPIIARDLNSSRG
                     GRGGFNYGGGRGGFNYGGGRGGFGGYGGNRGSGRGSGRGGGRVGGFQRRY"
     gene            <45550..>46875
                     /locus_tag="LMJF_05_0150"
                     /db_xref="GeneID:5648876"
     mRNA            <45550..>46875
                     /locus_tag="LMJF_05_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687439.1"
                     /db_xref="GeneID:5648876"
     CDS             45550..46875
                     /locus_tag="LMJF_05_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648876"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI8"
                     /translation="MPASARKKDKVPAPGAKGEKSTGFYTKKKWKSVLQETRVDLAGR
                     ALGPRGALIVGTALLKNTYVTSLDLSQNELGDGGAIAIASMLRTNTQLQHLNLSHNDM
                     TDIGGIALASAFIPNVSPSGQPGQWNRTLFSLVLMGNQLGDDTLLAMSNAAACHRDLT
                     RVDLSWNKVGQNGTKCLMRAYQRNPLCVYQLAANALGDEGTVYLCEALQRYGGKSQTT
                     LNLYRNAISCPGTEAVGRLLANSSIVQDVSLAGNTIGFKGVQALQRQLTDAAVIASCS
                     LRILNLSNNWIGDEGAASVAAIIKANIPSLERLDVSENKITDVGATAIVTAALQNTHL
                     LLLNCEANHLGAKAVDAVVQLIHETRTLTSLNVAGCVNSADHRRTLTIAVGETDGLHV
                     ELGPNPEDAAGAEGTALIEKITEHLQMLADQEAQRQKESMAAKKLKKAR"
     gene            <47964..>49520
                     /locus_tag="LMJF_05_0160"
                     /db_xref="GeneID:5648877"
     mRNA            <47964..>49520
                     /locus_tag="LMJF_05_0160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687440.1"
                     /db_xref="GeneID:5648877"
     CDS             47964..49520
                     /locus_tag="LMJF_05_0160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648877"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI7"
                     /translation="MPIIKSRVHADELHAAKNALTAANREADALHQQVLEQRAQLDQR
                     AQQNARLAAELVEAETKLEEAHRQLAEMQAHAQVREEHHREQVHRMAQNLRTLEDMVQ
                     ASRRSEREGPSWMYHRGQSAGNSSTDDAGRARQRGELICSQTSAALQRPPAVPTRGDK
                     AVREQHRPPPSPSPAASPPISAQALYWQEQLLDFSQRAAEGFGEVQRQLRHCLPPSPP
                     STSPAAAGSNAHSDQEPLATSASPVPDAYRWSRQLRRLHAQFDEVVQADSKLISFLLL
                     VAQQQGQQIRTLQERWAEAQNTVREAEAVLDEASARVSRNAQESAVLRQECAVLTEAQ
                     TALQAQLTNRTREHQAAVAALHRLQEAHAQLTNARTRQEEMWTTRLTQAAELQQQASN
                     YAQKLEAALLDKEQLMSAAAASAEQGLRREVLEAAKKRVAVFLRQLNASVEELHCSLA
                     SLSSPPPSLAPAASAVAGGTLQKVSSAASPEPSPPGASSSAYSASLSPLPPSFSQSLL
                     LPGSLTAASM"
     gene            <50004..>52289
                     /locus_tag="LMJF_05_0170"
                     /db_xref="GeneID:5648878"
     mRNA            <50004..>52289
                     /locus_tag="LMJF_05_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687441.1"
                     /db_xref="GeneID:5648878"
     CDS             50004..52289
                     /locus_tag="LMJF_05_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648878"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI6"
                     /translation="MVSVLVQRQQHEAARRRERLRAARQAAAALSIQQARAYQKQKRQ
                     QEACVREDARQLWLQSNARDLAAIDGLVARAATEQGEAQEAAGHYEANLQAEAYEEAA
                     AWQAERQLEEARHRLAVAYTRTQAHERAKPAREAEQRRAAVRVTEKVRAARVATAAPA
                     ALSLSSVLASLQGAPVATHVPRASVPVPRPSLESLRNAVGSTAGAARADVPPAALSPL
                     RRWRMSHVAPHVHVTLHGDPTHRVTAREENARSALAAADDAVPASADAYAAECAAVQQ
                     QRDEVLKDGQERAAQRAASLLRRQRAKELQEEREQQAQRERLAAVKAHYRHPHEEGTA
                     SGGDKGAAPEGGTHPATTTAGSSSGGSNGSPNHQHRRPQRQRTPQRLACHQQAYIKGE
                     EEFRAAFLEAPPLVVRLDEQPPRRAPLSELLRPVKVAELLYSIANSVPVDPVPFTPAP
                     HQGSGAAAAVSPSFPMTGEVPPSAQPSARARVLPSVPLRMLPLDERSSAARATAESAP
                     EDRAAAATPLSSGEEGCSLPPPPPPAPRGSSGALRASAEASTAPSPMRLDVLVSRTSR
                     SRTPSPEKAAAVEELVALSPLTPAPPAAGTCVPESPSRPPPCAGGALRELGQASANMG
                     ASDVTMAYPQQPLAAPGGRRATSAHANASASPSALSSMMERAPTHHCRRRSATPPSSL
                     STTTTTTTTETAEPPSGSSSPASVGSSSSSSSSGIDASSSSYNSASTSGSSRHPMPVM
                     TAEQLKLALLRLRSRIRSAQM"
     gene            <53727..>55160
                     /locus_tag="LMJF_05_0180"
                     /db_xref="GeneID:5648879"
     mRNA            <53727..>55160
                     /locus_tag="LMJF_05_0180"
                     /product="putative dihydrolipoamide branched chain
                     transacylase"
                     /transcript_id="XM_001687442.1"
                     /db_xref="GeneID:5648879"
     CDS             53727..55160
                     /locus_tag="LMJF_05_0180"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /product="putative dihydrolipoamide branched chain
                     transacylase"
                     /protein_id="XP_001687494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648879"
                     /db_xref="GOA:Q4QJI5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR015761"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI5"
                     /translation="MRSARCMVRRCIGAAAGAATVAHASGWPYTASRRHLFATTCAPL
                     GRCIPYRLADIGEGITEVQVLGVCVKAGDTINEFDPICEVQSDKATVDITSRYTGVVK
                     AVYLQPGATAKVGSVMLDIVPEGADDAPEAASPSRSAPPPSSAPDSAPQATYSASKPS
                     SDASAGKVLATPATRYLAREHKLDLAHVPATGKGGRVTKEDVLQFMDAGMSAAAAPSP
                     PSTASSAATAPPGTVVSGLQTEAGDTVMPITGVRRGMVKTMSQAASIPTFTFSEECEL
                     TRLMEVRGSLKDVVKERSKGKAKLSFMPFFLKAASIALQHHPDINAHCPVDCSALVRK
                     AAHNIGFAMDTPNGLIVPVVKHVERKSILDIANDMQVLIERGKSNKLTTQDMTGGTFT
                     LSNIGVIGATVTTPVLLPPQVAIGAIGRLQKLPRFDANGSLYAANLICVSFTADHRVI
                     DGASMVRFANTYKQLLEHPENMLVDLR"
     gene            <56375..>57469
                     /locus_tag="LMJF_05_0190"
                     /db_xref="GeneID:5648880"
     mRNA            <56375..>57469
                     /locus_tag="LMJF_05_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687443.1"
                     /db_xref="GeneID:5648880"
     CDS             56375..57469
                     /locus_tag="LMJF_05_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648880"
                     /db_xref="GOA:Q4QJI4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI4"
                     /translation="MEAGGDDLFVINDVEADQMEEVRDARPVEQAQETEADVMESVKG
                     LVPLCVQHAQGPQLSSATFGYDIALMAKRPWAEPGAKLSDYFNYGFNEQSWRVYCAMQ
                     EKGEESLLANATAVLQKLELAARPGAGAAAEEAGAGGHLAHDEPPMMMVGGIMDGYSD
                     GGPYGGGHGMYGGQEGPGRGGGYGRPYQPREFHPHGGGGGFERLHNANYKTRLCKGFA
                     EGHCNRGNQCNFAHGVGELRQPGGGEPIPPPPQQQQHMPQQLPPAGLAAGGSAPPPMA
                     QVYGDHRPGFNNYYTPPPPQVMTGGAPPQSPERVNYLMPSFQGGASMPPMMGGSAMPM
                     QDSSDGTGSGFRQPPKRPRQDGGGVYEPQY"
     gene            <58407..>60776
                     /locus_tag="LMJF_05_0200"
                     /db_xref="GeneID:5648881"
     mRNA            <58407..>60776
                     /locus_tag="LMJF_05_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687444.1"
                     /db_xref="GeneID:5648881"
     CDS             58407..60776
                     /locus_tag="LMJF_05_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648881"
                     /db_xref="GOA:Q4QJI3"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI3"
                     /translation="MSSSLGKALRRSKRATERKGRRNYRDALENERSAALEAELHQQE
                     IGRAKTQLKSIWETNDLENFLSIADAREEGYFAERDVRVVIGSRVHVVQHDKVVPQQM
                     PTDEAHVDWLKLSESLTIPKRPEWDCNMSADELQAAEKKAFADWRRSLAQMEEEHKVL
                     LTPYERNLEVWRQLWRVAERADVVSVILDARNPLMFRCSDFEKYVRSTKNSKGEPKKV
                     VLLLNKSDLLTEAQRRAWAAYFQHRGDDFFFFSAKLLQPLTTDAAAAAAAPSHAVTGN
                     DDEDEPEEDGDAPLDSDGVQLTAAQEKAALDKVMKHRKEKTRHQKKALRAPVEVKNPY
                     ELSAKREALQRQAHAPKAKAEKPPTEAELARNARTAAAAASAVKREPWTVLDPVQLLD
                     QFALLREEAGVTEMNTPLMVGLVGYPNVGKSSTINAILGCKKVVVSATPGKTKHFQTL
                     MIPNERRVALCDCPGLVFPSFATTKAQMVCDGILPVDTATDTLEATATICRRLPRPVL
                     EGELNISLLAEDDIDESDSLAERLLNALARRRGYMASHDRPNKARAGKELLKLYVDGY
                     FVYVEPPPTYRPDAAALSLDRYMEQQHASASPAAASSARGGGAAAEEPDEEWEDDDDA
                     TGHELNSEEEDAWADFDSGNDDRALSESGDGDNYSVDMDLEDAAPPMFYIRSHALRST
                     FTRYELFNMEANEARIRVLRKAERRRKKRTNHQLEPDTSTFVNRQGEVELRIDDDDGV
                     LELVTPTGGPVRPATKAKPKSKRQQRRELKQMGVGPSNRYGQRKGIVEY"
     gene            <61671..>66146
                     /locus_tag="LMJF_05_0210"
                     /db_xref="GeneID:5648882"
     mRNA            <61671..>66146
                     /locus_tag="LMJF_05_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687445.1"
                     /db_xref="GeneID:5648882"
     CDS             61671..66146
                     /locus_tag="LMJF_05_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648882"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI2"
                     /translation="MYLRTPLVQRGVLRCHPPRCHRRAPAVTTSAPLSSSGSTDGGSD
                     FACYIEAEFTDTLFAASSPTEAGADSVAQRTNSSFYLVPAAAAAATAAPAGAQRHYRR
                     RRSLHCGSEVSSLPPTHAILNHLNSSLWLQVLIRLHSRGTLSGEDCAGALRYLPALTY
                     RPLMPWLWSPAILSTPAEAAQPSSTSHRSEANRGSEAGNVSGARDSAEDEVDLGTEVR
                     RSVCLPALAMSCRPAAPPAPLATAPLTLYTVTDISTAAPSQWTVIATSVVKSTLANAP
                     PPTVKDLLKVWHDLFFALRYHAVWVSTPEQLRDSAHPQLMRLFECFYADVRRHSQLSS
                     ASEACCVAPLLSSEELPLQQRRTDVITEVVVRTLTPPILLRKLRSLYRPHRHSAMLFA
                     ELYATCVEEEETFVCLRRLHARSPGDMPAQEAAQPAARTQQRQQLTTTALLMDVDLAA
                     SYATLPGRRYSGLSDAGEQWAATLQHLRFLLPRVYLLQECRRAQGAPPTSSGNAAEEA
                     VWQPWRQVASILMNVCVWVSNDNAEAERCGEALRCTVEVLRSMNAESSTPGRGGAHRL
                     RAPPTSQDVGTFISCLVAAARDSMRTKAAQLQYGPTDGLLGVYLLSVAVAAVIPASAR
                     SRKSVADCRQTGDAVRILSTDADEDAAELLHRLRLLVHPSKSTPREVWAALRRSPAAG
                     EAARHGLVTVGHHLFNECVMPLVSQPKVFSTAQRLYGRLREWATEVGRPLGLHGEPVS
                     ALWKLRWLQQHLTTGGDSGTASTLLGRLTSGRAQAGSDRVAAHDTTTLPSPLWWRCGC
                     GFENESISTGVHHGNAVSVACVACVLRTLTPLSWECPSCHAVANSGECVPYCLRCGET
                     HPLAAKLGIAVKTPNVTGAHTCGVTFCKGCPHLRTVALLQPRGLPKSSLVYTPTPPSL
                     LNPPEATEGVARCCWDCGHACGDAHVAPLSSRYVAPSGHGNDDAALNSLSEDGDSLKV
                     GGTGAVVYVCSDCHAISTGPHSAALPKIPNGAPATGSSTASCSSCGTREPGYYTAAFA
                     WACGCGACNSALHAYCHACSRAAQQPTVTCTHCNHAQSVRGAAAWAGSRGACERCHHP
                     HPRVLAAVTQQRLVRCPACQGHVPSTSVQCPHCACTAVAAVAALLPTEADQPWLCHHC
                     GITHAVRDTAGGQLRTPVHLTDPSSLHLLLPPITRAEDGYCTTCGTRRLPATAWERGR
                     LWGCSECGEPFNSELACRRCAALAPGVPAGQVYAWRCATCDAYHPSWEMQCRAAGCGG
                     RRGAEDVCARFCYSPWTCAECGEVTLSSHAVTCATCGAETPTPLRATPCTYRDACGTT
                     AAATAGAHAKWHRGRVEANSSARAHEERTMPKALAGAEGDVREPSAGTCTALSPSLSH
                     TPSALSSAHAATAPDSRLAEVETFLLQAAAHPSLPLLTEPLDTALMGAVSCKSLRPHR
                     SRDASAPASEPAGDSAKSLTDPTHRDGVRAGGAAGTSTLAVEPWEDAYAATVISF"
     gene            <67734..>69731
                     /locus_tag="LMJF_05_0220"
                     /db_xref="GeneID:5648883"
     mRNA            <67734..>69731
                     /locus_tag="LMJF_05_0220"
                     /product="dual specificity phosphatase-like protein"
                     /transcript_id="XM_001687446.1"
                     /db_xref="GeneID:5648883"
     CDS             67734..69731
                     /locus_tag="LMJF_05_0220"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="dual specificity phosphatase-like protein"
                     /protein_id="XP_001687498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648883"
                     /db_xref="GOA:Q4QJI1"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI1"
                     /translation="MAPSSTAIPEIAAAPGAPRGVGVPASPSRGSRMSKCKRFLQNLN
                     GPAFDLKAVQEAQHTFLEEESVCNAAQAYPMSDITSLLAVGSWKDASNPELLKAHNIR
                     YVLNVAKELIPTEEAKLIAQNNDIVSEWIPMNDSHTQDVSEYLIKAFRFIERARSEHS
                     RVLVHCRRGISRSAAIIVAYLMASEHRSYENALKFVTERRSCVSLNLAFQERLSEFVP
                     SSEFFHGPPTQQQQQQQEPGAASPPSASSSDSLLPTLAGVAPRTDSGHANHSSQPQPL
                     QEADHPLLLLPECRSVTSSTGSSRASSSKRTAPSQSLGPRTAAKQASVLCSATSTATP
                     ASTRVTSGKSGKSTSLEKTLRLHALPRQQQSRRGSAAPQALAFTSTTRLSARSTATAV
                     APGIQSAEGEVIATPAPESVGSRDDGDDEVEEPCSPLGLHGRRALARLNCAQASSSSA
                     SAGPRKQLPRTCSEEEEVLTTAMAMTATVTTTLMHVNKCGPDEMPAAANEEVGDGEVR
                     CSSSSPNTSESHLHLHHSPRAPTQRGSAFDVSDGEADDSGSIAGTGTPLSLQKKSQRN
                     PRVRKAVSANSTGAPASENEGNSSEGRQEHAAGERNRSPTATGGGDSTGTAVAMDGLP
                     ATRYGTQSAFNEEGVASQSPTAVHPSSVVAGVTSRASSLSG"
     gene            <74208..>76136
                     /locus_tag="LMJF_05_0230"
                     /db_xref="GeneID:5648884"
     mRNA            <74208..>76136
                     /locus_tag="LMJF_05_0230"
                     /product="putative hydrogenase"
                     /transcript_id="XM_001687447.1"
                     /db_xref="GeneID:5648884"
     CDS             74208..76136
                     /locus_tag="LMJF_05_0230"
                     /codon_start=1
                     /product="putative hydrogenase"
                     /protein_id="XP_001687499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648884"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="UniProtKB/TrEMBL:Q4QJI0"
                     /translation="MDYIAPSSACIRPTLISSGGSHAVGPGDPTASASGVVGMKRGGN
                     APPLGPGIAAAAQHADVVKITLQDCLACSGCVTTAETVLVNAQSRHEIVSALLTSSAS
                     TSSTTAKGSALRPRLVSISSQSCASLAAYLHMSMAAVYELVAGFMRATLTTAGLQEAA
                     RNAEIAAAGPPRDTMKNEEVSGASTTATTDSSTVVLSELEPPIYVIDLEWAEQLSAEL
                     TAQEYDRRRRGSGNAEDGPLPLIVSACPGWVCYCEKQGAALLPHLCPVMSAQGIAGSY
                     AKRAVAANLYHVSVQPCFDRKLEAARDSMPSSTTAPPADGTDMPVVYTDCVLSTAELL
                     EWMKEADPTLPWRGRLDTNVNAAAALAGGNGPGHTTQRPTQLNEEEEPTSTPPPAASA
                     IFAPAHDAARFAGSGGYHRSVIAHRLWAEGVAALPSSSSPSPNTPANVAYEVKRNRNH
                     QLATCAALPEEVFCIGYGFQQIQNVVRGLKKRIPAMRSYTFIELMACPDGCLNGGGQV
                     RPAQQPHAEVLDAVLDAYARNMEGSREKGGLGAATPASSSGSALACMFASSPPDSSDA
                     QAEDGEIAMKAQRRRAEAPVPLRHTGTEAAWQPFADATIAVTAPSLGDALWRCTFRDR
                     EKEFAAMLNDGNVHSLKW"
     gene            <77830..>81549
                     /locus_tag="LMJF_05_0240"
                     /db_xref="GeneID:5648885"
     mRNA            <77830..>81549
                     /locus_tag="LMJF_05_0240"
                     /product="putative viscerotropic leishmaniasis antigen"
                     /transcript_id="XM_001687448.1"
                     /db_xref="GeneID:5648885"
     CDS             77830..81549
                     /locus_tag="LMJF_05_0240"
                     /codon_start=1
                     /product="putative viscerotropic leishmaniasis antigen"
                     /protein_id="XP_001687500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648885"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH9"
                     /translation="MSVQLNERHVNFTGRSGSVAVPHLGLVRFNLSAPTIGPQYFTSE
                     LCYSEVNCTNLCTNALMGHVGTCKVDRVIMPVLIVLLWMVPTVACVGFLAAMYLRKLA
                     KQRRKALDQSPEVFGTSPAASRTWRPLQRAPSTPRPSSSSHAVFTDEREASQGGSHEA
                     ALEHASEALVVIPVHGNYESLPPRLRSAAPPNTFTSCSLPERKEVEMAALRAVDPPSL
                     EQPSEKHRHTSTHNDDYVTGTATVRLPEERHFSPDLPAPSETLETTVQDSSSHPAIPQ
                     VNGSEKTNPLNCSTQQPQPKRTSVQALEEAGRLRAELEAAEEAARLEVMHEAEQARVQ
                     ALEEAARLEAVHEAEQARVQALEEAARLEAVHEAEQARVQALEEAGRLRAELEAAEEA
                     ARLEAVHEAEQARVQALEEAARLEAVHEAEQARVQALEEAGRLRAELEAAEEAARLEA
                     VHEAEQARVQALEEAGRLRAELEAAEEAARLEVMHEAEQARVQALEEAGRLRAELEAA
                     EEAARLEAVHEAEQARVQALEEAGRLRAELEAAEEAARLEVMHEAEQARVQALEEAGR
                     LRAELEAAEEAARLEVMHEAEQARVQALEEAGRLRAELEAAEEAARLEVMHEAEQARI
                     QALEEAARLEAVHEAEQARVQALEEAGRLRAELEAAEEAARLEVMHEAEQARVQALEE
                     AARLEAVHEAEQARVQALEEAGRLRAELEAAEEAARLEVMHEAEQARVQALEEAGRLR
                     AELEAAEEAARLEAVHEAEQARIQALEEAGRLRAELEAAEEAARLEAVHEAEQARVQA
                     LEEAGRLRAELEAAEEAARLEAVHEAEQARVQALEEAGRLRAELEAAEEAARLEAVHE
                     AEQARVQALEEAGRLRAELGAAEEAARLEAVHEAEQARVQALEEAGRLRAELEAAKEA
                     ARLVAVHEAEQARVQALEEAGRLRAELGAAEEAARLEVMHEAEQARVQALEEAARLEA
                     VHEAEQARVQALEEAGRLRAELEAAEEEKDERAGTLRYNEDCKGRVLYRASPDSRRPL
                     PRPFIGLSLSEDVERSILIVDGLYRDGPAYQTGIRLGDVLLRIAGVHVDSIAKARQVV
                     DARCCCGRVVPVTLATKMNQQYSVALYIMTVDPEHKDKPYFFDVHMHHRIESSHRGKR
                     AQWMEVLERPSVSSAAATPLVPLLRETTPRRGSVLQSSARSAFVATSYFSSARRSVSS
                     ESERSRGSSSAATAEEAIALAPQGYTPPNQVRGRS"
     gene            <83061..>83354
                     /locus_tag="LMJF_05_0250"
                     /db_xref="GeneID:5648886"
     mRNA            <83061..>83354
                     /locus_tag="LMJF_05_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687449.1"
                     /db_xref="GeneID:5648886"
     CDS             83061..83354
                     /locus_tag="LMJF_05_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648886"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH8"
                     /translation="MPRAYYKPFTAYEEAFGFHATRRNAYIMCSVLFGGLLLKCMLLM
                     KYSPVANPNRTSPLEDDPRYQELMEHRLAVTEDLSTRESMTKAMRARRSAPPA"
     gene            <84050..>85231
                     /locus_tag="LMJF_05_0260"
                     /db_xref="GeneID:5648887"
     mRNA            <84050..>85231
                     /locus_tag="LMJF_05_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687450.1"
                     /db_xref="GeneID:5648887"
     CDS             84050..85231
                     /locus_tag="LMJF_05_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648887"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH7"
                     /translation="MNTRPRDICTAAFEGDTARVEQLVTAAGVYSGRRHSPFAVDTSA
                     AARDALAHWEGVGDNQDNEGYGGAEEDIEEMLSGEEMAKLMAHPALCGIVKAYSLDRQ
                     ALGGAAEDSEAASGEEGADAYTQDDNAALLDEEVEEAAEEDRQAQQGDILLYKRLLAH
                     QLHRNSVAEHIQQHGLLRMSTTPPVDMTLYGILFSCREVPTAAGGAAVSEESSVPLQV
                     RWQPSKRSRYAGTPLHWAVLAHAHDTVRFLVKHGADCTAGLKAVTNDGEAPDVQLARC
                     DQRVLASLTPARMAADNESHGTLEVLERAVAAHEARRADEEAFFIMLEKRLQRRREEY
                     LRRFEEARAHRLREAEEARRAEAEEAEGAEESNLSGEDDEDGSGSENMDAGEEDEEAD
                     G"
     gene            <86241..>87200
                     /locus_tag="LMJF_05_0270"
                     /db_xref="GeneID:5648888"
     mRNA            <86241..>87200
                     /locus_tag="LMJF_05_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687451.1"
                     /db_xref="GeneID:5648888"
     CDS             86241..87200
                     /locus_tag="LMJF_05_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648888"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH6"
                     /translation="MAETAGEEDVRLMSREERIASYRELVEGLDDILASHDADGDNDG
                     EDAEQMAALVEEVEVQLRTLAQLLNEEETIQATPGLMKKVEKSPETGEVLTTIIYPPP
                     QMPNTASSSPALRPAPYEVLFDERDWYPCVITGVVPPAKDVDRVQYKAWILGHNVEEI
                     VYSEALRPWQPTACTSDIQGGVSCHVIDPQTGRYVEGVVDRLTLEETVLVKVPVAPST
                     STTVSASPSAATTTTVTVPLSHVRVGKFYSQLRHRPKTEEERAAWRSERARLKRERAA
                     QQRQMAADKIAKDADDWQALMGDMMGVGSGGGGTKKHKRRRLQ"
     gene            <87851..>88525
                     /locus_tag="LMJF_05_0280"
                     /db_xref="GeneID:5648889"
     mRNA            <87851..>88525
                     /locus_tag="LMJF_05_0280"
                     /product="putative protein tyrosine phosphatase"
                     /transcript_id="XM_001687452.1"
                     /db_xref="GeneID:5648889"
     CDS             87851..88525
                     /locus_tag="LMJF_05_0280"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="putative protein tyrosine phosphatase"
                     /protein_id="XP_001687504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648889"
                     /db_xref="GOA:Q4QJH5"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH5"
                     /translation="MGIKDMYLLAYNAGMCVGWGTILVKIIVHLAEGRDPASVYPDIA
                     RLLCVAQTGAVAEIFHAAFGIVRSPVGTTFLQVLSRLIVLYGAVRIGDTDSTKSLVFV
                     QMLVAWCLSEIIRYSFYGANLLRVNVASLTWLRYSAFMVLYPVGITGEIGCLYKALPY
                     IKKHKPWTVELPNKLNFTFSWYNAVWFILLGIYPYGSYVMYSYMLAQRRKTFAKAAPE
                     RSKKSA"
     gene            <90359..>90880
                     /locus_tag="LMJF_05_0285"
                     /db_xref="GeneID:5648890"
     mRNA            <90359..>90880
                     /locus_tag="LMJF_05_0285"
                     /product="putative ARP2/3 complex 16kDa subunit"
                     /transcript_id="XM_001687453.1"
                     /db_xref="GeneID:5648890"
     CDS             90359..90880
                     /locus_tag="LMJF_05_0285"
                     /codon_start=1
                     /product="putative ARP2/3 complex 16kDa subunit"
                     /protein_id="XP_001687505.1"
                     /db_xref="GeneID:5648890"
                     /db_xref="GOA:Q4QJH4"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH4"
                     /translation="MASAEASAASASRLCAELDALETTSLQRLPIDDARRVLDRLEDV
                     DAQLCRSAGVAVPISDSSEGAAPCTATRGARPPVHDASMGTLKQLRSTFAAQLTISQQ
                     DALMRVLYACMASCASGVTTPTSEAASWAPTGAPNAHAPLSPAGVHRLYEWHAALHDA
                     AGDGAVVRALMSR"
     gene            <92360..>93817
                     /locus_tag="LMJF_05_0290"
                     /db_xref="GeneID:5648891"
     mRNA            <92360..>93817
                     /locus_tag="LMJF_05_0290"
                     /product="phosphate carrier protein, mitochondrial
                     precursor-like protein"
                     /transcript_id="XM_001687454.1"
                     /db_xref="GeneID:5648891"
     CDS             92360..93817
                     /locus_tag="LMJF_05_0290"
                     /codon_start=1
                     /product="phosphate carrier protein, mitochondrial
                     precursor-like protein"
                     /protein_id="XP_001687506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648891"
                     /db_xref="GOA:Q4QJH3"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH3"
                     /translation="MLPVPAGFAVHNRNTGSNNSEGDGHASCVDERSTVLGLGAGVGG
                     GSTTDADVVSAVITTSLLPPGGVKEVGTASFVSPIVGARDRVCFQHFLIASVAAALTA
                     VLVVTYVWQSTSALNIDPVTGTVRPHSFQYFVYCFLGGIAAGMVHLIVAPIDILKCRV
                     QVGEYRSFKEGFVHLFRVEAGGSVYRALPLFFRGWLPMLWGYCIQGSVKFSLYEIVKY
                     VLLTVLQEPSVEAKAAAAAAGGVANLLASSSAAHVSGVYQFFVFLFSSCVAEVVADLG
                     LAPWEAVKIRMQTSPSFPVYLRSALPRMWETEGLHGFYRGLVPLWGRQVPYTMMKFSS
                     FEFVVVGLQSLFHSLGIMDAAEPGVLGKLVVSLLAGVLAGLLCGVVSHPADTVLSKMN
                     QRSSAPTSSAVPALANTLADAPCGSVGHGRAGAAHSGAMHGVLEVMHELGWRGMWKGL
                     APRLLMVVSLTALQWVTYDGFKVWAGLPTSSDAKK"
     gene            <94106..>96751
                     /locus_tag="LMJF_05_0300"
                     /db_xref="GeneID:5648892"
     mRNA            <94106..>96751
                     /locus_tag="LMJF_05_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687455.1"
                     /db_xref="GeneID:5648892"
     CDS             94106..96751
                     /locus_tag="LMJF_05_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648892"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH2"
                     /translation="MGWVRALPPTPPLSRLFLLSLSLSLSALEGRHDAKYCGRERARR
                     RAIVALESIGGQGGVHFKHDHPPTPRGLALHGREYAIKAQSPVACARCGRHDLPRVTA
                     VASLELFARAHVPPPSPHDPPRSPSSFSAAVSSLLPAARRAVMLANPQSFATSPAYTE
                     NGGGGGAPEASQEGYPRTLTSSLSQTTAYAVRAMDSVTCIPSRVLHLPAPLLQPHGSR
                     WASVQPSPDRASLLLCGRHECQLLAVSSFALQVPRAAVLAQSSRSSRGEDTRRLVAQR
                     WNERGSAPDNSAVGGRGRCIVLPQPHRDLTSSCWLSAGLDTGNEDDGEAAAGDDTAPG
                     AVVGLGDAASVVTIMRPSPLSRALSPHGATATWLQATIFLKDEGDAVFAGGTPLAWNH
                     QHHDRLDKATMLGRPCHWGRTPPVAPAWKAVEAVLPCSYVPSHSSSGLTDMYVLCQRV
                     DEVYVGSGVAAGGRSARRSCSAVWLASVQRESAWRVPLAMPPGDDEALMDSGGDGAAA
                     CSLAEVRHVVRRTPRLFDVRRRLPPALQQAPPHQPSQARPAPPSAPAHQRAGNAETGP
                     MGLVFAAAFRRHVGLYTAATVTPTVFFELPSWLTGGGGTAAATATSSPSRCSSWCVTS
                     VVEEPSLVAPVAVPQTSSNGGGSGYSYLVTAMHDERGNRRSRPYPAPAKVTRGDESWK
                     SDGDNNNGSSGGNCCCSPLSPSGSCWWLLYDCRNPSLPVWAAEEALAAPPALDEDDLW
                     HDAPVVTEWLASTSTSPSPASHAGLHRSPVCATYVPFATTSADGSSALAVPSACGVCI
                     VLDGGTRMPDGAGLDTEGDDDDDDVASGEAAEVFAPIMYELSPPRSLLSPTLGAPREV
                     TAKPPRVRALTFTEGTLHYACEEAL"
     gene            <97453..>97995
                     /locus_tag="LMJF_05_0310"
                     /db_xref="GeneID:5648893"
     mRNA            <97453..>97995
                     /locus_tag="LMJF_05_0310"
                     /product="glutaredoxin-like protein"
                     /transcript_id="XM_001687456.1"
                     /db_xref="GeneID:5648893"
     CDS             97453..97995
                     /locus_tag="LMJF_05_0310"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="XP_001687508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648893"
                     /db_xref="GOA:Q4QJH1"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH1"
                     /translation="MRSLSRGLPLAASGRLFCVSRRSPVTASTTLSATYASASAVPCS
                     SLSPSMAASAHRVSAVFFHTSRVHRAPSDVSDDLAKDLHDIIGHDRLVVFLTGTPSQP
                     RCRFTAQLVDLLDQLGVQYSFFNIMDDEEVCEGLKAYSDWPTYPQVYVDGELLGGFDI
                     CKTMMLDGTLTTMLKEKQLI"
     gene            <98290..>98385
                     /locus_tag="LMJF_05_0320"
                     /db_xref="GeneID:5648894"
     mRNA            <98290..>98385
                     /locus_tag="LMJF_05_0320"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687457.1"
                     /db_xref="GeneID:5648894"
     CDS             98290..98385
                     /locus_tag="LMJF_05_0320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648894"
                     /db_xref="UniProtKB/TrEMBL:Q4QJH0"
                     /translation="MQRRSVQQQLLLLLVPLLQPLITSVVHVCLS"
     gene            <99335..>102316
                     /locus_tag="LMJF_05_0330"
                     /db_xref="GeneID:5648895"
     mRNA            <99335..>102316
                     /locus_tag="LMJF_05_0330"
                     /product="putative DNA replication licensing factor"
                     /transcript_id="XM_001687458.1"
                     /db_xref="GeneID:5648895"
     CDS             99335..102316
                     /locus_tag="LMJF_05_0330"
                     /codon_start=1
                     /product="putative DNA replication licensing factor"
                     /protein_id="XP_001687510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648895"
                     /db_xref="GOA:Q4QJG9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG9"
                     /translation="MGGRRSGDGATGVKPSGLPAAVAASAKTDAWMDALWEIHCGTPL
                     AGAVRYTDAIVETMWEVFQPLLSELDVYPLAIADVQPETVTAATAATVPFTDFIVLRL
                     IEPTTPVRHGHRHRGGDHGDVEEDPQNEFGNALTAVMRTALLEQPCIVLALVEFFTAV
                     WLYQYEARKLSTSQTGQHGKQRQGDGGAQRVRSPIVASAASRAPALRRVYAAVSGDVR
                     HATPFDHLGAAQLGRVLTIRGTVVRMSPARISCVCMSYRCGHCGVVKKQAAQDGVLTY
                     PGPCASARCRGYKWTPLTDQAVCEEVQLLRLQEHTTFFDASSSPASPRDGSGATQQHG
                     GGSNRGNTGGSGSQRMGSGGMHVMIEVELRTPWLDAVTVGDCVCVCGVLETRRGEGKQ
                     GGGMQQVCLRARAVRSLRSQETSASSPSLSNIAALQRRQRDGALLSATMGPGSCRDGP
                     WRLAHGGGAAMFADGTSTGDAMRGDGEGEADGELMLGTTAQLGGVGPTAITALPSGAR
                     VSFSSGFDTWSAEETGRFYEVARHPQWFARLTASVAPSIFGMELVKQALLLSIVGGNR
                     DKNGGETRSSIHVLLVGDPGLGKSQLLRAACAVAPRSAFVCAHTSSSCGLTMTLTRDP
                     VSGETTFEAGAVVHGDGGITCLDEIDKGVQEHKALLEVMEQETVSLAKAGMIFSMPVR
                     TSILAAGNPIGGRFDVRKSLAANVNLSPALLSRFDIIACLRNPHGSSGNAQQALTDHV
                     LQWHRRAPAGGDGGEGCNGGGRGRGHGAGPLPLPLVQRFLLFCRSQCQPTLCREACDV
                     LQTHYLAQRQHLPQPQYGFEHGATASCAGSAAGHLSDSGSVSGPLPRAAMGLEATVTP
                     RYLQALIRVAEARAKLELRHVVTREDAEYAVQLLQSCLHSFDGLAASGSAAIGATAGS
                     ADVGAGRRPTTLNQRDAVLQRLKLAIVEENSGVNLFTEQAILDVCESVGCRSATAMLR
                     QLNEHGFLLQKGGSKYCLRGC"
     gene            <103150..>104265
                     /locus_tag="LMJF_05_0340"
                     /db_xref="GeneID:5648896"
     mRNA            <103150..>104265
                     /locus_tag="LMJF_05_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687459.1"
                     /db_xref="GeneID:5648896"
     CDS             103150..104265
                     /locus_tag="LMJF_05_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648896"
                     /db_xref="GOA:Q4QJG8"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG8"
                     /translation="MLKSSIVLLRRGKPRPRAGMFPEKYRRVPTLLKPQQGGQQYFNE
                     FLIRSANDALEAQQQGYGSAFRVGGSGAARILADGNATAADGIHDGEISSVHPRLPQA
                     DIDGVLQRSRAETIQAELKQLVAQDGFISQRGFNERLWYEQEHHRLRTHGDGVEASPS
                     EVAATAAASSSTAEAVSATGEGRAVPERILGDDYFQSKFGYSLLKGRSPDASAVADNV
                     KAYAQLDLWGEMPMYSRDFVFLYLVSRRRNTYAVAYDYDGKRLLPTYTAGNRGLKGGD
                     RGFRGDGSTDNGHQVTSMYLNDLLPKIREARAASGRPLGRGEKIDLVVRVMGFYNGRQ
                     GAVRAVQDRSADFRVRYLEDVTPFPLNGPKMPRGVFR"
     gene            <105666..>107141
                     /gene="TRYR"
                     /locus_tag="LMJF_05_0350"
                     /db_xref="GeneID:5648897"
     mRNA            <105666..>107141
                     /gene="TRYR"
                     /locus_tag="LMJF_05_0350"
                     /product="trypanothione reductase"
                     /transcript_id="XM_001687460.1"
                     /db_xref="GeneID:5648897"
     CDS             105666..107141
                     /gene="TRYR"
                     /locus_tag="LMJF_05_0350"
                     /EC_number="1.8.1.12"
                     /codon_start=1
                     /product="trypanothione reductase"
                     /protein_id="XP_001687512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648897"
                     /db_xref="GOA:Q4QJG7"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001864"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG7"
                     /translation="MSRAYDLVVLGAGSGGLEAGWNAAATYKKKVAVVDVQATHGPPF
                     FAALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEMNRESLCPNWKTLIAAKNKV
                     VNGINESYKSMFADTEGLSFHMGFGALQDAHTVLVRKSEDPNSDVLETLDTEYILIAT
                     GSWPTRLGVPGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPRGGYVD
                     LCYRGDLILRGFDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEE
                     DYDQVMLAIGRVPRSQTLQLDKAGVQTAKNGAVQVDAYSKTSVDNIYAIGDVTNRVML
                     TPVAINEGAAFAETVFGGKPRATDHTKVACAVFSIPPIGTCGMTEEEAAKNHETVAVY
                     ESCFTPLMHNISGSKHKEFMIRIITDQPSGEVLGVHMLGDSAPEIIQSVGICMKMGAK
                     ISDFHNTIGVHPTSAEELCSMRTPAYFYENGKRVEKLSSNL"
     gene            <108077..>109954
                     /locus_tag="LMJF_05_0360"
                     /db_xref="GeneID:5648898"
     mRNA            <108077..>109954
                     /locus_tag="LMJF_05_0360"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001687461.1"
                     /db_xref="GeneID:5648898"
     CDS             108077..109954
                     /locus_tag="LMJF_05_0360"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001687513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648898"
                     /db_xref="GOA:Q4QJG6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG6"
                     /translation="MAEFQRLGIQRWLSEQCTYMALETPTPIQCKCIPAILAGRHVVG
                     GAATGSGKTAAFALPILQTLAADAYGVFALVLTPSRELAYQIIDQFIAFGAPLRVRTM
                     LAVGGVPTETQVDALKARPHIVAATPGRLRHLLEVFAPEVQKAFAHLRYLVLDEADRL
                     TEGDILRDVQSLLRLLPPTRQRRVLMFTATLHPRLTTLEVPQAAQGLSASGGAAEERA
                     GASLASSHSPALQQPQNGEVDEVAEHFSLLAELGITDASTLEVAVVRGAIQEGLGHAA
                     ESGSTGAAGGPTSSATAPTLPGRPTSFHLPETLTQNYLFIPNMVKLPYLVAALRLQGK
                     EQSTIVYVNSCLRAELVRLTLQLLGFPVCSLDSLLTQQHRLDNVASFKLGIARILVCT
                     DIAARGLDIPAVSLVLHYDVPKHAETYVHRVGRTARAGREGTSVALVTEYDVSLVQRI
                     EKKIGTTLTLWKSPAAKESAILSLLDEVSSAKIQARQQVTEQFGARVQTNKEHAARKK
                     VAAAAARAARSSRQRRQQQEQRLPSAEPNATASMADTASPTSLSGLKRARRSVTSAED
                     APTQAGVVAKKAKKGAAVRGLAADATASRRSATQQRPAKKSATGESDRSPSRKRVKEA
                     A"
     gene            <110835..>111821
                     /locus_tag="LMJF_05_0370"
                     /db_xref="GeneID:5648899"
     mRNA            <110835..>111821
                     /locus_tag="LMJF_05_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687462.1"
                     /db_xref="GeneID:5648899"
     CDS             110835..111821
                     /locus_tag="LMJF_05_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648899"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG5"
                     /translation="MPSDRVPSGDGFNNPYGNTTLVGNWLEDRLQQRIVHKRRGGAAA
                     TWCAQGIFEDPAVTMARHPAEAQAALLHSTYDVDYGHRPGRTQRTASGGVDNSAAAST
                     LMRGSKHNANAAGPGSASSTAKGGIDKVLLFSIDPVADPAAPLPLSTNADTYGAFYYG
                     NDNGSVDNNGARHAGSATGATTSSPADQGDGGATAPPADADRNLYDSVSRAVAAAAAP
                     SSSFRMPRAPMQRGANADATFSSSPVPRRHMLSLGVATTSTFGHTGWTLASSSATSAA
                     DHVGAAPWRPLQRHRLPNKDSMDDERWCSSKQAADTPVEHFTLQQRLPPVRM"
     gene            <113531..>118990
                     /locus_tag="LMJF_05_0380"
                     /db_xref="GeneID:5648900"
     mRNA            <113531..>118990
                     /locus_tag="LMJF_05_0380"
                     /product="putative microtubule-associated protein"
                     /transcript_id="XM_001687463.1"
                     /db_xref="GeneID:5648900"
     CDS             113531..118990
                     /locus_tag="LMJF_05_0380"
                     /codon_start=1
                     /product="putative microtubule-associated protein"
                     /protein_id="XP_001687515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648900"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG4"
                     /translation="MSGAVATFTNPRLLERPANERTEYEDAYQWRGLPEKPQDTHEDI
                     DNIHPSVNPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAY
                     KPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPHDPDAYRREQPTDDGEGY
                     ERVPVDPAMYNTTTKDAYKPHDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKP
                     HDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGNGYEK
                     VPVDPAMYNTTTKDAYKPHDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPHD
                     PDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPHDPDAYRREQPTDDGEGYEKVP
                     VDPAMYNTTTKDAYKPYDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPD
                     AYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVD
                     PAMYNTTTKDAYKPYDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAY
                     RREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYERVPVDPA
                     MYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPYDPDAYRR
                     EQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMY
                     NTTTKDAYKPYDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQ
                     PTDDGEGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYERVPVDPAMYNT
                     TTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPT
                     DDGEGYERVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYERVPVDPAMYNTTT
                     KDAYKPYDPDAYRREQPTDDGEGYERVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDD
                     GEGYERVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKD
                     AYKPYDPDAYRREQPTDDGNGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGE
                     GYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYERVPVDPAMYNTTTKDAY
                     KPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGY
                     ERVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKP
                     YDPDAYRREQPTDDGEGYERVPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEK
                     VPVDPAMYNTTTKDAYKPYDPDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPYD
                     PDAYRREQPTDDGEGYEKVPVDPAMYNTTTKDAYKPYDPDAYRRVVDEVPSELPVLAL
                     SDRAFSTPAETHVGGLAEGTAEATPSHVDVEQKPNPRMRRAQADPAFYESIYAKDYKP
                     AVPTAEAVPAPADVSEPAAEKPDPRRRRAQADPAFYESIYAKDYKPAVPTAEAVPAPA
                     DVSEPAAEKPDPRMRRAQADLSSYQSTYAKDYGCSDGAPASVVGKPVVPPLRIPSEGK
                     SNKKNGTARTSVRAPIAGRQKERSSVPAAKAHAPVSPPASAEEAPTKKTLPVAPAKTG
                     EPAEPRPRPKGSYETEYRKNYRAYSNKHTPVETPRRTQACVHHVDPAFYTTTCSAAYV
                     APAAAPARSAFTRPTVSVRHVDPSMYVSTSRAAYA"
     gene            <125122..>127281
                     /locus_tag="LMJF_05_0390"
                     /db_xref="GeneID:5648901"
     mRNA            <125122..>127281
                     /locus_tag="LMJF_05_0390"
                     /product="putative protein kinase"
                     /transcript_id="XM_001687464.1"
                     /db_xref="GeneID:5648901"
     CDS             125122..127281
                     /locus_tag="LMJF_05_0390"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001687516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648901"
                     /db_xref="GOA:Q4QJG3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG3"
                     /translation="MNSTINSKGASAAAAATAAVPLHGGDSHRMGAAATAGGSERANW
                     NNPSFVAAPRNSSGTINVDGYPPAQDHQQPSHPLLLSHSTDVDDAGNGAQHAAVNEPL
                     EYCGVRLLPGVEQIDFDEGYYVGTIDENGEMAGYGKATWHSGDTYEGEWLNGMMHGKG
                     TYTWADGDYYQGDYVRGRMEGRGEMKDATGLYTGEWADDMRQGYGRMLYAGGNVYEGE
                     WLAGMRHGSGKLVEPAAHVMYEGEFNRNEKEGRGVQTNSDGDVYEGEFARGKPNGRGT
                     YLWADGARYIGMFKDGVKHGDGCEWLANGDWVAGLFVDGEHVDSQSTLHKATVLTPDS
                     SDADGGSEDGAGDGGGGGSRGSIGLSESTAAAVLAPLDAAKLRRIADQVHAPSFSING
                     SATAMRSLRSSLRKNSSSNYQDFSGLGGVTIEEASSSFLRSLAAPQMLLDDSDLEGWT
                     PLKTIGKGSFGAVYTALLRNGRTVCCKVIELGTVESEEEMDKLRNEIALMRRLRHPNC
                     VQYYGSLEDKVKNTLNIFMEYVSGGTLTSFVTKFKSIPLETLRQWVYQMVCGVKYLHE
                     CGIVHRDIKGDNVLVSVDGIVKLADFGCSKAIDDVCSATHGCSTMVGTPYWMAPEVIK
                     CEAGGYGVKSDIWSIGCTIVEMLTGKPPWPECNSMWAAVYKIANSTGLPTEIPADIDP
                     KLMDLLQKCFERDPKLRPTAAGMLSHPFLAKVTEGVA"
     gene            <129427..>133059
                     /locus_tag="LMJF_05_0400"
                     /db_xref="GeneID:5648902"
     mRNA            <129427..>133059
                     /locus_tag="LMJF_05_0400"
                     /product="putative structural maintenance of chromosome
                     (SMC)"
                     /transcript_id="XM_001687465.1"
                     /db_xref="GeneID:5648902"
     CDS             129427..133059
                     /locus_tag="LMJF_05_0400"
                     /codon_start=1
                     /product="putative structural maintenance of chromosome
                     (SMC)"
                     /protein_id="XP_001687517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648902"
                     /db_xref="GOA:Q4QJG2"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG2"
                     /translation="MRVKSIVIDGFKSYAHRKELADLSPHFNAITGLNGSGKSNIFDA
                     ICFVMGITNLKRVRAEDPRELIFRAGTTGVHAARVTIEFVNDDPASAPPGYSCEEYPL
                     ITIGRQIKLGGRQQFFFNNTVSLQSKVKRFFESISLNVDNPHFMILQGTVHKLIGMRS
                     QDILSLIEEAVGTKAFDHRRRTAETLIRNKERKMEEIDTNIEAQIRPLLETMRADQEE
                     YNTFMQMREKMEEKVRFRVALDYHTHRTQHAEAEAAMTARKADVQNAKTQLQALPRQE
                     EEAARRLLQLQDSLSAPSEAAIALHEEEDELKKAHSRLEGQLGNCTKSLKQLETQLKS
                     LRKEQERQSSSQAAFAARQREHEQLLAQIKEGKETCAKLKKGLKLLRSGVQAGASGVS
                     LAEERQQVDLQLIEQQSRVRRATDRLEELVKQQRRVEAHQAEESSRVRHLEREYAKAT
                     ASLEKAKAVYTPLALKQQRKEALEAEISSLKRECQAEYENFQRQVSTATARNYDLDYN
                     RYACPPDTEDKVLGRVGQLITPTDPQHALGLMVGAQNQLLRVVVTDDRVAEAIIRSGL
                     RQRTAFFALDKLQRQPTHFFIDGAKLQAARLMAEQQGGWVHRARDLVTVQEASSHQQQ
                     QQLNALADFVFGNFLVCSSLRLAQELAYDASIKAKAVTVEGEVAEPNGLMTGGSTRQL
                     RDVFADLKTYTAQKEPLKALQQRTRALEVEYAALRDTLRQHQHDIQVYKTAEEAAELS
                     KQRYIVAANSAQSGAAEQAEQIEREQTALAEAREKVEVLQARQRELATQAQATDLNAV
                     QQEMADQLAAAEAHVARLTADEERGAAEFERLEADMEQQAADLSRKTQDTEEDMVQQQ
                     SQKLKLAAQVEEVTQQLAAVQARSKQNEERRQRLEKDIDDAQEELTRFAERKVTLDNL
                     VKNGEVGLREQSRCLESLRRHVHEAEQRHSWLLEARATFNQPGGPYDFSDAARTAAIL
                     QELRDIEVRAAVMTSKLSQKSAILYEERRREYEELVKQRTALGEDKEAIQRCITEIES
                     KKWGALDRMVGVVSSIFGKLFATCLPGATAQLLEERDAANHLSGLGVRVSFNGKPRES
                     LSELSGGQRSLLALCLILAILRVRPAPLYILDEVDAALDPSHTQNIGRMLQLYFPHSQ
                     FLLVSLKDGMFNNANVLYHIRNTQGYSEVARIEHKPPPQPTSADSDTRNVASGAENKD
                     AVASFA"
     gene            <134152..>136914
                     /locus_tag="LMJF_05_0410"
                     /db_xref="GeneID:5648903"
     mRNA            <134152..>136914
                     /locus_tag="LMJF_05_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687466.1"
                     /db_xref="GeneID:5648903"
     CDS             134152..136914
                     /locus_tag="LMJF_05_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648903"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG1"
                     /translation="MSATPPPPPPPSSNASTGYPHTRASPGTYRGAGRGAYSRGPSYQ
                     SSGSSPSSSPIYTSGPSRRGGGNTRVRVHTYGFVHADPAASLAAAPPASHTSAPRATP
                     DVATPPLPSASSAASPPLSSISSDVLSSLNASVQESLSGYLYTDAIELAQRLFDLEAS
                     YAHLHLLAHCYTVSGATGTAYRLLQHYYPFLELHVTRPRTAGASTSAAGGAAGGVGSG
                     VLPFDARRTWTASYGVHPSQHPFSSGMPSATAAVTFSASSNENNLTSDEFELGYETVD
                     LQSQWDCQYLLGVCCYRTQHYEDGARVLSQLLYVCHQVTTTSSVLRRRLQQLRQQQQQ
                     VTVRSDTSEEDDAGVAAAVRATERQLRACAFVTEARTSQVLYWLGLCEKHRQRHPIAA
                     EHLRRAYVANPLRLDAFQEYVHLAWPSEQVVQSLLAVKTSLIEEEDGAEVDVTEPPQQ
                     RQRPPQRRGRDATDIAVDVDADADDEEQRAPCSAAAVAALASGSGGSHSAASVSPHAT
                     QLVRTGPSAVTLLAPRLTAQQRRCAQQHLRPFLHAAFLGITYRCPEAVEALHALLAQE
                     QQQQRAAAAALGSASSPTVASLHGSARAVMVRSSSSSSAPLWKNQGGGSATAGAVAST
                     TSPWLLRQLALAHFHNGDIQESADAFEQLLRTAPWELTNPALIFYSTALWHLKSESAL
                     GSLAQRLTDAEPLSATTLCVVANAYSLIKDPRDALVMLKRAVQVAPTLAYAHALHGYE
                     LLGQDSKAEAEAEFKAALAVDASLYIAYAGLGERFMREEQIDKARGYYKEAVKLNPTP
                     AIVNRFALTYHRQGKSLADLKTALRLYTESLERHPNNVTARRQRADVLLRLDQPMQAL
                     EELKALLVQCPGEAVVYVTLAECMVCLRRPHEALQHYQTAMHLDPRRESYVQGCIDQL
                     VAANML"
     gene            <137768..>138103
                     /locus_tag="LMJF_05_0420"
                     /db_xref="GeneID:5648904"
     mRNA            <137768..>138103
                     /locus_tag="LMJF_05_0420"
                     /product="putative dynein-light chain-protein"
                     /transcript_id="XM_001687467.1"
                     /db_xref="GeneID:5648904"
     CDS             137768..138103
                     /locus_tag="LMJF_05_0420"
                     /codon_start=1
                     /product="putative dynein-light chain-protein"
                     /protein_id="XP_001687519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648904"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:Q4QJG0"
                     /translation="MASGDRITLVDDASVICEDVVNALFSHETRYQHSKIAGLVSAIS
                     DQVVQRLTQEAKLPRKYVVLVTILQKNGAGVQTISSCSWNPTSDACYVYKAENKAMHC
                     IITVYGVTV"
     gene            <140803..>142824
                     /locus_tag="LMJF_05_0430"
                     /db_xref="GeneID:5648905"
     mRNA            <140803..>142824
                     /locus_tag="LMJF_05_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687468.1"
                     /db_xref="GeneID:5648905"
     CDS             140803..142824
                     /locus_tag="LMJF_05_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648905"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF9"
                     /translation="MLRRGLWRYRRISYVTDVEGDFAYFQRFVCLSRVLRWEPAEAAV
                     SANPPHPSAGSSNGSRAANDRWAPLSSVAPTAPSGEFPASDAAANTQALHTTTTTAAT
                     AAYEPGYCRLVDLSRYRLGFQDATSHFVFGGDAFDHGSDITFGKALLDFKRRFPSRVH
                     LLLGNRDVNKMAMYPRMACEVAGMTPDAAENAVFTLLPPSTKTVRATSMATALRYRDF
                     LLEQRQREESQRQGGAGHAASSPCGGTSSDSSGDTLRADAVSFLQWALQYKLGGPNAF
                     AHRRQELREMAAMMTEGCGAVTAAPPAAGAEAMRDGIAYDEDAVVAASFFTAAQPGGV
                     YYEYIRVGVLSVVLDGILFVHGGVNTSNAGFVPSLEATSYAEQVTAGQWWLPEVAPQE
                     VATTPTATSATGWLAALERFKAAAFSDWVNGAALRGEALRAYVYPRFVAPHSIAVGTV
                     MNVDGPHYIPLTVVAYLLQSGIHTVCGGHQPVGDTPAIIRQPGGFTIIDADNSYCGRG
                     NKFCTRFNRRGAAVMELLFEHPDDHGGDENVAPHDAVAAPSLTVHGYRADGAPFEFDA
                     YSDWRVGRYVGDGWWVRLPPEATAATSSLSFSGSEAAHAGLYELRRTQDGFRHEETRW
                     ATAAEVDAWLRQAAASGKATVPGELAPRHTKEELAEVLAHRLKTKVKRT"
     gene            <143271..>145835
                     /locus_tag="LMJF_05_0440"
                     /db_xref="GeneID:5648906"
     mRNA            <143271..>145835
                     /locus_tag="LMJF_05_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687469.1"
                     /db_xref="GeneID:5648906"
     CDS             143271..145835
                     /locus_tag="LMJF_05_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648906"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF8"
                     /translation="MSSTWLHALRAYAARTNATPASLAARCRLFDQLCAVQLRGLPSA
                     QLHPDALPVLREARWSLLREGTTADKAELLEHIVRQYAQASEKAMYAAPTASCSLDGI
                     RGSADAQRQQPGKTSNHTRSLQDRSPQHATRSGTSGSLLSGVQLSEMSVLQQLLLEQV
                     QCLVEAKVSDIPLSARHYRYPMRSPLLATVSPELPLLLLEELTQQSTAVSSSSSSSSS
                     AQSNIDWEARVDCCVGLVAAGHVQEALALCSDDGSTFRTVMHRVVPLRRDGWRCAWAL
                     ADAAPLSRVLDDATAAAGGTASLHWLRGVLEAVDMRHRAAVGARQVSDSANAERNHVF
                     EWVDRLRRLIVPSSKVALAGAEGQQQRVSATALRLIMDTYLSVCPASRWRDAVGAVLE
                     LAAATDEASAVAQAAAEGNCCADAVTMGRLMSILKAAEQPWMVLLFFYGDSLALQVAS
                     SRSRNDSSPKQPDSDAPARWQVSDKSVQAKVEECVRAARDADRLTVATGTILNERDKR
                     HAAIYNHAMVALAATGHHTEAMHFYRTLPILLVNCYTHWSVLQLFLQPTRDSRAVSAL
                     RSSENYNHCARALRHLIRMSTADSKAAHAHTQVNGNNGSVHPATPIRCTRDQGGVWES
                     MILWAALRRDTETVDLCATHAPAVSRYAHLIALLSAAASRGDGWSAAQAQVRHMCAAP
                     RTTLKELSLATAAMASFFPRWPAGTTAAELPVRAELFDEVARSMAPLVGRSQSRMDEM
                     LELLVGYSVSLRRRRRMPLTPQDEAAALDDILVKENILANTMDLARPRAGYASDVDRA
                     HHSCDNGAADDSGAWRTVVHVMTSVAERQGLSAARAAPALVSAGVPAEMAIDLLPT"
     gene            <147201..>147791
                     /locus_tag="LMJF_05_0450"
                     /db_xref="GeneID:5648907"
     mRNA            <147201..>147791
                     /locus_tag="LMJF_05_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687470.1"
                     /db_xref="GeneID:5648907"
     CDS             147201..147791
                     /locus_tag="LMJF_05_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648907"
                     /db_xref="GOA:Q4QJF7"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF7"
                     /translation="MADEGAIDIRLVLKGPNGEFKVDRDLYIIVHCDDGKYIEVSKNY
                     IKQCPFIEEAEGEIPEFGYPAAVLEHLIRWAVHYGVDGHAASQLTRPCIYRDFSYVVT
                     DKWDNDFFNQRLCSPLNQKHYLLTMTAAEQFGMQGLLDFMCIGLGCKLRGKDDNGIIH
                     EVMGLDKEMEITSEDLAEVSRDYPWFDDAVKATTKK"
     gene            <148684..>150567
                     /locus_tag="LMJF_05_0460"
                     /db_xref="GeneID:5648908"
     mRNA            <148684..>150567
                     /locus_tag="LMJF_05_0460"
                     /product="putative GTPase"
                     /transcript_id="XM_001687471.1"
                     /db_xref="GeneID:5648908"
     CDS             148684..150567
                     /locus_tag="LMJF_05_0460"
                     /EC_number="3.6.5.1"
                     /codon_start=1
                     /product="putative GTPase"
                     /protein_id="XP_001687523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648908"
                     /db_xref="GOA:Q4QJF6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF6"
                     /translation="MGKPGKKAGKGLLAPTNPNRRTDPNKTSLRDQRTIKRLKMYKSK
                     IKRDEKGNIIKGSVLKASDRIEQQMARIAPDRRWFGNTRTIGQEALQKFREEMGTKYK
                     DPYSVIIKQSKLPLSLLEEPKNTDGSIRKEMEWDKTFGDKANRKRVRLNAVDMSTLAT
                     EANVKGDYYDCNKKEKDRDLMKGVHKDRDDKTRNGILMTKGQSNRIWCELYKVIDSSD
                     VVLYVVDARDPMGTRSAFLEDFMRREKKYKHFVLVLNKCDLVPLWATARWLQILSKDY
                     PTIAFHASVNHPFGKGNVISLLRQFARLHNVTHRGSKRTKTPISVGVIGYPNVGKSSL
                     INTLRRKSVCKVAPIPGETKVWQYVALTRSIFLIDCPGVVYDRESNNDIQAVLKGVVR
                     VERLGNADKTDVVDTVLKIVKQRDIVATYGVREWRDVVDFLEKLAKLRGKLVAGGEPD
                     VEAAARMLLYDWQRGRLPWFNAPPFESNKHHRDAMEQPQEKHMKLIEHYSTFNVVDDT
                     INRGDEKQDEGGDGDEETANNAADEDQLDSGSEAEKDEEAVKPLKPSKTDRLSATKAD
                     TQLATVATYMREQEEKQRKAQRQQKRKAARKGQEDVEAFSADADRESDDALWAQFLAA
                     AKV"
     gene            <151870..>152901
                     /locus_tag="LMJF_05_0470"
                     /db_xref="GeneID:5648909"
     mRNA            <151870..>152901
                     /locus_tag="LMJF_05_0470"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687472.1"
                     /db_xref="GeneID:5648909"
     CDS             151870..152901
                     /locus_tag="LMJF_05_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648909"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF5"
                     /translation="MHIYCSRVCAHGDVARHSPCAAYGTRSWPFLSFAPSSTLVRFSL
                     VCSASPCACRLLGALVDTTIRRCDIDNLKNVETGERRGTTQGLRRLPFFCIWHVCAMT
                     SNATLPHAVALAQELEIELRHLDALQQHYAQLLVHQLSSLDFLSEGDAATMVAAKEPT
                     TVHNGGHVAAEAEVVAVATTCIKQPSAAPLPWRHHAHDAARVRQPPFRHSACPVPSTI
                     SSSSSPLPQPLAATRVPPPLPPQPKRSGRSAVKSVTPRPNADKTCNDLPRQQPHVAAA
                     PVVPVSAKDEAARRARRALRFIREERDAYFNAKARRAEELLREGREAARKNRARRQAD
                     MAQALPKAA"
     gene            <153920..>155644
                     /locus_tag="LMJF_05_0480"
                     /db_xref="GeneID:5648910"
     mRNA            <153920..>155644
                     /locus_tag="LMJF_05_0480"
                     /product="monocarboxylate transporter-like protein"
                     /transcript_id="XM_001687473.1"
                     /db_xref="GeneID:5648910"
     CDS             153920..155644
                     /locus_tag="LMJF_05_0480"
                     /codon_start=1
                     /product="monocarboxylate transporter-like protein"
                     /protein_id="XP_001687525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648910"
                     /db_xref="GOA:Q4QJF4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF4"
                     /translation="MQIYEACKKADRAVTHRPADHWIGYLVAVSGALMQMMSYGIDNS
                     FSIFSNSMQNDPSLGYPSATTVSFGNSVSLGLSPVFGILAGFLVDRVPPRVMMFTSTV
                     MLFAALWLSSSFAKSSAEVTASYSLLASISSALMLSPGAAATGSWFRRRLGLGQGINF
                     CGGGVGSAVVPAVLGSLVDVYGWRHTFRLMSAFCAIGLVATILSCRRHPIEDDVDVDD
                     HARGNNSPAREPSPDDCTAHRSPSHEERNEMMRMITSEAGENAAASPTTRMIDSMRTE
                     AEKAANRNSGDTITKGGKPDAAASARAALASPDGSDDMSMLLGRHQQQPQQLAQYGRK
                     VHGTEACTVADLIQDMHARRLTWGEMMRVFLSVRFLTHFFMFAIYGWSFYGLIYVAVP
                     YVSSMGSAGTVYAGVTPISTSKASTVFTFWGVFQIVGSILVGGVASFTDDALAYTMCA
                     TVGGLATSLLVFCRSYAAFAVCLSVVGFCTAGIFAMMPALIAKDFHGPNLGFVMGCVF
                     VAGCLGGFSAPPIQAQLQTRYNGNYSYGCVFISCCTTFPGVLCYLLLWPAKQTRVGRV
                     FTRVVRQA"
     gene            <159146..>159925
                     /locus_tag="LMJF_05_0490"
                     /db_xref="GeneID:5648911"
     mRNA            <159146..>159925
                     /locus_tag="LMJF_05_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687474.1"
                     /db_xref="GeneID:5648911"
     CDS             159146..159925
                     /locus_tag="LMJF_05_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648911"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF3"
                     /translation="MPPAPAPPFSSVSQCLSALLPPTAFSLLPLTHTHTHTHTHRTCT
                     HIIFSEPHIVFYCVCPFTRCHRRRPLPSPLSLSLPQHTTLSTAINKHEAEVVLDWSMS
                     RLARALAKPFTVPVAMCTRHVAAMDEPLKRHIDAYAARGEDITIAVWREYVDGQRALL
                     PYRWTKFRSEVAYLTSGQMAITDLTFADLLVFIRFLTKCLFIFIVAVMVGRRSVFPSL
                     EPTSPFVEEIVKNWQPNRLHGVAGAEYMACDQAAAAGYGHR"
     gene            <162152..>163876
                     /locus_tag="LMJF_05_0500"
                     /db_xref="GeneID:5648912"
     mRNA            <162152..>163876
                     /locus_tag="LMJF_05_0500"
                     /product="ATPase alpha subunit"
                     /transcript_id="XM_001687475.1"
                     /db_xref="GeneID:5648912"
     CDS             162152..163876
                     /locus_tag="LMJF_05_0500"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="ATPase alpha subunit"
                     /protein_id="XP_001687527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0500"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648912"
                     /db_xref="GOA:Q4QJF1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF1"
                     /translation="MRRFVAQYVAPAMGRLASTAAAGKSAAPGQKSFFKATEMIGYVH
                     SIDGTIATLIPAPGNPGVAYNTIIMIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEV
                     QSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLESEQTLGKVDAGA
                     PNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQ
                     QILSKNAVISIYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYS
                     GVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLE
                     RAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQRPAV
                     NIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVA
                     LFNQKNPSFFMNALVSLYACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFY
                     MYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQSKMNAIKTEKEIKALKNL
                     LYSCKRAV"
     gene            <165296..>167020
                     /locus_tag="LMJF_05_0510"
                     /db_xref="GeneID:5648913"
     mRNA            <165296..>167020
                     /locus_tag="LMJF_05_0510"
                     /product="ATPase alpha subunit"
                     /transcript_id="XM_001687476.1"
                     /db_xref="GeneID:5648913"
     CDS             165296..167020
                     /locus_tag="LMJF_05_0510"
                     /codon_start=1
                     /product="ATPase alpha subunit"
                     /protein_id="XP_001687528.1"
                     /db_xref="GeneID:5648913"
                     /db_xref="GOA:Q4QJF1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF1"
                     /translation="MRRFVAQYVAPAMGRLASTAAAGKSAAPGQKSFFKATEMIGYVH
                     SIDGTIATLIPAPGNPGVAYNTIIMIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEV
                     QSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLESEQTLGKVDAGA
                     PNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQ
                     QILSKNAVISIYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYS
                     GVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLE
                     RAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQRPAV
                     NIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVA
                     LFNQKNPSFFMNALVSLYACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFY
                     MYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQSKMNAIKTEKEIKALKNL
                     LYSCKRAV"
     gene            <169900..>170922
                     /locus_tag="LMJF_05_0520"
                     /db_xref="GeneID:5648914"
     mRNA            <169900..>170922
                     /locus_tag="LMJF_05_0520"
                     /product="nuclear receptor binding factor-like protein"
                     /transcript_id="XM_001687477.1"
                     /db_xref="GeneID:5648914"
     CDS             169900..170922
                     /locus_tag="LMJF_05_0520"
                     /codon_start=1
                     /product="nuclear receptor binding factor-like protein"
                     /protein_id="XP_001687529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648914"
                     /db_xref="GOA:Q4QJF0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QJF0"
                     /translation="MSKVASAGWRYARCGPISRVLTYEMFDITPGKEEAVVQMATAPL
                     HRVDAAVVNGTALGRKRVNMASFPRIGGCEGVGKVVRAPAAAAATSSPVKEGDTVWVA
                     PLHGTWATNIAVPVSQLHKIDPRQAEMAATASNFLVAQQLLDGYARLQKGDIVIQNGG
                     SSLTSLAVSALAKAYGVKVLTAATPGARFADAKQRHAKYGSDVFEYNGTGSRAMQAAV
                     GRRGAALYLNGVGGSYFDSLLKCVGPMAHVVTYGAQNSFGLFISGSGLIYNEVTMAGL
                     FAPTFLNSMSHGERQIKLEFVLKAVQEAGLAYPMVTAPSLEKLPEVWDEVYVNGGRKA
                     VVKMTA"
     gene            <171745..>177930
                     /locus_tag="LMJF_05_0530"
                     /db_xref="GeneID:5648915"
     mRNA            <171745..>177930
                     /locus_tag="LMJF_05_0530"
                     /product="kinetoplast-associated protein-like protein"
                     /transcript_id="XM_001687478.1"
                     /db_xref="GeneID:5648915"
     CDS             171745..177930
                     /locus_tag="LMJF_05_0530"
                     /codon_start=1
                     /product="kinetoplast-associated protein-like protein"
                     /protein_id="XP_001687530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648915"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE9"
                     /translation="MQPRLVLPSSQPLRISAQHPVRSSSTAPSSSSAAARPRALHGVS
                     IDSAQAPNVAAVAVATPLPPPSSSSRLLQEIEETRKLLRTFRSLKERGASRAELADLH
                     LRVKALKAAQQRQQPNSGACKAATLPLAASTTADAEAAVATAAARPSLACSPEPAPPL
                     SCTHRHAGVTLHEGEAGWTTGSSHSLHQPQQRGVEEAHVAHCDGRLPEGRHHHHHRHR
                     HHDVRVDRAASLSISTKLSKAAAQGSTAVRNGAINAVSSGSAGICSAVTLQPGTASAV
                     PGSLVQINSIVFAIALAEAHTRRDIAQRWERRWLRHWANFKEERIAIALRPPTTTTAA
                     LSRPQGQLERWAEAAPMALPREWQQWHQAVSTATATVEGSSVATTTAARTVGACPAPV
                     PGKSVREAFAATTSSPAVVGLQETPSLSAGHRSGEEARHGAEEQEETIPDVDDTAVDK
                     DSVVWTSPPPQHQQHPAPPATERDLEASACAAADATAEAAAAVRNVEDEEVAARTATE
                     SAAAEARKRIELAEVTARLRAEEAREALQSLMAAEAGARVTLEGDEARLRISHVAAER
                     DGAQRVALAAAEAESRRRAQEEQVRQEAAARAAAAKREEEKEREAAARRAAEAQLQAA
                     ADIEAAERRSVEQQWQEAVRLSESLLSERIKDAVAAAPPLAHSKGIRAPKRPLCDELA
                     MMEDAQAGETADAQACLRERQQAAEQCLVAFGAAADAVLGEWISAAATVAEQAASVEA
                     ARRRKAEEAAAQAKAVVQERASAAEAARAAVARTEDEGRVALAASEEEVWQRLQLQHG
                     ADVEAARLAALAAEGKAARHRAEEEAAAMTATLCSVVAELSKNLVDGCVAEAARQVSE
                     GVEADAVEELQMQRRERVEGEEALARDDMYGNALDELTRLREDEAAAEVRKRMEVEAV
                     AAAKEQQQRVQAAAQYFQISELSEALLLEFLHDAASAAVAASTATVANGCLAETSPLA
                     ALPEGEEGAASAVMEDGQQQQQHHHHHPSADDAAEELDARAEQRQGGGVDSPDKANVD
                     TSAPEAVAATASLSLSPSSSAGPSSFFVESVSADATPKAVTTGVPQGHAVEGVGLLSP
                     TVFVHVVDGLLSDVLRDAAMEAQRGGAGAVGAISEVIASRTQAGQRAREHRKPLPNGS
                     EASFVSVDHGSSHSTLGCSPPWEPQPKPLELPLALVVRDAAGDRVPQVQYTGGELNDC
                     AEADVVVGGAGNVTAFLAEVADAGKCTPHQRIVSPLLIPSMDVVTASTSSISTASVTD
                     RRGRGCARGAAGATATASSPLHCFSTASSVDDDDDAACSSLTAPGAPRPLNLLQHSVL
                     SPLLCQQHGGNGGVHNDGGEASTPAGSEAAAGTTTVAALADRASLSENSRARPQLPES
                     TGTGDRDATSDADGMWSAVVTMNHSVMEITEDLRAFQLDAPPPAHDVAEQRAGVRIAA
                     HDALTADAMAAVADSLEQRAVHDASLLFDSRGQSAVPNTDSDRQESHDAVKVDHAAAP
                     PFLFASAQSHEQSTVEGKSSGSGSGGGTSSSTCAGDVEAHAEKRVSIAEMGSGFTSGD
                     AREATLRATRSLSPAAAAVAAEGIAGSHAPLSNLSTLVSAVAAPNDFVARLRQQEEEK
                     KVAAHQQNRYLTSRELALVAARYLTSEAAAADVMEVGPTTMLSSRAVALVLSVGLVRA
                     STLENRRARSRMVKAEKGDGSSARSDGGTAGGGVLVGENGLQKLTPGGGADSAMMDSP
                     DAPHPPIGGGGDGGGFPTGIIGEAGAAGDDECVDVQLVSPTARGRSRGGDLSMPEPTA
                     SSVVGDVAHASGDVKGTNMSGGPTGLGSRPLSPRSSSIRSASQPTAAGGGKGALAANP
                     AQQQAGVRDKLPADWATALRGVAERVARDFIDYASRCVLLGQGEGQSNQDHLRTARRI
                     HIDALAYVDVQALFTQELQPRDVERLTSYYVELATNGPRDRVDPLCAPAALGEHNIFG
                     HRSSVRNEDIASFDNLDTASTTVFVPPTRPGPLFASPHLLPSSKNRLLSAATSIHVRR
                     AGLLHLVLEQCVSNVLHDLVGDTVGWLWTACLQAAPPGAAPNGTQ"
     gene            <178561..>178968
                     /locus_tag="LMJF_05_0540"
                     /db_xref="GeneID:5648916"
     mRNA            <178561..>178968
                     /locus_tag="LMJF_05_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687479.1"
                     /db_xref="GeneID:5648916"
     CDS             178561..178968
                     /locus_tag="LMJF_05_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648916"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE8"
                     /translation="MDSSAGDDAGVVLSNSVAKAPGVGTSSSSAPTDPFKYLAEHIHK
                     RVAISLLPVDDDDDGAVVRGTLLSVDDLCNVMLQHWSSTGATRLDSSIGNGRQQQQPR
                     KRARLDAAGGEDAEESVRLIRGAQIVSISLLPA"
     gene            <180374..>181333
                     /locus_tag="LMJF_05_0550"
                     /db_xref="GeneID:5648917"
     mRNA            <180374..>181333
                     /locus_tag="LMJF_05_0550"
                     /product="putative cdc2-related kinase"
                     /transcript_id="XM_001687480.1"
                     /db_xref="GeneID:5648917"
     CDS             180374..181333
                     /locus_tag="LMJF_05_0550"
                     /codon_start=1
                     /product="putative cdc2-related kinase"
                     /protein_id="XP_001687532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648917"
                     /db_xref="GOA:Q4QJE7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE7"
                     /translation="MRSSGPTPARPTGFQRYQRQHKVGEGSYGKVFLCTDVVEGGTVA
                     VKTSQWNSGEEGLSVSSIREVSLLKEIRHPNVVRLLDLFTEEKKLCIVFERMEKDLRS
                     VLSTRQTPIVGRKLKHMMYQLLSALHACHSRRVVHRDIKPGNILVSADEQTVKLADFG
                     MGRAFGLALQSYTYRIATLYYRAPEVLLGDRYYLPSVDMWSMGCVMAELALRRALFRG
                     EGEYSQLITIFGIMGTPSERVWPGVSRLPHYNAEFPSWVPTSLEKYIPTLDPEGIALL
                     KAMLRYDPQRRITALQAMQHPFFDDVRDECEARLQQQQQQQQS"
     gene            <182725..>183981
                     /locus_tag="LMJF_05_0560"
                     /db_xref="GeneID:5648918"
     mRNA            <182725..>183981
                     /locus_tag="LMJF_05_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687481.2"
                     /db_xref="GeneID:5648918"
     CDS             182725..183981
                     /locus_tag="LMJF_05_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687533.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648918"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE6"
                     /translation="MALIASCNALYFPREPRDNILKVRWNAQDTPLEPNTSVIFKIKC
                     TAPHLFHAMPRYGALLLADATGAVTPSSSQTTTITFSLRESQGGGAGDISPTGVSRQT
                     ASTTTRTSRASSATPGGPAYQERFAIEYVMIKSEPLAFQQISSSVADAARLTEVVKNM
                     WSLVASSAIPRAHLGVQAGINLKVYMENVVLQPSDPAPSGGDEATKIVVPPEACLVLP
                     MASERRCRSVHDVTRPGRSRPALDPSPRLYSGGDGADHLGGTSSVFRRKPTDELRALR
                     EEINTMRRESTTPHSAVGGSVRNSSSPSSNTPNSKPRGHEGAAAMQPLPAHRAAGTSS
                     YENLIMKFDLGGAASRAGDPAAQKEGLKVYIVLLLMVALYVCLLFMRRGATHAEGVKN
                     GSGNRAEAAEERYAVQLSSREVQMRK"
     gene            <185699..>186931
                     /locus_tag="LMJF_05_0570"
                     /db_xref="GeneID:5648919"
     mRNA            <185699..>186931
                     /locus_tag="LMJF_05_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687482.1"
                     /db_xref="GeneID:5648919"
     CDS             185699..186931
                     /locus_tag="LMJF_05_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648919"
                     /db_xref="GOA:Q4QJE5"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE5"
                     /translation="MRSGTSARAPFTHGVAGRAIKTRVKSNLGQPYAQRFYNNVWTYR
                     VAQLTTSNVRSMRKARIAVGFDSGVGGGHGGGASSQDGNDGSGSGAELPVKSDLQPHA
                     LHKFTGEEDWSIVLAVPKSSEHVRNLQDCAKGSLMLGHTDPQLFHWFKELGVLPPRSL
                     LSGPMELLRGDLQVEAWEHTFSRHPVIHRIAQDMWESDESKTAEEVVHIAKREQEEDE
                     KRMRRMSSSDWRTKFRDRERNPTPAEDEEAPVYVIKPETFSLFRMKPDVRLWMNVAGQ
                     TQRVWDPVVPDPDPLSRCSHRFIRMLNLGRQKLVPSLNMNYSLKLTNAFIFEIDDRGL
                     WAMGTQENLADKNGVVKEEWMELRLDFGKNQVITTEQEMEWWVRGLTKLGAPELSQTS
                     SSVEDAGLNPEDFEYRHI"
     gene            <188040..>190394
                     /locus_tag="LMJF_05_0580"
                     /db_xref="GeneID:5648920"
     mRNA            <188040..>190394
                     /locus_tag="LMJF_05_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687483.1"
                     /db_xref="GeneID:5648920"
     CDS             188040..190394
                     /locus_tag="LMJF_05_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648920"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE4"
                     /translation="MEHSVSSRSPSGQWYPQQQQQQQPPAFRRNNSQQQLQWSPVSGT
                     ATPMVMVGGGQPTAMPAGTGSAMLGNSGMLSSGSANLCGQPHLHSGMTPQQQMMIMQS
                     MYTPQSQCCAPCCGTQECSFCPRPGEPVDPFCCTPRRPDQEVRWWESIYKYFDWTFFL
                     ACVLCVLTIIGFAMVMVTKNQDNIFAAFGVHNATDLDVAMMPYIRWMNTKPTIPVDNR
                     KGVPSNAMRAVVTALSTSPEYAVEAAASESSIPAAILVPAHSCTRRRLFGSFGELCME
                     DNMYANTFAVQLSFWNDARDTLWILAMVYSFLTVLYAVLINVRRHASGASVEVARGSS
                     FMLPSITPQQQEEFVKMTPQQQQAFIQEFQQQVAMMQQQNPSAVFPSQQQPGVGCCGS
                     DRGIEFYETPFYEFVRFAWLFSGLTTFAWTCNLFISFWSFSYFYIRETTGPLNTFWTV
                     YTHKMEATLIVVTVFLAWPLCNFVLELIVLVALVLPWLVIRSTWKRGIQMYRPALPPS
                     QLPAYIRADMFFMDFQDVKRLGFSRLAWIILTDSEKPFFEGCEDPTVDKDPAMTQLMQ
                     QRVQWRQMMASMLPPWIQSPQQQMSVMGPGGAGMMMPGQVAPQQRQFDFSGAATPPAN
                     SSMQSPAQYPAEDGEHRSHKRRRHHSTRDRRHADPLGAASMEETSAGLGATGKENSTR
                     HRHRRDSHHRNHSRSRSRSRGVFDGGVSQPPVSDAAVENGAGHTADGASRRRHRRSHS
                     RSHSRAAAGDDPSALVVAAPRSMGDAAQNGGAAAAADLDSLMQL"
     gene            <193054..>196071
                     /locus_tag="LMJF_05_0590"
                     /db_xref="GeneID:5648921"
     mRNA            <193054..>196071
                     /locus_tag="LMJF_05_0590"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001687484.1"
                     /db_xref="GeneID:5648921"
     CDS             193054..196071
                     /locus_tag="LMJF_05_0590"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001687536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648921"
                     /db_xref="GOA:Q4QJE3"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE3"
                     /translation="MQPHPSWRVYVGDDVDTGGTGAAAAAAADQTNTHASSNMEEDAA
                     RLLDSAFARRARYTLQTLPARIRQQPSAAPSPVLRWLLQHGVVEGQRKKEQAGTAPSA
                     TDKPSATPAPVLSPAVAATSGCVSAAAAAATSALARRGVGPKDPLVQRLLKKQQKAAS
                     SASAATSATSAVPSNATNATASTVISGSTRAPMSSASHWTQRPFSAMTSTSWKVFRQQ
                     LGITVELVAPTQPPTETSGPSAAQPGTFVKTLPPADTLPAIRCWEEAQLPFSLGRCVT
                     RAYALPTAVQAQCVPLALLPRPAPLVAGAKSGGVAGAATAAVLGMDILAVAETGSGKT
                     AAYLVPLLYHVLCRAPKLLGHPDRISLGPLSLVIVPTRELAEQVTASFLQLCGQAPAA
                     SMYSSGGGYISQDTIRAWETHESDVSGASGHDRASSVAAAGAARNYLSELRVVKVVGG
                     ESRDAQYAALARGAHCVVGTVGQLQMLLADRLLSLGNTQLVVMDEADRMIDEQQEERL
                     TAVLERCPQPRQTVMFTATLSVACAAVAKQYLAKTGYYLVRTPYRCASIRQSFELVAD
                     TGSLATGAAEDPVTAAAVAATATAEGRKKKPSRQQGHTEKGEPQPPQRQRLLHPLIHA
                     QKFVRLVAWLVYGTGPIIVFANEKSTCDALWEELRAEAERLDAQQEYYTIEDLVGPPP
                     DGLSFREDTAGGQEATSSSAAARRTPTLANLTSVAVVHSELSQTERRSLVAQFQRRQR
                     HVLITTDLLARGLDVAGVTLVINYDVPWAASASPSDAVTLYIHRIGRTGRAGSTGVAV
                     TFVTLPAAMVQRAEEVAREEARDAAPKQPEGRAKPPRAPPRVYGDEDDDLAALGELFD
                     GDTRNVCMAGAAALSTTASDNASGRRRRRGDDDSDDTEMDSSNDGDDDDEDANKEGTT
                     GNTSNTANHNGNGMRKPPRMRRKRSAATFASDAAVLRPLWSFLVECAEGEGCRDGAAA
                     LRRGTYAKVSVPPALGCVMAQLSATSPYGRITL"
     gene            <196696..>199404
                     /locus_tag="LMJF_05_0600"
                     /db_xref="GeneID:5648922"
     mRNA            <196696..>199404
                     /locus_tag="LMJF_05_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687485.1"
                     /db_xref="GeneID:5648922"
     CDS             196696..199404
                     /locus_tag="LMJF_05_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648922"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE2"
                     /translation="MLLKHIDNVEERFDQALQRVRDGVRRRDAALNDIRQSIHAESEL
                     HAPLREISNVQYRLMPQYVHRSAALARTVAANASLAERSSKRVRRLDALLQRVQQTCA
                     IVDAMKAMENDVAQMSSVLDSGDIDKILQLLHSYEAAQRVLASASPATAVAVEAKASE
                     VGTGGGASLSAAGAASNATSVSDVMRHARATVQARLLKMIEDAVQVNDKLAIMKGTKL
                     LAELGEGAVASQLYSDWIADHTIAALAKLIDSEMRKMEDSATVAMTHLALVSQCLDNV
                     AAAFESDEEFTYEAFGAQGPLALLAKLHSRATARCVPVLSDFIERRKDVLTQLEKHAS
                     AGDGASGASRASTPSMNAAAGANANAVVASARRADQILEEISHMVSCGHIYLTFVERK
                     QTEYEKRMKAAGAAAAAESGREESTSMAAAGEVVAGSTADNLWRTSDNALLNSMQDIL
                     GVYVPLQTTYFTIAYDQAVDLQLRAIRDAAKEAAAAAARAGGGDASRTAAGARHGNAS
                     AALLSTPSAATFMSGLQNLYMVAASSADDLIASVGVGGGSASVAGGGASAAASEELAS
                     FWYFTHNGQVTLPDDVFFVLRMAIHRAMNTKSAQICSAAVMSAMDVVQLRLLPEIESH
                     TVIAGAGSHAGVGGAASNSSAAGGRRRAGAAPRGGFLTPDELHWTGAAQRTATYLQRM
                     ADELQQLGEATFSATPHDVTRFRELAGNMRTLGRTLQDKLIPAWLDAFADVCCDSVLP
                     QHMERFAAVSYDMKEAVYSHYELNDVWVQACLVDLGAGLQYLHQHLADAKLFDALLTA
                     MARRVAKWACSVLLRKRVSLFGALQVDKDVRALRSFFVERTQTDLTPIRDAFAVLNLM
                     ATLLLSDKPTDALEEAANTALTADEKKKVLLTRVEFRKEAVMALPL"
     gene            <200300..>203083
                     /locus_tag="LMJF_05_0610"
                     /db_xref="GeneID:5648923"
     mRNA            <200300..>203083
                     /locus_tag="LMJF_05_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687486.1"
                     /db_xref="GeneID:5648923"
     CDS             200300..203083
                     /locus_tag="LMJF_05_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648923"
                     /db_xref="GOA:Q4QJE1"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE1"
                     /translation="MLLFGSAHQPANKPADGPSGGNTGASPYMMFKPAYAQQQQGVLG
                     SVLPDEKAVAAAGWSSGSVFPAPDASYSQPLPRLLPPPYVNTASPRPPFTAASLGILG
                     PGTTVEGVSAPPSTSAYSPPATAAESATGVPVKVAASTDVLEVPLHAPRLRVPTNLPL
                     EQTTLLDLLATAVVQGGPTTEEEIVKREMGRGNPAFAFLGEKFNHPCMLYYRWRLYSL
                     LQGDTLVSWRTQPFQIEEARRAYVWVPPPPLKVGPECLVGLHQPELLDPAFATGSSGD
                     AAATVGGAEEEDGADVIVRTARPRRRCHHRGRSAEDGASDKRSCHEAGDGTDHGNRSR
                     GRSGRCSSSSSSSSGSSSSSSSSESDGKQNERKGSSGATSAERCDGDEETTKAKSQPL
                     GQSPAGTSAEAPSSEVAADAARVRLPPPSAQWISRQCTAHRHVFAILQPHLLEKWAAL
                     LNPYAIADPATMSDGGIAALCERWLQRDEIASRMVFAIRHADAMHHLLSVLLDAVVKV
                     AYVATARSRQQPTASVDPIDSNVYCVEALWYLFVLHDIVMNASNTPEPSATSVTSVNK
                     NVSNRQQPQQVLATAAGMSGATSAGRIGVDEEFFASEGSPEALEALYEVFSRQNLAIC
                     AGASTPPPPAAAAGTSPATATAVSPSSALGSTPRPRRRQRHSQRRSPYERCGDALELI
                     LPTLMEACTAIALAVSMDKERQRSQAVETAPTAAVRVRHFKVLPPQQQQQQQQSKAKG
                     KSKAAEHESAMTSSSTTLPVGGGPALSLRLDAGCDADAVAKTPSSTLPLSSPSAEGSG
                     STSVGGGADTAAPSTSSAPAVMLLHWLKAFLVVWMNAEQPLQPPPSPSPSAGAGMAAG
                     VVLPPGTVWPDCQADAADMPDVSLTYHVDPQHASLLGLDAASQQQRNVYHQPPLLSAR
                     ACAILKDRYSFLF"
     gene            <203938..>206562
                     /locus_tag="LMJF_05_0620"
                     /db_xref="GeneID:5648924"
     mRNA            <203938..>206562
                     /locus_tag="LMJF_05_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687487.1"
                     /db_xref="GeneID:5648924"
     CDS             203938..206562
                     /locus_tag="LMJF_05_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648924"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QJE0"
                     /translation="MSAMSSRDISTESLSLTASSRSAAKADGAAVPALTFVVIPARVA
                     KQNIEEVLRRGSPSTRGLHSISPLAPNAARTPPADSRGPPRYLRARGITPSPAASSAR
                     GRREVREPPQSRQNSRRRRPFSRRRGDRHSSSRGSSHRHQGEGKQGKAQTASPPQPQS
                     SEAASSDSQTPKSREMTAPPQLAVPAQLSNLLLPLPQNHRQLAPSDNQCGNQAQQEVQ
                     RRDRLSQPDDSGSAVAETQEQEQECSARAPSPRSKSPASAHASSLHKCNGTTAAAARA
                     PARRSHVVDMVLTIPRLSPAQASPFAPSKQPQRTRRTGEDFRHGSSVQPAAWQQQLSK
                     RPLQVGIPGRVGVPGKGSAAAVVTPSAAQRGTALSTSPQLVSTSPIARSYVVQSFSSH
                     LPGESTVLLGAHHRGGPSPSSTPPPSSQAVGPSAGVAAATSMPAVVIEVAVVAAAAPS
                     LPEPEVLQRYEDMLRQWHAGNSNGCSGGAPRHDGREAQQWYTHNDLSAAFDLIVHIQL
                     AAAAAVTVSDIKDEVELRTGLPAAQQCLVYDAVLLQDCLPVCLLPSAADDDGVDDERG
                     AAMGRSAGPDYWRLVCVPLSSASSPAAMARQTRRIESPPRAVASPAAATDATRYDDGG
                     DEAAAALRSLLSVSPVRPRTQTSRAAEATATSPPRRPGAVPFTLSNGTTVTASTAATA
                     GHTEQVVSEHINRLRLLYLSNAEMSDQFGRADLGFPVAAVERAPEHADPSTAAMAGVR
                     PPTRPQRDLLLSPLREAPAVGAEHYRTRFGLSSSAAPISSACTPPPPRRTELSDALIA
                     ALPPPPVRRPVTLPYESIKTLSWKPSVHQTQPAQITASSSVGAGTNGGNGGGGVDASW
                     MSSLNASFSSDAAAAVMM"
     gene            <207471..>211154
                     /locus_tag="LMJF_05_0630"
                     /db_xref="GeneID:5648925"
     mRNA            <207471..>211154
                     /locus_tag="LMJF_05_0630"
                     /product="putative kinesin"
                     /transcript_id="XM_001687488.1"
                     /db_xref="GeneID:5648925"
     CDS             207471..211154
                     /locus_tag="LMJF_05_0630"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001687540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648925"
                     /db_xref="GOA:Q4QJD9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD9"
                     /translation="MPKVRGEESIGVYLRIRPPPTSQQSRLLATGGGGGTAAVSSPFE
                     AARGTGQSPATFQYEVEEDFQRSILHLHTAQRLVQEAQRASTGPSPSQPSSVPANNPR
                     GGGGSTSHAAGVDDVVNNTVVDFQYSFDRVFKPSATQEDVFATVAKGCVASVLDGMNS
                     TVFAYGQTGSGKTYSITGGTESYQDRGLIPRAMAMIYEEVARRREGGGGRHPRCRRSS
                     SVGAAGDDGDHASDGDASGGGATTYTITMSYLQIYNDKGQDLLNHGRDARTLEELPAV
                     TIHEMEDDIMLKGLEQHSAPTLADALNLLFLGDTNRLYCETPMNKTSSRSHCIFTIYL
                     EARSASSSVVRRSKLNLVDLAGSERVSKTGVSGTILTEAKHINLSLHFLEQVIVALSE
                     KAKGVRDHVPYRNSFLTMALRDSLGRNCKTVMLATAHVVASQVAETMSTCQFAQRVAL
                     IQQAPQVNVETDPVLLVRKLRAEVAQLKDEVAYLRANGGGSSAASLAADRTLTADEKN
                     VCRGMVDAYIQKAAVDGDWSSRLTGLNGDMARIYCCYEILRERLVRGGGGAPDDTQQQ
                     RQQKQRLDDSEAQVTALRHTLQLKENELQMLLTVLKKAGHADATSGVGGAGGGAGLGA
                     AGVRYTAVAQTPHSNGGAISGSGEAEGVVGVPFVFTRSRSSSGSRGANVGDVQNDEHQ
                     QAELLLRQNIYRDAQQLIAQLRRLAGAALTHATAAAAPPHAERTVEAALTRVTTLAQQ
                     GQFTEAEAAAATEFLESKREYRQHVANLHKRSEGDKNNGGGGGGGAGGGDARTAVDVL
                     MDEQFLQNRAQALEAFKASYDAQHKVEETKLLLRPKYAACKASAQQLNACVDAIKQLK
                     TKIQRRRAERAAEGSDVADAEEVAWLAELSSTKERYNVHAAQLRHDKEEIDGMHAYLK
                     HAQEQLVRDFERWFSARQQQVQLAVQQQELHAQRRHEEEKRTELTDGLRAALGISPTN
                     VPLSEKPGPNMCATPPPSPRGDTGYTASSITSSQCGSSLPFSPLFSAAQPQRSYAHSA
                     SQSMIAVPCLPNTSGSGGLSAVLLPSTTQAPVRGEHHSSSVPTLSLTAPSARLAMTVK
                     DGQPHSADVALARLSPSPTVQRDGASASPPATSPGLTGPARNAWTTAKASTTLMMSGG
                     TETTPSPTRPFHLLPLGNTTTTTTAANSTALSVAPAGSAASADKKRSNPYFPLFPSTG
                     NAAADAQLAELYKAREAMRKQFQ"
     gene            <212049..>217733
                     /locus_tag="LMJF_05_0640"
                     /db_xref="GeneID:5648926"
     mRNA            <212049..>217733
                     /locus_tag="LMJF_05_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687489.1"
                     /db_xref="GeneID:5648926"
     CDS             212049..217733
                     /locus_tag="LMJF_05_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648926"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD8"
                     /translation="MASTLPPEKKQKATKATTGAASQRKGDGGGSGAHVREDPHHTWN
                     QQLMEACLACDAAAVRKLIERGADPVNAREVPPLSYYTGPIIQQLQLQQQTSSQARSH
                     SEPLIIDQLRADQPPRQQSPLSGSSSPPAAAAAVPDSLPPLAAMLLSGLNTPDALEVM
                     KVLIQHGASVNDAFSFSTAPLTAARPGTDVSENESGGSTAYGASANDSGGHRKNTRVS
                     SSDPKGKQSIGKRKASAIGTALTAAAGGCALVGAAVNPPEAPRQEESTIVGSVLHYVV
                     AHGDHAQLLRLLLLAATAVRSAADAPSVSPSLPLPLQQQLATGEPDAEDSTAFLPHLF
                     PVPLPCTLLPAVEAETIVGVMRWQHQQRLGGAADAAGPNGLPPPTAAPRVSQSRKSHT
                     VSNAAATARFYGSAAAAQSTTAVLPAQEARPVSATSLVSPSAAEAVLAALQQVLRQRQ
                     TSTGGYHGLPILTSVYPQQQQKENDAELGSGAATGSTAAPVVVAAAAPCNWWSLADLC
                     DVTDAVVTDDLHQRTRLDFDLLDTCGRSAATLALECGDALSVRLLSFYGARVAFAGQV
                     NASHTRLARACTHGDVARVEALLRQGDSITQISADGRYTLVHYAAAQPSVLRTLVEHG
                     LSMEFENAFGESALTSLLRHGTARNDPRYVQTLLTIAAAVRSASTDGATNTATANLVN
                     SIGSTISANAVRFAQLSTAVQRNMILCPPTPITTLMNAGGAASGSAAAHLRLLSNNVS
                     HGTVAQVTASKSSGGNASRPLARQPFLGGCEVGTWWSFLPPTAATADVLDSLLHAGAL
                     MQGFVPDEELDLPYVLFSERQTSISACGGGARGFASAADEDDEAEDDDISDGGVEEGG
                     NADGEDDYGYDDDDGSVADAGGYKAIRTPLSATERHDRGRRRQKRFDALPARLPMRLT
                     PLHHAIFDYHPELIRRLLVDYRVDPMHRDSQGATAVHYAALCTHAQSVLELLLSPQAL
                     APNTIGNSKSRLSSNPGPDVITGAASAVVGASFAAAGSSDVRIDLNAIDMAGRTPLFY
                     AAYVGNATAVQRLIRFGGATLLCGKADKDGYTPLHVAVQQRHADIVELLIRHSNQLMS
                     SAAGVGRGQPVDILVELLASTSSGGGSAGRSSRGGTRLSANRRSSSVLAPGSGHHSQS
                     GSHSAGEPSLASFTGIANPELLVNVEAVEGVTHMTALEMAIKAQQQPPQSTFSSASLS
                     EAQELQKGRLLRIVSVLLSEAQASPLRPSGLANGGALLHRAVADGEVEMTELLLSQYT
                     DPNEVDDVNETPLFLALRLAAPASAPQASSAEQKQQHRLRRTSLIRVLLQYGATPYAQ
                     SSVHLQTPMHLAASSLADDDEIVQLLFYSTPDAGGSYGAVRRRRQEQQRHQQAPSYAA
                     DVMDGDAPGVNYPLGGSTGGSSSARGRHSSSGGGPTAGRKNFERRVRERRAQQQQRRS
                     SPSSSLPGRSASTSPGPRRKPWRAAAAALSESDRGSSVADVDGPADDQALLGNSSFGY
                     REARNRSVASGEQAGADQSLTHTGEELVPDSRAGGDADEDVLQDEHQQFLERLAQWQC
                     ADHLLEPEKCWMLTDAQGQTPLHVLCSRSSPALQRMPAVLKLLEDLQAVTRTNSAIAA
                     VAAGVFDGTRDDDHVLSLCWHLSDAQGRTPLHAAAQSGFVEAMEHILKQAPQSALAVD
                     MQGRTPLHACVLMAASPTAATAVTAHAQGDDDDDKVERATRLRRMLSLLRSAVAAAAG
                     NGAAGTANLSLQLQLQGTPLRRAAGDVLPSRSMKTIATMSNAIGSAAAPHSSIQRLVA
                     SLVQASSITAQLQRWQQSRHWGCPALAMKGIGSTGAHMRTACGDGLAAAAVAAAPASR
                     DLQPSDGVLTSSGAANEWKTYVQLPDGQGRTALLLAAEVGNVGAARELLRTM"
     gene            <219345..>221945
                     /locus_tag="LMJF_05_0650"
                     /db_xref="GeneID:5648927"
     mRNA            <219345..>221945
                     /locus_tag="LMJF_05_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687490.1"
                     /db_xref="GeneID:5648927"
     CDS             219345..221945
                     /locus_tag="LMJF_05_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648927"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD7"
                     /translation="MEPRWRGGRLSAEQVADLRTELGRLAAALAVAFPAGSAEEEGQQ
                     TEDVAAEAHDGKGSAHTSSSAPLSDPLAEEAAALLLKPFEEMHLSGYRLGDATLTSPS
                     LPDLSSFLSVVSRHTRLRVLDLSFNSLTPQVLAPLLQAIRGLPLLAVLKLSGNMLGSA
                     RSDDDNDSRSEKWDLSTVNVDEELGDAATAAARLGRYLATNPALLELALFHCDLNDHD
                     VRELLSGLVHPRNTTLHTLQLSWNPACTSRSAVIALQLVTDLGNTTLCKLELEGVAPA
                     TQVRLEYACTADGVFRSGHTLIPESAWAGSATGDGDGDGDNSGNTGTVSTSAAGADVV
                     SLEQLRQQQQLAEIQKHLTPAQGARFMNRCRYLAEDLDGSRVLAPLVMRELEAVLSTR
                     LPPKPRVDEHHGASELNVAAFAERETASASAAAAGAHNQDGSGELFMPAATGDCGGSD
                     PHSGRAAPSPVAAANSSAGHQRRFFEAVADMTDGHAASVAPPPQATDAPRPRTSPPMH
                     LRRRWLTPVVSTGSVASPASGRHAARQRQHPRTPQELRDARFETPQRLAAVMADAEAF
                     RRRLQPVQLDTRAPPCAGVSRYRSGAHSASATKTRSLWYADDGFVLRPNGLSKVLVAP
                     VLPGGATAFANVALEDVEDRTLQPCWCTPRQTSPMTGIYAGTLHYHCVHEATTQQQKR
                     QYGTSSSPPPSTAATAGKPADPNASKSRLPLLLSQPLQQPQPQPQQPPSTAEMYCGCQ
                     GTGHLCLSACVASEEAGAGRRRDRMRSTLHVKAAKSVGKSAGSGYGASASRKPDRTRE
                     RLLNWTATNSDAVNTLLSTVAAAAPPALSRSTVRTTCGGLSIALNYNPVTHFSAPHVS
                     CAAGMTLAEF"
     gene            <224549..>225520
                     /locus_tag="LMJF_05_0660"
                     /db_xref="GeneID:5648928"
     mRNA            <224549..>225520
                     /locus_tag="LMJF_05_0660"
                     /product="nitroreductase-like protein"
                     /transcript_id="XM_001687491.1"
                     /db_xref="GeneID:5648928"
     CDS             224549..225520
                     /locus_tag="LMJF_05_0660"
                     /codon_start=1
                     /product="nitroreductase-like protein"
                     /protein_id="XP_001687543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648928"
                     /db_xref="GOA:Q4QJD6"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD6"
                     /translation="MLRRSPRLLLVAAGARPAASTPRASEAAGTCGNEERHSNTSSGH
                     GGFLATLRHLVAWNRTNAAAAASSSSVSCAETPACVSSSAALDAVEAVVRDRWTCRQF
                     DTAKPIDLDTLKRVLAATTRAPTGFNLQGWHAVVVTNEAVREQLFKAALGQPQVLQAP
                     ATVVFVGDTEPERNAPQALEMGLETGYYSPLYGATYLRNIYYLMHGGPMQSMAAVKSV
                     VSAWYSRAAGTPLISVPVSRTGYAWKQTMIPATTFVNLCTAAGWETCMMEGIDEDAVK
                     RALGVPAERYTVPVIISVGYATATEAEKRQVCSSRFATPHTVRWNKF"
     gene            <226647..>234281
                     /locus_tag="LMJF_05_0670"
                     /db_xref="GeneID:5648929"
     mRNA            <226647..>234281
                     /locus_tag="LMJF_05_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687492.2"
                     /db_xref="GeneID:5648929"
     CDS             226647..234281
                     /locus_tag="LMJF_05_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687544.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648929"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD5"
                     /translation="MEDDAAAETTSINFSLVLSNGSGDVAGGSSTESPPSDDNGIIRA
                     GRGDVHHLMPAIQVPKPMRLQPPTSPIPALRAALPPSSSTPFGDEASDGGAPSSAASP
                     ASAHVAKSITPFQEIHPAELPCKRRVASPSLEKDVSLDFVRAVQRLDSENFQRSWSRS
                     TVSGGDGDDDDSEHSGNDVSAKRRCHQGAAGNAINEGEQATQAPAQSPSSTAPSRQLL
                     VPPQQPTRARNVAATTSTLIATTADETINFEEEQNDDTDDTTAAPVAAAAPPSRTSAV
                     KQAALPPPQEQHQRRGTALTPSTELRATAHESPPLLPSTTAGTTPSKNISGPKPQTPT
                     SPPAQQPRNEHRRSSSSSSRNTSPGYTVSAATAATITGAADVGGATLPTASLASHGRI
                     ALPDADPQHYPPYLRVLSSSMQNEDDPMYCTVSEMTMANPVTPRGGVSLPLLGLNTGP
                     QQARGTSGGSLYLSPLRPSLRSAAAGRRVQSSDFSLDESNALLTLNTAREVVKSATAG
                     AKESTYFRDVAFEDGAEPASTSTPSQSMLGLHGKPLPSFVQPALVKRTADGRTTAGGG
                     RLSPPASPRQLPHPSAPPAIVAELKCHAEREEDDEKEHTLRPTSTPSPRETRVGGEGA
                     HRGRRSASSIFKSFPSETICGRSRNSVAAKSGVDEHGEGGGEGRDVKASGRSTSSIQS
                     TRSSSLASGLSRLSSMFKRLVSGAAHGRVEVKTQRPLQASSSSLQQQQQQQQRTRQRE
                     DNAATTTAVAALVTSTLGNTVKVTDSSTDLRSADTQVGRKQRQPPPAVTPAVASATVV
                     KPGRATPTREITSSWHGDSIDFPTADEEDRGLGDGVVGVAPLIPPAAAVPAVPVEGAC
                     GSAEESKGQRKKKNAERPVRRRRRRRRHDAEAQDGTSSSASATGGDDRRSSSSSSAGD
                     VDTSSSSTFLTSASGAKKPRRRRGETGRRSGPRRHRHRREGRKHQNEQDNSVSKYPQD
                     RPSSSTPPLKSQSSDRSASSNGRLDRSSRRLSQRGCRQRCDANDRGLAASGKALASRI
                     ANQRRYRRALRGDGESPRTFRRPCEGARHHNTANDNSDRGDPGDPGGSFSRDCHGDMV
                     PPPIASAAMLAARRRELRTKSRVSSSVNHFAVSRRTRPATRHRQELLRHAGHASLARL
                     QKRDGERTSGSEKPAAVVAEAVAASRGASPSQLWASSRQTTVKSHQSSTAPFLPQPLT
                     PGRLEQYEAALTRDILELDVIVEKRRRRELWAEASPEAAAAAAKAVATPSRRPLSGAA
                     QRRAMTTPAVTTGPLPSRVGITTVVTASTPTRTRRSSAGNTRAALRYNGPIASARRSH
                     PNDYGSSKANELESAAADGRGSGDTSSTAPPTPRAETTPSPSISSPLFRVRTAAGVRW
                     QPQQRPSARASYTSHTSNAASVSAAVRRPGAADSGNEDAEAAPHHSSSTRLPGDAARI
                     AMMALQRRYEQLLEDIVAQPAPQPPATAESDEGDNATDGEVLMKAHSRHNYSARRHQY
                     PHQHLSREQGEGERNRGAASSSSTQGRRSAPAPTQVDAMMEAEEARCSAALRAEYYQP
                     PQREQNQQQEPSKTMERVPLTPATHEAGADTVPVAHVAAPYAQALRPSCAACRPQQLN
                     EYITLGLLSMMRGCADECVDTAAVAASETAANLRQAHARPVTTPTLVQRRIREDLYAA
                     PRRCSRRRMTQAGRKQKATCSDGNTAAAPPITSVSASCGVVLSSMHAQSADAAAAGRD
                     VGLSPQAGTAPLPLAQLTHSFTPTPVVIDSALLTRLMRRERRARRERASQEQEARYTL
                     QRLYIVETILVLRAMDKAAAMQEQEAPAAPALPTSQALASAATAPVNDRGGNRSGSRC
                     PLAATRSSGDASVEADGGAAREPVVAIVSVSQQPREEASASEEEHVAAAVVVVCGDAA
                     AAAAAEGALHVTPASQGGEGKGTQNESARAAVAPLPMRDTTARSLAMDASEMRCGVEV
                     DTVERDAGDSSSSSASPAVLVTPSPQTAVATEVGGEVKQAKDHGGDVDVAESSSSNRS
                     ASSVLSFHVEDSQEGAALQQPGPGSDGADKDHYPVAASGSSAAAAPAAAAQPSSDEST
                     SPVTAAVDSLATPSTASPQAAEGRPLSIDRGEPITDSDRHGTLDDVDGAAGTVDDALD
                     GHAAASPPSAGKHANAAPHRSPPPVPSSSSAASAASSSPSRSLHVVEVLEAVRATTLV
                     PEGEGAVGASHNADDAGATDLEAVARAAIQTPVTPVEATTSTALASAAAAEAIPESVP
                     PPSAGDDPRRALEGPRPWKREQRQQQKMATASTRSAVPASPRRVRFSLQSEVVSSDAG
                     EVKEVSGASKQTCWEGRATSPTAGGPQTMTPEPFKRAAAAKDDLAIDLLEKLNGLDAL
                     LLHSFPTYFTTGTDEDGLPGVVMRPHRHLPFVSPQPLQPCRSAPSRHLSDSMPPLAEG
                     RETPPASAAGAAAADASPFDAHASALCGHRTSPRLPPGSLASQLRRKYGLPQPVQQRR
                     HDHSAEFTLGLPAAATPSVAAAPSTPPSASASGSWPSAVPAAERPSPQEGIDASHLAV
                     RRSVWF"
     gene            <236245..>237285
                     /locus_tag="LMJF_05_0680"
                     /db_xref="GeneID:5648930"
     mRNA            <236245..>237285
                     /locus_tag="LMJF_05_0680"
                     /product="sre-2/carboxylate carrier-like protein"
                     /transcript_id="XM_001687493.1"
                     /db_xref="GeneID:5648930"
     CDS             236245..237285
                     /locus_tag="LMJF_05_0680"
                     /codon_start=1
                     /product="sre-2/carboxylate carrier-like protein"
                     /protein_id="XP_001687545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648930"
                     /db_xref="GOA:Q4QJD4"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD4"
                     /translation="MMQLSPDATLEEVPHFPQDLQPDQSTYKGRFLRFLSMTDPRTLL
                     TSPTRLALSEALLERVDRREDGWATVKVADYLDARQRVQCIVHPESGKPILMPFRFSA
                     FVPMNFINLCGMLAPSQQTPARAMFWQFSNQTYNVGFNYCNGSGKNGLPLHELAISYV
                     VATGTACGTSYQLSKVASAFSASTSSAALLLQLMIPYTAVACANIANLGVIRFRDVLR
                     GIAVQDPETGKDLNDGKPSAVAGRLAVAQVALSRVMIPVPLMLLPPVFMNALFHPTRG
                     VRFFVQRRAQLFLPVNVLTLVSVLCVALPMSIAVFPQKTVVPVSWLEASFQGQTNAAG
                     HAITHVEFNKGL"
     gene            <238660..>246723
                     /locus_tag="LMJF_05_0690"
                     /db_xref="GeneID:5648931"
     mRNA            <238660..>246723
                     /locus_tag="LMJF_05_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687494.1"
                     /db_xref="GeneID:5648931"
     CDS             238660..246723
                     /locus_tag="LMJF_05_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648931"
                     /db_xref="InterPro:IPR010736"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD3"
                     /translation="MGALSSAGAVQLYQCWRRRQQKRQRGVEAHMPRSSQSARTAAVH
                     PSSFSHTTSHLTTGTAKQDRERDIDVNAMQRSFQRLYAVMQDESRRQGHDAVATERVA
                     RASHAVTRSPQRRSRSCPTRSQRRHLHTASPQALHGAAAAIRVPPMDFDSDSIIIIDD
                     DNSRYRSSTKLVKAETKSVKTQESPWPTAGSTAASVKVLSPALTSTDTSAITSSPSKS
                     STSSSQPCSPPRQPRAQRYQCLNCCRRCGSCDSVGLPCPVNAHEHRSRGTAAGAAHGR
                     CHARSSPARGRWLSSADCAATNKDSAPAASKTATVDSPRLQWLGQLPATPSRRPSPEQ
                     LSSSEVRCRSTRRVRHRRRQQSPAHDRHHCCHDRRVDRSCGAHRREKSTSVDAVAAVS
                     STHGRADHGKGEAVLRDIATRTCTCYWAEFSGFTMAVNPASHAADCPYQAHNALYAEV
                     MLESKADDGGSGFASTSSQGRCSSSASLHGRCDRSGRESSSRHYRQEYDAGAADSSAR
                     PRRAAQLRQARDDPESKRTRGRAAVMGSTKRRTYIEIIMDAARDAPPSQPPRSGGRRR
                     SNAEATATSLAAKHGAEVTAAVAPRPLSPTAQTSLPNGEAPLKVEDEPQQQQQLSSNR
                     SSSENDAAAAAADEDKDGAPAAEDQHDEAGRCSKGEKQPLLNDESPLRALSRPRRRPT
                     VGVPGPGSYHVDLAYAASSAAHGIRGAAMPKSARMPAVKSVTPGPGAYDAYKREEERK
                     AVTAEAVAGGGAAATTTADGGATDGKGADTPSTAGKQVIGKGVVFASTGARQLQLRYG
                     DAYVHTSTWARRAAAVPGPGTYNIVDGDRYDQSRPLGAARTGHQFSKSADGAHFSVVS
                     AAAAAAVAAAAATPLRASLVVPWRDWAGGAYIGTTTSNFVAHPSLAGGDRRTLGQTVA
                     ADSCTVCCSNTSAAVAAAAAAADGSVWRGVGSGVALRLTSQRFPGKTAGAPAAAVAGG
                     HDSKTGRTGNGEGTAPPPGEPSPATYDLERGLRWVQRRAPEVSMTFRHDRGPRGPLRS
                     GAAAADDDTLASAVSGGAPRTALSSLSPLLSDDVSFSPGPGTYDVRGVEVWRMRRSPQ
                     WSFGTAARHAPGAAVPLSAAAEGVNDVNGRALHAVDHPGPGAYDTEACYRALQRSAAS
                     ALICTAPRLAVDDSHRAGVQGSATTAGDTVNGARAGPGTYDVESGDRVVRESIKGGVI
                     PRAGADARAKVDNEEAQDGGPGPGAYTLPALPPSGPTAYLGMSAPRFPYQQALAATEG
                     NVGGQGAAAAAAGNGHPPHPNTDLFLAHLATPGPGDYDVDAATSLVNRPGAIIGRAPR
                     VSLLVPTGSTSANVGPGSYMLPALPAGRGAVMSTARAIATAETGDAAERPGPGLYDPV
                     DMCASFTRTFSLARTGARFPDSDAHAADAPGPCAYDLPAVPMTRGVVFDTAPRFSRSS
                     GGQSTDGVGPGAYEVVDLSPPGRSAVMGSAVARPDLERKDGNGGGPGAYSPQYAQVEK
                     SAPRVVLARAPVGRGAADYYASGDASMPSHEQRAGAGSELGPGQYDPQYPSDVVQARR
                     GYTFGSASRAAAVASAVDGPGPGAYEVRVTRDGRLLDSSGAARFSTAPRLAEESASAT
                     MPAGPGPGAYMPEAYTDMGAGFGGGALSPAVRIGTAPRIVGGDDARVAADVPGPGAYE
                     PNPWVLYPTAPSISFPRADSAHALGDTDIPGPGAYVTTGFAAARVAQFGCAPRFSEGS
                     VGGLAAYARNGAEGAASVPGPNAYSPNDDAIRPARSAHRFGTAARLAKAVGEAAEADG
                     VGPGAYDIEAGLVHSSQGPTVAAYSFPRAGGSGGYSNSPGVGGAAAGGVAESPGPGAY
                     NVEAAYRATLPSAATAILSGGGASGVNGVRGNDEGEASSPGPGAYHLPPFFPEGPQWG
                     FGTSMRSAGADATDGSSALATASPGPGEYAVQAPAPLHSGSSFPKAETAAPTGDATSP
                     GPGTYNVVDAAVRPSAPGVRFGTAARHACADVSAGDVDIAAVGVHDSGVPRTPGPGTY
                     SPNVNASSTSRSTRAGPAFAQAPRTAPSASAHAVGWGAGAEGDNIGPGTYDLHGDMAA
                     STAAAHRFGTAPRMPPATAPGAATKGDVGPGSYMIEAADAQVLPRAPAHTIVLPAPHA
                     PRLQEPRPGPGSYEYPVAVQEHRRSALVLGRHGDSTDITRDTPGPGAYDIDTAYTATQ
                     VARQPGGFTMQGRPVASMQVGLAESPGPGAYDAGASAASVAAAHHFGTAPRMPSAANG
                     DAGVGPGAYDLPAPPAIRQPVSFTQAPREVVVGAHEGSADALQSGDMRGGCVGGGTPG
                     PGSYDVGSAIDCTHMGGRGPSFTIPRGLRPVLRSGDVDASPLVGPGTYSPVDPASHHH
                     GGGGSGTNGPSAAFGLAERVVNTIPRGSDAPGPGTYDPHRPRLANGAGIGPSFGSAVR
                     MDDVGGAALAATPGPGTYAVAPSFKATAAAGSAPALRFGTAKRPSAVLNENPGPGSYA
                     VAGYDAATRVAATAPSFGQAAPRPHLACCGLDTPGPGAYYRASNLDGTSTAAGPSFGF
                     GERMSAVAGTATPGPGTYYRDSAASVAAGVVEGRGASFGLDERTSPVLNNYPGPGTYF
                     RGAGLAADVAALRGPSFGTGERHDPKLNNNPGPGTYFRDTLPAAASAAQPRPRRPTAA
                     DTLRKLASVGYPTLASKTKPATTTTATDSRSTG"
     gene            <249315..>254546
                     /locus_tag="LMJF_05_0700"
                     /db_xref="GeneID:5648932"
     mRNA            <249315..>254546
                     /locus_tag="LMJF_05_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687495.1"
                     /db_xref="GeneID:5648932"
     CDS             249315..254546
                     /locus_tag="LMJF_05_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648932"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD2"
                     /translation="MALPPGAHVVKSPYPFGGGLGAAGLMGPPAVAVPPGFRGKGPPA
                     QMLMMAGNQQTLMPPPSLLAAGGGYSLATSPPLSRTTSPGTMTAQPGPPGRSPIGPPH
                     SFPQFAFVNGKQIMMPPGMKSLMGGPGPSQAPGATAAAAPPQAVMHSKMMMPPGQGWE
                     TRRGPSPTTSPPLGAMSRGAAAASTGGGGSPSPLRVNPGQGTVRPPMQATALPSPPPS
                     QPQPTRVATTGAAGSKSRQFNLVRRLTNALSSLKPGSASDRERENEQLRPKVAAVQQR
                     VQTPPGLDARAKDVGGGPAGPHSSSTWMPRNRSLPHPAGQSPPRTQQPMPPPQLMSNA
                     KMMVGQPPASPRGKSPTPMSPAKSGNASGGAGAAAAAAAAAPASSPMRMPPGQLMAIK
                     GRPGRGGVVGGATNAIMGPPPPGAGHSMAATPPPAVRLVSSPQQQLQHPSPAGSRLVK
                     CIVGPPPPHERLIPAPLPKQPQQQSHSRSTSPPTASLPSPPLPATPPPAATAAANALR
                     VPSSTVLKEDQLPEAGVRSPGHRLRRLGESSEDSDSNGGDGGGGAHAGTQVAVASHSH
                     GPGHLRDPSLVKDTGGAVGSGTAQKNAAEEGDAALHEEDKTQPPRPSSSSPPRHAAAR
                     ETRDHSHHPGDGDCNDGTHHTTGAMTSKSASAGAGAAAMSQSSSSAHRDSNNKTSAST
                     IRRPVRQTSTTAARSAAAAAKRRQEEEERRRHEAAGKDVLASKKLRSSRSKSAPCAKH
                     SSPPQPAAAAGVAREPPSPQEEDNTQKPSSVERSIHSIASTASCRAPLSPSGSSTSTL
                     SDKKSPRTPTRGRGRAVGGGGGGDGFAAQPGSASTRSGKRPGKAAHFDPSDTQKNGQW
                     QRQPRSIRSKPRSRSPNARRSTSRARSGNDDGDSSDADDEEDAESGSEKLTSRDLYRL
                     AKLLRDGNADLVEADIDDRQRSGRRRRSRHRGDNRSDRFSDADSSDAGSWGRQRRGRQ
                     RRQHTTAKRRSALPLTTVGIPWRYAGTRRSLEPFASPPRVRRPLGYINVGGGRYARVG
                     GSPYTRSQSQPRAASVGTVPLDTTNTRTLVSDAAAYGSHSPLSGERNRWTSALLDAFR
                     NAAVAEVQRSALLDSQPASSARSGGADGGAAALYYSSQQRQRFGTRGSPPHPHTRDGC
                     SAPGGGLDDTMSSAAESQHPYCVSTSALLSAMSSTAPLRRGTAPAYEPNEQERGRSSP
                     PSGPLRWAAVQPYSLPSQPQPPTSAAAVTEPDGLLRLGKDKVDPAVEPNTHGTVAAAV
                     DGAAAPVRVASWRWSSFPGQLHSLLPTTSSSVDATRAAAAATRSRSVTSNRRSSISGA
                     DTASVSAAAPTSSSLIPTFTSPTLLAPPCEQAWSRGIGNHLRTPSPSTQKRWQQEQRH
                     AQRSESCNAANNSRTCNNAAAAAAAHAGRHTSDANLDACGSPARKEEPVYLSKATVAR
                     LSAPRQRRGCLGASAATAISPISRRSHGGVDGISSVTAQTCSKWLDEIIDSTTVTATC
                     VRAGGGASGGGEHAVAAANAIPVVDLRREFKPRIADSGTDGRGGPSSVRAASPSLHNG
                     GTTDYTQEFTGSRARPHVPGISFKYMIGARSATGSPPRGGGKASATGGGAVNVKTVKG
                     ISDGLPFSAYSSIRIHDPARKSPWALAPEREGLKVLPGQPALSRRRRIPVDGHAAAEN
                     GAADSELGVHEANDARHRARGTTRTVVEEVHLDEHHRPYLIVRPVPSSEEGEAQRVAV
                     ERLSRPKSIYRRANDHV"
     gene            <257575..>261846
                     /locus_tag="LMJF_05_0710"
                     /db_xref="GeneID:5648933"
     mRNA            <257575..>261846
                     /locus_tag="LMJF_05_0710"
                     /product="putative CYC2-like cyclin"
                     /transcript_id="XM_001687496.1"
                     /db_xref="GeneID:5648933"
     CDS             257575..261846
                     /locus_tag="LMJF_05_0710"
                     /codon_start=1
                     /product="putative CYC2-like cyclin"
                     /protein_id="XP_001687548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648933"
                     /db_xref="GOA:Q4QJD1"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD1"
                     /translation="MDCVETCPPHHRRSSQLSHRPPTSAVGGSNGISGGVGASGSCNV
                     RRACAAVSAARSTDRIHSAFPTYAESLQQPPQPSTTTATSATAARASSFTQEKHHQCC
                     PDASAAITVPPEPQQQCQHVKRLSPSTCSGSASNLTILLHSNTNASVTSAATDSSEHS
                     TPLSGVSLHQQQAHRVRAQRVVDEANHLYSNPCSSLQPSLDSRSSSRAPDNEDDEVAA
                     DDALSAAFVGGTAVAGNDDDQQQQHRRHSDDLLQRHRVRCSAPSSKRPRQPLRDPSSP
                     PLPPQQPQPQADLKDEERTHPHHRCGAAMHIPDPSTFADPSSSSRHRPTTKTATASTS
                     KDGTDPGGPSTGCNGHTMTQLHQCRGGSGNPNGDGNRARTLDDVEHREDQEVWRTLHP
                     PQHLRRHGGERDEDNHGPRAATAAMTIAPGGGAAVTSMSSARLSAPDATPVVPPPKRF
                     ATGEGEAVALDERRYTSSSTTTTAAAASAILEEGEDDEGERASPSHVTATTDKNREKE
                     ASSVSRRALQQQQQQQQRDSRTRRARVAGASRGNCVSSSSSSSSGVLPSRRHANDSVT
                     AGIPYDPSRFPLPSQPLNLAAPVTAAVATAAHRTASEPASDGPRRSPSQPSCATPPDA
                     QQQQQQQQQEEEEAPQAAGASGSATLAPARPPIKLIETRYAFLALSFMMRMLCKLHKG
                     EPIPSSDFHSHCIPPMTVTMYVQRLVRYCACSGEALLCSFLLLLKYVFHSGHPVTIYN
                     AHRLLITSIVLGIKLRDDVYYSNVYYGRIGGISGREMNKLELLFLEKLEWETQVHVYE
                     YMALLDLLAELGIDAEPTNAQLEAFAAAHPDEAAAYVSDEEDGEIAEASAKLQQQGAD
                     SAAGSSMKDAAASATALPAAEQQRLKVLRGAYRLHQWHTLVVPWLARLEHCVFAKAEE
                     NAVAAAAARKEEGLRWQQYHREDEKAAALRHQRPSSASTWLSPLSVQKRATSSATTAA
                     AAAATAGAAWASEPPYQASWSHRDGSNVPHRSSSGALGAGGGGVHSTATSSSGGNSGF
                     DSVRYNNFMNFANNANGGCFGSLSAAASASAAAAAPTAVSQGSRLASSGQSNSHSGSA
                     TLDWSASPPSSGQCPSQQKHAVSGPAPFSYYYQGTDVARPSAQVRHHTAASASAHFDI
                     TNRVAASVAAVSTSADAGAESHQHAASTQQQQLPPVAGTTVQLTSPSSSTTRGSGINV
                     NAQPYYYVSSRMRKQQQQQAAAASPASVDPSVTRPGSDLAVAGTTSTRTPATAVGTDD
                     TVAAVQRAPLSTLEGGSDARSPGSSFTSPACVNSLARFSTYARTTTDSVAGHASQPSG
                     FRSGIETVVSAMKMSGIYGGSGGGGNNGNSTSRSSAHPHTFPSRPIARSGADGGSGGE
                     QATLARVPRRSPHADHQAPVHRRSTFASQHSLGKKRSKPDSYKDY"
     gene            <264152..>268198
                     /locus_tag="LMJF_05_0720"
                     /db_xref="GeneID:5648934"
     mRNA            <264152..>268198
                     /locus_tag="LMJF_05_0720"
                     /product="phophatase-like protein"
                     /transcript_id="XM_001687497.1"
                     /db_xref="GeneID:5648934"
     CDS             264152..268198
                     /locus_tag="LMJF_05_0720"
                     /codon_start=1
                     /product="phophatase-like protein"
                     /protein_id="XP_001687549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648934"
                     /db_xref="GOA:Q4QJD0"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QJD0"
                     /translation="MPARPQPQPQQRRRRHPHRPPSKQLLQIREEGGSSYADSKTTSP
                     FLYDTPSWSSRTSPSATAAIDGRAGGAGGTDSVDRGSGAEMTSTGDSDDNGGDNNEAK
                     RIAAKLSRARHSPQHPRQSRCYLRMSPRVTSARKAKSGDRRRASSSGSGLDRAAAAAV
                     RSSATSLVRSLQAPMTSSSAVLGGHVTYYGPLSSRSLCESDGIEADTQNSKSDCGGSD
                     GGTAFAIPGSANDDVRRTTAGCKPETAVSCNGDSGSRAYASSSPPSITVTASTTPLTY
                     AAVASSSLHGKRLPQSRVSFSQWRKRLCCGSASMPNTIDGANTTPGTSSRAAAAFLNT
                     FPSAPLTLTTPLAATTASTPRATGKSTSTRAPSVDGDGNAADDGDGKTSMPSGDEHDC
                     TSARPQHLSVSAVMPPLPPSVHRHKPTHLILQLPHAPPPQQARNGPDSDEDMASSSSP
                     RNVGTPGIAATTNELPSPVALPSKSNGTATAAAAPSLSLSASEVASATGVRMPGVQTG
                     TQQHRQQLNALIPVMSPSYTAFGPATPTRGGAKSSSRPKVSATAAAAAGKGMRRVPSA
                     ASFFSAAEILPGLFLGAYVDATDTEALAAHGISLVINCSYECPVTSAMVNNSHHVRYA
                     QCPLRDHSDEAIAPFFTPVTRIIHEQLHRRQINHQRMARRAATSAPGVHVNDFEDREM
                     QGGMLWAWADEAENVWVVPPSLVSPRLPVGGQPSFKESKRETPRTPSSTQGLGARFGD
                     GAGCSSTTTSCSPSPSPGGNATFPPLAAEAPGATTAAAAAAPGSAGMPSAKQNGSNGR
                     TNALFNTAPAPAFTAATSFTATTAPPPDAAAITALPASSSAPSPLTVVDPRDCGGVLV
                     CCRMGVSRSATFIIAYLILYGCTLAPLDDTASLFVHFLERERRIIEEAGGLTFFTDNN
                     GGVSTTSSPALATAPACPGSGSRCVNGALASHGSPGVNGVQPFVQNLLAPNSPRTLRR
                     SAMIPVSSPLSLGGGCVAGSLTTPLSGNASTMSQQRLPTGSPTTHIELASRLCQPCYL
                     LHLRERRLQQKTQRRLLISGQQQLKEQRDEVQQMVALSASCMAARKVGQGCGWMGSVE
                     DNSNFGDSSSAVASGRSDGGHQEEQQQQHRHVLCALPSSAPVTSYRSARGSRAMTLLE
                     AAYADERVHADDGVDEEGNRQQEDGSRMAVGQRSESLAVVSTTATPTLKRDTQKVRSN
                     SPTHKVCVAAAEAAPTTPDYSAVADERRGDGENVYETPLSPAEQEQVPLLSPCAILPT
                     QPPMKGRPPSDLNASAGTLLGVSFTSSGGGGGSGSAFGGAAPAMTYREAFDVAKRQKA
                     DVNPNIGFVLALRELAGGGGDFSFSTSF"
     gene            <269941..>272157
                     /locus_tag="LMJF_05_0730"
                     /db_xref="GeneID:5648935"
     mRNA            <269941..>272157
                     /locus_tag="LMJF_05_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687498.1"
                     /db_xref="GeneID:5648935"
     CDS             269941..272157
                     /locus_tag="LMJF_05_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648935"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC9"
                     /translation="MSTSESSVLKKQRARIPWLEASLDTSIVAYEFHRNALENVYAYL
                     EKWQQSPGEGCIHISPATLSELLNDIADVLEQCALRLQPIDGATPAADSPTEQAHSGH
                     RFGDAHLYPDNARGTRRNQAVPAPRQQQPQMTPRSVSELSRGSRPRGAEDDLHEASAA
                     TTESRQHLQPKPVLQYRPLSSSRSRTSSVLPAMNAGAAEAVPPVYTTSADSTPPPSQA
                     LAGSCKPQPRPRAQPRNRTGVALTPWPIMADRQQPSGAAAGPADRTRSNPTPPSARLR
                     AEENHNELPAPQYSSYKKTGHPLLPSPERRAAAEELAELAAAEADVKADSAYQQSLSG
                     CSHSRESERNCVSAGHRWPSPSSSLTSPSHQLPPPPPLQGEHHGQSYWSEEQDIPYRR
                     GSSAAGEHRSSNTGTGSHIGSGLSEEGPHADIAPAAASGRRAAATVTSHHSHPAPSHQ
                     QSSAGGRALSHTSSTLKGSPSDAAVAAVESLSYASSSIPHRPCQPRGGAAGAAAMYAG
                     HPVEASQAGSLGLVYTPSVTPQRGSDNGAVVTALQQLGERRRLRTHSQRPIPPKTNDS
                     SQVESTVYHRRTLSPSAGLKPLRADSPETLRFMEREDVFLEKQRRRLLGEEHRDPLQS
                     QNNAGATLYITANPGGQPVADGGKAGKEAAPEITAVEEQLIAEHAILCTQLEKMQMEM
                     SIAVARHRERGNEQRYTQLNTRMKRVMKDLDRVEWELRVVRNIGRQSRSQSPASGI"
     gene            <274178..>275275
                     /locus_tag="LMJF_05_0740"
                     /db_xref="GeneID:5648936"
     mRNA            <274178..>275275
                     /locus_tag="LMJF_05_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687499.1"
                     /db_xref="GeneID:5648936"
     CDS             274178..275275
                     /locus_tag="LMJF_05_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648936"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC8"
                     /translation="MMSSASLLEKVPQPWAALVRPFLQRSHEFEDKEPLVAYYLRTHV
                     AFLCMRQRSKEDKDGTAFLMTLLDALEASKARLGAQLQGIDGRTVLTKFALMLFARAD
                     DAERTGNASMAIVRLFYTASVLFEATAQFTDDGAMDAVAAQKSKYAKYIATRMKKALD
                     KNEPYVSPNKLETADDDAAGGVGGVNGAGPATTFTTAPASCFMRPTSQPTSVSNRAPA
                     PTTAHENLPALPYAPPPVTQKLDTPPPPPHTPDADTQGRSKTPVHPSPMKNTYAPPQP
                     QHTSQQQQWLSTSSAVPSLPPTPSSAQQRYAAPSSAGGGVGATGFKPSVDQMIDAQKL
                     ASQAVSALQFYDYENAKQQLVASLRVLNGVQ"
     gene            <276543..>279020
                     /locus_tag="LMJF_05_0750"
                     /db_xref="GeneID:5648937"
     mRNA            <276543..>279020
                     /locus_tag="LMJF_05_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687500.1"
                     /db_xref="GeneID:5648937"
     CDS             276543..279020
                     /locus_tag="LMJF_05_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648937"
                     /db_xref="GOA:Q4QJC7"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013917"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC7"
                     /translation="MISFLLQLFASLGLPLVAFLLYSHLADSVHTGGNVAGGDAGAAD
                     DADTFSRQVQAELEQLGVASAPPSAAPAQSPPPARMAPSPAVAVPPSPVAAEILIAYA
                     TQSKNSLALAHKLFSLITAQLHTAPPAAAEDVVCPLVRVMEMREEEVGSKNVCRVDTL
                     LEQNQYALTIFITSTYTDGVAPPRSQAFEAVLKDAFEDHRIPRNTLGRKRFAVFGLGD
                     IAYGEERFNAFAKNLHEWCRGLGAPPFVVPPVYATEAKTQSLFRIFSTALLKWVSRAT
                     FHTDGTVTVKKKSEMAVTSPAAVSATEARSCKGGSATVAAANTSVISAAAGGTCGKEG
                     GLCACQQSSQQLCGSSAGGDGDDDCACCKAGTIADGVAASASDDDDDNNSNAENNDMD
                     DVEDLVWDGTDDADFDLNKDPSELPELLYPKLRQNLEKQGYRLVGSHSGVKLCRWTKS
                     MLRGRGGCYKHTFYNINSSQCMEMTPSLACANKCVFCWRHHTNPISRHFRWKQDPPEL
                     LIAQGMAGHYQMIKQMRGVPGVTPERLATAMQIRHCALSLVGEPIMYPQINGFCELLH
                     QHRISSFMVTNAQFPEQLRDLTPVVQLYLSIDAPTPEELKRIDRPLFEDYWDRCLSCV
                     KELAKKQQRTVFRLTLVNQYNTENVKAYADLVEMGQPDFIEVKGVTYCGTSSSSTLNM
                     KDNVPRHDEVVDFCKALCAEMASRHPHYRTPQMDKEEEGGGDVIVIPAEERNRPYHVA
                     CEHEHSCCVLIALDKFFFDGHWHTWIDYERFYDLVESGRTDFTSLDYAAVTPAWATYN
                     SKEKGFDPQQTRMVRKNARPTTVTASC"
     gene            <280459..>284223
                     /locus_tag="LMJF_05_0760"
                     /db_xref="GeneID:5648938"
     mRNA            <280459..>284223
                     /locus_tag="LMJF_05_0760"
                     /product="kinesin-like protein"
                     /transcript_id="XM_001687501.1"
                     /db_xref="GeneID:5648938"
     CDS             280459..284223
                     /locus_tag="LMJF_05_0760"
                     /codon_start=1
                     /product="kinesin-like protein"
                     /protein_id="XP_001687553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648938"
                     /db_xref="GOA:Q4QJC6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC6"
                     /translation="MSELDLNDANEGVDWACVDVDLRDLLRESMQLARANAAAPQADA
                     VASTSVGDAGQDKSAGGDSGSMILPPQGRTSPAPEDGIATEPAAMVADDDLATADMNI
                     LVAMRVRPHTSLIMAKGTPLPSPLTDTAARCLFPASSASSHNAVQQPPCELRSSGGDW
                     DEGLSTQVSTVGGGSLVEERQRTANSTLSHSATVCGRRSASRRVTPKAEKGNAGNSDS
                     KDKASKEVCVSADARNGFIDCPVAVAANASGGARTQTATAANGATAGQRIRTFRFHFD
                     HILDDSVTQADVMACIGQRAVARVLQGYHSTVMCYGQTGSGKTYTIAGPHGGKLSRKA
                     LRWLASQPGSAEAVKCDDDNVDEEEQARAASDVGLLPRILIQLFRGLEARHGADATAA
                     TPGDGRLQHASAAPTSSWQVTLSALELYNNDMRDLLPGELPKNEEATLGKKDVSHPSA
                     ATRLHHHCSSSHISDHRKATASAVKRGRGQLSVLPPPCAVQNCTRTSQRVNSRRGNSA
                     TTRNHPPTAAASTPRATSHAGAGTAMGSAKTIPMKWTAPTTTHAAPQLRIRLGVPASS
                     ASQTSPPTQLKKARAVSPPPSSWASLRQPSLRQPSHDAGSEAVYIQGLREHQVHNIHA
                     AMEAVRLALRQRHTGRTELNKSSSRSHAFFFVRVEQHERHSRDGEKPACTTRCSTLSL
                     VDLAGSERVSHTGAHGLQLKEAQNINRSLSVLGNVMRLLSSVARSSLSKNTTTTSASS
                     AAALTSTSADQHIPYRDSKLTRILQSSLSGNAIAFLLCNVSPDSRDVQETLSTLRFAK
                     LCKNVKSNAKLNETTADTEDAKAAAEAKICQLVVDASTAQNRLQQLATYTWWLEGHLG
                     YFAAAMIRHQQQQQRQRQRLSGTLTTSASMRAVTSSSRSRGSSGGRGLVVSEETTVPK
                     EISGERSAGARNGSMQRFDSLESRGVENQEGADPGASPEGCRRSAAPAGPTSPEWWYL
                     SPRPSSPTAPADDDKDDGGGGAAEAEGYWHSASSRALLSPAYPIAQRRMELQRKLIAA
                     AAATTNIEDPAMLAMLYSTDAAVGEAEATACGRVIDGTNLLEISSTASTASTSTRAGG
                     SGVLVSKPTTIPVSTGVSSASEKTRAPTRHLRPSPPEHARAATQARLAEVEQSNVLLR
                     LRLAELLGRMQQEGGNTHVADCHQAMNAEKAARGTVGTDYSWAPSSLAAAPAPLPSPA
                     EASASRVLWPPHYSRASHDASLKVFLARCGFAAMDSMAPADAAMSPRRLA"
     gene            <286394..>290464
                     /locus_tag="LMJF_05_0770"
                     /db_xref="GeneID:5648939"
     mRNA            <286394..>290464
                     /locus_tag="LMJF_05_0770"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687502.1"
                     /db_xref="GeneID:5648939"
     CDS             286394..290464
                     /locus_tag="LMJF_05_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648939"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC5"
                     /translation="MQSAVAAAAPSTITVGAALLPTNGSRAGVVLAAPPQGHYQRQAR
                     LAATSPSPPMSTCRRLSYDSSKTGSNSRSCTRASPSSVASPHSFSHPLSEQQQHFWQK
                     RVTVTEVATAAASPRSTVAEARSPSIRMGPAVLPSSPETTAFSSVVEADAQVTSKPGG
                     AAVAAGAREQQSHKAAAAATATVAAATSAGACKANNGNEGVSPFSRVHKHGTRSSKTT
                     TVGGSSASPLSITAVQAAAAAVATKRGTPVRANGSSSPSMPSPLSTAVSPRAAAPRPL
                     PTRRRSAGTTTPGISGLPVAQPQPQRAAPPPQPRRSRSASSGLRGAITNPSSVYFQPA
                     PTLRNAGIGGPSPFAAEQLAMPRQPQPRLAVAPTGDGASRAGCAQSGQTPAKVAAPPL
                     QLVRPADLYRSATTATGKATAGVGGPASTAMAASLLPGAAAAQDRLQLPRRSRLARTP
                     SATSVQQRRRTPSADSFGGGGNARKAGSVASSSPLKRRASVSSHSDDAAGPVGGSAAR
                     AASRRPRSNTPSGTLFLYTTREASGGRSPLGHSEPSRGGDGAPALVDAGSGTDTSRAA
                     PHKSVVRSGSAPVHQRRRASSSSRTSSAVPGSVTDQAPRIADGLGAPVVAPSSLVRSS
                     SVANVHQRRPHATTITVPVSNAAAAASTSVAEWASSMSTSSAPRRSHSRDGTSGTARS
                     SAAGKSVRSSLHTAAASAASRAPNMGTAPTARRPNAGATRPTINSTTGAGGPRARPVV
                     STTAGAATPAATSRAAGPRRLADRKPRDGGSSNTVSVSQASMISMEESKAFLQDFQRM
                     NDRELALFGTLLATVASEQQNRRGLGITSDATRSADKADATRLVGNVAVDSETGIAPP
                     TGVAVSAEDVRVWTCKRAVSLPSDQQQQQPGQTSDMPPPTTPGEPAVAAQPALHANEE
                     LIVLVRRSRSHSAGLHAPPRLSTSGSEAPPPQQQQPRQRQKPAKSQLQPDQLTQRADG
                     TEEKGSGHVATSSHVFLWSPLHHPYHQQQARCTVTDVAAGSRGSSGVVVLNCASRSPS
                     PTPSSAAIARGGKENGQQARSLHSVSSSPVPASPLSTAAGARALQQQRQVGALASTRA
                     DQSVSGKLRPREAAGVNTSANHTAVGAAQKVAVETMATSTRTPHKAPTSNIGASAAAA
                     GAVGRGVVRNRPSPSAAGRVRRGSRRRCGANDGAHTPSSPQEHSRQLSVESYTDIMRC
                     YSPKWREGSHAGNGGSGCDATLEERMPIDEGPRAAGASASSLSSAMSEAAAPLAALKR
                     AKELAAELAAAARARTASADKTSVAMIPTSFTSPATFSSADSPISGSVSMGRASGGYA
                     TGAASEISGVRVTAAQLQLLIDSSRSEANYARYQQL"
     gene            <291978..>292421
                     /locus_tag="LMJF_05_0780"
                     /db_xref="GeneID:5648940"
     mRNA            <291978..>292421
                     /locus_tag="LMJF_05_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687503.1"
                     /db_xref="GeneID:5648940"
     CDS             291978..292421
                     /locus_tag="LMJF_05_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648940"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC4"
                     /translation="MLASALRHSAAEGHSSAASAVAKISNIERAGAYLRFSTLRVHPH
                     HEPNFRASPVGWKAWNSKQYMDPWAPYPLTSPVRHVDRPFSGMWFGMGHFALKNFFGP
                     LNWKFWARVSFFGTLGWVYSLSTYALRMHRNGWEWKNRGAVFSMD"
     gene            <294416..>295582
                     /locus_tag="LMJF_05_0790"
                     /db_xref="GeneID:5648941"
     mRNA            <294416..>295582
                     /locus_tag="LMJF_05_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687504.1"
                     /db_xref="GeneID:5648941"
     CDS             294416..295582
                     /locus_tag="LMJF_05_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648941"
                     /db_xref="GOA:Q4QJC3"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC3"
                     /translation="MLRRTLPCCAAAPLRYAASPLCFPRSRRGVGPAFSSSNGLLHMT
                     RAYATTTPPSAGNHDDAADEDAHMMGDGDVDAAAAHRHHAPTLRSALPPSATELPEES
                     FLKCIDKEILDEKMRLDREHGPPPVPMGWTMHHAEGTSFIYGRRLWMPPPPSSSSSSP
                     STWSGEAEARCGDARDSSTQESREGEQERQEREVKPAPEAMERHFLRIQLTSRDASLD
                     PECDVRGEHFPFSFFVQRVLPEEGEEGSGAGVTSRSSGEQGATAANSQDALHGDSFEE
                     HTFYHNSIEVRCDVVDGELIVDGVVYHGPPPPTSHPPSSSGAPRPRYTNPFGGYPGPN
                     LDEAEEEVLDGIQSWLAERGVDDQLGEFVGQYSIWVEQAEYERWLQQLRDYVAA"
     gene            <296178..>297497
                     /locus_tag="LMJF_05_0800"
                     /db_xref="GeneID:5648942"
     mRNA            <296178..>297497
                     /locus_tag="LMJF_05_0800"
                     /product="MYND zinc finger (ZnF) domain-like protein"
                     /transcript_id="XM_001687505.1"
                     /db_xref="GeneID:5648942"
     CDS             296178..297497
                     /locus_tag="LMJF_05_0800"
                     /codon_start=1
                     /product="MYND zinc finger (ZnF) domain-like protein"
                     /protein_id="XP_001687557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648942"
                     /db_xref="GOA:Q4QJC2"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC2"
                     /translation="MPPPPPPPRPDPVTLDQIFVQLTAVDVAYDSKAYHLVALNTVAF
                     HPSVKLFLFEEPAAAAASSSSTASPDARSTSSSPPAAAVLNKLRREKLLKNVAFMLAQ
                     RNNAVCHECRWETVSLLGELCRMESAHSGAPTSALGQLEAKLNNYAKANLEYLAQLPW
                     FRPAINSILKAGGDTVDDDANGDVSVAAATAKKARQQGESSTSVAASSSRSALKEKLT
                     AAREAGRNSRGRADSSNGNGPEAEEEDEDVVIALLDIRRALPTCHRVSGSGRGTDNAD
                     VVFEWSDANVEQARDLMFVDASTSMLHLIPSVARGCSDVCAQCQKRVPAASTSAAAPL
                     LRCSSCKAVYYCSAECQKTHWTTVHRTPCRAYKERCDRILEQYYGTSTASGKKKDLKT
                     GEVVILEVPLEPSLFFETRRYLYDHRDESFAHVDYSDYFMKYTVRGS"
     gene            <298330..>298821
                     /locus_tag="LMJF_05_0810"
                     /db_xref="GeneID:5648943"
     mRNA            <298330..>298821
                     /locus_tag="LMJF_05_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687506.1"
                     /db_xref="GeneID:5648943"
     CDS             298330..298821
                     /locus_tag="LMJF_05_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648943"
                     /db_xref="GOA:Q4QJC1"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC1"
                     /translation="MDKITSIISVTTGSGLDGAEGTDSQESLCPSLTFKQRVQGCVGC
                     AVLGLLFFVLSWVTVFLGDYVFFGVLFTLGSLTCLGSTLFLAGPARQFKSMFNEGRWI
                     ASTVYIITMVLTLLCAVLLHSGLLTILMSIIQLLALAWYILSYIPFARDIVKGAFSRL
                     MNR"
     gene            <299726..>302551
                     /locus_tag="LMJF_05_0820"
                     /db_xref="GeneID:5648944"
     mRNA            <299726..>302551
                     /locus_tag="LMJF_05_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687507.1"
                     /db_xref="GeneID:5648944"
     CDS             299726..302551
                     /locus_tag="LMJF_05_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648944"
                     /db_xref="UniProtKB/TrEMBL:Q4QJC0"
                     /translation="MGKSNPRRRNKASAKNRPKHHQGCTEVEADPVGHVVLTPAQPPH
                     AFTPRCVQQLRESREYAVLEDACSDIAHFALQLQHNSDFLREAVPQRLAQLLIFSPPY
                     ELPQLNTNADATPVVVSPTLSAASMAGEEEPQPHKGILHMQIAAAEALRTLVVNSEQD
                     RVIDALTSAGAGAGSGDRFVEGLACLVQTGWQRVQQARRRIAPEDWMDVNGEEGEEDA
                     GSGGDDEAAAESEAEPAAQASARHRRCRQSRFTRSLYFILLRHLEEVLALASVCVEAS
                     EACAQTFSSTSTLLLLLDVLRVATTTTWETLLHPSANYYADEAQVPVASETVLAIRAF
                     KRREAGLLASLAVSTADLLLLLSPENQSLAQVFTGSSEGNGAAVTASSSSFPSAAGSS
                     PAMTAEQTAFLNTAVDAVDLRAWLAEKPAVEVQLQERFSDASLPSFLGAQHTAVAMER
                     ERVLHDLLRATLSIQGMLLHIAPVAANLQRVLPLLDDTLHKASLPMHVWCGVLPLLMG
                     TCECADDDVRAVATTLTTHRLRSTQAAVRLLHVMVNAVGEENDTDQYEDDEAAFAANP
                     LAKLLQSGGLLYAFGLLLKDVLWMSPNSDSSGNAAIVAGATYPTATRDVMAWQAQQRA
                     LRAEASSNAAATEMQMVLLATEVNVWEVASTLLLMLPVASLGDPALMWRALLQAVLSR
                     YQLHLDAAAMEAAEGEGRGAHANILQHSARTHQLLWMQLESLGQMLWTMQRKQSKASG
                     GSAAVTACNHVQATSADVDLLIRVFWEASASTLLKQSCVGTVGLLCASMQREEAVATA
                     ARFALAVVANGGPAATSDGTKLLDVYAQLVPAKVPTCPAERRVWRQQLALADAAATVR
                     CEAANTLMDLFLDERHDAAVYWLLGIQEQLIDFKRQLAVYVKRRQQLDKETKRLYHVS
                     TETPDAVQWSEVLENLCGFIDYKAHHK"
     gene            <303576..>304496
                     /locus_tag="LMJF_05_0830"
                     /db_xref="GeneID:5648945"
     mRNA            <303576..>304496
                     /locus_tag="LMJF_05_0830"
                     /product="putative methylthioadenosine phosphorylase"
                     /transcript_id="XM_001687508.1"
                     /db_xref="GeneID:5648945"
     CDS             303576..304496
                     /locus_tag="LMJF_05_0830"
                     /codon_start=1
                     /product="putative methylthioadenosine phosphorylase"
                     /protein_id="XP_001687560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648945"
                     /db_xref="GOA:Q4QJB9"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB9"
                     /translation="MYGNPHKEPVAIAVIGGSGVYKLNCLQDAVYHDVPTPYGNPSGQ
                     LCVAKVDGVPCVFLPRHGPHHQYNPSEINYRANICALKQMGVRYILAINAVGSLDESY
                     KPGDLVLCDQIIDKTYMRKATFFEDGVVVHADFAHPTSRIFNSIVHEALLRCFPDVAA
                     GKGTFQIHSSGTLVTMEGPQFSTKAESLLNKQMGGHLIGMTSATEARLAREAEIAYAT
                     VAMVTDMDAWSDAPHVDAAQVTKVMAANVEKAQRYPPEIIKSLAQNLFDDPAHHTLEY
                     AIVTKPEHIPAETKQRIAPLVASKYPQFAP"
     gene            <306548..>310738
                     /locus_tag="LMJF_05_0840"
                     /db_xref="GeneID:5648946"
     mRNA            <306548..>310738
                     /locus_tag="LMJF_05_0840"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687509.1"
                     /db_xref="GeneID:5648946"
     CDS             306548..310738
                     /locus_tag="LMJF_05_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648946"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB8"
                     /translation="MGNDLSAMSGGGRNLEVWSEARARRVANELPTPRTIPLGHGDHL
                     VPPALLLDAEMRSAADDASSTSSLRSAGTVSTYSTQHSEISKANQIPDPQPRRRSMSM
                     SDMNAATALLAAAAPPQQQQRQLQRRTQYSMYARQMRRPGCDRGRYGLQHHNSGVDFM
                     VANDFFNRSDSTLGSEADLDSSSGIGSSGSNDEEDDAGGVHHRSGMVPREPTLPYGSG
                     RRLTGNELSAHPPRRERNEVDGAPALVSTATAAAAASTTSPPHAKSSSTGRAETITTK
                     TVSVVVSGVDCSSDPPLALTSSRNSSNGSHDSKSSAASLRKGGATPLPSARQGSWHKR
                     LLRPASRGSIRDDSISGSATQRGSPDAADGVLSSHEEKKCKTSKRRIHPEGLLELKRL
                     HRTRSSVAAPRTSSATAGAATTAIGVEALVSWMKLSTTKESPRTEAKWRHTSGDLSGC
                     TAPPLSNEKRGGQCGSFTRVSSPPAQQHHTTGKDSRGRPGANSSGGPPHSSESPTHHH
                     SRQVQHRHCGGDDGNNAVPETVLPRLVDTKHHHRQPRRNRSLGGTLDLHDEGPNDFFA
                     STQRSGQYRMLYGMDSDNRSSTASMREAVCMATGGGGAAAHSFGSLFAGSRAASLYSV
                     SSSPGQAWTGDYADGGVMQLPAAVDHRALDMQKADDGGGTREASRHHSSRVLPCSGSG
                     VACVNNTGAFDATSQPQQADLQRSMKTHLQRMTYTSKSPSLVTSNQVVSARPENSQGI
                     QHSLISALPMPPSVVAAEAPANRGHVGAPAGMREALSAGAPCRDGHGHVHTAASVSRC
                     SSGDRSISPDVSVRELVKSPAKAVSPPLLPQPPPPQTAVMRAKTHSFRGHGGGGRPTN
                     LSATEGVAASAVSLKRHSSCAGRRHHHSNGDDTLHATASVLTSVKGSGSGSASRPTRA
                     DSKDLILRPDRTASARRHRRGGGDENVPEGSDSRQRRPQNRKLSARMHFTSFSFSSDS
                     FLYGKVRGRLAKAAAVAANSNSIERRRHTSGCGSSGGTQAHARHHAHTEVDSVALGAS
                     PSASSRKGEAECRHRGSGCDNESEMGSVMADLDDLLLGADGRAPFGNLTALYLRSVSS
                     SLSLAPSSRNSSTNGSCVSSGSVRALRKRAARARDLSASSSVDSEAIGRLHPHWTAPP
                     LPQQQQYGEAGATATASSMYRLPLVKTSNSCGGAVASNGSASSAVTGGTRGMNLQSIK
                     PNMAVDVSSSPDASSDRPANINYVLQPLRSPAANGSTTMAAASPEVHGVAKSHSTSSG
                     SGVAADTSGAMPTVHGHEKPSQRPSMAPNVPCALFSGNGGGAHLPRMPPTSSPRHASS
                     KRNDGTDSLTVSFPDANGRGDGGSGAAASSSAASLLAGQSRDSSAKRRRPTTQRFTPW
                     SVGTSLFKALQEAQEPPS"
     gene            <312098..>314092
                     /locus_tag="LMJF_05_0850"
                     /db_xref="GeneID:5648947"
     mRNA            <312098..>314092
                     /locus_tag="LMJF_05_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687510.1"
                     /db_xref="GeneID:5648947"
     CDS             312098..314092
                     /locus_tag="LMJF_05_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648947"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB7"
                     /translation="MPAGANSRTPATDFVQDYAAKRQAQMERARQLREDRLQQQQQQR
                     QSSPKTSGGGNAYNSSPTYTAVPSASGGGTATAAPTSRQPPPPSLNVPRSRHVTPGHD
                     SADSGSSPGKCGDGCVLYIKEQDFKQATQAGIITPDQARQLWAMLSNQIIRVCSPSAH
                     ANAVSVSSLLALSNNSYNSSGWAAGGPQSTGGSEFGASISLESLRTSIAYFKREQQRL
                     QQQGGGGAAGAAHGSNAQGRHPLSSSPPALSNTVGQPLSQSRGLPQRQLQYDGNANSD
                     YCRNDGAANDNEQRALGAPMPLRGSGGSGGGGRGGRPAWNSDVEVRHEDDYDDDRNRH
                     APSSMSTMNSGAAALKKPRTGRTNTVRPAAKGPAASSSPAAGASGVLGTSAQGRGYGS
                     DNEEAGNNAYMPQQPSSAVPRGAKAGGSGAASRRPPASRPTAPPPSSGAPVNLDDVPV
                     GGGGGGGGGMNDWANAYPPGMVPPTSTGGNDAIAAEAAAAAQEPMQECRTCGRRFRIS
                     VVMRHEALCRNQANKPRKVFNMREQRLDGVEGIKEVQRTAARSGGGGGGRGAGGGGGR
                     GGGADAAAGAAKGKLPKWKVQHEQFQAAMRAVRQQKEAGGGFGSGRMAPPPAPIPEEY
                     DDRVPCPHCGRKFAQDVAARHIPKCATTIAKPKGIRPIRR"
     gene            <315195..>315662
                     /locus_tag="LMJF_05_0860"
                     /db_xref="GeneID:5648948"
     mRNA            <315195..>315662
                     /locus_tag="LMJF_05_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687511.1"
                     /db_xref="GeneID:5648948"
     CDS             315195..315662
                     /locus_tag="LMJF_05_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648948"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB6"
                     /translation="MLRRSPVPRRYRTAWRELLHPLPVWARRQQWLKRDTVEMNEAIL
                     REPYYRIKTFAQPAAFVSPRVSESAAHEPDTQQSSRYGVDRQLRGPRRAVSPERLQEL
                     REQLQFVGSIGPKVPPAAGAGTAYQDEYGTRLRPRYPQSWDTVPPHQPSRSEI"
     gene            <316682..>322450
                     /locus_tag="LMJF_05_0870"
                     /db_xref="GeneID:5648949"
     mRNA            <316682..>322450
                     /locus_tag="LMJF_05_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687512.1"
                     /db_xref="GeneID:5648949"
     CDS             316682..322450
                     /locus_tag="LMJF_05_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648949"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB5"
                     /translation="MASGRSLPLPTVCVCFPYVPLYSMPLSTFSVRDIVATPDDADVL
                     QASLEELHRHRCVKRQEEQARKRWEQHQLLDEDAGSWGTAQELAYRREVLHTWTRQYP
                     RLREAMVSLASASSSNTAATAPAATTAAAFSVAETVRPSYPTLWRIPAGTIPTDFYTH
                     NAAMEVSQLLSTPQRQHATTEAVKDYSAHSCLVRVRWEPVRLTGLFTEPPPSAASSFV
                     PLSQHPSDSTSHAQLQPQRVLARWPQGKPASAKMAAVLRSIGIEERKREQWNEHLQRQ
                     RQKQGEREAPQQRLHDRVRDRLSAASVKRFDNLASSADGCEPPTEEGAVDESYSAATA
                     VRAGGVVEDGGSGGGSAADASESALGHELYWPAHITRTRALFTGAACLQDTFHGLGQL
                     QRYERFEPVLALALASSLRIVVDVVYAVDETSEAFGLSIDPVVHFDAMTSSDARRNVA
                     TGRDSDAMRSINLGSGCGSGASRHGIATDRRATLSSSEISSSMAEDECPVLLPSSLPP
                     VLSDLNYAFMAAPTAAGAAAGGGSADSRRAASQTTSFIDDSTTTSTAVLHRSTLSTSP
                     LSLYTILAGPASQTHSIVLLRPTPEVVCAARARALQELEQRWLRLRQALVDRLVACEE
                     QAPAAIRARSPTLSPADVLAVELPNADTYASPFIDRSARQCEGLPAEPVGAESLTEEE
                     MQRQTRLPQLQGGHLPRRPLTDQVGGPHGVNGRLLRLAATSLQTPPADPGLRTRSLPS
                     SVKRPSRGSGAQDDGASAEAAAPWSASTPPTLPRPLQQSPCTPRQSHTRRADQGAWST
                     DEAASASAGGDDGCGGLVRGSERASTTATPRSDAGIPRTLQLARSPVDPISLCSPSSC
                     EGPEVPCTDGSSSDLDGLRSALFSEGRRAATEKIRTILAAVRTSKERPRVGESTAGAP
                     QPPATMPRAHLSALAVEASLPVSADAWRLANDTDRVGSAAAPGSPRKASPSSTSLPSQ
                     RHRHNDGSPMDADTAMQLTHDDRDAVGDSPRHRTCSGVERYSAILSVSAQSVPDSQPM
                     SVLQEVSVTSCLSWDVRNTMNDTASQHSNTGDGDGQVAPCSGESGATLPTSPSPQLCT
                     PIPTYLPRPSRLNKNGALKMPNLSTPDIAVTLATPCSTVSSPTSPPPHAASPMLQTNF
                     FTAAAAPPHAEDHSQSPSRVRYPILQQPPAPLCHADTASARSSSSSSDATRFVLTHTS
                     RPEEKVLGGCTKNEKTLSAVPARSDPRTEARSAPQATRSTALESSSSSDDAPVLSGTA
                     TYSSYIPVDPLSSVAVAQGASAAWRAGAAASSSPQTPHEAARELRGASSSTPSTRPFS
                     SPTFLSNKCLVQLRNLEQPQREPMRRVSPPPPPSLSTSAEARARVHLGLSSLRENDDV
                     AALSTDLHHTRGAALGTVPRKIAVVVEVGPQQRPRLSERGLAGATRHDGARHREHVSP
                     LQSGTDAVEATTTSANHQVGHGGSSDTSGAVESNGSPLSRRPPLLASSPATGANGGAH
                     EAASISTAPCAVASQPPSQHTDGTGATGLASGEPRPSHCPQASASSCMHHRRASPRAP
                     KTAAAPAIDDNAEGSPQRHLQRQRRHERTGSVSVGVLCSELSVSVDREVELPEQPVRL
                     PEVPTPRSPQRSQPHQQPYLVTVDAAAAKSVRSGEPAAGLHNLDKRMHSGRVGSPEAH
                     QWATHALQSRNVSADVCSPYRQAYPHHRSPGEAAREDSASSPSSASSPPLLLPKSRRP
                     AQRPSRHVRSTGSEKSDAVAPRALSTSCMRHTTPPAAAASANSAPSSVNFRSLISSAA
                     PSPRGTSPVPHPSDCFSRSGRGGAGELLVLRPHRSTSSSQHNRRYHDGAVALSPSSLS
                     TTRRHTVLVRRVVRRRRSEVFVEEGGTLVHRAPMATPHLPSSSSSSGGSGRGASAPTL
                     PSSLRDTRAARTRTTPRRHSHT"
     gene            <323404..>324021
                     /locus_tag="LMJF_05_0880"
                     /db_xref="GeneID:5648950"
     mRNA            <323404..>324021
                     /locus_tag="LMJF_05_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687513.1"
                     /db_xref="GeneID:5648950"
     CDS             323404..324021
                     /locus_tag="LMJF_05_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648950"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB4"
                     /translation="MQRVRLAAPAAAAVSVSSSPSPSAAALWTPSRGFRKELFEGPLD
                     LKPGERNARKGPPVAHSLPVYKTTHKLHNSVRWKNANLVTNVAGGQDYRLRETQGEGT
                     FDETGMYRDWLYGDERRYANYIGLTLGALAITLFWYTMRVIGSETWDIPTPVLASQRK
                     RLAKGDVEGSGGDAAVEVLALPTEKEIRQDALAMLKRPTTLSKSS"
     gene            <325243..>331185
                     /locus_tag="LMJF_05_0890"
                     /db_xref="GeneID:5648951"
     mRNA            <325243..>331185
                     /locus_tag="LMJF_05_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687514.1"
                     /db_xref="GeneID:5648951"
     CDS             325243..331185
                     /locus_tag="LMJF_05_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648951"
                     /db_xref="GOA:Q4QJB3"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB3"
                     /translation="MNHNSVAEGEDGGTGADAAAVVPVNETLLYHQTLIPTQNVTHAI
                     EGSFTLPDANDLVLIRHNVLELWRLYAENANGGVECVCRTPLMSAVYAAVAVPTSASS
                     MAKAGGTGSAASPGGSVAPVLDDATTTAHRSGVHYLAVTSETGYVTLLRYQLDEPPVP
                     TRLSYGDDSDEGNEGVGGNSGASGGATMLVTTSLKGRFIKVSEVCLGRSGARLTVPGA
                     RMVVDPAGTALLITALMRTKTLVPITANETWDPVKSVNVGQDDDDDAESDADGDDEDE
                     DGDDDDAGEHQRRGPVTGRELRAARRRRAAKVRRANGAINLSTPIEMQRQTVLYSACA
                     LDGYLDHAVFAVLEEEIVEARDAAAAASASNPANAAAAAAEASGGTFLKSSGGPNAVV
                     QRHKHFVLYAYVPSLKQVQRTQLVHVPVTAHRLIAVPAAPYGPGGVLVCTDTELIWYD
                     VSATQQQQQQNSAAAANGRVGVFKCTYAFPRRLDCTEILYDPSIIQHTLTCFGRRFFM
                     LLQDEQGDVYRVFLEAGDVQRAYEALRTRELAQANPELFLQQQQQQQLAANGGVAPAP
                     VLPPVPNPLSVHYFDTLPPSSAMALFRRGFLFIGNEAGPLHGLYKIKSNGYTADREYI
                     VKRVRRERALPMLSSSKAEKAAKAEVEDGAVKKEGDGADRKRQRAADAAGTAVKPEPQ
                     DPTAPATSSGSAASSTLPRIKTEQTDGDGDNLAAAAASATTMRPPAPSTATAPAFKTP
                     MEVRVIKVYQPHRRPQHVVQLQSFPNTPAITSFTSHLTASTSTPATASDGADHPTGFG
                     GGPAPAPEQSSEQPEIYFSYVGGRGGESVLVQARYGYAAKLEGRQMLPTVFSFVIPLP
                     SALSMQSLAHQQQAAIEAAAAAAVTRRADEKTLRGTGGAARQHAQRLKALRQLAATVS
                     GARDQVCTDRVLLCTRQGTTVYRIGSTVEQDTGSSFITAERTLAATTLQYGCGYVQVT
                     PRGINVLSCVDTAAGGGGRLDAAGRRVHGSGDGAGASSVVPASWTHPHGSTVLAAAVT
                     PTTVLLSFHQRGGIASFDFGLAGTELQQRDVLPTFPLAPVVALLQPPASAVSAALQRE
                     LQALLWNSSAASPSSAAAAAAASAAAAAAAAQTEQLAAIATVNHEVYLVHPRKLREPL
                     EKITCRRSSSPDAGSSSSAEVTITSLLLTYLGDTRGGSDAAAALIGGAGPRSGRGGNR
                     VRGGVAAAAGRRQLFLFVGHSDGMVTRCELNPSSAKVTATAELWCGARPCQLVAGDGE
                     TYCYVVSGERTWRCEMQDRTVRMAPYSFPTRPTSFARFVLPSRVSAAAANGSDSAAPG
                     AQDSANEEDENALAAVESITLVPREQQQEVVIAVQNRELALYVSNIGAGGGGAGGGGG
                     GGPGSGGVEYSFQHHPLPLAGRRLLQHPTRPAYLILCGVEHRSHGRQEAERHRAEDRA
                     FLTARMADTTQAEDRGALYVEGVYGGIPYTAPQRSLGRPNAYHSTLQLYHRDAQRLLP
                     PIHFEPNEAITSVAVGSFFKEFGREPVVIVGTASSYTHGAGCGTAASWRYGFLRTFRC
                     ASGSVGGGGGGGADVLLRLELLHSTYLRPDETGGSGRDRRSGANSSAGAAGGGGNGVG
                     GDAKPDYPSALCICEPVGILLVGMGAAQGLRIYSWGKEHLLRRRHLTNTPGQRITAID
                     YVFASPPGSRNLNARNVSFFAADLYQCPYGDAEGMRMAREKQLLIICGTVNASVFIAA
                     LQPGHLAPAAAHGAAGATIPATPSFLLQIMTDSVPRHITSVVAVDERTIAASDRFGTV
                     VFLRIPETTRTQFAQPVHQLQDAELIAEEAYLRTKQTFREVARHHVGELVTALHVQPY
                     DPSQGTDAALATKIVYYSTALGSIGAYVPLLSEEDGALAAYLQPLLHSHMRPLLGPPP
                     ALPPASYLSHHVVDGDVAQLLRGGATTPFSAAAKDDIAEELERQVKREAARRNILGLP
                     KRTLPSLTELIAKQRALLTLPL"
     gene            <332312..>333172
                     /locus_tag="LMJF_05_0900"
                     /db_xref="GeneID:5648952"
     mRNA            <332312..>333172
                     /locus_tag="LMJF_05_0900"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_001687515.1"
                     /db_xref="GeneID:5648952"
     CDS             332312..333172
                     /locus_tag="LMJF_05_0900"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_001687567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648952"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB2"
                     /translation="MATIRDAFTRVAALATMLALLCVVPTATAATISDGSTQYFVKLW
                     SGKYPLKYVWSGKDICKYEGISCDTVKQTVSMLLPKIGLTGTIPGYGSKAGFKPANVR
                     VITINLMGNDKLTGAFPGHYGQLRQLQELYLMNTSLQGTIPQAWNNLANLVILDVSNT
                     KACGNLPAWDAKSMKSLQYMHFTGNSLMKGSIPASLATFGAVSFNTTGCRFCGCLPSE
                     FSSSMYMMIQLISSQPQVNTQDCMTANTCTVQHMSCKAKANAAAIGCSRASVAAVVAG
                     VLVVVASLLA"
     gene            <334884..>338120
                     /locus_tag="LMJF_05_0910"
                     /db_xref="GeneID:5648953"
     mRNA            <334884..>338120
                     /locus_tag="LMJF_05_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687516.1"
                     /db_xref="GeneID:5648953"
     CDS             334884..338120
                     /locus_tag="LMJF_05_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648953"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB1"
                     /translation="MTLRGGGGSGPAASSLPPMDFPLHVASPSPTASSPLPAPTAAAA
                     ASTALLSSSDALELMRTYHMYVRVHKTRCRYLLLLLLMLLYYFQCTLCGRYDLLMSAA
                     GEGSYGGLSSGVAGSGAVGGAGLAGTGAGGPSKDGGLRLGLAAPERQAAGDDSGLAGS
                     SEGRRRRYARPPFITRALSGIGATVGRMDLWEIEWWPPSNRTPDATDAHYEHGLNVAT
                     PTAASLSLARSEPPWSVDTQRGLVAAIARSATRLSGPLFGQDPPPYERALSAFFRTRQ
                     ATSGGSCNRCQARAIDKDVQKELINYNAFARDFKLRVPLLLYYNRMPVYAMMQHLRLM
                     RARSYQFLDYMSRGHASQNRPETATGDVADNPHLHARQLTFELTRLSLVFYLQRLHLR
                     ALRHADAMRLETFHFLRYLSSTIPVLRSVWVGQDHCSWPGVSCVVVRVPLNSLIDSEH
                     PALQAFVEDIFSVCRGPQCRQRRCAAPSCSAYTRRLTRRLFTSAAPAYWLKWDRMDDT
                     AAMDEMIWEKTPTSSRGAAGVDGMAAAPPPSPSAASTGTDGDAGRSGSTKAAARSRRG
                     TPARSKRSVWTEQLFAYEHPHLVLTEPTVLVDIDVQNIIQEMVEPVVASAPCNDGDDE
                     WAPSSPSPSATLSGPPSDLATPEYAERPLTGDLFGMQRRLLRTMAEAAPRGLQYGKQR
                     NDSSTVTIPYTFVKLNLANMGLRGYLPDFYDIASAYDEQRDAAAARGRRESTNTGGSS
                     GSGSGTQSGFTDACEAANLPSATAAAARQCGSKSAPEVSVLTPRSDLYWGRRSRMRML
                     EARNLSSASLATAAARQPLASVAAIGSELQWVLRRLEKIGQRNHHEDLAAYFSEVASL
                     ARFQNERWSPYRWPEAMITVTSDVSQSATRRLYSVLEDSAFTPNFADPVQSIDHSVNA
                     FGELNPRLIGLLSLDVSANPLLTHLFPRTWLSIPHLQSVQTTGTSILTPPLRLRPRLY
                     NHAAYCPASSMRFDSDMKADADEAMGERCRRDTKVAAAMETAREKVEVSSATGSSLHD
                     KDFIGAVLMPPFSKIDTLFSASSPSETIFQHQDPLTGRCLLDYPTSSP"
     gene            <338705..>342049
                     /locus_tag="LMJF_05_0920"
                     /db_xref="GeneID:5648954"
     mRNA            <338705..>342049
                     /locus_tag="LMJF_05_0920"
                     /product="putative paraflagellar rod protein"
                     /transcript_id="XM_001687517.1"
                     /db_xref="GeneID:5648954"
     CDS             338705..342049
                     /locus_tag="LMJF_05_0920"
                     /codon_start=1
                     /product="putative paraflagellar rod protein"
                     /protein_id="XP_001687569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648954"
                     /db_xref="GOA:Q4QJB0"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QJB0"
                     /translation="MLLSSPSAAAPNASGSGSGGAAAGDEVVPPTRETSTALSTAHAQ
                     LVLLEYAIRAAADSAVPSDASAQSHRKASEVTRTTNATVGSQNSLLPGPVPAESGSLM
                     SIMAATRLSSVTATAPSGASERLSALHDNLRRVRHLMQQYEEASQHVIKVHLLPSPET
                     GEETLGSVTTPTAYAGQRTKEVSPQQLSVSVAAAAVDRPFLEQHSSNSANVASNGKPA
                     AAPQNIPPSLHQRRALASDAVFTRFCGLRVTPDQLLLPLPPPATPTTSPTPPALAQQH
                     TSPRKPVAPRGIDNDAEEKKNGSGDSLVSHYSEPMKRHGSNSKTRSSQTAGSPNAKTQ
                     ESSASSSPRHSPVSCTAQQRERTSTEAVLEEYAKLFYRPSATAVSRPAPPRSTAIGMQ
                     SSQSPVVAAAPAHNTSATKAGSLSSSTPADDSEVARQLQETQQRFAALQRCHLFAYEA
                     HLRSAAAPADSQGNGSDVSTIKRGITTLGAVTTGANVDDISWQHIPVAVQHMQDSLTA
                     LQARFTRDSHYARCGRQPIALVHQLQTWTQPLIQNLNELLSNSTLEEKSENTREKLRR
                     MKFDAEELQQAQAQAIANGDMQRSEELYYEQGSLAEAMAGPYDELEAIMRKYGEVCVD
                     APLTRVLEQRDLLTTRLTRVIEEYTSKLSEVTLDVERVKEKRRAVAQARHRQRNNMSA
                     YNHTWKKAWQTNSDQQMACYRAMEQLEKQLNDLQQTQSFLVDDWISHVTQERQREEDA
                     ASFACFADARAAALAETQHNLQTVVEGVRQYTGAVQFSCRHVEAFAREVLRGHLSHSQ
                     VALRKDRLEQFRALYLTLGDLRFKKARNAEEIEKKIEYYTLQQEVAMDALNPKAKEFS
                     KTKQRYEAAKAEVQKQIDQLDQRSRLQLERFRPTEQLLREAGVNFVSPEEELARRTQQ
                     RSQKLLEYQQLIEDCIGVRPTATTSSITSRSPATLTTVAASQPAASSARAEGAKGLTG
                     TNAPSPPRLQAVESLHSCPLPPTAGEAANPTATASGALCGKNGRQLPPLRRMNRTYPP
                     SQRTDHSDNSDEPTATTTEPSPQGANQTSTAATVAAAPTAASLSSLHATEERIMQGIS
                     KMAVTDRGRTRTSSVTASIRCKRSKR"
     gene            <344082..>345476
                     /locus_tag="LMJF_05_0930"
                     /db_xref="GeneID:5648955"
     mRNA            <344082..>345476
                     /locus_tag="LMJF_05_0930"
                     /product="putative ubiquitin-conjugating enzyme"
                     /transcript_id="XM_001687518.1"
                     /db_xref="GeneID:5648955"
     CDS             344082..345476
                     /locus_tag="LMJF_05_0930"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-conjugating enzyme"
                     /protein_id="XP_001687570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648955"
                     /db_xref="GOA:Q4QJA9"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA9"
                     /translation="MSYASSAIKRLSNEYRRLQKPENRVREYYVAPLADNIFEWHFTL
                     RGPGGDDNSLPYKKGIYHGALIFSRSYPLEPPDILFFTRSGRFAVREKICSTISSYHK
                     ELWQPTYDIALTLTALRHFMAQEDEFGVGAFPKNMIARETKEAWATETWSFTCSTCGM
                     ATKDVWETQMKMHPEISPEKEAQVPKLPPPPPPPATPAASAMAKPEDAEATQDAPDTA
                     SSPAPPPSATPSSTLLPPPTAADASETAAKAPDAPQSHNAPKDTPSSPALASTVVDAN
                     ALQSPTPGVHGTPQTPSPAAHEHTSKSGAAINEEGAMSEDDDALACFTDVSPARVVRA
                     PVAAAPPPPAAAEPDRLYDMRPESLVCDTPQSEAGLAAAAAAAAADATPPVTSAVVDG
                     VVAADVAGTSASPLSPAAAVVAPPQFAQRVVFGVSIMEVSIPLRLLDRAIIVSFLFVV
                     LILLRRGLCSLLMS"
     gene            <346532..>350428
                     /locus_tag="LMJF_05_0940"
                     /db_xref="GeneID:5648956"
     mRNA            <346532..>350428
                     /locus_tag="LMJF_05_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687519.1"
                     /db_xref="GeneID:5648956"
     CDS             346532..350428
                     /locus_tag="LMJF_05_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648956"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA8"
                     /translation="MITVEAAGSSSTRAPSLPKHTYVETRMLGQLPSQMASSSIAAWC
                     DGVQHLMEEYFSRLGEVVVAHLGLRAPSMQDQRSSSGSGTAEKREIMSKLRKEHKENL
                     ELDVQATDIEVTEMVLFQQLWAHHQLQQKRQRPVAADDGTEKEDRLSGASRGGASTPD
                     AVAEAALTTRDEASYIRPPSSSAAAAAPEDAAPGAPCDMEGNPFLKTQHHPASELAAR
                     IPADLLELFRTAQALHSAASRSTGPPPPATPSKEAAAAIENPFDTTADRPSQAPVVLS
                     EEESAQAAAMALLCFRYFYSSNSMPASPVEAAAPLLSATEPPEQPPQPAHVPEKLPAA
                     TIVPKQKRQRHLAPLSHATPTSPALSAHASHGADASSHISLSSPAAWRKLITPPGSLD
                     PAEYQQQPSSTPAHATDRLRAELASLFPQQAQQVQGDFSCGLPPQRALLTGSDTTVNA
                     DAAVEKSRPESKGRNNHVAFLNADRTADGARGACGRRPPLTHPTVGNPPTEDAHNSGA
                     PRSKGGVKLPLLTSHAPPASAGERPPSAAASSSPPIPSTPTTAAAAAGTPHVMSNQSP
                     VLPALAPGATAAPSIVTATTAAPGTETAASAQKHGSGTTKAKKRGGSGQRRRALRLLP
                     KSVVLPPNYSGVHGEQLTMAQLEQLVASVSEDCTVAQVDVKRQYDAADAAAAELYRLQ
                     QAVARVLLENIQLEKDIYTLTATSHAYAAGDEDGDADEAGRATDAAAGVRGRHYSDGV
                     DPSGGRYSDANKSRVRTGAMSCFAASTLSPASAAHPSAGKRKRQLILPPAPMPLPHCQ
                     RALTVASLLLHAAGEKKAAPPVSAAAAAVVQPWPWQQRSAPVEKAKVSPKSSCQHKAR
                     AVASAIATAAEGVTAVDGQQEPRTILQELRSAIASREAEKAQTLAEVDALSSRVTRHD
                     TLLHAVAEYWRRNAAVMKRQHFAVQSQPKQSTSSETITRLGDGWGSENAVGTITPPHL
                     FDAADGTHGVVTQANSRNSGHSTSSRKCSHSTVITAAMSLSGQMTNLGGSPSQVQRAL
                     AQMEALSPTPLSSTPSFDLRITSPVPSALSPTLQMQTLARRQIVPPRQRAQKSESAPN
                     KPDTITATLSAATGAAVEDELGGRPHQKVVAPPREGPTAAAAAAAPSSTRTDTDTTAT
                     TFIRSPDSVFDAMGRPPSASAALTVGAPAVLKQEWRKNEHGLAVSAVAVNLFNDSPRR
                     CPGELLASPVGFTQAYDRAAKEDDNVCGSGSYPTAPLHPSRSTTANNSHNYAIGGMRR
                     GDEDVLDRGSWRTIPALQLENVDEIAEFIYSVFERP"
     gene            <352756..>355479
                     /locus_tag="LMJF_05_0950"
                     /db_xref="GeneID:5648957"
     mRNA            <352756..>355479
                     /locus_tag="LMJF_05_0950"
                     /product="putative glutaminyl cyclase"
                     /transcript_id="XM_001687520.1"
                     /db_xref="GeneID:5648957"
     CDS             352756..355479
                     /locus_tag="LMJF_05_0950"
                     /EC_number="2.3.2.5"
                     /codon_start=1
                     /product="putative glutaminyl cyclase"
                     /protein_id="XP_001687572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648957"
                     /db_xref="GOA:Q4QJA7"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA7"
                     /translation="MQHQSLAARRRGRRLARRGESAFWCSLLKRCLPCLPLRWKSVHA
                     TSRTRRILMGILLCLITTLIFLIGLLVCLTWKSNRSNTPLEPAAVQSTHAPRVPPEVG
                     VHDPWAEDPVDVAVIRQREEAVVRKWKENGFRPTYWEVERRTLPRLTKRALESWFEHG
                     RRAAASATAVDVAEDVLTAHAWDAVDGGDADADLFDSLAFLYPPAQQRQHYRAAMDAI
                     LRHGPRVGGTKRDALLHHLVDEGLGRRRYDAARHAYHPAPPHLSPRGKELLEKAAASW
                     PDAPHLAAAPQDDVAGREPGWRWSLSWDNFTADIPIRIDGSSRVEMQNLVFQFPGGLQ
                     FRRKQAAAASAAATGAKDALDEFVGGVPNRRRTRADDRKDVLEAEYHPADMTGETVYT
                     QENFLQWAQDGVPFNPRPALVRGVPGTRVVLSPDAKGARVPLKPSLSAPAAEPATQQP
                     VKHAVLAAHWDSKYFADIPFLAACDSAMPVVFLLRTIKNIAVLTDVAEALTESYKAER
                     SGVVGGDASAAVPGLTSTFRNATTEAEVRERLASLLSPAHHALLYQYFFARPYSIGGE
                     QQNFVAAGIRNHPTKVEVDVRTWLDWVQHLPIISVILFDGEEAYKHWSGDDNTYGSRH
                     LAQRWRSTPSVMRSRHTDGPQSLYDSVDLFALYDLMGPAGTTFRNMYPTQSGIFYAGL
                     SQREWELRHRAMQHSSAISAELLWRYDEATALPPAEAREKADPFLRLLGPSPHEAVAS
                     LNAAYTRRLLANNASRPSVASLPRSWLMYGSPHEMLTLHSVARTTHDVRFVENFDQLR
                     VYDRLDREIAAESSFDAERYLNTINHNIFFSPSQQEDLRRNRDVFVADDDHKHWLDTQ
                     RVLHLIPIPFPKSWHTANDNGSNVHDGTSTDLAGLLWSTVLELGDYWTRKE"
     gene            <356672..>358711
                     /locus_tag="LMJF_05_0960"
                     /db_xref="GeneID:5648958"
     mRNA            <356672..>358711
                     /locus_tag="LMJF_05_0960"
                     /product="putative dipeptidyl-peptidase III"
                     /transcript_id="XM_001687521.1"
                     /db_xref="GeneID:5648958"
     CDS             356672..358711
                     /locus_tag="LMJF_05_0960"
                     /EC_number="3.4.14.4"
                     /codon_start=1
                     /product="putative dipeptidyl-peptidase III"
                     /protein_id="XP_001687573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648958"
                     /db_xref="GOA:Q4QJA6"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA6"
                     /translation="MSHNTLYITPRAVPYCILSIANAFKDLTPKQRHYAHHMMAAGWC
                     GAPVVAEQLSPESLPLLRLFFKVLSAQPLDTFKANSVNAGVDPDEVDQFLEYFAMVYS
                     NMGNYISFGDTKFVPSIPKERFAKIVASADGSPAVDAQLLDAIYNLDDDKLTLDFPPK
                     GLTRYYSPNVTREDAAVANDFLASKKMDGVNTRVFKEEDGSLVIRVAAATERTVPAEK
                     FNGRTIAIYYGDYKEEMARVVAELRKAQPYAENETEVRMLNHYIEHFQYGDVEAHKES
                     QKEWVRDVGPTVETNIGFIESYRDPSGVRAEWEGFVAVVNKEQSKMYGALVAQGEKFI
                     AQLPWGKAFEKDVFSSPDFTSLDVLGFASSGIPAGINIPNYDDIRQTVGFKNVYLSNV
                     VSAMTFKDKLNYITEADWELYKASILAATSVNVGIHELLGHGTGKLLSENSDGTFNFD
                     EKTVDPLSGKPVATWYKPGDTYSSVFGGLGSSYEECRAEAVSLYLCLLPELLEIFNIQ
                     TAKEQQDVIYVCWLNMVRAGLVGLEFYTPEKQQWRQAHMRARFCILQALARAPNPIVQ
                     ITENAKEGVLITLDRERIATDGRQAIGDLLVNLNVNKATADAKRGSAYFENMTVVSDQ
                     YVHYRDIIMARRKPRKQYVQPHTFISGDTVEVLEFAGSVEGVVESFVTRHREIPL"
     gene            359585..359843
                     /locus_tag="LMJF_05_SRP_RNA_01"
                     /db_xref="GeneID:12981692"
     ncRNA           359585..359843
                     /ncRNA_class="SRP_RNA"
                     /locus_tag="LMJF_05_SRP_RNA_01"
                     /product="signal recognition particle RNA, SRP RNA 7SL"
                     /transcript_id="XR_002460059.1"
                     /db_xref="GeneID:12981692"
     gene            359953..360024
                     /locus_tag="LMJF_05_TRNAARG_01"
                     /db_xref="GeneID:12981698"
     tRNA            359953..360024
                     /locus_tag="LMJF_05_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12981698"
     gene            360083..360201
                     /locus_tag="LMJF_05_5SrRNA_01"
                     /db_xref="GeneID:12981699"
     rRNA            360083..360201
                     /locus_tag="LMJF_05_5SrRNA_01"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460058.1"
                     /db_xref="GeneID:12981699"
     gene            complement(<368099..>369211)
                     /gene="MST"
                     /locus_tag="LMJF_05_0970"
                     /db_xref="GeneID:5648962"
     mRNA            complement(<368099..>369211)
                     /gene="MST"
                     /locus_tag="LMJF_05_0970"
                     /product="3-mercaptopyruvate sulfurtransferase"
                     /transcript_id="XM_001687522.1"
                     /db_xref="GeneID:5648962"
     CDS             complement(368099..369211)
                     /gene="MST"
                     /locus_tag="LMJF_05_0970"
                     /EC_number="2.8.1.2"
                     /codon_start=1
                     /product="3-mercaptopyruvate sulfurtransferase"
                     /protein_id="XP_001687574.1"
                     /db_xref="GeneID:5648962"
                     /db_xref="GOA:Q7K9G0"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR015206"
                     /db_xref="PDB:1OKG"
                     /db_xref="UniProtKB/TrEMBL:Q7K9G0"
                     /translation="MSAPAAAPKHPGKVFLDPSEVKDHLAEYRIVDCRYSLKIKDHGS
                     IQYAKEHVKSAIRADVDTNLSKLVPTSTARHPLPPCAEFIDWCMANGMAGELPVLCYD
                     DECGAMGGCRLWWMLNSLGADAYVINGGFQACKAAGLEMESGEPSSLPRPATHWPFKT
                     AFQHHYLVDEIPPNAIITDARSADRFASTVRPYAADKMPGHIEGARNLPYTSHLVTRG
                     DGKVLRSEEEIRHNIMTVVQGAGDAADLSSFVFSCGSGVTACINIALVHHLGLGHPYL
                     YCGSWSEYSGLFRPPIMRSIIDDYGMCMQMQTPSLGDNPKANLDTMTLKVDGAPCERP
                     DAEVQSAATHLHAGEAATVYFKSGRVVTIEVPAVPN"
     gene            complement(<370602..>372047)
                     /locus_tag="LMJF_05_0980"
                     /db_xref="GeneID:5648963"
     mRNA            complement(<370602..>372047)
                     /locus_tag="LMJF_05_0980"
                     /product="putative NADH-ubiquinone
                     oxidoreductase,mitochondrial"
                     /transcript_id="XM_001687523.1"
                     /db_xref="GeneID:5648963"
     CDS             complement(370602..372047)
                     /locus_tag="LMJF_05_0980"
                     /EC_number="1.6.99.3"
                     /codon_start=1
                     /product="putative NADH-ubiquinone
                     oxidoreductase,mitochondrial"
                     /protein_id="XP_001687575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648963"
                     /db_xref="GOA:Q4QJA4"
                     /db_xref="InterPro:IPR001949"
                     /db_xref="InterPro:IPR011537"
                     /db_xref="InterPro:IPR011538"
                     /db_xref="InterPro:IPR019554"
                     /db_xref="InterPro:IPR019575"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA4"
                     /translation="MRQGWLRSSAALLERVHGHLKDQDRIFTNLYNDFGTGIDAAERR
                     GDWYRTKDILLKGHDWVINEIKASGLRGRGGAGFPSGLKWSFMPKKKQDDRPSYIVVN
                     CDESEPGTCKDREIMRHEPHKVVEGALLAGFAMRARYGYIYIRGEFYNEWRSVEKAIH
                     EAYEKGYLGKNACGSGWDFDLYTYRGAGAYICGEETAMIASIEGGQGKPRLKPPFPAN
                     VGLYGCPTTVTNCETVAVSPTIIRRGPQWFAQFGRKGNAGTKLFCISGHVNRPCTVEE
                     EMSMPLRELLERHAGGVRGGWDNLLCVIPGGSSCPLIPKHICDDILMDYDALKEAQTG
                     LGTAAVIVMDKSTDVINAIERLSQFYMHESCGQCTPCREGSPWLDKMMKRFVNGNAKK
                     EEIYTLWDVSKQMEGRSICALGTAAAWPVQGLIRHFKPLMEERIERFWEANPHWGQPG
                     SPWRRWKTHRYYTMQKGDRLNWDGKIVRNWN"
     gene            complement(<372780..>373052)
                     /locus_tag="LMJF_05_0990"
                     /db_xref="GeneID:5648964"
     mRNA            complement(<372780..>373052)
                     /locus_tag="LMJF_05_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687524.1"
                     /db_xref="GeneID:5648964"
     CDS             complement(372780..373052)
                     /locus_tag="LMJF_05_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648964"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA3"
                     /translation="MVVIKGGGQTYAVGNGRQMEWDEVPESFKKNLAEQKEMEKCMDL
                     RAKAQRCISDQGFWAPDCVHLTEAFHLCQSHELTRTELTQRKGAES"
     gene            complement(<374697..>375008)
                     /locus_tag="LMJF_05_1000"
                     /db_xref="GeneID:5648965"
     mRNA            complement(<374697..>375008)
                     /locus_tag="LMJF_05_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687525.1"
                     /db_xref="GeneID:5648965"
     CDS             complement(374697..375008)
                     /locus_tag="LMJF_05_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648965"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA2"
                     /translation="METEVASGRSGARDGFFGAALLSNPAVDAEDEQNEETCQVLIPP
                     NMSMGADDEEVCGVCLEQPPAGCFVELWCCGNILCVADAQQLGKCPFCREEPLVWNIT
                     K"
     gene            complement(<375903..>377750)
                     /locus_tag="LMJF_05_1010"
                     /db_xref="GeneID:5648966"
     mRNA            complement(<375903..>377750)
                     /locus_tag="LMJF_05_1010"
                     /product="methyltransferase-like protein"
                     /transcript_id="XM_001687526.1"
                     /db_xref="GeneID:5648966"
     CDS             complement(375903..377750)
                     /locus_tag="LMJF_05_1010"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_001687578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648966"
                     /db_xref="GOA:Q4QJA1"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA1"
                     /translation="MKYVAVFASSASLADFRLPEFQFVAATLGVPITFLDDKIPWVAG
                     GGDTFWFSVFESPASRSELKALAERCALLRGVYTLFETAPTLEDLYVCLEERHGSAPG
                     SAGPSLASSPTTAATAFVGEDETTHLTSSTYSYQVETIGKKYSADAKRAVAEAVLKRV
                     PRAGEVEWRQPGRAYYVFLQHAVENPPPGAQGWVSNGPLLRVFHCRLCVESSRSALLA
                     TYDLRKRPYIGTTSMPPEESLMMVNMSGVCRGHYVYDPFCGTGSLLIAAAHYGARTFG
                     SDADGRAMRAGTEKGKTSPQMQQQRRLALAAYTEEQLCVLTEEERVLPSMITNFKLYR
                     LPPPDRARMNFSAWPRTWHACAPHLGSGGIFDSIITDPPYGLREPRKRMETTAATIPT
                     AAAAAASTEAGSDNAAKQQAVTFSAYPTHEVLLDLVMFAATYLVVGGHLTFWHPTTDH
                     YTNDELPSHPSLSIVCDIMQRVSLKVVRRLIVLRKVMPVPKPPPSRESCAAKKSPDDL
                     RVLMDATEIPDNADYMHYRAKRERKRQAAHKYKASAGASSSPSTPAAGVDVGSGSDGG
                     NRRGRKHSRLDGQEKIVANRQRNIELRAAKQAASHLANTAHKTVDHSRP"
     gene            complement(<378688..>381447)
                     /locus_tag="LMJF_05_1020"
                     /db_xref="GeneID:5648967"
     mRNA            complement(<378688..>381447)
                     /locus_tag="LMJF_05_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687527.1"
                     /db_xref="GeneID:5648967"
     CDS             complement(378688..381447)
                     /locus_tag="LMJF_05_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648967"
                     /db_xref="UniProtKB/TrEMBL:Q4QJA0"
                     /translation="MASSSATASRADRLQAFLRSPDIPASFYTNNTRDDNLIAVTTQF
                     DILYHKYFPDRKPLFLLPNNECQRRKMICSFVRPTSLPYDELFDLEGTCQFVADYVRY
                     EPLYDPSMYDDEYDDTVEQLPQQIVSPATVLDWQVGNCFEMSLVLTSFLIGAGFNAYV
                     VIGSATKAVCLSDQKSTMWEGELPKEVNSDDEVEDDMPQNNPYVALIPEKLTLRLTTD
                     PDPASVSKKNSIMASASDYPKDIDTPNVRGGAVKPIHSWVLVLPDGRRSVSKAVFVEP
                     STGQLIAFSSTDSRYTSVEALFNHQDYHVNMRPEAPVSSLSPDLADRSQWESLFLHAN
                     LSDDEAESLAGTLSATQRAFTNELAATTTAATVNTAEVFDSSRSRRMYIPNLWSTELT
                     LNRHQYESRYPAGYKEITYANAVVRRYAPYSQSDYRILEVVVPDAEYAELHETHVFYA
                     HRADKLRRATVSPSLVPQSSSKESLIFSSPSSVSLEKVPGRPRKIVEWYEKGRMHNTS
                     VEGLRELIYEPGKQRTMKFYWRARSDGLYCRTELLYDASTLRKVKEFYKGRSDRLWYR
                     SFSYGRPSTMRERDMHSLILQGPGNVSALHVYPRLDPVRISQKFLRDESVPARKDVAK
                     TTFLRPASEGKSGGNSSAPTVGEIWVFFHYDAGSILRPYHMFAKPSSSVEEYIAASAA
                     GKPAEPPMRVVSLPGEEPPSELDLYNERKWLNAVEAACLMEQRVTSDECMDILKSIEQ
                     GHNKPQHVLSAYDTLRNRPKETEAERARKLAEAARREESRKDYLAPYIAKLEMPADFD
                     GNYLNVLLSKEQAKQVRDEALQELKDRLIQRGHIMQSRMDKEKAEFNKRQQLYRKNCD
                     ASALEGDKETEAFALYCKEATWRMKVLDERLLQHIDHASDKYNQLAQRLAEDPRLSAL
                     YNPTH"
     gene            complement(<381962..>382399)
                     /locus_tag="LMJF_05_1030"
                     /db_xref="GeneID:5648968"
     mRNA            complement(<381962..>382399)
                     /locus_tag="LMJF_05_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687528.1"
                     /db_xref="GeneID:5648968"
     CDS             complement(381962..382399)
                     /locus_tag="LMJF_05_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648968"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ99"
                     /translation="MQCTFLKLSSRRGSAFAASLLLLANSQNMRAADAVQRIEAEEFA
                     KSYQMKPMADHPRSLFEYKSSAKGAEVGARNEAAFMNYETFTPQTLSGRLVMPGDINL
                     LTVSPLYCALLCIAAAGWGVFYWDMYCRKNYETVLIARPKDMQ"
     gene            complement(<382894..>383967)
                     /locus_tag="LMJF_05_1040"
                     /db_xref="GeneID:5648969"
     mRNA            complement(<382894..>383967)
                     /locus_tag="LMJF_05_1040"
                     /product="stomatin-like protein"
                     /transcript_id="XM_001687529.1"
                     /db_xref="GeneID:5648969"
     CDS             complement(382894..383967)
                     /locus_tag="LMJF_05_1040"
                     /codon_start=1
                     /product="stomatin-like protein"
                     /protein_id="XP_001687581.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648969"
                     /db_xref="GOA:Q4QJ98"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ98"
                     /translation="MLRRGIVLLQYGAQGASYPINSAPQEHPSGGSASSRMMMQRSQK
                     MLLDPASFIERPPRNTLFNIVPQGHEYVVERLGRYHRTLDSGWWVVVPFIDKIRYNYN
                     VKEQGIEIPNQSAITSDNVMVEIDGVLFLKIVDSCKASYNIENPVFNLINLAQTTMRS
                     EIGRMSLDSLFRERASLNQSTVEVLRREANEWGIECKRYEIRDIVVSELVRRSMDLQA
                     EAERKKRKLILESEGESTATINRANGMKIAQQCVADAEKYTAERQSEGAAAAIRVKAA
                     AVSDNISIVSDAIEKAKHSNEAISLRVAESYIEKFGELAKESNTVVMSQPVSDPAMFA
                     TQALSVFNTVATSAAKRSPPTGK"
     gene            <385420..>386751
                     /locus_tag="LMJF_05_1050"
                     /db_xref="GeneID:5648970"
     mRNA            <385420..>386751
                     /locus_tag="LMJF_05_1050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687530.1"
                     /db_xref="GeneID:5648970"
     CDS             385420..386751
                     /locus_tag="LMJF_05_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648970"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ97"
                     /translation="MFHTSRLAIPRLATKTSALLTRPGRVEKSVASPNPEARTESGAV
                     SGVTERTTAPLQPPIIDSTKEGRTHILPQKVLKELLNSVSAGQQNFLFGSDKDAGDPT
                     AGVLRATGSFFESINTAYEGRMLQEQQVEVENFVAKRRIHYMQRLNEETEEFRREQKE
                     IHDEIQRLEAEKYKNDLNNDVIQFTKARETEYEARLHADVEKYHNALLAYRARVKKSD
                     QLGANGETPLKQLNMNVIEVMQEMEMDDTLRDFGDAAGIGNDLSDQDIRSYVVQRTCF
                     YEKVVQDEVHDFTKRRKSFYEDLLEARAARHAAKVRADTEKFHSKRQSYYDERLTADG
                     SWMAKCFQEHYNRCFLQSYARRAWIEHRRYQATLEGIKLFTENGEKVPAISNPADISI
                     STLNAEIPLSTILDMYESENMAEVTRDVFLKAARRVAADYAPYGVDERPSA"
     gene            <387684..>389120
                     /locus_tag="LMJF_05_1060"
                     /db_xref="GeneID:5648971"
     mRNA            <387684..>389120
                     /locus_tag="LMJF_05_1060"
                     /product="putative ATPase"
                     /transcript_id="XM_001687531.1"
                     /db_xref="GeneID:5648971"
     CDS             387684..389120
                     /locus_tag="LMJF_05_1060"
                     /codon_start=1
                     /product="putative ATPase"
                     /protein_id="XP_001687583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648971"
                     /db_xref="GOA:Q4QJ96"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ96"
                     /translation="MFRRASVLLSLRPSEAYRQLVLRGDISNDQNQISALPVFDRLYD
                     DLMKYTKESKRIGVPKRQVELRPPNRLGIIPSLFLRREQEKKVEQALSDDNKAVYHPL
                     SQVKGLYVWGGVGCGKTMLMDLLYDNAPPEIRKRRLHFHQFMLDMQKTSNSIRYKSKE
                     EMQDPANRTNMVRYNTSDNRRRTPDAEINLFDEVAQRMISDVELLCFDEVAVSDVAHA
                     MILKRLFHSFYKIGLVVIFTSNRPLEDLYKDGLNRGGFIPFIDLVKKQCIIHHMKSNV
                     DHRLLGHQADTYLTPMNSENNSKLEKLFLEMCKAMPATERKLEVFGRDVIVPRACGGV
                     CYFDFYELCGGEKSAADYEVIAKTFHTIFINGVPQFPYENSDVKSRFLLLIDTLYGHR
                     CKVMIHAAVEPPQLQAPKEEAAGRIEGDAQRVDQLSEFERESGNRLVDVDDSAFQMDR
                     CVSRLFEMRTKEYLEIPHEPQEVDLSTR"
     gene            <389961..>391490
                     /locus_tag="LMJF_05_1070"
                     /db_xref="GeneID:5648972"
     mRNA            <389961..>391490
                     /locus_tag="LMJF_05_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687532.1"
                     /db_xref="GeneID:5648972"
     CDS             389961..391490
                     /locus_tag="LMJF_05_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648972"
                     /db_xref="GOA:Q4QJ95"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ95"
                     /translation="MPMATTGLAVSLLVVFLCGCACVSTAAAAHVNDDLPPGVMRGPL
                     LHEHSFQEPLVSDWWEEGVPHYMIGGSAVANERFLRLTTNDLDDHGFAFNTAPLDHDN
                     WEARVRFSIRPPPLAADMNGSSVHYQGGDGMALWYLDQPIGDDHQHVVKYSKSISPEL
                     RDEMLDAENPWRVADFLLNGDDDDDDDEDVDEDDLTEQEKQERQEAKDRRAAKKRKRE
                     SLFKQLFKRGTSVDESDREPRIMGVKFSDFNKGFGLILDSVGDEKEHLREHQQQGDAV
                     QHHHHTASIYLLLNLPNHTSSSGATVVNNFDPTRENFRSSPDVLRCTYDFRQKGTKPY
                     DPQARMMDKVTKAVTAAEEPLELIVRYYKRKLTVIIRREDVAKREVSSVVDETGKATD
                     EVEVVRTYTETMCGEVYPIHLPLRYHFGLSASTGHRPAKNRKRRPLRSVFHEADKKTF
                     THVDVHDVLRFDLRELGLDAKAMGYSKTIPLEHFDFEADRRERLHFSRQLPVNPDSDT
                     A"
     gene            <392950..>395130
                     /locus_tag="LMJF_05_1080"
                     /db_xref="GeneID:5648973"
     mRNA            <392950..>395130
                     /locus_tag="LMJF_05_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687533.1"
                     /db_xref="GeneID:5648973"
     CDS             392950..395130
                     /locus_tag="LMJF_05_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648973"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ94"
                     /translation="MSDDASEVAVELPQMWQYIHPTHNSVDSSDEETDDEENADVANN
                     DAARGGRPADYVKLKKSAPRLGQLIRFLNDMEDEDVQGLLLENDPVTRQTLLQWATLN
                     NHFMLVEYLVKRMKRAAFSFDAESVEVVVYDRWAEMSQELPTAAEVAERQKQRENEKA
                     KRLAERAMANSGDDAIEDEESEEEEEVEPMPEELVYDTLEDYHGELGDGGVGVVKRIG
                     ELGIYVGPRLPDGTKQGLGQTLFPSGDCYTGEYKENQRDGRGVYWWSKGGALYCGEWF
                     RNMRHGYGRMVYPDGSRYLGRWVHGKRSGKGRYVYADGSSYDGAWVKDEKHGSGTYHL
                     LDGSSFIGTFHHNRFVSGEWRLASGTVRYIGNFENDAPAGAGVYVHRCGLTPGAFQQA
                     GTYSAEGTSWVPSMRKCTSRMVPHIELVVPPQPSGSTRVPMEFGAECTGRTMADLIKV
                     ANYAPLLRWVASLASAAKDVVVGEVELKGVELRGVEVQSMRYDATDPDAITEVTILPI
                     LVDNVGKRVRPPSESVTLKPSVTRLMILLEAPGTEPVVLLEKSLQSASPDEHHQQSRL
                     PAVRISEDSSVGGDVVDAVGPALRLQLASTNSMALLLPPMRCNPMQGNAEESVWLYAQ
                     EVHRETVAQLEHKLQLLSAELPEASTTYVAVPLSDVAAISTDAMTAMAAANAQQRRAA
                     QTLPRATVAPQRPPTPPPPTLEPRPELQPLYEAKARRDEAELEE"
     gene            <397747..>399471
                     /locus_tag="LMJF_05_1090"
                     /db_xref="GeneID:5648974"
     mRNA            <397747..>399471
                     /locus_tag="LMJF_05_1090"
                     /product="putative double-strand-break repair protein
                     rad21 homolog"
                     /transcript_id="XM_001687534.1"
                     /db_xref="GeneID:5648974"
     CDS             397747..399471
                     /locus_tag="LMJF_05_1090"
                     /codon_start=1
                     /product="putative double-strand-break repair protein
                     rad21 homolog"
                     /protein_id="XP_001687586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648974"
                     /db_xref="GOA:Q4QJ93"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ93"
                     /translation="MFFSTYVLTKKGPLAKVWLAAHWDKRLTRHEVKVVDLSQTILHI
                     VRPVVPIALRTSGELLVGVVRIYALKVKHLLKEATEATLFLRVTTLATKGSKAGVAGQ
                     HRTVSIDGVVVPVKGSDVEAVTFDWNADVAAKHGAVADAAEALGEGRFNAIADLLGNS
                     HRIDVSDTDKEDALLASAWYTVQPTSQAAGDGLHTTQQDYDEIAKMRADLMAFGERAS
                     GSASTSKSKSSLSSMEKGRGSVAVDVDGMAFPAVGDELDIGVPLPDELPPGFPALEGQ
                     VPAGMIPTDPFLLPDMMNMDEEAAAAAQRSRPGRRMRPVNVCDLDSTTLSREAFEKCM
                     ADRSDILNSEPRRGPYDAQEEADRYTVTGSANAANALATNPALDAAPLSGVLNPALRL
                     TYAKALRQSAEEAVAMAAQAFRESMARRSEVPAGGGGALEADDAQVAAADLDGSAMLV
                     PEAEVAQQRRKRGRDDGDGVDDSTMTAGVSASVQQTLERIRMELSLRAARDHKKSRTQ
                     SAASLVGASCALREVCRGLRRRDAARTFVDVLALASKQYVSAQQALGSDEVQVTLNES
                     ALRLLAAA"
     gene            <401891..>402628
                     /locus_tag="LMJF_05_1100"
                     /db_xref="GeneID:5648975"
     mRNA            <401891..>402628
                     /locus_tag="LMJF_05_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687535.1"
                     /db_xref="GeneID:5648975"
     CDS             401891..402628
                     /locus_tag="LMJF_05_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648975"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ92"
                     /translation="MSKYANPEYWEDRYRSNDTTFDWFVTYDNLQTILRPLLQPAEQI
                     RVLVVGCGNSRLSANLYEHLNIKKITNVDVSPTVISQMQRRYSEMNEMQWICVDLLTA
                     PIEKLMLELCPNDYLYDFIVDKGLVDSILGGSNSFHNLYIFNKNMSRLLKRGGRFVVV
                     SYGSPETRMDHFRRKKLNFDVEHKLLEKPMLSSSTASPTGHYHVYIMVKVGTKQGAGV
                     ALAAGDAESEEDDDFYDRFMTHNSAAN"
     gene            <406711..>410385
                     /locus_tag="LMJF_05_1110"
                     /db_xref="GeneID:5648976"
     mRNA            <406711..>410385
                     /locus_tag="LMJF_05_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687536.1"
                     /db_xref="GeneID:5648976"
     CDS             406711..410385
                     /locus_tag="LMJF_05_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648976"
                     /db_xref="GOA:Q4QJ91"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ91"
                     /translation="MDTTTKRLPSFVVTSSNDATFTKPATPAKTGSSITLNPDAQEFR
                     VTPAFAGTLFSMPSAAASAPPPQRWFQPTMDFSTRPTAGNNGTSQSSSSPPPASPSAS
                     AASDAMDNRQLVELTEAYMHQLYDRKCNDEKLHMVSVFHLHPRTTDKQLSRIFFPTGA
                     SAAEVLEPRMMPESLAKAFLAVRQRAGVVFFTRKDFAMVGVEKVHDFVPHGQHQPLVV
                     RYCGPDHEATPLSGSPLPPRSQSSDPLRGDALSSAKATSPRPSDRPTPPQSRHRDASN
                     PSDVFPASIVAVPPLSAGLESIASAGTTTPALDAGASSTAAYDSIDHHFLQKYAGEQV
                     YLVGVHNLAYGTTPKSLFKMFYPMGALNSELLPRPVSVDGKLRCSGVAVFGSKGMAME
                     AAEKMNDFVPHGQRRPIVARFLKRATSPAFASSAAPGNGSSTTSSAYTATAAMASTPR
                     GSTSSPSPASGISSAAALLDSVEKQLRSKSLNDSQLAADMAALVLCAESGEAEARKLA
                     AVLRDVLLSMRDHSTILASPLSGALRTLHSTLGIRVRTAPATPADASLSVRKGVLFLQ
                     QIGRTLMMLVADTEAARQTRIVAAVQCAYLYQYTYLPKTPLCFAATLFRNCERELREA
                     REFLCREPNVPSSLAEEQQHRPWITLMDALHEMVSVWRSLDPRTYAQDAVREEYERFV
                     CEFRGMDMRRSSPVTSTLSVAAVASAGGGEHHSGACTPRNDALGVPAEAVNHTYSAKG
                     HGSSSVNASAKKSQFVTPSARPTPRRVVSKSYSTTSDWKVKQSTPLAGPNCAVPPQVM
                     LTSPASDYTQGASEFSADSNSAGTTISSALRSLGLTPQHPSMRFNWGSRLLSAAPQPG
                     MPPNPTVSAAAMLPATPTLSAPASTSATASAASGTPAAAATSAERSDATMTERTVYIT
                     KLPSCLSAGQVRRLLLHFGDFRKVRLCHDDKETTRIGSAEALAAHNLKFDQLCFGFVE
                     FVESSSAKAMVEFFRNEVHTPSAFDFLRAEDVHGFDDTELNQLRNTRTSQARNPIHDQ
                     QPLDATRTQPCFFGIIQPHHTVDTYSDAITAEEVAEAVRQLHREEEGAQQQPLPMCAS
                     PFIRPAVFSTSTPYSMTVSKDVSFGSPVAATASPTGDNNYDENDGGGSVVAALQPMDA
                     VHFPSGFPYHEVFTAAASQTGDGDGAGHHDNSAGSNGHLPSDDMDLYGSCAPVIVEEE
                     EDEVEGLQEYQVQQILQLLS"
     gene            <413264..>413599
                     /locus_tag="LMJF_05_1120"
                     /db_xref="GeneID:5648977"
     mRNA            <413264..>413599
                     /locus_tag="LMJF_05_1120"
                     /product="hypothetical protein"
                     /transcript_id="XM_001687537.1"
                     /db_xref="GeneID:5648977"
     CDS             413264..413599
                     /locus_tag="LMJF_05_1120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001687589.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648977"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ90"
                     /translation="MRYHCGFTAPVLLPVFLAAGGAHARDGSDGVMENFSIFLFLFIG
                     GIALGAVIMLPIAYLRWQGLPLELQPRERCMWETAPSSKMSAANLVLMNKIKTDTLDA
                     KNALRAGVL"
     gene            complement(<416350..>418044)
                     /locus_tag="LMJF_05_1130"
                     /db_xref="GeneID:5648978"
     mRNA            complement(<416350..>418044)
                     /locus_tag="LMJF_05_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687538.1"
                     /db_xref="GeneID:5648978"
     CDS             complement(416350..418044)
                     /locus_tag="LMJF_05_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648978"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ89"
                     /translation="MTTLTHSRPRPLHLPLSPPHTRKNDGAAPAPAHTHPSHFLSVAI
                     TVTHTDFVTGTIMKSFFSNITSKLKTRRKPLAPCDCSDFIEAAPAQPSLTHLRGVVAA
                     RHFHGAPPPASDVENARRDFVVRSTVFDLQHRCGAGGRCTCAGAPACRFPQCFTMRPV
                     TKGAEVLAERQVYEVEDAPTPEIRALVALAAEEKLEEVVKGIQHTVDAHLKAAARGRG
                     LEARFIIDGSDGHEFTPATPKTGTGSIHAGANPLREDEDLREEITSLYLWRAALLVNL
                     RRDEQAVSSLLNLAFAVEQKDRTRLYGAAAAWAVLNDMEIIYYRSLVKSCKPFDQAVH
                     FATERPLLLARVFEATRGDDYHTDYCTHVVFSKEVTATVTRAQTAQMHGDFTEDPMRS
                     LCLPLTMPYYRFRVDEEFWKRFYALLCMPPVPPPTQEEAKAQAIDPAAELGLTPNYIL
                     DAVGRSMMLHHLVTFADVRDKEIDTGVVVDRVKEMKLLDLQPHPSDYTPVLTTSEMHV
                     AVTRMKELLVVVRSFEAKEQERLSGAAAAQRLQRAQSGNDAANPSAAPPAPSPIEK"
     gene            complement(<418707..>419780)
                     /locus_tag="LMJF_05_1140"
                     /db_xref="GeneID:5648979"
     mRNA            complement(<418707..>419780)
                     /locus_tag="LMJF_05_1140"
                     /product="vacuolar ATPase subunit-like protein"
                     /transcript_id="XM_001687539.1"
                     /db_xref="GeneID:5648979"
     CDS             complement(418707..419780)
                     /locus_tag="LMJF_05_1140"
                     /codon_start=1
                     /product="vacuolar ATPase subunit-like protein"
                     /protein_id="XP_001687591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648979"
                     /db_xref="GOA:Q4QJ88"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ88"
                     /translation="MGRTMMDYNVHEGHLEAMVHGYRDVLLRADEYNNLCQCDNLGDM
                     KSQLQITDYGNFLQQEGTLSSRIIVDRAQEVLLKQFKELRSWAEPPLCQFLDFISCEY
                     MLSNVLKLIVAKRSGRANLELLTKCHPLGVFPEMPTLIAASDVQEMFEVVLIDSPVGR
                     FFSAEGGFERDLDELSVEYIRGILMKNYYEQFYDFCYNLGGETREVMCPLLDAEADRM
                     VLTFTLNTLGMREITPVDRRKVFPSIGSLVDIHDDIAESENEEQLRDRLRRFATYFEL
                     LDESSRAMDSACKKSLERRFVEMSVVMYNDAMTRQFQYGVFYAYVKLKELEINNLQWI
                     ADCVVQQMRNRLHEYVSTVPYAQ"
     gene            complement(420523..423035)
                     /locus_tag="LMJF_05_1160"
                     /pseudo
                     /db_xref="GeneID:12981693"
     misc_feature    complement(420523..423035)
                     /locus_tag="LMJF_05_1160"
                     /pseudo
                     /db_xref="GeneID:12981693"
                     /db_xref="PSEUDO:CAJ02036.2"
     gene            complement(<425656..>426405)
                     /locus_tag="LMJF_05_1170"
                     /db_xref="GeneID:5648982"
     mRNA            complement(<425656..>426405)
                     /locus_tag="LMJF_05_1170"
                     /product="putative fatty acid elongase"
                     /transcript_id="XM_001687542.1"
                     /db_xref="GeneID:5648982"
     CDS             complement(425656..426405)
                     /locus_tag="LMJF_05_1170"
                     /codon_start=1
                     /product="putative fatty acid elongase"
                     /protein_id="XP_001687594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648982"
                     /db_xref="GOA:Q4QJ85"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ85"
                     /translation="MKFADAMQCIGKESLCFHPELNVFVNYPVLIGCHIGYLVVIVLL
                     YKFMKGRTAYVLKYPMMLYNTAQVALSLVMAINLGQFLVYGVFNLNGGFTGTIEYWIF
                     VHYATKFLDMFDTYFIVLRKKEEQLSFLHIYHHVTIGFIWGLLLHHGVANGTAFFGAW
                     INSAVHALMYFHYLYTSLGYTNPLKTYLTQLQMIQFALCILHAVLAVVAHSPIPKKWA
                     VLQLCYHLTLLYLFMRFYRKGMRKLKRKAKV"
     gene            complement(<426991..>428367)
                     /locus_tag="LMJF_05_1180"
                     /db_xref="GeneID:5648983"
     mRNA            complement(<426991..>428367)
                     /locus_tag="LMJF_05_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687543.1"
                     /db_xref="GeneID:5648983"
     CDS             complement(426991..428367)
                     /locus_tag="LMJF_05_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648983"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ84"
                     /translation="MHMSARHRLTNASILSNIKSMANEKDDLTSKLVYLRRRQEDAIA
                     FAVKEKEMLAEKAKRQLAMEEEKLKVEARIEALISEAAQLGGPAAAQRMRDEIAKDKT
                     RYVRSVDAFGDKTVRLQHTFAGLADNRIIHWWEYAYWNYIRYFFTQELLIAKDRFGNK
                     FTVTWQFLKGREEQRRMYRKDSNKKHQPYGALATDERLWERWMRGHRGDPPSVAEEEH
                     LRDYKKQFFGAMVLEDEEVEDALMRLMAHMNRASQTFQELDEDQVYGDAHRVAKPLRE
                     TERKPGEEMSARQKQKGATWTLGFARGDLFYNEEETQVMRTEMGHLFRNMEWQELEYK
                     RQVRMNKQQPPHGKPPEGTTDPNTPDGDPMNHYWERTDLGIPYHDAVPDLTTPELERM
                     RIESSQLEDERLAIRKELGLTDLGDIREGREPIKRDHAPFQPPPVSQRWKPKCWEESW
                     GTGSGMKY"
     gene            complement(<430278..>436160)
                     /locus_tag="LMJF_05_1190"
                     /db_xref="GeneID:5648984"
     mRNA            complement(<430278..>436160)
                     /locus_tag="LMJF_05_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001687544.1"
                     /db_xref="GeneID:5648984"
     CDS             complement(430278..436160)
                     /locus_tag="LMJF_05_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001687596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648984"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ83"
                     /translation="MSNKKQTWANAHSQLWTSSVARSAGSRTQSEVSSIASTNRDRSL
                     LDDGDGYHQPPSHVCAQELRHQAYQPNDKTLAQVSDILESYGAIACDADIPAVLLEVV
                     KELERTKRDNNFKDLLLREYSDTVQRRFGLYGEESPPSIAEVSARLRDGAPARPVAAP
                     NPAWLEQPLNELWRTVCDGMQACFEKNADLSAPVLLPEARRTKANVSQLLHTSCDVLS
                     QLAKEYTTAKAAVMKKMERTVAASQSFRQLTLSTALSELEAQQELKGSAAEDGGASAM
                     DGSHTVGSALQSLIDVIPASLQIHFNLQVPEAPVLTRCNSLTELIRFLLSEYLSMERY
                     MEMVEVERQRLAEVFYLPSSKADANGDLQLDEALSRSLRSLQETVTSVVAFPHHISKE
                     EMVLRHSSAQAVEELAQLLVDARRGGSVSGSCAPHSVAAVRVEPPTRNLLEMVELVKS
                     RFATVMAQQQRKELAGAQGRVGLAHMEESMTRHGKQVVQLLQDLCVAQEDAAADSEVS
                     EQLLVEVMGNVDLERNLTPAKLDHFLSDVVERLRMVKTKYQRALNAAAAGKARAEAAS
                     QKSTGLQKRLQKVAAAVERIGRDGLGLTFPSTPAASGIGSAGEADDAGKGRDDAEGGR
                     RGNGVSALRRLNLRPALEPATATKASSLTTTKDGTANETDTPGAAVTEHNVLEALQLV
                     ASRIGTSGEMRDWAVVQEELAQLRAGKARWKADTSAFHEAMAMLMQRLAKNGQMVKQT
                     LFLMGTDESAKDELVEEVLQRDSEEELDRLSAEAMEYVERSLAELLQKYNRWAQRLLQ
                     TTEDHLYTQRKIVKYFAAVCRFFSSQSRAAAAPAEDIPEDNLYDIDSCLMRAADIILP
                     SLDAAIQAAAQEQCPASATATPDAPATLPPLAPSSGDTATSDATPRQETLVQLARDST
                     AAATGGVLPYDHRIARLYETVARLYTVVTSLLQVHYLCIPSASRRRSSGEMELMFDGD
                     ANDDGFVDIDLDRLIRVSQQRSAAASAPPAAARGDGVERERFSKEGHGGDSAGKTPTP
                     SPPSTITANNDLILRVTYQNMEVLQDTLKRFSANHKMAAIVLQKDVDTMQQLLAGMLE
                     KYSEVDMEGAFGQSRETLHELYVTLRDRGQRQKGCYFFNRVGGEGSCTWVTALEHLAD
                     GFRGVVDRLVQRTTLAAEYRRLVDEVVDVCAMYMNWAERRTLPASHALPPELLALCVR
                     DSSEVTAKQTVATMVEGGQSSCPGGDVEASTKPASGGTATINATTATVAASAAQRPPK
                     PSRMPPLTPRASTKEQQERQQQHQAGQERGVVVPTAASAAEPKISYFTNDGAVLKVMT
                     HMFQLAQLTVESPPATGNKTGDAAAFDADAKVQQLTEEMQLLREAVAMAERHVDELTN
                     AKHVVELQRDQAQSEAAVARAELRRWKRRKRQQHEQQRSGRTPAIADGAQVRSPPRSP
                     REAASTHQPDKTADGVDAVLDEATVKEVMEYMRVLSEELQTAKRQVSGSSARARKLVR
                     SPCQAASSLRASGAVPKDYADVVRKEDGAEGNAADGDEDAPYGAPHSHRDRRSYTELA
                     EQLRHQYGSTAIAPMVVIDPKTHSYSNSQRRSGHARDGSSEASHAQNRYSPVKYRGPE
                     YDACDRYYARELAQVLIEEGEHAAHPRRYRSIDARHPATTKPAFSGLASAPASQRHLS
                     GESSRGAAAPSTRDLDVCRRGGGGNSAAAPPRRRYPPRSLSRDEPLLSPGAAAASANL
                     ASPHAYHAPQRATSVAAAAAPSYRLFPKPATPGACRHSSGNALFSTPMEACAHHHRCH
                     YDRGDNRPRCADTDEGEEVFYDAGTPRAQTGWRWSTPSWAAPQPRRRPSAARERLCSP
                     HEQSTKASILSQQRCPKVHDGLCEPPEDVGEGLAAAVRQIDAVTQRSTVTPTRRGSQA
                     GSRQDTLHGSPVSVPPASIPATPASEQQMSRNANLRAAALRRLAEVVSKTAVPSTRRA
                     QF"
     gene            complement(<436552..>436950)
                     /locus_tag="LMJF_05_1200"
                     /db_xref="GeneID:5648985"
     mRNA            complement(<436552..>436950)
                     /locus_tag="LMJF_05_1200"
                     /product="putative prefoldin subunit"
                     /transcript_id="XM_001687545.1"
                     /db_xref="GeneID:5648985"
     CDS             complement(436552..436950)
                     /locus_tag="LMJF_05_1200"
                     /codon_start=1
                     /product="putative prefoldin subunit"
                     /protein_id="XP_001687597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648985"
                     /db_xref="GOA:Q4QJ82"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ82"
                     /translation="MQQVHPDIKKLNDLLRPILKELQEMGDKKGKLIEARRQLGGQKN
                     ENELVRDELNRLEPDATVYKLIGPALVPQDQSDAKTIIGNRLDYINGEIKRSDTSIAE
                     LDRKEAELQKKAQELYRKMQERQAQLIQQQ"
     gene            complement(<437957..>439147)
                     /locus_tag="LMJF_05_1210"
                     /db_xref="GeneID:5648986"
     mRNA            complement(<437957..>439147)
                     /locus_tag="LMJF_05_1210"
                     /product="protein phosphatase type 1 regulator-like
                     protein"
                     /transcript_id="XM_001687546.1"
                     /db_xref="GeneID:5648986"
     CDS             complement(437957..439147)
                     /locus_tag="LMJF_05_1210"
                     /codon_start=1
                     /product="protein phosphatase type 1 regulator-like
                     protein"
                     /protein_id="XP_001687598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5648986"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ81"
                     /translation="MFANLDEEKKARLRERILQAAAAPPPAATPARSNSDSDGEQEVP
                     PQHTESTKHASEQLAINAQSTDIDIANIRLFTLDELDLNQLTECKTLSLRKNLIHELS
                     AFPQHLAGRLVELDLFDNKIRKVRDFFDSAMVPDPESGSLSKKAVPHAFYSLTKLDLS
                     YNQLRKITGLDSLGSTLKELYLVENKIKVIEGLDSFVHLELLELGGNRIREIGSGLSN
                     LRSLQSLWLGKNKIHSIGDSLHNLRELRKLSLQANRLTSITAEAFKEGCNPYLAELYL
                     SENGISTIENLPLHSLHLLDFSFNPISTINEAVINPTNMPELEEFWLTDGSISDWGEV
                     KKFCGFANTLRTIYVERNPIEQDKRYRDKVYMNLPFVTQIDSWPVVNKDNLEGDRLIQ
                     RRAS"
     gene            <441522..>442376
                     /locus_tag="LMJF_05_1215"
                     /db_xref="GeneID:12981694"
     mRNA            <441522..>442376
                     /locus_tag="LMJF_05_1215"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_003721727.1"
                     /db_xref="GeneID:12981694"
     CDS             441522..442376
                     /locus_tag="LMJF_05_1215"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_003721775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1215"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1215"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981694"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ0"
                     /translation="MALSLFSLIGAAAVTLLLLVAAPSSADTITVNAATQAWLKMWIE
                     SIPNLGIIWLNPNICSRAGIECVSATNSINIRLDGVTSAGFNFIGTLPEVDSSIDGDE
                     LQITSVSVRGKTRFTGTIPASWSRITRLTHLDFSRTRISGRIPDELGSLAALMSVDFS
                     NSYFCYGLPNWNASSMPMLSQAIFTNNNMRGPFASSWSTFPASLKLDITGNKLCGCMP
                     SSWDSKPNLVAAAKAMDAGTVSNCFRSCNSASLSYCPASPVGNGAQMITMTTAVVGLV
                     VAVASLVF"
     gene            447934..448030
                     /locus_tag="LMJF_05_snoRNA0089"
                     /db_xref="GeneID:12981695"
     ncRNA           447934..448030
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_05_snoRNA0089"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460086.1"
                     /db_xref="GeneID:12981695"
     gene            448178..448251
                     /gene="LM5Cs1C2.1"
                     /locus_tag="LMJF_05_snoRNA0084"
                     /db_xref="GeneID:12981697"
     ncRNA           448178..448251
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.1"
                     /locus_tag="LMJF_05_snoRNA0084"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460081.1"
                     /db_xref="GeneID:12981697"
     gene            448344..448439
                     /gene="LM5Cs1C3.1"
                     /locus_tag="LMJF_05_snoRNA0079"
                     /db_xref="GeneID:12981700"
     ncRNA           448344..448439
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.1"
                     /locus_tag="LMJF_05_snoRNA0079"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460076.1"
                     /db_xref="GeneID:12981700"
     gene            448546..448830
                     /gene="LM5Cs1H1.1"
                     /locus_tag="LMJF_05_snoRNA0071"
                     /db_xref="GeneID:12981705"
     ncRNA           448546..448830
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H1.1"
                     /locus_tag="LMJF_05_snoRNA0071"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460068.1"
                     /db_xref="GeneID:12981705"
     gene            448855..448923
                     /gene="LM5Cs1H2.1"
                     /locus_tag="LMJF_05_snoRNA0067"
                     /db_xref="GeneID:12981713"
     ncRNA           448855..448923
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H2.1"
                     /locus_tag="LMJF_05_snoRNA0067"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460064.1"
                     /db_xref="GeneID:12981713"
     gene            448953..449045
                     /gene="LM5Cs1C4.1"
                     /locus_tag="LMJF_05_snoRNA0063"
                     /db_xref="GeneID:12981717"
     ncRNA           448953..449045
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C4.1"
                     /locus_tag="LMJF_05_snoRNA0063"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460060.1"
                     /db_xref="GeneID:12981717"
     gene            449128..449202
                     /gene="LM5Cs1H3.1"
                     /locus_tag="LMJF_05_snoRNA0075"
                     /db_xref="GeneID:12981709"
     ncRNA           449128..449202
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H3.1"
                     /locus_tag="LMJF_05_snoRNA0075"
                     /product="=H/ACA-like snoRNA"
                     /transcript_id="XR_002460072.1"
                     /db_xref="GeneID:12981709"
     gene            449231..449299
                     /gene="LM5Cs1H4.1"
                     /locus_tag="LMJF_05_snoRNA0090"
                     /db_xref="GeneID:12981721"
     ncRNA           449231..449299
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H4.1"
                     /locus_tag="LMJF_05_snoRNA0090"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460087.1"
                     /db_xref="GeneID:12981721"
     gene            449646..449719
                     /gene="LM5Cs1C2.2"
                     /locus_tag="LMJF_05_snoRNA0085"
                     /db_xref="GeneID:12981725"
     ncRNA           449646..449719
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.2"
                     /locus_tag="LMJF_05_snoRNA0085"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460082.1"
                     /db_xref="GeneID:12981725"
     gene            449812..449907
                     /gene="LM5Cs1C3.2"
                     /locus_tag="LMJF_05_snoRNA0080"
                     /db_xref="GeneID:12981701"
     ncRNA           449812..449907
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.2"
                     /locus_tag="LMJF_05_snoRNA0080"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460077.1"
                     /db_xref="GeneID:12981701"
     gene            450013..450297
                     /gene="LM5Cs1H1.2"
                     /locus_tag="LMJF_05_snoRNA0072"
                     /db_xref="GeneID:12981706"
     ncRNA           450013..450297
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H1.2"
                     /locus_tag="LMJF_05_snoRNA0072"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460069.1"
                     /db_xref="GeneID:12981706"
     gene            450322..450390
                     /gene="LM5Cs1H2.2"
                     /locus_tag="LMJF_05_snoRNA0068"
                     /db_xref="GeneID:12981714"
     ncRNA           450322..450390
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H2.2"
                     /locus_tag="LMJF_05_snoRNA0068"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460065.1"
                     /db_xref="GeneID:12981714"
     gene            450420..450512
                     /gene="LM5Cs1C4.2"
                     /locus_tag="LMJF_05_snoRNA0064"
                     /db_xref="GeneID:12981718"
     ncRNA           450420..450512
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C4.2"
                     /locus_tag="LMJF_05_snoRNA0064"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460061.1"
                     /db_xref="GeneID:12981718"
     gene            450595..450669
                     /gene="LM5Cs1H3.2"
                     /locus_tag="LMJF_05_snoRNA0076"
                     /db_xref="GeneID:12981710"
     ncRNA           450595..450669
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H3.2"
                     /locus_tag="LMJF_05_snoRNA0076"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460073.1"
                     /db_xref="GeneID:12981710"
     gene            450698..450766
                     /gene="LM5Cs1H4.2"
                     /locus_tag="LMJF_05_snoRNA0091"
                     /db_xref="GeneID:12981722"
     ncRNA           450698..450766
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H4.2"
                     /locus_tag="LMJF_05_snoRNA0091"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460088.1"
                     /db_xref="GeneID:12981722"
     gene            451113..451186
                     /gene="LM5Cs1C2.3"
                     /locus_tag="LMJF_05_snoRNA0086"
                     /db_xref="GeneID:12981726"
     ncRNA           451113..451186
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.3"
                     /locus_tag="LMJF_05_snoRNA0086"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460083.1"
                     /db_xref="GeneID:12981726"
     gene            451279..451374
                     /gene="LM5Cs1C3.3"
                     /locus_tag="LMJF_05_snoRNA0081"
                     /db_xref="GeneID:12981702"
     ncRNA           451279..451374
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.3"
                     /locus_tag="LMJF_05_snoRNA0081"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460078.1"
                     /db_xref="GeneID:12981702"
     gene            451480..451764
                     /gene="LM5Cs1H1.3"
                     /locus_tag="LMJF_05_snoRNA0073"
                     /db_xref="GeneID:12981707"
     ncRNA           451480..451764
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H1.3"
                     /locus_tag="LMJF_05_snoRNA0073"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460070.1"
                     /db_xref="GeneID:12981707"
     gene            451789..451857
                     /gene="LM5Cs1H2.3"
                     /locus_tag="LMJF_05_snoRNA0069"
                     /db_xref="GeneID:12981715"
     ncRNA           451789..451857
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H2.3"
                     /locus_tag="LMJF_05_snoRNA0069"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460066.1"
                     /db_xref="GeneID:12981715"
     gene            451887..451979
                     /gene="LM5Cs1C4.3"
                     /locus_tag="LMJF_05_snoRNA0065"
                     /db_xref="GeneID:12981719"
     ncRNA           451887..451979
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C4.3"
                     /locus_tag="LMJF_05_snoRNA0065"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460062.1"
                     /db_xref="GeneID:12981719"
     gene            452062..452136
                     /gene="LM5Cs1H3.3"
                     /locus_tag="LMJF_05_snoRNA0077"
                     /db_xref="GeneID:12981711"
     ncRNA           452062..452136
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H3.3"
                     /locus_tag="LMJF_05_snoRNA0077"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460074.1"
                     /db_xref="GeneID:12981711"
     gene            452165..452233
                     /gene="LM5Cs1H4.3"
                     /locus_tag="LMJF_05_snoRNA0092"
                     /db_xref="GeneID:12981723"
     ncRNA           452165..452233
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H4.3"
                     /locus_tag="LMJF_05_snoRNA0092"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460089.1"
                     /db_xref="GeneID:12981723"
     gene            452580..452653
                     /gene="LM5Cs1C2.4"
                     /locus_tag="LMJF_05_snoRNA0087"
                     /db_xref="GeneID:12981727"
     ncRNA           452580..452653
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.4"
                     /locus_tag="LMJF_05_snoRNA0087"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460084.1"
                     /db_xref="GeneID:12981727"
     gene            452746..452841
                     /gene="LM5Cs1C3.4"
                     /locus_tag="LMJF_05_snoRNA0082"
                     /db_xref="GeneID:12981703"
     ncRNA           452746..452841
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.4"
                     /locus_tag="LMJF_05_snoRNA0082"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460079.1"
                     /db_xref="GeneID:12981703"
     gene            452948..453232
                     /gene="LM5Cs1H1.4"
                     /locus_tag="LMJF_05_snoRNA0074"
                     /db_xref="GeneID:12981708"
     ncRNA           452948..453232
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H1.4"
                     /locus_tag="LMJF_05_snoRNA0074"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460071.1"
                     /db_xref="GeneID:12981708"
     gene            453257..453325
                     /gene="LM5Cs1H2.4"
                     /locus_tag="LMJF_05_snoRNA0070"
                     /db_xref="GeneID:12981716"
     ncRNA           453257..453325
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H2.4"
                     /locus_tag="LMJF_05_snoRNA0070"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460067.1"
                     /db_xref="GeneID:12981716"
     gene            453355..453447
                     /gene="LM5Cs1C4.4"
                     /locus_tag="LMJF_05_snoRNA0066"
                     /db_xref="GeneID:12981720"
     ncRNA           453355..453447
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C4.4"
                     /locus_tag="LMJF_05_snoRNA0066"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460063.1"
                     /db_xref="GeneID:12981720"
     gene            453528..453602
                     /gene="LM5Cs1H3.4"
                     /locus_tag="LMJF_05_snoRNA0078"
                     /db_xref="GeneID:12981712"
     ncRNA           453528..453602
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H3.4"
                     /locus_tag="LMJF_05_snoRNA0078"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460075.1"
                     /db_xref="GeneID:12981712"
     gene            453631..453699
                     /gene="LM5Cs1H4.4"
                     /locus_tag="LMJF_05_snoRNA0093"
                     /db_xref="GeneID:12981724"
     ncRNA           453631..453699
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1H4.4"
                     /locus_tag="LMJF_05_snoRNA0093"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460090.1"
                     /db_xref="GeneID:12981724"
     gene            454046..454119
                     /gene="LM5Cs1C2.5"
                     /locus_tag="LMJF_05_snoRNA0088"
                     /db_xref="GeneID:12981728"
     ncRNA           454046..454119
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C2.5"
                     /locus_tag="LMJF_05_snoRNA0088"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460085.1"
                     /db_xref="GeneID:12981728"
     gene            454212..454307
                     /gene="LM5Cs1C3.5"
                     /locus_tag="LMJF_05_snoRNA0083"
                     /db_xref="GeneID:12981704"
     ncRNA           454212..454307
                     /ncRNA_class="snoRNA"
                     /gene="LM5Cs1C3.5"
                     /locus_tag="LMJF_05_snoRNA0083"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460080.1"
                     /db_xref="GeneID:12981704"
     gene            <455384..>457102
                     /locus_tag="LMJF_05_1220"
                     /db_xref="GeneID:5649019"
     mRNA            <455384..>457102
                     /locus_tag="LMJF_05_1220"
                     /product="adenylate cyclase regulatory protein-like
                     protein"
                     /transcript_id="XM_001687547.1"
                     /db_xref="GeneID:5649019"
     CDS             455384..457102
                     /locus_tag="LMJF_05_1220"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="adenylate cyclase regulatory protein-like
                     protein"
                     /protein_id="XP_001687599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649019"
                     /db_xref="GOA:Q4QJ80"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QJ80"
                     /translation="MSVSGTATCPLCGWNGSWSTDAAYSECVRDAVEARLKESAVDLL
                     RDAYPALSSGCVGDVVDSCFDRSCLTVDLHQAQQYLAAVPPDGVGAVCTSLAAPDKIP
                     NKAAVFSLRVEGPWLTSCDLVRRFLQLQVLVLCDCADLVSLRGVECAPLLERLTAERC
                     GLVDTLGIDACPCLKSLQLRECPRLSHLGWNQILNSQSSLQESSGQDGGCAALLSVSV
                     FRCPAFQGIGLLSAAPHLREFRAQRVRISSLDALRECRHLELLDVGGCQQVCCIEALR
                     GAKALRYLDLSNTAVSDIGALSQCTALERVNLSGCLRLRSLDSLECCTELRELQASRT
                     NIETLIGLRLCRALKKVDVSGCAALRDAAALTHLSQLTHVDLSFTAVDDVSSLAYYSG
                     LESVRLRGCRYLRDYSPPHNLEDAPPLRSLDLSNTSVCSISEWGRCPPRLEKLRMNGC
                     TRLSDISVLQSSTGLRIVDLGNTSVHSISPLISCAPALEELRMHGCTELSDISVLQSA
                     SRLRVVDLDNTSVRSVSPLRLAASELEELRINDVTYQGEVPIFQSTGVQRRCNMINTG
                     ASSRSL"
     gene            <460337..>461152
                     /locus_tag="LMJF_22_1225"
                     /db_xref="GeneID:12981696"
     mRNA            <460337..>461152
                     /locus_tag="LMJF_22_1225"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721728.1"
                     /db_xref="GeneID:12981696"
     CDS             460337..461152
                     /locus_tag="LMJF_22_1225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.22.1225"
                     /db_xref="EnsemblGenomes-Tr:LmjF.22.1225"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981696"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ1"
                     /translation="MRALRSSCPAFLCWQALPSTTPLLREISRHDPPSTRNEQGSPDS
                     SNTEQIQKASHLDSHRTANADHSQALPPAEAVPPLTADTLRVPQVRAECPPDSALLSP
                     GNGLTPTLAECVSNAAPQPSEKTAPKRDASASLRRKREREGACDSSFWPLKTRRALDA
                     SAHTAARQPSEAAPVLAADALPPTPAECAPDAAPQPSESEMVVYDPHGAWSSLLVDDG
                     LYINPVGDQLLSSALLSAVRKSQEGSRLLQHDEEVWAGPDWRTVMLRHKPLTK"
     gene            <462075..>463874
                     /gene="LPG1G"
                     /locus_tag="LMJF_05_1230"
                     /db_xref="GeneID:5649020"
     mRNA            <462075..>463874
                     /gene="LPG1G"
                     /locus_tag="LMJF_05_1230"
                     /product="putative GIPL galf transferase"
                     /transcript_id="XM_001687548.1"
                     /db_xref="GeneID:5649020"
     CDS             462075..463874
                     /gene="LPG1G"
                     /locus_tag="LMJF_05_1230"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /product="putative GIPL galf transferase"
                     /protein_id="XP_001687600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.05.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.05.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649020"
                     /db_xref="GOA:Q4QD44"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q4QD44"
                     /translation="MRKSTSVYTLRSHRCFITLRAVIPILIFICLCGAVGTIFLTSSH
                     QSALGWTREPTTSAPSGELTTTEPGEPRRSMTPTSAITTSAPATATTAEQTPLPPEQT
                     SMFDAPGTPTPAVSAASARATGAQDSSTLMEGAKTETTKQNLAMKGLDRWMKMQLPAD
                     WMECIRQNLQLDKHGQPMHAVTEMKDAIPLLITPLTGDVKFFPYFVCSMDVAVRYHYV
                     IQNERDPDTTAVIDDLQRRFGNSGRLLVVRNRYNRGYSGSMNQAFEWALKERTAEEVP
                     WVFACGVDAIFEPGLLAKMIEVVQQNTRGDAAMLAALRAEVELEERLVREGNYSYYER
                     WAPRGRPLKVLRSGYPGVPLNVRTAPLLPDRIRYTVADENRESGIVRPAELRTRFFGN
                     YVATVTPVPDALGTIAVTRLALSAVGYFDENYFPAYMDDIDLRWRHFAYGFGALHGER
                     NGPVTRWHHYNAANLRGSPFVDPDLEKYGTEDNYSRRAFLSYIRRSKGIYDKLKYGPR
                     DMDGVWRQAAQKAEFKYSSFNVSHYPADTWVLDEDARGCMFHHTYNYKTQNWSRPSDC
                     SYNPRTLEESGILGVDQLASYRSMLAEKAFAYQ"
CONTIG      join(FR796401.1:1..465823)
//
DBGET integrated database retrieval system