GenomeNet

Database: RefSeq
Entry: NC_007248
LinkDB: NC_007248
Original site: NC_007248 
LOCUS       NC_007248             596352 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 7.
ACCESSION   NC_007248 CT005246
VERSION     NC_007248.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 596352)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 596352)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796403.
            On Jun 1, 2012 this sequence version replaced NC_007248.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..596352
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="7"
     gene            complement(<3153..>5330)
                     /locus_tag="LMJF_07_0010"
                     /db_xref="GeneID:5649284"
     mRNA            complement(<3153..>5330)
                     /locus_tag="LMJF_07_0010"
                     /product="putative ubiquitin activating E1 enzyme"
                     /transcript_id="XM_001680852.1"
                     /db_xref="GeneID:5649284"
     CDS             complement(3153..5330)
                     /locus_tag="LMJF_07_0010"
                     /codon_start=1
                     /product="putative ubiquitin activating E1 enzyme"
                     /protein_id="XP_001680904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649284"
                     /db_xref="GOA:Q4QIU4"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU4"
                     /translation="MSAVSGKPHLTFSDLQLSIDVGFWEQLRQLKLTEWRLEEPHAAL
                     AGVIRANVSDRVFLSPANLVHLSAGSLHPSTLTQAAAENAADVVSVQVQGTVKSFNFA
                     EELNALNLRNALLSIAAKTLLGPAVALYASAEEEADAWGNMPFATLCMLTYIDAKTYR
                     FFHWEAFPCIAIESAVLVDCLVLGASPALPFSAEAAQAMYRHGTSLLRQKPERACNPF
                     LAVYANNSVEFISFSPTAFVSATATKGDNVVVCLFDFSDTVGSVSLPVRNVITCLRLA
                     VSSLTTLRLYALRSGGTEKSVFVKLAFDALEESLVTSLRERLTGASFADLARVQWKEE
                     FPSLKASGWRKKKIECLDLGAFINPVQRADNDSRFNLELMKWRVLPSLKLDQIARCKA
                     LLLGTGTLGCNVARNLLMWGVRDLTLVDRGRVSFSNLARQSLFTFEAAKDGKTKVDAA
                     AEAVRAIIPSAVVRPVPLTIHMPGHRIDEARADKALGEIRRLEELIAESDVVFLLTDS
                     REARWVPTIIAAATGTPVINVALGFDTYVVMRHGVPGQTSRSNAVGEDDCRDTLHTPL
                     GCYFCSDIIAPTDSLSFRSLDEQCTVTRPAVSSIASAIAVELLAELYQHPSGFRCPAY
                     REAATGESDQGRCRLGVIPQQIRGSVFSHTMHHLCGERNPFCTACADALLRAYREGGS
                     EFLLRCVNSPSFIEEVCGVKALKAKWEAGMDAMGWSSDEEWAD"
     gene            <10435..>11355
                     /locus_tag="LMJF_07_0020"
                     /db_xref="GeneID:5649157"
     mRNA            <10435..>11355
                     /locus_tag="LMJF_07_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680853.1"
                     /db_xref="GeneID:5649157"
     CDS             10435..11355
                     /locus_tag="LMJF_07_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649157"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU3"
                     /translation="MENGMQNTFLAFSTFLCITPQPGITQSLLLPAVFQSAMQDRLRE
                     IEGTLARTKERKNTILYKLSKRRQEEERLARLGVERLPTNPSEVDDEKIIKYVLFRLK
                     QEIGDKTAQLRDQKLLSIDRDGEAVIRAKNDEVNKLLSRKYQWEARLSFLAGEPIAPR
                     PRKKIFFGCAKELPEASVVQKRQRVEGMQEAGEDEVADSSEEDELVPDQLEAEQPATQ
                     DHDYLERVKWLGSSAADLDLIRFEREAEAKMRAKGDSIVSRAGSGALILSYCKEGKAM
                     IPDEEHFKQQLVNNRKKALQERLNALRGKN"
     gene            <11939..>12838
                     /locus_tag="LMJF_07_0025"
                     /db_xref="GeneID:5649158"
     mRNA            <11939..>12838
                     /locus_tag="LMJF_07_0025"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680854.1"
                     /db_xref="GeneID:5649158"
     CDS             11939..12838
                     /locus_tag="LMJF_07_0025"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0025"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0025"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649158"
                     /db_xref="GOA:Q4QIU2"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU2"
                     /translation="MPVVRARKARVDHGSKRSISRFLVSEAAIGKLVKDISAGTDAAH
                     PVTPRELGSGSPHDPIHLPLRRTPNGSGCYHCTTEECCCVEFEKILSNTYARVPKKRM
                     VEVSGARQLCAKSLLTPFVTRLVRLMNITEKDTFYDFGCGNGSVLFQVAFMTGAKCVG
                     VEISEHNADVAREAWQLLRQVLEKKYDRPMPRVEIITADLAELLSTPTYFDEEEGQTA
                     ILISNLLFPKPLTHFLSERLRSAPVGTRILCFDDLYPHARSVASYRDPGAFELFEMKD
                     YFWQEMSVEWCSMEGRFFIHTRK"
     gene            <14183..>15013
                     /locus_tag="LMJF_07_0030"
                     /db_xref="GeneID:5649159"
     mRNA            <14183..>15013
                     /locus_tag="LMJF_07_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680855.1"
                     /db_xref="GeneID:5649159"
     CDS             14183..15013
                     /locus_tag="LMJF_07_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649159"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU1"
                     /translation="MTLAPELKVQPNRPVNFAWAYDKEVGFLKDCFLLWSVKSKGVKN
                     DGCLVGELTSNEAIVAYKLNCMCKLHVKRTAAHSSCAVTKDNFNAIGYGARLVFKICN
                     IADCIVRNGESNRVLSVSSTIMSMSVIHGGITIQTIPVHCVFNYELCNPLRMAHVDRQ
                     KCAPGYVVSDPLPEINEYSDADVVIKNLLSAHSLHDAHEKNAFTALVRAMISDRDMQK
                     LGGNTEADQYALIGVFLILYGPGSIKIANQENELVPKKHVDYCGKKQIMNLTRKNHDT
                     "
     gene            <15633..>16580
                     /locus_tag="LMJF_07_0040"
                     /db_xref="GeneID:5649160"
     mRNA            <15633..>16580
                     /locus_tag="LMJF_07_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680856.1"
                     /db_xref="GeneID:5649160"
     CDS             15633..16580
                     /locus_tag="LMJF_07_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649160"
                     /db_xref="UniProtKB/TrEMBL:Q4QIU0"
                     /translation="MSIDALSPLVACAARAAVKNGETRTIESSLDDLQQQMFGIEEGS
                     HEVATEMMLKRIRETQVLLAQDSASGKSNLTTERLLLEAVSTLGELLLSAAAGQRLRT
                     KTAKQMEDVILPILFLRTSVTPSLLKAHALKVAWSRFECSGKTNNEARDRLRHIFVLW
                     YRNHGWDFARSSGNGVDVCTPTPTPHEGADNAKSNVEEKNACCSLPVHPKQQRVMLRE
                     ISWNAAARKVTTSGIPSYLLTKRRRCDSTYQCDSLASARAEGGARNCFPAAAQPPSPT
                     ATDKATCQINPRILALDSPVKRRRRNLTVDVPPSPDRPE"
     gene            <17177..>20062
                     /locus_tag="LMJF_07_0050"
                     /db_xref="GeneID:5649161"
     mRNA            <17177..>20062
                     /locus_tag="LMJF_07_0050"
                     /product="alpha-adaptin-like protein"
                     /transcript_id="XM_001680857.1"
                     /db_xref="GeneID:5649161"
     CDS             17177..20062
                     /locus_tag="LMJF_07_0050"
                     /codon_start=1
                     /product="alpha-adaptin-like protein"
                     /protein_id="XP_001680909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649161"
                     /db_xref="GOA:Q4QIT9"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017104"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT9"
                     /translation="MDMRGLAHFIRDIRRATGNKKEEESRVDEELAKIRAKFLETSTM
                     TTYDRKKYVCKLMFISMLGYPITFGHIEGLKLMSQESPSAKLIGYLSTSVLLNENSDL
                     LTLTTHTVYRDLLSVSDLSRSLALTAVANTGSRDFVEVMHEGVFSIVMDDSVNQHIHK
                     KALLTLLHIYRKYPEIVDLNTVIPKAAELLLSTQDGVSMCAVAFLSGCISKESRHLYR
                     GIPDKLIQVLARIILEKQTEPGYVYYGVPAPWLQAKLLRLLQYFPLPSEADQRNRIIL
                     VLRKVVKATDKVLKDAQTQQKQRGTQSRVSAMNAVLFEVVSLCIQWDVGSKLILECVA
                     LISSFLSDKRESNLRYIGLSLLARLSFVDVPGFDFHMHCRQHQQQIIVGLHDSDASIR
                     KKALDVLVAMCNRSTADDIIKELISYLPIAADPDFKTSLVLSIALLSEKYCKDYNVYV
                     DIMLTVVSEAGDLCPPDIVQRVVQVVVNDPSVQKRAANIVFQELRKKTNVPEVMLRVA
                     AFVLGEFGYQIALNAESTPMVQLNLLTQKLSFTSVVTQSIIISTFFKFYTLYDDVAVR
                     ERIMKTLQAYTKSPHPELQQRATEFIALVEFGRSELLEKVFEPMPPFRADVNTVMNQV
                     KRLQSSVQDIWALKILERGVEDVNDTGKRKSKSESAEKPKHQAKRRITLHDLSPVSTA
                     APVQGGNADQAYAELDALLDVSLPSQDVDRVRSVYEEHRRRLFELSRADKGVLFSNES
                     IELHCTKSTYGADTRMTVVVRDKTGKGLVQVAVEIIRADAGLILQSRTKDGTTVAAWG
                     TITIEFAARSCFAFRSPPSVRVQYAPASDSARVRTDVLSLPTLPTTFFTPYQVDSDVN
                     FSRLYEATKQASTFAGWRKEVSPSARVDANALMQLLELQGYRTKETGSGAIVGIAAFA
                     VQPKERVEYVPVVCEIQTSASEMQVFVYTESSVLQHGALDTMEFALR"
     gene            <21798..>22574
                     /locus_tag="LMJF_07_0060"
                     /db_xref="GeneID:5649162"
     mRNA            <21798..>22574
                     /locus_tag="LMJF_07_0060"
                     /product="putative cytochrome c1, heme
                     protein,mitochondrial precursor"
                     /transcript_id="XM_001680858.1"
                     /db_xref="GeneID:5649162"
     CDS             21798..22574
                     /locus_tag="LMJF_07_0060"
                     /EC_number="1.10.2.2"
                     /codon_start=1
                     /product="putative cytochrome c1, heme
                     protein,mitochondrial precursor"
                     /protein_id="XP_001680910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649162"
                     /db_xref="GOA:Q4QIT8"
                     /db_xref="InterPro:IPR002326"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT8"
                     /translation="MAGKKAHPIKRDWYWNHNDRFEIWHSLDWPSVRRGRQIYTEVFA
                     PCHSLGRMTFTHFQGFMTREEIKQLASQYEMIDSEPDAEGNLNRRPGKPTDTLPTPYP
                     NQRAAQFANNGAEPPDLQHAVFGKEGGSDYIFSLVTGYNWGNGELMEVPPFAPELKPG
                     QFWNPYFKGCVLSMPPPLSDGLVDYEDGTPATISQMAKDVVNFLRWSAESEYDDRRVA
                     FWKVITTVGLVNCLLLHYGQKNTNWRIYGRTTFRYWKKAW"
     gene            <23603..>24181
                     /locus_tag="LMJF_07_0070"
                     /db_xref="GeneID:5649163"
     mRNA            <23603..>24181
                     /locus_tag="LMJF_07_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680859.1"
                     /db_xref="GeneID:5649163"
     CDS             23603..24181
                     /locus_tag="LMJF_07_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649163"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT7"
                     /translation="MFQRTCTPRLLACTSALLKRSGKPSDLPDYKQVYLPYDTAPTKT
                     ELDRERRKFMHAYSGRMEHRKMVEVKDVPQNMYTYGKEGMSIPISIFKDQADPVIGPE
                     WTYPGIFENKIVAQHWYMEELFDREKSNTFESPWQRQVLDNQVKRRLGKVAWRMSMLN
                     IKTIDIFHKERGASKRPGAGDTKAPATPAGKK"
     gene            <25187..>27058
                     /locus_tag="LMJF_07_0080"
                     /db_xref="GeneID:5649164"
     mRNA            <25187..>27058
                     /locus_tag="LMJF_07_0080"
                     /product="putative Golgi/lysosome glycoprotein"
                     /transcript_id="XM_001680860.1"
                     /db_xref="GeneID:5649164"
     CDS             25187..27058
                     /locus_tag="LMJF_07_0080"
                     /codon_start=1
                     /product="putative Golgi/lysosome glycoprotein"
                     /protein_id="XP_001680912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649164"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT6"
                     /translation="MFRMKSLKLLVVIGVSLALCSTLSLAAENGKRLYPACGVTEHTT
                     SASSQVTSTLYSFSGRTHSLTMTCLAYEVVSVGNDHADEDYCLVEHQTEYMYALVIHA
                     VYTTGNGVTVERNFSIRDMRGGSLAELTVAMPTLSRFSVMFTNLATDTRCNLRVRALL
                     SYKIAGKAGAGNNAPIVVAVSPHTVYSKSADRSVLVLDHGVGQVPQSTDIVSLVDFSQ
                     GTCARPDGNVLYMDYLTAIPATVHVYGNRTQLSVRAITFHEPNTYRVCYRAQNSHVAT
                     QIGVITVYAGNPAYYDVVGGVNEKGEVLVGTETTIKFYGHDLDTRENGDEAKFVEFTK
                     ECDTGKPAGGVPLANDLEPEDNYGPNTTYSLWKSTIAEGGSYKVCYKRKAVNVWTEVP
                     FIEDVAIADRPGESTQAPVPTPTHPSTHAECPMATETAEHPWPKFKSAKVVLTVKKLP
                     SDFLSTLSSLLCLKRSMFTLAYLKHNSEGKQVVFLVLNCEENENAALSECSSIERLNY
                     FASLSKKQLEDHGIESVQGSTHMLAFDEDEGSSRNVFGLILLCASILAAGGMVVFAVC
                     RYMERRHHFVQFGLDDDDIDDMYDFNAAPRSAMRIQYDVAPQAEPTRIANSVIEIED"
     gene            <28603..>32361
                     /locus_tag="LMJF_07_0090"
                     /db_xref="GeneID:5649165"
     mRNA            <28603..>32361
                     /locus_tag="LMJF_07_0090"
                     /product="putative methionine synthase"
                     /transcript_id="XM_001680861.1"
                     /db_xref="GeneID:5649165"
     CDS             28603..32361
                     /locus_tag="LMJF_07_0090"
                     /EC_number="2.1.1.13"
                     /codon_start=1
                     /product="putative methionine synthase"
                     /protein_id="XP_001680913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649165"
                     /db_xref="GOA:Q4QIT5"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="InterPro:IPR003759"
                     /db_xref="InterPro:IPR004223"
                     /db_xref="InterPro:IPR006158"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="InterPro:IPR011822"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT5"
                     /translation="MSAMRGERSPVFEELEELFQKRILVLDGGMGTMLQRYKLEETDF
                     RGEEFKNATKDLKGNNDLLCLTQPAKVRDVHYKYAIAGADVVETNTFNSQAVSQSDYE
                     TQHLVRRINLAAAKICRDAAEQASRETGRRIFVAGVLGPLNRTASISPSVERPDYRNI
                     TYDEIVAAYTEQATALLDGGVDVLLIETIFDSLNAKAALFAVNTLFEDKGYTRLPIMV
                     SGTITDLSGRTLSGQTVDAFYSSMRHGNIISIGLNCALGCREMRPYVERLAEISEGYV
                     TCHPNAGLPNAMGEYDELPEDMARDIRDFAANGWVNLVGGCCGTTPDHIRAIATAVKG
                     IPPRPRGHSSETMVISGLEALHFTHHIGFCNIGERCNISGSLKFKRLVKEGKWEECLA
                     VARQQVEEGAMVLDVNMDDGLIDGVTAMTRFLNMIASDPEVARVPVMIDSSKFHVIEA
                     GLKCTQGTPIVNSISLKVGEEEFLRQARLIRRYGAAVVVMAFDENGQAADDANKTRIC
                     KRAYDMLVADGFPPENIVFDPNVLTICTGMEEHNNYAIDFMNAATWIKANLPRAKVSG
                     GISNLSFSFRGFEAIRMAMHSAFLKKMIADGSLDMAIVNAGALPVYTDIEPDLLQLVE
                     DAIYNRTPHSSERILEYAERLKAEKASGGGAEEAKVSKVDEWRNASVEERLSHALIKG
                     IVEFIEDDVEEARTCGKYERPLHIIEGPLMGGMGKVGELFGSGKMFLPQVIKSARVMK
                     KAVAVLVPYMEAEKAALMADTNGASTSRAKRVLMATVKGDVHDIGKNIVGVVLGCNSY
                     EVLDLGVMVSCEKILAAAREHDVDVIGLSGLITPSLDEMVHVAKEMKRMGFNIPLMVG
                     GATTSKQHTAVKIQPHYNKTVHVLDASKAVVTVSNMLGSSEEEFWEEVHETYQEIAED
                     YLANLKDRVYKPLAFCRENALKIDFVEHPPAPRPRKLGTITISDYSVEMIATRIDWNP
                     FFSVWQVRGTYPNRGFPKLFNCPTVGAEAKRLFDDAQEMLKDIIATRSFRAKAVVTLM
                     PVNSVGDDIEVYKDDTRNEKIATFFGLRQQSEKERGEPYLCISDFIAPKGVAPDYLGS
                     LVVGIFGADKMSEQYEKDNDSYRSIMIKALADRFAEAFTEEVHRIIRTDLWGYAEKET
                     AKTADLIQMQYQGIRPAPGYPSQPDHTEMDTMWRIGEVEERTGVKLSESYAMIPAASV
                     SALVFAHAQSKYFAVGKIQKDQVKDYAERKGWNLDRAESQLSSSLAYN"
     gene            <34567..>37665
                     /locus_tag="LMJF_07_0100"
                     /db_xref="GeneID:5649166"
     mRNA            <34567..>37665
                     /locus_tag="LMJF_07_0100"
                     /product="pitrilysin-like metalloprotease"
                     /transcript_id="XM_001680862.1"
                     /db_xref="GeneID:5649166"
     CDS             34567..37665
                     /locus_tag="LMJF_07_0100"
                     /codon_start=1
                     /product="pitrilysin-like metalloprotease"
                     /protein_id="XP_001680914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649166"
                     /db_xref="GOA:Q4QIT4"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT4"
                     /translation="MLRRSVRCLSLRTSRREDLVFRSMHGFTLLKIRRIDDLHLVAYE
                     MEHVRTGALYYHIDVEDNNNTFCIGFRTPAENNKGTSHVLEHTTLCGSKKYPVRDPFF
                     MMLKRSLSSFMNAMTGSDYTLYPFSTTNRKDFQNLLDVYLDAVLHPLLREEDFKQEGH
                     RVELEDKSSDSEDAAAQPAKRTRRLINNGVVFNEMRGVVSDPSNHFVHSLMRTMLPHT
                     HYTYISGGYPPDILGLSYDELLSFQRRHYHPSNSITFTYGNLHPESHMEALNSYFADF
                     ERAAPVLVPTLADQHRFTEPQLVHLEGPLDAMGNPLRQKRVAVSYAVPKANNKLEDVV
                     ALSVLDSLLSSGPSSPMFKNLIESQIGSKYAPMQGYAFYLSSPIITYGVAGMDEERTD
                     AEAEVLQAVESALRSVQRDGFDERRVRSVIFQEELQHRHRSADYGLNTCTGLCAMGLC
                     RAQNNPLDFINWLPHLQRLADDNAASLLPRIETHLLSNPHRAVVSVSARKEYLNRLQD
                     QLKEADEAVNASATEADKDRVEKETKEGLQRLRAPQPHDVLPTLRIEDIPTESFAEPV
                     PCRSSLSSTNGQVYTITHPTNGLVYVHGLIPFNTSLTSAMEHGELGQVPQNIMLLESL
                     IGRTGAGKLSYKDHSIAVKLSCSGFGFEPLLNESYLHKSTTITGTSYSFYTTKEKLKE
                     ALDLLSVTLLEPRFSADDTDVYSRALSNLKMACSSVIQSLQAEGNRYAVIRAVGELTR
                     RGELREHWWGLSQSTHASEMLEKLQGCPEVSRETVSALLDNYAVFAQEMATDMSRSLV
                     WATCEDAHREEVERMLKEFLDAFPRTDSAARTHLFLPPCSTEKGVQQIIKKLPIDTSF
                     VGLAMPNKLKWESPDQARVRVGCTLLCNEYLHRRVREEGGAYGSNCTATLHGEVGGVS
                     MSSYRDPSPELTAKAFLEAGDWLSDRKNVTAERVSEAKLRLFSSIDSPYAADSYGEAY
                     FYNDLRQDTKQALRDALLSVTAEDVVNVAHYFTPQSTTIISILQPAGESSDPAAVPPE
                     AS"
     gene            <40736..>41773
                     /locus_tag="LMJF_07_0110"
                     /db_xref="GeneID:5649167"
     mRNA            <40736..>41773
                     /locus_tag="LMJF_07_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680863.1"
                     /db_xref="GeneID:5649167"
     CDS             40736..41773
                     /locus_tag="LMJF_07_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649167"
                     /db_xref="GOA:Q4QIT3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT3"
                     /translation="MTVVLCRSYETPTYLIPYYLRDVRSRFLHYASVRKRKGGPMYMT
                     VEDFVLALLASPEKVLPNPDIVQDLQRLFESMDANGDGYISFPEFRFLMSLLTSDPHE
                     VEALFSIVSTDNSGTLSLEEFANVLRGATKDEGVVRSLLKPSTRRNGIVRALFGDETA
                     PRRCSFRELEALIHSVRTEVWKAEFRQYDVEKHNRITAEEFAALIARQVLGSHLPYYL
                     VGNIRRLHGSGDVVTLDMWLGLNEVMLYAEQLAANVEMFSGSGMSVTKRDFPRLMSMA
                     GVPALPQATIDIIFAVFDKNGDGSMEMDELLFIMRKKVKYHYSAPPHERKSLPKRFLE
                     CSSDVLAGLGR"
     gene            <43014..>49598
                     /locus_tag="LMJF_07_0120"
                     /db_xref="GeneID:5649168"
     mRNA            <43014..>49598
                     /locus_tag="LMJF_07_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680864.1"
                     /db_xref="GeneID:5649168"
     CDS             43014..49598
                     /locus_tag="LMJF_07_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649168"
                     /db_xref="GOA:Q4QIT2"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT2"
                     /translation="MAHHQPTNVEVENKVAFFVQLNALLTRVSSVVSSDALSSAQKAK
                     LSDVRSATEAWLKDVGIIGAPRPFIAASPPPPLRSSVTETPAAAAPLSETVAASEQQD
                     EEQAEAALTQAPEAPAAEQATATTSSAADGPARASASPATPGGSSTTTAALTSTHERA
                     DGRKLVGLVSYLRLLFDSDVPERAKLQEFGKSLVRLLMVRCCSTIMASLQHVVHHTYT
                     STTTTAEEGDDAEAALSALFVQLAKEIDVATKALLGCVQLITSSAVLSEAASARFPLQ
                     LCVDVVKQTRRAQVYFQSRVEREEIYLLRTFVTSSDTAAKSAEGLLEDVDAVHDALES
                     VSPERVAAHVLRRVEALRRRWGPSLVHSVRKIGDVIEPSVKFLAAVAAVRAEGAPAPL
                     VALKKDAAHDLFSLCEPVTAAAAGGQASLAKSLSTCDSPSVVAAPVSASSATPLARRA
                     AAGEVLIRLGSSFSADYLAAVAACCGDNNEGELLATRLLTDMLKCVAAHDLPLLRCVL
                     LDGRWYRALYDGILNCVSSSQPAVLAAGLDALGLLTTACPVVIGREVGLLYSNVVLRL
                     LESSNTPRYVKRTIVLHFVTTFMGSGSTLPADGGGAAVPLILHLYRLYDLNVHAHQLN
                     LMQQLTSALSRIVRAAPKEEFMQDAVVQEQLRIQQEAAPSAVMTAPAAQLDGAQHRTG
                     VGNGTTSSEPSSSTAATLNPASLSLPAIALHGLVRIVELLTTQTPPEEESGKDVLASL
                     PAMTCRESKLKEQQEVDRFNAAPKKAIYKLFNVTAEDNAIPASHADFSSQWEHTLLPP
                     LTSTAAAKVEAVADFLNQVSSLNPEAVAEFLTTPEVFPLQVCRAYLRRLPLAGCSVLE
                     AISELLMCVQLPKEGQRIERLLEYFSAAYYEANRGHGIDSDIFPFKSDTAVFIVVVAT
                     VMLNTNIHNPSAGMRLDAKTFRGQLCRCNNDESFAGSFVDDIFDRISRHPLESIKSIA
                     ADANASTDSTNRGSFDMFFVSQEEKRQLAFGLERQRMVRETQQLLKLRTQQESLAPAP
                     EGWWCAVAKDFFLSTWSSVCAVFGPAMYEGTTAAPSDVLLQCVRGLQSLLCMAAAFDL
                     PTECTVTLLTLLRMADATPVREHCRRAVLVVAATTYAVNFPVRCWVAVCQIILEVRRT
                     AAAATPPLVEDVFTRIEGITRLSVETEARRAADDSAPKTDRPTEAIHRAMEGITTTIS
                     GYAVGDVANLSSALAVLRRALEYTRIVHAKRRTDIVYFVNVRDFTAVVAPAYVELMKK
                     HSSSDDGLQALFECLVDLLCTMWVSYSTSRVMVAGPGPAAAGGKAETAETLTVDTAPA
                     DFAQSFRFLRSVYDVTLASASDGTATLLQMHTLQAIKEVLSRTVRMAEMTPAGQHLSL
                     YTMMASWQEMLYPLAVALCDRNSTAVEAGSLALLVLRKLVALCGGTGTASSDRLPGPV
                     RAALLWLLAQLAYMGGMCGDADSAQVCVALLSSICTTTVAMSVTAASSSSPWCGAAGP
                     ASPVTAVADPSTVARLMEQRNALTQQVVTSIEENPHYVVQCTLARLCLLLRCEREQTR
                     AEVMHQLRTLSLQMRPAQLCPMALDLAEVVLEGTIGHDACHRDAPHTQSSLIPFLFFQ
                     MPVPASMRRCSRTSFRATVPAALGFLANELLTGLSGDDLATAAESVMRRCLLPILLSR
                     NSPHQSRFIAVRSLSQCISVCLPQNSTAPSPQLAQCVLDCLAMALYGVRVPLTSVVSP
                     DTSFVGRRWLDAPATSSASGWAAYCAQATHTVELMDRAEPQWLVRGATPAAADAALST
                     LAATATEERDGAAATPTSSHGGCATSDETHRARGGAAFVPDEALIEYVNLLAQMLAGV
                     PKELQGVVANAAAAAAGSATPSAGAVAVPDMHTDDWKLPRASVMVLLQLCLQAGGTLF
                     AVLWRVNHPHEVEQYALQSVESRREALAFTRKSGLLPHAAIRSVLQCYLKLAVLSTEY
                     PSAELLEVTTDIIEGIRQVQAATHAAAPMPSPPSLAVGGGAGAVTAGASNTSLAADSA
                     SLQRLPPQEQQHVRTCNSGMYQQLSVVLGYLVRLLTGQSTSMASVAGWARRQEAFEAM
                     ALHPQFFSSLVSLLTPTAGTLIITVRDYFAWYIAHAQLPHQASEIAGPVTVSGGAACS
                     GEVTPTSAAESNEEGPSSSQLTALNGTQDGKGSAIGSYSVNGGGSVKRSDAKAATVSP
                     VAGR"
     gene            <50483..>52294
                     /locus_tag="LMJF_07_0130"
                     /db_xref="GeneID:5649169"
     mRNA            <50483..>52294
                     /locus_tag="LMJF_07_0130"
                     /product="putative tRNA-methyl transferase"
                     /transcript_id="XM_001680865.1"
                     /db_xref="GeneID:5649169"
     CDS             50483..52294
                     /locus_tag="LMJF_07_0130"
                     /EC_number="2.1.1.61"
                     /codon_start=1
                     /product="putative tRNA-methyl transferase"
                     /protein_id="XP_001680917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649169"
                     /db_xref="GOA:Q4QIT1"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT1"
                     /translation="MSVATTRSQLRIAIGLSGGVDSAVTALVLQRCVHTTLDVAALRC
                     FGGPRAPPPPLLALRAAVDAHVPLHELLGKLVTAGEPSITAASYDAAPVQHTPFFMRN
                     WHDDSAASGWCVRAQVDYDDAQQVARTLDLLPRDGTPLPWYDLSSEYVEQCFERMLAA
                     YAAGHTLNVDVLCNSKIKFGALTRALRRTGSVFSETLLATGHYARTWDLPHGVHGGDD
                     AKRRPVLLVRPCSAGRDLNDQTVFLSRVPPSALATAIFPLGHLFTCKADVRALARHSF
                     GQSGSTAAVASSNGEPQRTVAHISRKKTSTGICFVGPPSAATCAGNTSCSSRFPLFLN
                     EYLPPPPPPSGPSTRTVFCDAVTGEELLVPGDTTEHFAGASLQSSACRLYRGPMCGAL
                     RVDYPGLLPAYAFTLGQRVRLCRRTVDGRVREAAYYVADKVLAPLPLSALSDNKAVPV
                     RLLAEVRVVAQWNNALLYTSQATVASLHWWLPLPMLHQRAVVNHERGMYGLRCHCCTR
                     HHEALQPATVEWEAADEELSADAEVRVRRARVHFDAPLRAVTPGQALVAYMPLLELKE
                     GWKKGCDASHGDAEPSPPEAMAVIGSGWVVSPDFPPP"
     gene            <52889..>53944
                     /locus_tag="LMJF_07_0140"
                     /db_xref="GeneID:5649170"
     mRNA            <52889..>53944
                     /locus_tag="LMJF_07_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680866.1"
                     /db_xref="GeneID:5649170"
     CDS             52889..53944
                     /locus_tag="LMJF_07_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649170"
                     /db_xref="UniProtKB/TrEMBL:Q4QIT0"
                     /translation="MLLSSQVARAAQKAPVTAGLLVFMCLVLLLSSSNDLTCMHSALY
                     ELFPWRFITYPLAMTTRQPWRVAVNTAVVLAGASAEAATGSSEYATFLLFTTVATGVL
                     VLLTDLVIFDPLRLVVGGGDNSHNQPYGYTGVWPVAEVVGFSLCRVRGVSALVGPRLR
                     CGQLTLQRVPLAIVWAAFGCDVVSLVVGRSAEGYNEHCAGWQVMVASIALLVSWLYER
                     RVTGAANSAFALEAFMYPGPLREGARWVCGRVQRRLHASPLHFLLPPEGGVDGGAAAL
                     PTPLFSRTAVGNPFPGSSNTATTTTTALLPGTTAEEAERHRVIAREALARRLQQQQSS
                     ASASSAAEAADSVAKTA"
     gene            <54795..>56645
                     /locus_tag="LMJF_07_0150"
                     /db_xref="GeneID:5649171"
     mRNA            <54795..>56645
                     /locus_tag="LMJF_07_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680867.1"
                     /db_xref="GeneID:5649171"
     CDS             54795..56645
                     /locus_tag="LMJF_07_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680919.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649171"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS9"
                     /translation="MTWDWGVLRQQTLELLYGATAEQRHHQSQHRDQKQAYEAFMAMS
                     ASAAGEPHRSGGSAAPSASPPAAGRRHRDHGYATVRKHFQRIPDMFLDMEFYFAITGL
                     GLFDHLVGLLLLPLKVLTQWRRCELRDIITLLVLTITLGSYWVADLATTQLYSYLYHA
                     VRRTSFIKVVMIFSILDVADKILSSFSQDSLEVLYAAVDDEYAYRCAHRCQTKPAAGD
                     TPMNRAAFGGACAGRDDAGYANARQHTPPSRWLLAGSAIAACISTSCHSLSLLLHVVT
                     LNVAINAEGNSLLALLVGNNFTELKSVVLKKNTPESLQSVCALDALERMQYVVFFLVM
                     LLHHMHERFTDFAVADVFVILCVEVAIDFVKHLFVFRFNGIPPSMFRAYSQLALLDLS
                     CETVLWRLPSLEVVASGSGSGVATRMEEAAELLTPAFGFAPKNVKRNGFDAIAYAALL
                     LWSCERVAGYLLWQAPLVCVLLVLILALLKLMLSSIVYGMCARFTLRTLVVSPPSWSS
                     LPQPSAVSAPLDGGSCSESGASQRRSASLTSSVSTWGVRMGVSPISTPRATPVGSSRH
                     THISAATSSSVNGKSGPAAVPTLVRLTPLLLALLKADRFDLQAGKAKRTY"
     gene            complement(<61003..>63546)
                     /locus_tag="LMJF_07_0160"
                     /db_xref="GeneID:5649172"
     mRNA            complement(<61003..>63546)
                     /locus_tag="LMJF_07_0160"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680868.1"
                     /db_xref="GeneID:5649172"
     CDS             complement(61003..63546)
                     /locus_tag="LMJF_07_0160"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649172"
                     /db_xref="GOA:Q4QIS8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS8"
                     /translation="MGMEHYTKVKDLGGTNGAFLARDRQQPHRLVVIKRLADGTQGIE
                     ELNASLRLRHPHIVRFLESFIYNGSLFVVMSYESGGDLDGLFHYLTQSHRTPTTHTLL
                     LWFVQLLEALVYCHDHHVIHRDIKPSNILVSEDTKVLYLGDFGSAKTLSTSNVTSTFV
                     GSPMWISPEVLLGTSYSYATDVWSMGCVFYEMAALCKPFSAPSFAHLVQQITWGHITP
                     LPAHVAQEVRSIIHSMLVLDPAQRMTAKAALEVARGALVRAEELRQASPSPLRPAGMP
                     SKSSATSLPPRLTSPSEVVAHQPRQTPPPPSPPPSQPYSSCPSAGTTPPRKRGLTQTA
                     APPVPTPSDSTPPPSSTVSDPLLAVASEAKAGEDPTPHGSPPSAAAPESTSQAAVVKQ
                     RPGASSPTSPLVEPTTSPTPQPPAGGAPASRQSPAVLVVAAAPPAPAAQKQAAVQDKG
                     ALVASPVVDAQLRAPQQMVLQISTTGFSKPAQRRKAVAQRKNVAAHKAGPLSLRQRVP
                     SVLGPTSPPTEAPKFVRQLSTDSLSTRRAAELFAPSRGSSGSTKVVVKAVPPAHVAKR
                     ALAVAGNRENPPRVPRESPTRESRALHKAQLKPALKLPPKPAAPASDAAPADQWFDQR
                     MRDLCAMENYLHQHRVNDDKVLKTYDARRHKEEQQCESATSEARAAGKTSAARRRSPA
                     TKFASPAQPPGVLVMTPPRHRHLSDGIPTPPALSAAQQQQQRQQRPGAASPFVRQASY
                     VRQVSNPACRSESRQSSLSSTFNGRQASNARARTRVSLEEQLRNEEGRVIAREKREAE
                     RQRMKELISAQRAAAKQRKRKARKDDAVDVQIVLPDRLHYTPDSVVPAD"
     gene            complement(<68768..>71962)
                     /locus_tag="LMJF_07_0170"
                     /db_xref="GeneID:5649173"
     mRNA            complement(<68768..>71962)
                     /locus_tag="LMJF_07_0170"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680869.1"
                     /db_xref="GeneID:5649173"
     CDS             complement(68768..71962)
                     /locus_tag="LMJF_07_0170"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680921.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649173"
                     /db_xref="GOA:Q4QIS7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS7"
                     /translation="MPAQPLAQCQRSKQPSPTGTETMVNSEYKIVEKMATGSFGVIFK
                     VRRVTDHQVFVMKRIPLLGLTAPQRRDAAQEIILMRDLHHPCVVSQRDAFLYNEHDLC
                     LVMDYYDGGDMDTHMAAQRDLDMYFELDQVMLWFVQLVLGAQYLHAHNVVHRDIKTHN
                     VFVRSKDMSVVLGDFGISERLGVDLANHTWVAGATMSGPHGSDGSSLTSVPAMVTATA
                     AGSPSPARVNRVDDAMRSLSISGGLRPSTPGGAGAGAPVLSPLLHQQMAWSSGQWGAE
                     SHICSPNSSPYQPLSHMRQTSASSNAASSCSLQRLLNGGVEAAMKGTPLYMAPEVLQG
                     GAASPKSDVWSLGCVLYELLALRHPFESRDLAPLVMRVLRGQREPLPTHYPRPIADLI
                     SSMLCLDASQRPSCEEVLTVPCVRAYVDLWRSLRTPLDVPASPGESALTRQLQAWQAN
                     IAAWNARHPDDPRSKSVHYTELKRQLLSPACAPAEEREKVERRAVEAARTALAAQPSA
                     LACSISSVGISGASQGGGGVQDGTFFFGATGGCLAGAAGRRSSELPSITSAREGMLNM
                     GPSDSMRPYMVYDAAPEIAATVAAEGVGPSCAESAASKALSGRPPRPSRRPSGSPPPH
                     PVQGEDLAVTGHNIGKGGARVGSLPQAAAAARSEDSPMMSAAARKRRCQQARQREPAA
                     PQQKGEASRHDDTAEPERKPLTGAVSPAINSAAEAPSATPPVLSSHFSLKPGLPTSPP
                     LMHKRTATRCGSVDEDALFFQTYENVADMRFASLDEIAQSVVDLRQRVQQRMQHQRLL
                     TDIEALHERHGSALLRSMPHVLNVLEAAAAVDDGAEGPSGRSGGGQFTMSPEQVYARM
                     VRQIDEQRSGHEQHQRDPDNAEKVVGILHLRQLPVGRPIPPRIRQLRESAALAQVAAS
                     EEARRRSRLLPRESKDRSSSTTKRGVSVSAAVSIQFADPAAPLMASSTGGGRSSSLTT
                     VMELRRWRPYLERRNRLSAALTRIFDATTLRAVYSYYRTCALLQRDAAVVRRLVPDRQ
                     QWSALPSIEELAVLDRRLEVMFEGRPSWDGRQGA"
     gene            complement(<72737..>79090)
                     /locus_tag="LMJF_07_0180"
                     /db_xref="GeneID:5649174"
     mRNA            complement(<72737..>79090)
                     /locus_tag="LMJF_07_0180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680870.1"
                     /db_xref="GeneID:5649174"
     CDS             complement(72737..79090)
                     /locus_tag="LMJF_07_0180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649174"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS6"
                     /translation="MPLFFSKRLLSRTRGRPDPKPAPSPQHLATDTAQRSDRGNATAV
                     PLVFPRYLDGRDICACVFSLRPVDSRWVEAMLRQLRAPRRSASERIPRSQPADIAPCD
                     RRGKKRTRGGDDSGGGFVAAGVATQSHRLNRCSSSAYTQRVMGSPPLSFIDDVNNGSA
                     AAASVSACGLRLVWRGASLDRPPSGSASAATGGGMAENYHAASVGSRVEDRDVTAYPT
                     LFRAFIMLDDDAGTAEAVMADVCSTAAGARSCASAELRTPVAQRPRRAHVGDRDLIPG
                     PEADSAELVRCWCQSVQQPGTEAEGRGGRGDTLSPLVSRWARNRTRAVLAAESLADLT
                     APCCTTTEVDIATQSPQATSDPSGRAAHWLRLCSSAIPKVSPGAVGTISVSGSLPQRR
                     FTDMESLWHFSFTAPSVPRALRMRPGARADATWSVTMQPTMWLERKMEGSRDAEASVR
                     GVRPAAGAEIAANEAAVSAQLGGAAVTAPQLAIVRHARLRCLIRDNDSGGDGTGKEGH
                     RAAPEVSPAAPMTSTEDGLTAEALSAQWNVFVADVCESRTTQERRRAASTHERWQAAA
                     ASLGSVGESIAEALTTLPQLHFSQLCAAASASHREGEEGAHNALDVGPTDSMRGLGQA
                     YPYPVLEWWRWTSCGRSRSPPPQHARKPPRRLLGTCVAFRSVPDDVEATRAQLVLTLR
                     DWVRDMSDVQWRAASWLPWDSWITAVCAVAAVPLLLFPLSSHRAPLLMPSISRVQSRL
                     RIAAAQEGSAASTAHLTADSLVLGGRPTGHSVKDRALEQQPWAPLDAAPQLLREAMRS
                     AAARPRMGLLAAVVQEDAEDAKPLRCTVRTAAVAECEALARVCERSARAPSHERERGA
                     AAAATAAKESAAHTLHCPLLRRCRCDKLAAGVSSDDEHGRSEGRATARMGASPPDAAS
                     PNSQVASFSSSLAVAYVARGHTDSVAVDLLGEYSRSPPATVPLLAPSEASSASEASSA
                     EDAGTGDRCVGEAVGRKRTRSEAASPSATVLPSSPAIAASSLTCVVRASLPLVERGAS
                     VCLPRAATSAQRSSTPQRLLTAWLEQRCREVISAANDSLSLTASAATAEAGAVPSSSG
                     NSLLASRPSSQSSSPPPPDALSVAHSCLHGDRFRRMRRWLISPPSPTRLPLAPSRRRR
                     RCAAVIYELAGPTVSTACAPVLQPPTRWGPSTRQALLQDAQSTESRCALASPTASVTP
                     VHGERAEAEAIDDPAVCVNAALWPPGELATAMATGCCSRTTLRMHLPVNPRRGLGGAP
                     IKPVTVWKWAQLTLHNYAADALAGAILPGARAIERHLRATEGARVPMAPTAPPVAAQT
                     AAHLFASGLKNPVTSPRTHGRPLRALPPPSTAQQGQTPAIETAGVRLLVTAEHWRQRR
                     ARRAVQRLALYGLMLAHEAPPPPSTWLQSRSPSQSMEGEETALSRGADHTAANSLTVG
                     AQLYRDELQRNDRAELAQCVRDALTRAQYAACVRMFQRWSGHGEKSAGELAEARRLTD
                     ACDSAVSRTCASCKAAHDSSCTLIPASFSGSLSSRALPAPADGRCCVACERRLHRIIC
                     DGMRRDGWLAFHTLWYDALSEHVSPYSPCTWPGCLLSATQGSATTHAASSEEDGTDAW
                     AHDAPLRSAFVPQTRVEQRDIDSLDVWVDTEPGASPLEASAHEMRWYVDTSDEDDEWR
                     EAEEHDDGVVALHAGHSSSQWCCCCLASHENLIHAIMAQEELTAATEHSAAPVPTLER
                     GATRHRGGAQPPLCPAWWRAGSTMGATVISDGSSASQQNPTSAAARATARSEAVRRAC
                     GALVFGLLDAGGVSVPPPLSSWPLRSYFHPRAHGAAEEGTLDDSRADKVSANSAAACF
                     FARLRRYAAQLLSCDALATRSAAVATVAVATTVLHRRRPSSCRSLSSSTGSPGCCRAE
                     PPCALPLRQLSPRAGMVAAATPAVQQQREDEEDVEERVAPLRRCRHTRHVCSFAEEMQ
                     SLQTWLLPHWWARQQHHFAVTVNARQLPPRSRASRRLEYPLDGSHAVATTATHDGIDE
                     DDDVGEDAHLSSLRCFLAPREESEAWVQLLHHAHLRQLRRPYGPLFHGRCLLRCAPLD
                     GCIADAEVHHTYLAAMLRQRTEEACGALSAYVLPYCEPHDTCM"
     gene            complement(<81348..>82529)
                     /locus_tag="LMJF_07_0190"
                     /db_xref="GeneID:5649175"
     mRNA            complement(<81348..>82529)
                     /locus_tag="LMJF_07_0190"
                     /product="putative phosphotyrosyl phosphate activator
                     protein"
                     /transcript_id="XM_001680871.1"
                     /db_xref="GeneID:5649175"
     CDS             complement(81348..82529)
                     /locus_tag="LMJF_07_0190"
                     /codon_start=1
                     /product="putative phosphotyrosyl phosphate activator
                     protein"
                     /protein_id="XP_001680923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649175"
                     /db_xref="GOA:Q4QIS5"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS5"
                     /translation="MRGSDAMATHASRWRPPQNPAAVRKYSNETAAPQPPAKIIMEDH
                     SLAEVFRRSAAFQRILAYVQGCSEAVESTPNHQRLSATVDDCDDTVRYLVTDYLPRLH
                     DIVTAIPLEDMAQQRFGNRAKRVFHARLEETVVADMEKLVRTFPTSAGRSEEAITDMA
                     TEVAAYVMDSFGNATRLDYGSGHELHFFIVIMICLEEHGDGGGSLKDEPAVLVPLEVP
                     PPPPVPPMERAEVRKRRQDYIFYIFHEYMRLVRRLQKRYSLEPAGSHGVWGLDDYHHI
                     PYIFGGAQLINAEVQPVKPAAGQEAMLVLPKHICDRAKVEMLKDSYLYFSMIAWILEN
                     KTGPFHEHSNMLYNISGVEHWSKIYSGMVKMFAAEVLAKYNVSQHLLFGRHLPWNTKT
                     M"
     gene            complement(<83766..>86033)
                     /locus_tag="LMJF_07_0200"
                     /db_xref="GeneID:5649176"
     mRNA            complement(<83766..>86033)
                     /locus_tag="LMJF_07_0200"
                     /product="putative phosphatidylglycerophosphate synthase"
                     /transcript_id="XM_001680872.1"
                     /db_xref="GeneID:5649176"
     CDS             complement(83766..86033)
                     /locus_tag="LMJF_07_0200"
                     /EC_number="2.7.8.5"
                     /codon_start=1
                     /product="putative phosphatidylglycerophosphate synthase"
                     /protein_id="XP_001680924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649176"
                     /db_xref="GOA:Q4QIS4"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS4"
                     /translation="MPALLVYLIILAIAAGVTFALFGEVGEADVAPADALALFAAATP
                     TASGATSCSLEAAAETTAGADDCGARKSHAAPGDASGIEHIKSLLMKCGVPPQQQEMI
                     SFLGRHCCVLPVKSHTVRVLNRPADFYEELKARVMAAQRSITLSALYIGDGPLSRAFV
                     ACLEERVRWAAAGGRPFSITILLDYNRMQDRKNLVSLKTLMELAQQTASTASLPVDAA
                     IVGASASSPTTHSPSTLGSSSIVADGERDAEEDEVVRGNSSDDASSATTTTAAAASTG
                     VRVRLFLYQNPSKWNRLFAPFGRAKEVLGVQHTKVFVFDQRHTILTGANLSDDYFATR
                     MDRYMIVKDNALVARWFTQLVRTANRMSHPVVCRKEFAEQLIGGGDTCASRTPNKRGA
                     LGHSSSAASPSSCMAAATANGSAPEPLQSPLRWVVEKVSRAVSPPLTSLVSQREGSPT
                     LHRKSNLVILANALQMDPSVDTEAFCARANALLHDFAAWARRLCAVATVDWSCYDTFL
                     FPTVQAGRAGVYHDSVIVKQLLRLSTAEDHIFLASPYLNMHASFVDEVLHGTSYVDCI
                     TASVQTNGWNGHNGVAGRIPLFYLQLERSFYYLMKAYSCLRRVHIREFSVKGLTFHAK
                     GLWFMGRRCCPAAAAAASPPGKDDEGDARQHHDGHGADAAAADPCPLESISAPYLVAY
                     GSTNYGYRSVHKDVEAEAFLLTTNDALRETLRQELLFLLQQSVPVTEAQFVGTAMGRF
                     QPVISLLAHLGHDFL"
     gene            complement(<86595..>87359)
                     /locus_tag="LMJF_07_0210"
                     /db_xref="GeneID:5649177"
     mRNA            complement(<86595..>87359)
                     /locus_tag="LMJF_07_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680873.1"
                     /db_xref="GeneID:5649177"
     CDS             complement(86595..87359)
                     /locus_tag="LMJF_07_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649177"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS3"
                     /translation="MPHFSLPAHEADTPPEPVDAASRRHCCGDDVELCCRLTAAEELH
                     GHVRDCFSLFASRFAYTAVALACIGAPFSSSPPPARSGVLPGTPEASEAEEADAPRSA
                     GGTFDVSTVATVLFLHVEDKVGACLGAAGGSDDDAKTPLLGVVVAFQYWRGFYCVAER
                     RYASAAEAQGEAAALERGNLTVSQLLRMPQWQLMGEPAAEASLSPAPGSGHAKLNTSP
                     GSTYMTPDFSGIDENTVAKHGAAYESLMALMVGTYL"
     gene            complement(<88294..>90201)
                     /locus_tag="LMJF_07_0220"
                     /db_xref="GeneID:5649178"
     mRNA            complement(<88294..>90201)
                     /locus_tag="LMJF_07_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680874.1"
                     /db_xref="GeneID:5649178"
     CDS             complement(88294..90201)
                     /locus_tag="LMJF_07_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649178"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS2"
                     /translation="MMRCFRALRARKDIVELLVCRGRLADIQMLNFFSIQLDREVSAA
                     TAAAAVPGSAVAAGGTGGGEESESTAKQAEKAAVTAVTPDATGTEATMAAAGAATAVE
                     AEAVAKAAAAEAQRAQSCEARKKAWKAFHDRSDMVRRLAVSESPVAWLREVYSGDEEW
                     SCSYLTAATAVATHAGTGAPTLKASGTATAVGNGDVQRARTTSAGSEGGQHPHHGSSC
                     ATTAAHALPKSIRVVLRLEGGEDGTPKYVTGCVPLDQPGVVEKKMVNGMLQVRLNNAD
                     VAQSEPLSAEKVASYQNVLTATAYSGILRKMGEIGSLHATNTVRYDALLIRNPAVQMR
                     LAQLACFRYGIDCLTDYVVGDPAVVDGDEAAELFSSFSEQLQIPLVESMVLKIYAERA
                     LMDGMDCMWEMVRDTPLVAAVAHRSNPAKMINYPYLAELLNASKYLLTSWNGSMEEQA
                     MAFLHPLLSQGGLFGSGAGGSRAGIGGVLQGLIGLTTGHSCGGVRLAAPHVNLAGMAK
                     TLELDVAKLLSVIAGEKGKLEPMFVISVAQYISEVLANLAVIYRCTAALNIDEEGRGH
                     REWLLAQAFGGASAVRRQRIMNDYMMSRAATSVIKKSKSLDNYSTHPIELMNTSPRNA
                     KTSSTERAAST"
     gene            complement(<90901..>91242)
                     /locus_tag="LMJF_07_0230"
                     /db_xref="GeneID:5649179"
     mRNA            complement(<90901..>91242)
                     /locus_tag="LMJF_07_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680875.1"
                     /db_xref="GeneID:5649179"
     CDS             complement(90901..91242)
                     /locus_tag="LMJF_07_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649179"
                     /db_xref="GOA:Q4QIS1"
                     /db_xref="InterPro:IPR007785"
                     /translation="MSSPAPSTQAFSLKTRQPIPDEDALLTEEDRILKQATKGEDCTT
                     RRRACKNCVCGRAELERKLEAEVLTMPPGGCGNCSKGDAFRCAGCPFLGQPAFDATED
                     GKVKLNLTDDV"
     gene            complement(<91907..>93730)
                     /locus_tag="LMJF_07_0240"
                     /db_xref="GeneID:5649180"
     mRNA            complement(<91907..>93730)
                     /locus_tag="LMJF_07_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680876.1"
                     /db_xref="GeneID:5649180"
     CDS             complement(91907..93730)
                     /locus_tag="LMJF_07_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649180"
                     /db_xref="UniProtKB/TrEMBL:Q4QIS0"
                     /translation="MLRFTRWLGEHVAMSAGVGSPVYKETSNLFWHRRVHNFRRRGSF
                     GKLATLVGYGTAGAGVYVATCLVVRTLHQPTVDALFAPGRDYTLEDWKDVEPTLQPGD
                     IILMRGTGPVSWCITTLQFILSFFKPAALRYSHVAVVVAPAVIEHVNDDTSEAGVPAA
                     TGPTEARGAASPSKASAFSTPPYRVRNLSEVFERGTEEAESAAPAHGTRVPASPTGWV
                     HEQLRAEEAALQRRPVIRRGAIILEAMDNTDYDVVDVKGNVTHNTVQLVEASRRLLSV
                     TPSGVPAYHYFAVRRLRNYDHTPERERRLARFCEESEGRRMDSSLLYPLAFLWPRLHT
                     QAHPLRQLITGEVSCSELIVELYQELGVLRRRWRWVPLEPDATASAPPPSTDATRQGN
                     ARSDEQHSASNGENNGMDVVAPPPPPTATDVKDDRRSRSLHVYDYAYGRLDARAQHPV
                     ITRDRPLLPDTSVVENSEAIAAADVRLRSSRARLKPSWEHIDRMEHIKNFYGRTLTGD
                     AEELARQQMKQRSEAVYHVDAAVPPLVLRAGDTATGVDGRVYQLQWYYQHSSVATCPY
                     HFTEGAGESVLDFAANTSLGRELHMRIVREEDELSRAMEED"
     gene            complement(<95018..>100639)
                     /locus_tag="LMJF_07_0250"
                     /db_xref="GeneID:5649181"
     mRNA            complement(<95018..>100639)
                     /locus_tag="LMJF_07_0250"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680877.1"
                     /db_xref="GeneID:5649181"
     CDS             complement(95018..100639)
                     /locus_tag="LMJF_07_0250"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649181"
                     /db_xref="GOA:Q4QIR9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR9"
                     /translation="MSGSQLDSATAAATMTSTAVSSASAEPSPPTGSSSTAIMPSSLT
                     ALAQQQQQRLLVSSLLPCDGPLQYVDPTADGLPGASSSCDEEHNSCTRPDAAQHDRAV
                     SMRVPHVTAHERSEHASNDPGPSPPFLPAAAARLGSRSADAAYATSHLDHDGAADCAT
                     SSSSTATASTTSMYAAETCVLRDTLPAPPMQDQPSSEGAVDATDTRHSSSSLVNAGSD
                     ATLAMTGIRSAAPSSLLKAQSISLQPKETARDAIDAVSRGSAGQQPSAGGCLTTMMTT
                     ATATNTTTAASELPRTMLPDTLSACTTVKGSETLSSQAGSLMLPLNDGAPPSCSTKAA
                     TAALSGPRREKRRPPSLFSSSPATTSLTVATRPVLITPAVGRQEDRSLATSVTQAASS
                     VSQTNQPVHGQVQRPPAPLPRTPGVPSPLSSTIVSSVLPTHGNGGGEEAADGERLSTL
                     AVRRDLHELAAARLPMNPAPYAPTHVKLPAVLPTTSPPLRSGRPAHPLVAQQHRAACE
                     SQGGLTGSSGASTAAHHSAAGAITSTAIAPVTTPSSATMSRYGSFQAGYASIAAAGGA
                     VTPNATPLLSNNSLCGFANHCGAGSFGSGSAPAASLSTATSTAAANRLQPPSAARLSV
                     TGTGGGGGGAAAGVVSPLSLSGAAATARTVRRRVPPPLLFRLRSPVGPAPPSAAVSAN
                     DTSGEMTSPGSAAPPSSASRTATSAAAAAASAGACSSVLTTPPLNSRSMGMTINSGSA
                     SDLASTMADRPARGSGCNPPATSAPSGPFARANGSVAQNLNTFSSSTRSGGLVRISHD
                     RRTLVAGMFRVSRDGCLTVRNMLLLNPTRIDAGSATGGAAGPGGTCGSFMGSSTAGAG
                     GGGSRSRPLQLLHPQRSATSYSPVSSNGGLVGRMQLLGPGGGGNDLGGGGGVGGGAGG
                     LGPMTPNTTGSDWYSPHAYHGGGGGGSGNARNMHHSGGGGGGTNTTANASFTLFSTSM
                     DTPFSPITYSMDSQRLALPSPFGAHHDRAGAAAGPPPQLLGTLCDDTAASHFLSASGS
                     PRQQPQQHEGLLPGAHHVTETNASPTRSLGFGMMTGGAPAAAPLQQVATPNSTTTLGR
                     PSGGSGGNICHAQRRCQASNGWLPGALGATNTASPPPPFATAGGTAGMLGAGAFTDTD
                     TANSLLLPYVDIPTDRGGIASTTAGSCVGSPSGHTNPGGCRTTTTAATTMTAASPMMG
                     GSGTTQNTSFPPLPPNVVWLRDLDILSTTCGEGASATVFVAIHKPTGRRLAVKRVDLS
                     PLCLGCSSPFLRSGAVSSGRINQLQRIVIRELQVLHLTYRSPFMVKVYNAFFLAEVAA
                     LDIVMEFMHYGSLDHLADCLQQHARMVRGSQQERHRLLTGDDDHDDGDGDGGGRCGSA
                     HGGSPPVPPLLCDAPEAPQVAEGSLKDASAAGVGRSGSGEGVAAADAEWRPSMTSTSP
                     TLLDSQRTLAEWALPSAPRPCISRVLGTTGSSGVDSMVCDGGGVPCHPLTGGYKHIYD
                     SNDSLLLDSYSVKSNCGTDDSESDDGSGLVEEPHGVTERLVAVVGEQLLRGVRDMHSR
                     GYIHQDIKPGNVLVNEHGVVKLSDFGLSQRCDSNGVGIKNDMLTYMPPPSVAPTQSIT
                     PLQSPSLTALPLTGARGRRAPYAWRAQRGSIGAGISGQLGSVMVGTTPPEMGSSAEGL
                     VFSTTNSLLAQRDGMDVLEAESTSSEESPGEWDGTRRGRSGLNPSSSSSDDAGDCCGT
                     DKYMSPERQRGEPYGKPADIWAVGVTLAEFAVGEYPYDLKDVIDEFDRVSRMDKPVDV
                     LQFNKHRAVPLGTVFADFCRLATLPTGSQRPTAQELLEHPFFKQWHRPFNLKDYLAAR
                     VPVPSNRLKEDYLAKQRERPPEGQQPAGPSG"
     gene            complement(<103568..>104668)
                     /locus_tag="LMJF_07_0260"
                     /db_xref="GeneID:5649182"
     mRNA            complement(<103568..>104668)
                     /locus_tag="LMJF_07_0260"
                     /product="homoserine dehydrogenase-like protein"
                     /transcript_id="XM_001680878.1"
                     /db_xref="GeneID:5649182"
     CDS             complement(103568..104668)
                     /locus_tag="LMJF_07_0260"
                     /EC_number="1.1.1.3"
                     /codon_start=1
                     /product="homoserine dehydrogenase-like protein"
                     /protein_id="XP_001680930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649182"
                     /db_xref="GOA:Q4QIR8"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR8"
                     /translation="MTVVRAALLGFGTVGQGIYKIVQQRREQLKQKLGGAELVIVKIL
                     VRDLRKRSRVLPDGYASDAKLFTNNIEDVFRADVQVIFEATVGEEPAFTYLQRAIVEH
                     GCSVITANKVMFARYGATLQELAASCTPTSSFPATRVYVGFEATVAAGVPIIKTLQNM
                     CHVQQVRKIEGIVNGTSNYILTELREYPEKSFEEVLKKSQELGYAEADPTNDISGHDA
                     FMKLLVMVAIAFGHQPSRSTVPVTGIDTLTPEMLQDARAKGLRYRHVVSAAMEGAATS
                     SCALKSSAAEGEEAQPRTPPLHERLTCSVKPMLLGPEHPLYHMDGTTSAVSVWTDYLG
                     VVTISGPGAGMYCTASAMMEDYAVWMEAFRRP"
     gene            complement(<107093..>108286)
                     /locus_tag="LMJF_07_0270"
                     /db_xref="GeneID:5649183"
     mRNA            complement(<107093..>108286)
                     /locus_tag="LMJF_07_0270"
                     /product="acetylornithine deacetylase-like protein"
                     /transcript_id="XM_001680879.1"
                     /db_xref="GeneID:5649183"
     CDS             complement(107093..108286)
                     /locus_tag="LMJF_07_0270"
                     /EC_number="3.5.1.16"
                     /codon_start=1
                     /product="acetylornithine deacetylase-like protein"
                     /protein_id="XP_001680931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649183"
                     /db_xref="GOA:Q4QIR7"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010169"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR7"
                     /translation="MASLQHVRDMLAKLVSFETVSARTNLPLIEYVQGYLAGCGVKHV
                     TVMRSADGIHANLLATLPSAGGSVEGGLLLSGHTDVVPVDGQKWTSDPFVLTERDGNL
                     YGRGSCDMKAFIAVCLALVPEWVCAPPRKPVQIALTYDEETTFDGVRQLMRERGSDLK
                     KCEGCIIGEPTMLDLVIAHKGIFYSYITFKGKAAHSSLQTAGYNSIEPAMHVFQKLFE
                     MRDRFAREGPFEEGFNITHTTLCPTLTTGGNAINTIPAECSLGFEFRNVPSHAASVIK
                     KEIWDFVGAETERVKLACPEGGMEVVKCGEVEPFGGNKDASVVKALLAANPELPKVTK
                     VSFCTEAGEYQAAGINSVVCGPGNIEQAHKANEFVSLEQLDKGLLVVRRVVQLMCGGS
                     EASQL"
     gene            complement(<108775..>127557)
                     /locus_tag="LMJF_07_0280"
                     /db_xref="GeneID:5649184"
     mRNA            complement(<108775..>127557)
                     /locus_tag="LMJF_07_0280"
                     /product="putative ubiquitin-protein ligase-like"
                     /transcript_id="XM_001680880.1"
                     /db_xref="GeneID:5649184"
     CDS             complement(108775..127557)
                     /locus_tag="LMJF_07_0280"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin-protein ligase-like"
                     /protein_id="XP_001680932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649184"
                     /db_xref="GOA:Q4QIR6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR025527"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR6"
                     /translation="MDPQLLVHLFDTFGADGQSSQLPWGISASDSIALEAQGDGIRFE
                     SNGREWRVLQVGTAEDEMNLPPYRGDTQLRDAARVLPPVCCAPLVSRYTRLLRDPRWE
                     VRHVPRMMEAMLNDRVLFHLMDTSPLSPLSDSRVSAMTRWWGVMGKPVLRYENNTGRP
                     LMSLIDGYGSPPSAFSDAAEGRQGAGKEARQDQASRILDEHRSSAQEEQIGDTADSAA
                     AATATGTRMSLEEVRQGYRDIKTVLTLIAATSAPYRCSRPPNASVSGCTARLVFCKDP
                     STIYLGLLLNSALRGLPRKVLCSMSVFRLIAEGWGSSPGFADILRASWEEYSDIMRDI
                     RALLGLPDPTTETPSPPSLAASPSSFSCMSASSGASAAALSRQQPQYQRRGRRRQLPP
                     MHLPSQHSDSGEQGRHPRLQHLGQSTAGASSSGTSVGPSTGVSSSAAMVPHTSLRQTR
                     TTAGGRMQAVELGIPIQSTNGGGARGVAEEARQSTGNNTGDVNDFVTALLGNALHSLN
                     GLQLRRNTANGVGAARGIMGAAGAGSSSGEADAPLGTHPGINGNEHNSVPFKTEDANA
                     ICHESMLECAQTPELLLWWARCRLLAYQLLDNPCRVSVESTGALEYFREVWACTPLIR
                     EILEDDQEALLVASLSSPRLSGDERESEEMEAERASKQARLEALQERAQRLYAALVGA
                     VADLSKFWFSIRVAQSTVNAVASSAPETNTVWSIINATVPSRRRFQREEFATYAEHWQ
                     YALLVDDYVTQPMCFRVSTRGRTMVTQLLHILAEYPTFYPALVARTLAMLNRREMIVA
                     ELNERLVNAVARCLRFYLPPMPPVLAVPPVQAAPTSIPACNATVAGTAETHMAPRVSS
                     AAVADVTGASADRTAAATPVTVARAPPPDAGASQRSWSSPEDSSSHSSSFSSEHAEDG
                     ADGDVVSGSGGGGAAAQSTAAPSTSGGDGDASTRGGIDYEALVVVSVTSEPGDGGGDC
                     GRHVHNGKSSIDASSRRRMREEVAKMPVITVKAYDAILTCLDVLRMLVRNGHISVNPM
                     SLLFTVPTATTASAAASASPPASVDQQADGHTGTGGAVGSDAAGHSPVDASAANTSAG
                     PLYEASLPKSQCDLYTLLHQLVYQTRYGPLASAALRLFSACVHYNVRDMVPLFAERGL
                     LNTVLAIARRPRLFAEDVATAAAPLRFALDMVEENGVPNIARRELLQASSTSSAPSPL
                     LIAHPSPELLARYVPAEDAYLNAVAVRMVLPEFVEAMTVHKATHRVFSKHTEWITALT
                     QSLTVTPAMSAASLLDIEALFDESAEACSEHEADDIDRGEDAAIGEDEGGCQVPCDAP
                     LSPSESPASVAHHVDPVQQQQGNYHSPQQGRQHGLLRCRSSAAYARLLQDLKTTRRRP
                     LGAFPVPAAHSSTSSTDSVASHARHNEWRRLPQRIGGASHSADASAPIDVVLTRMVEL
                     HRLHLKREEVSYKTLQGAVKETQRVLTEVLQPSPLITSRFAPALRAELSLLSQRAHAF
                     AQAVRARATHPHPFSGRTADGDEVAVAGQSAVAPATSGSGAGPRTRADHLHLLVQAIE
                     VCRTLNNFFAFFSALDWDGHQRRYRLSRRSAEQQASQQELAMVLESTVRDFHVAVNQL
                     WSLMGSHAPLQLRDTDAAEASGSTTAAEDKERQAAQDERDATDRRGHTLLTCARLGNP
                     LQVYEQGNADGASSLLSYVQATIGSYLHARIFGDYLRSAPPSTRMETTLKSTVQCILH
                     FSSRDFIGAPEVVMARDSGTDGSGGGGGGEAMTDSEGAMSKTMRRRCLKAMKRVLEGL
                     GSEAQRHSSNDSMQQPPNGAGETAGEGRGDDVDVRNGAQHSAHEAASVERVYYHTSES
                     PCKDVISSVLRPLSVGDGVFLRQLLEAWRVSTSGSSGSGGGSNGPGRRDSEATPWRSV
                     FSEVIEFVVDALVVRASYTADDVTGLLRSLQAGTQHSSVSTGILSLYDRNAEAGTTIA
                     PAIPAALPAAMRGRSGSEEETGAEAGMEASDQILQSMLQDGRSLLNEPSTAWMTAEAW
                     VQATTSAVGAAAAAAGDEPSLGSSSAAEVPQQADAGPVARAEAAAAGGAASAEALPHS
                     AFSIVVPSVLANPHARGSGSHGGISRGADSEDSVDSSTTLSSSPPTLTPPTALATDAV
                     GDTAAVEGLAGSADGVGSGGSGAGGGGAATAASAAAAAPLTTPLFAPINAAKALQQWL
                     FLSLFTGRRASDQPTRNFFYLSPYRRDGHARPALPLNVTGLLRTIRNDLQAAFEDAVR
                     GASADTANLSPTPGDGAEDEPTRQLHSSRTRAKQRNSHDSDEEEASIVADLQERLHMF
                     RPQPRHENRAGAAASNSGGGGRHAALSSARVHAACEWFDLDPRELAAVNLPSCVNVEA
                     CLSEINFVAARRVLWELAVLGAVCTGGSGAAPELESTPLHDMLSRAAQFMILLSRLVF
                     AGDAESAKHASAAAGGGSLTSATTPAAVSLSPAAAALKDQLQRCLVYMAVLLMNFLEG
                     CDARTRGRHCTHVESLLYCVLDVWPKLPGFPMVPHVYVAAMEAVAQLKPETLSRMSFQ
                     ALAREWQDGAAKPASAATTAAATVNMDTSPRVPSPQPREQEGTAAGDDDDEEEGGGSD
                     VQRSSAEEARTTIAGDGSRRFNQSPWARAGLLNNGRVGAPSPGSGPMQDRFGQYVTRL
                     QQSRRSQLGAPLSVAHEWGRALPWVCDVAAGRVFPLDTLSETGHRLLRKRVCRALWGM
                     WTGTNAAEQQYVVAYMLHRVLSNVRENVVLLEYVGVLLTQLRGVVLVEALALTPLPRA
                     IVKVVRQAIEEVTAEQHEEEARQQALSGARAGAAATAQREFRQRRRRYYARTQMTLHG
                     QLVSFLSVFQNVRSDAPLVADPLARTAATAPHVQAMGTQCSYFDATRNTFCWSGHQCH
                     RQHIVPVNGQRGRDGEEHRFGLNTFGPGTQHALDEVLSVLEHHGFPCPLTMPATATAT
                     AARGATSAAGAASEEKEAEVAEAEGHAAMRSHASSAASDPTQSTGQPQAHQPSQRVVR
                     LPMSGGTADPNTVPSRPQNAYEVERRTWQGDRARRERLSTRGYAPTAAHGNRGDEGSN
                     ANRDGASAEVGERALPSQASLATADAMGPESYQRLLRGEGLPWLPLSARPAQSSSSSL
                     QQLRGGLSGPRDLDYGGDDMDEEAQGMFTHLTGAFGGSRRERSPLRHRLLNPLTSADF
                     RADPLRRTIIPHCALFGRDVCEEVVRMAFDFMAARLRDEAADKADAEAGKREQQQQHQ
                     QQGSTGCISLSALSGNIRSLDGVLSTSPQFPSSPVASPVSTAALPFSGVLPASAATPV
                     TTAKVVAARLTLPRVEVVECAVDEVMVHFLLTCFSTYYTTCMHLVRTHRPAGLPAPPA
                     ATYTAAARSMAPASSRDASADATSGCADSLSVLCAYITHIDPPNREKAVLLSGLLLTD
                     MLRLEEDVWQHMVTVLRTTVQVHRKGRRLTDKAYAALSAHHLRLTRASANTPVEPSSP
                     SREEGRATAATARKSFRHRKPRSQAHVCVSSTNSTPHQAPSSQLAESAEQEELRADGG
                     AAGAANNGDAEAAIAVHHYLIPISIFLANLEPYIIRHPIAFYHAFRRYCEVRWVRAAT
                     GEMPAAWLGVWVRPRPPAAGATAAGSRGHSPRAARRPRCGAASTPSRDFVERVQCFVQ
                     HLARNVDASQGRATHGASMLAVVVQLPGVCEALLSPNFEVPVPAMYAELLTSTAGARG
                     TPVSSAEALAATAVLSGEGEGGPATSVSRRLPVIAVPPFLALALYFCSALGEAGRSSG
                     GGGSGGVGGHITGSVDFATAIFAHDPITVSEVVVRTLSCLVAAVEATAVGTTPVAEAS
                     PQAVAGADNDNAVGSDRDGNEEVVAASTRDGLAEAAAAAAAAAASAVPSPAEEREPAV
                     QQQQVEGKDRARCATKTLTRCLHDVLCFLERGSPQPATAALPARQRATQQRMGVSSAV
                     QESFLRFFDHLGRLGLLDLLFRVCLLQSCEHGRDATSLLQLLAHQLLALGEFKLAEML
                     SPSQKRYAAQLQDMQQQQQHRLPRGLSRTSLWLSQGGVSASLRRPYPGLHGPELANTM
                     DWPPSQLRGAAEPPGLRHAFDHLEALLARDTIRSGGDGAVQVADNVLEITSSFTGEHG
                     MGAEVPDANGLHAFLTFEEEQEEGDGNESGDGNESGDDDGDGDDGADSGITESGSGFG
                     ERAGHDGAAARPAAPNGVESTDTWPPMHPVRRAGGMRSVQNNSGGNEEEPSVSAQGSV
                     QQRRSPPQVLSSPPAMVGAAVPRMPEGPQQASLVPARDDVVRGGLSDEEEHRHRRHAV
                     ALATYEEAVIRSLRAEEAVGRHRRRRHDDEDDAEEAVEEDEEGDDEDYLSPDEEGDEE
                     DDNALFPDDMVDDGADMDGDGDVENLYRSQPEMSGFFVPSPLSSPRAAAGGGRHRRED
                     DDDDDDSHAGEEHAGSDGDNGEDDDSTPDDDEDEEEETYEEDDDNDDDDDASLYYDGA
                     GHLLSGRDHLEDALLDMHSPEMAAGGGDSSALRHGLAQQTAGSLTYLNDDPVGRPVAA
                     ATAMERAQSFAACTYRAILLAVRPLAAHNVVETETPPLPVLHAFEEEAPAASRHSGDG
                     NDGSADLAYRLLAEVHQRSVGTTNDSGSPSPQQNSATLRVTNTVTPTSSLQQPRRRPL
                     SSTTLPSPFSAATGAENTPSDQVMRRGRDSRSPLDATAPSTTTQGAAAAASASLDATS
                     PTTAGTSQRPAAEAGNTAGAAEVPTEPTTTSEADTSIDVLTARILALFAAGNANAHTA
                     SSAEPLPPQASAERASATSEQPTNTAAATAATPAPAPVAAPEPWEGTLNPQFLIEMPE
                     DVRSEILFDSMNLLRGADEREVRGQRTRLYPGFLNSIPEDAQRHALEVEARWVRVTGT
                     DNNASELYQTLLLVDAETRRDLLLQCDLELLRSYPEVLREATELRAEVERAREEAEQA
                     AQREQERRQHQRAQAEQLQQQQQQASQRQSRLWMLGAWDTTRDARGSGATAAATAATV
                     ASGIRTSLPALRDMETVEGVMRVMFGSPTPLYEVVNHELFLARRLYRCEAVLQALEPP
                     TSSSISHSMSLYPDRAAEVSATGLMLSPLRDDDAMREVMMFNHRHGVHRGANAMTRRA
                     PPRGAPMAAASGTAGAGHYHLPQFPSLQLPPSADLVASDSSVSPLSPPPHTLPSDGGG
                     VFAAERSASGSHAAAAPSTSLAALSESMVPVQETLYHPLALPLPDVPEEIVARCIELL
                     RLRATAPLALPCNLLTGISCLDQELQRFMQVLISDTSTAVRVACQLLDLMAATPTTTA
                     EDALPDSAAGFGRSATATTNARAAARASPSTPATSSSHFSRPLSTSELAANRQFIKDA
                     TTLFVSLVKQNQAMVSAFFLLPDNTVDAATLKPLDAPLDAAEQRAVQHGLWNRLWRVA
                     RQHVHVPSFALALDKLLQQLLRCQRSMSTASEDNELASGADPNASELLTETLIAHPRH
                     PHRLRWTNIRLLSNYEDGGYVCNVCGVNPGFDYCFHCSSCQFDLCANCSRERLTLAEM
                     QQRMRRAAALMLQNVPETVTSMMRLLRHPLCRSDVAMNVVHLMSFGLQECGARESVSL
                     FSGDAAGAGSGGVGSATAGPPFLHSASGSLHSGTGSARVSPIQLLEQELVELADARVR
                     ALKAARDEFRQEVYVILHPRPSSNGHNAGVGLAASAPTRSQSGGGTNVSGLSGRHTWQ
                     QLSIPEGYVFDTDTVMALLVKLDIKNSEGDAIQLLFEPYVATMRSEPRAFTMLWRASQ
                     AYLLDVSTLLEHVAPKEVLPLPSCVSSILQTFCKYHLSESRLLGASSSARTLTDSRSS
                     LAGETEHFLHASTKPSSVSDRAVRELAERPDAAQWMTAAGTRLSEEGLKSSEELQHRR
                     LPRVVRMVLEENRTTLNTLLHWDGNLLKDSFAFLKYEPNLIDFNFKLTDFRRRLGSRR
                     GPNILLRVNRQTCLLDSFKELQKVKSFGGQLHIRFHGEEGADAGGLTREWLQLLSEAI
                     VDERYALFIHSQDSISFQPNPFSSVNPNHLEYFQFAGVVTGLAIAHNVPIDIHFTRAF
                     YRHIIGHRPVFADLQSFDPELYTNLNWIMENDVTDLGLTFAVNYDRFGSVEEAELEPN
                     GQNTAVTNANKQQYVRLLCEFYMTKRTEDQLLRFLKGFYSVIPRREIQCFTEKELELV
                     ISGMPNIDVEDLRTHTVYEGYSSTSPQVRWFWEAVGSMSKEDLANLLQFTTGSSKVPH
                     GGFGHLEGSNGRSLPFTISRWAVTKEDLLPQAHTCFNKIDLPVYPSAAVLKEKLMLAI
                     TYGSMGFTMV"
     gene            complement(<130607..>131371)
                     /locus_tag="LMJF_07_0290"
                     /db_xref="GeneID:5649185"
     mRNA            complement(<130607..>131371)
                     /locus_tag="LMJF_07_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680881.1"
                     /db_xref="GeneID:5649185"
     CDS             complement(130607..131371)
                     /locus_tag="LMJF_07_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649185"
                     /db_xref="InterPro:IPR005366"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR5"
                     /translation="MSALSTSVVASPEAYTKALLHCYKYPAQPVMGMLVGKRLSDDAG
                     AAAQSSGSPNSPHTSCGAASGTSSSTYYVSDAVPLFHTLPMTAPHPMLEVAYAHVQYA
                     AKTTGQSLLGVYIANERLTDNGVSPLTKKMLDAVQARLPTSTRLLVWFVSNECLTSPP
                     TGLAITSLTADRCSCNKAISLPSHASADERMTFGRWNSDTLAPEATVSAESVMESVSN
                     ALDAFAHYRIADLEDHLEDPSITYLEQPLMALMTRK"
     gene            complement(<133085..>135640)
                     /locus_tag="LMJF_07_0300"
                     /db_xref="GeneID:5649186"
     mRNA            complement(<133085..>135640)
                     /locus_tag="LMJF_07_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680882.1"
                     /db_xref="GeneID:5649186"
     CDS             complement(133085..135640)
                     /locus_tag="LMJF_07_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649186"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR4"
                     /translation="MEYEQVEYGRRVVTEAIMSQDINDYYDILSPQVLLVTHFPYPSA
                     SADSNMQAVHRWVQMSERQHIAAVDAASAAAAAAAAAASSAAAGGRWSVNINARNQLS
                     AAAVAPAPTAGACSARSQKRRARELLQRQEQWRITQQQRYDSFRKLRELHHSCVADEG
                     DGDNDVGGTGSTEGAARDGNDGAVAISEQCAADGRGAPAAPQPQQQQTRTDKQRRGEP
                     FAKATSARDHASNGGGSAAAAAAARAADGVHWFQQQQVRAQLQPPEQRTRPSTFLSSD
                     ASEVSAAAAAAAAAATAAQKRPASRGNPIAYEDAVTITEGKLLVSYRFFQLLHWIVSS
                     DGKTAPPARIAPIEVDIQLRKDILQEAEVLAPPPAPTTVQEAYSQLGQQFTERNQPLS
                     CVRIVWGTDHLLFDDKIFLDDGLIVTIHRRMLTVAEVLTRVAPAVSSPPKTLRELPPA
                     PLSSPQTRLSEKGSAASLPAGKGGLARKREQQLSAARSEQVYHAVEVFYGVTATRVDA
                     CSNAWALLDFSFVKATEPSMLLRLTPVSGHVHVNRLPRAAADPRLSQGIFLNQENDPT
                     KPQQAGSSRTLIKARNKYGEEEAYEFQTQRHGCFYEDGSGRGAGGGDEGASQRNGNRA
                     LGGDGGAGAARYDASCVRVSGCHMQAKMDQLVPVLRRLVVNCLLTLHTLDLSQNNISS
                     LPDLSLLPLQSLRLHGNAIADWRVVEARIAPLPYLGVLTLHGNPIAEDTEIEAVAGNS
                     SKTAAQEAHCAGTVGKAAKGGRADGDSNYWKRLLALLLRSPDRVAPLRQVDFVTLTGQ
                     DYNMAGAYEMFVRGQTGLLAKARSMMGSRTQTKPAGATTKPSSKGAHVVAGSG"
     gene            complement(<136949..>139378)
                     /locus_tag="LMJF_07_0310"
                     /db_xref="GeneID:5649187"
     mRNA            complement(<136949..>139378)
                     /locus_tag="LMJF_07_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680883.1"
                     /db_xref="GeneID:5649187"
     CDS             complement(136949..139378)
                     /locus_tag="LMJF_07_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649187"
                     /db_xref="GOA:Q4QIR3"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR3"
                     /translation="MYPERRPYATTMPHSGYRAKPFVPQPPKDALMMLRSHVGYDDLQ
                     NGGSDQPVSFLRSAAGRTYLADGSSALSSAQLTAAQKLLPLTDRSSQAALDAARLEPP
                     IEHASVMYHGCQQAVLNAELREKVEAHYKHWSSRVEELQALLSDLPTESALHSTRAVE
                     NLHSYLGAYRCTEDMLVTPSEVVEQHALRTPVPEIDVMFQMPAIPMDTMRRALDDLLR
                     SPYLLAPLDTHLAHLSLLDKLGQLSWSGEGEVTAPLSKKPRGKRAVARKDCTVDESNE
                     TGVVLQAEEAAAEEDIYPSRAAVAMHERLHYNPGDYAQRELKKSEEALRELQDRMQTA
                     KRQKEEAIDAADPLTALRNLHAQVDFSNDLLLLYRARMALVSLHSDDTRDFRRDVVDL
                     IDDSHQSVQAVHRYAREALPSVQHDVRAMTEVIRQTQQRLIAMQATEAAADAGMRAHL
                     CDMDKAARVLWEEVGALLEKIAENARERGRYAQKCMSLREQRAKEAAAVNAQLQAQSA
                     HCERLCRCEEVLTRWNQAGDVFGKYMDACVPKLLKHLAAVEESDADLAQREAEGYVGC
                     YEQFVYAAEEARAKRCTQADRMRLLQRSTLLNQERASDTMDPDAPAHAQRLDDVSREL
                     DEVQLYLKYLSDMEADRKAEVDPVLRGVLARQTQAQLVTTGEEGEAEKPLPTPGLLED
                     APAASTADAKPSLASPSTAAETTKSTSAVPATAAGDGAVVAATTTATTTAPPSLSVTV
                     AHPFVTARLIGLAHESDYISQQGQLLGQEMQAVEAKWTGLRHSRKELQAMEEKYKNGD
                     DIRALLGVEKL"
     gene            complement(<140887..>143979)
                     /locus_tag="LMJF_07_0320"
                     /db_xref="GeneID:5649188"
     mRNA            complement(<140887..>143979)
                     /locus_tag="LMJF_07_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680884.1"
                     /db_xref="GeneID:5649188"
     CDS             complement(140887..143979)
                     /locus_tag="LMJF_07_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649188"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR2"
                     /translation="MRREWKFALQFVHQAGQLLIQCSPQWEYEFIDLDRTAVGLAQRE
                     RLPTQAESSPMFAVLSYTDRAAVVQSPPQPVTAAGGSQGAGVSLRRPSTSRGSLSASP
                     ATANIGYQHAEEHAFTSSREVGKPAETAPAVADDRVDGDAWWVEKSKAVELFYCLPAP
                     GMDLKGFCKHCVQFVLRDPHVASIDGDTRLARLHIGDKLRCTYQLGGRHRSFQLRYTL
                     HDRSELQESHVYAIGTIVGQRGYLLRARCTDAEELEGYVRKVLLPVYTSPGRVQFGVD
                     VTYHDVSPTTPLSEQQEAFGQLQYVDHKAAIVFVTPLYPMRVLPDYSPAKTVGVGSIT
                     CLTLKLSVHERLLDDIAAAEITGVAKYKVSPIIACVEVEEVSRMGYPKVMSTEQYSEL
                     KAARVAEVFPDAKMVGLPSNLFMGSRTGRLRTMTFTYEPLGCVVKALIASTLVGNLGV
                     TALYIAKFSGGVFDAHLYVFQQLVRGMGYLPQNNAEKSARVSRYRARNIRLMEEDVIH
                     AYSDDKQLGDAVPQPVQGATPGSPSSLSTAAATPHPTMLAARDPRIVAATRERHLHFL
                     SLGNDGRVEGGVEAVVSPEEGGIAPTRRSVSAANNEGGLHAHGGCGGGSEAEGASAFG
                     TEAAQTSLISASLLTASLASDALVTASLPASALVPTDEAFSAPGGGILDALHADFSSS
                     ADSSSRISVTNISHLRGSGSASLAGDHSDADDAMSGFMEDGHDAFACSHEEASASVGP
                     SAASLAGSHPRASVTENGDGIEACTSIYRQRGSGSILAVSCISSAAADAGAGEVLKTQ
                     VVCSGSALPTSELPDVSGDGDAVGRSPDVAARLGTTTCPSVVDNADTAAAEQLKQRQL
                     YEQLVGKGDPVVQQALREAEGGTLYGPSLRDVYARCCEAQQCRPNSYLMRKLPVQPEF
                     TYSVEEIDLSANYVGHNGFVAVLHLLEHLPRLRVVYFNNMSLDNMDAESLCYALATNH
                     TVREVHLEHNPGISLPSMRHFTALLRVNRRIEVLMLAGTRLSPTLIAKLQEEACQPRD
                     "
     gene            complement(<145179..>147686)
                     /locus_tag="LMJF_07_0330"
                     /db_xref="GeneID:5649189"
     mRNA            complement(<145179..>147686)
                     /locus_tag="LMJF_07_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680885.1"
                     /db_xref="GeneID:5649189"
     CDS             complement(145179..147686)
                     /locus_tag="LMJF_07_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649189"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR1"
                     /translation="MSVFSVVASYAVFFYFGELLMRLVVVQPLSDASAVRWCFASTFA
                     LSVSLFSAVLVDMAEASLFPSAAASSAAAAEGGAGGIAGAGGKWASWLSMTSLLIHPL
                     MRVSARSFTWLLLLLLSTVLVACPAVFVTSLLRHVVVRGSGRRTAGTRFCSSRRLSRS
                     ASGVWGLSARHLCSSRFRSRSRSESSSIFRHDCEDTTRSRGLCGRLRWVLVCLLVVVA
                     LVCADVWAARVMGLDAHAVRQTSIAIVRRLYTQLQTRTTILNVPREIEHKSTSGAGGD
                     TATRSSVQEAGQVRSSAEGVLEAAADRVAEPLVDAKVEVPGGGGDAAGQAPLPQQPRR
                     PFPLGEAVHAMPSAAADLHALVCAVTSRVATVGVAMIGLLSGYAAVTSPCLFLAPYTY
                     WRGREEELRKAQQNFNKKLCYVLNSYGAAQRQIAALQYSVLHEEWSSPAFAAGSPSPH
                     RGYSLSPPKQGPALYSAGAGYDPVNPYHAPYPGFDGSGGVSGYPAQGRLPGGSDLRQS
                     TGLGNQPVPPHAPQHQVQSQSPTGAAGRLQQKLSNTAYAGAGGASAGGRLYPKSPTSA
                     VSNPTLSRQRAIARISTLRSESAASRFLSLSMYLQLHEVEGMLREAQRGATWVGRWYA
                     GLGVAMTLYSVVKIGLTVASLWLFKASTQDPVTQAVTLLENTFILRRRNAEGVVSFSV
                     TAVEISTHVVLALALVVNGWMLLNSIRGVLLALFHVTMSFSGSAICRPETISVGLSMM
                     IGVYFIGQLVMLRSSLPGTVASTPGGAPPPDGTATSNVLLAVLGSLPYYYYQRLSDWC
                     FLVGCGGAVVVRSVVLRDTLSAVVYTASSGEEQHVVG"
     gene            complement(<148839..>151199)
                     /locus_tag="LMJF_07_0335"
                     /db_xref="GeneID:5649190"
     mRNA            complement(<148839..>151199)
                     /locus_tag="LMJF_07_0335"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680886.1"
                     /db_xref="GeneID:5649190"
     CDS             complement(148839..151199)
                     /locus_tag="LMJF_07_0335"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0335"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0335"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649190"
                     /db_xref="GOA:Q4QIR0"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q4QIR0"
                     /translation="MPSGIPGVDLALLTQVTRHLSERRLHVYHPGSRRSAAALVLRFG
                     DDTQRTLTEAWSTFRAATARHGYADPDVTEAEALGAASSPYGSGRSSSRFFSADASAT
                     TAAAAAAASIARDSAEGGWTRPLEFVEYLAHHRRHHRCADFVDAGAASSLQLLFLKQT
                     NREVRRWSGQIVFPGGRRDPDDHDDFDTVCRTTYEEIGFPLQHHREFLCLGRLPDYQL
                     HSRIVGSRGFVQARFVFLHVGDITPTVQLASHTVESVRWVPLRALTAAHVERGRVVHP
                     LQSFVSPQDANTRLMVGELFPNTYLSFPSLLLPGTLAPSSSSATAGGTEAGGKGCSED
                     GGRPRTREDTSSASPGSPSWRVWGLTLRTANELLSLDSCEAFDWPFVESNSRLLQYGV
                     FFPMYGYYELLYQFYWWRAWMTATMRLRTCEGCAAGRGETNAGDEQHPSSTLGSSRSG
                     SRSSAPVSHLSRERQRWRRVLYGSSMERRYAVLPASAGALLRAAPATPIAEHVVGFAA
                     ALGFVVCALYTVAAVIASVGAAVGAALGVKADLHGEARRRAYYDANTPSSVVRHRRPA
                     AGACAELWSLENATAHGDTVISAADAVAPSRETSDSCSCWPRQLRGSRVPCWRATADE
                     AALSAELRSTAEVLHGESLIHIDSAVPQDTRRRLSTSTEMPAVKQHLTGKASAAMRPT
                     PSDAGAVLEPLTVRPSRVTTTTDHLTTSSAISTISVDTIRECGSAEDAYEAGKELGGV
                     GPVFTGVAVPAEHPVAAAMPADAAELRHEEELKVIMCRYRPQSTEN"
     gene            complement(<152464..>158697)
                     /locus_tag="LMJF_07_0340"
                     /db_xref="GeneID:5649191"
     mRNA            complement(join(<152464..152804,157260..>158697))
                     /locus_tag="LMJF_07_0340"
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /transcript_id="XM_001680887.2"
                     /db_xref="GeneID:5649191"
     CDS             complement(join(152464..152804,157260..158697))
                     /locus_tag="LMJF_07_0340"
                     /codon_start=1
                     /product="putative ATP-dependent DEAD/H RNA helicase"
                     /protein_id="XP_001680939.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649191"
                     /db_xref="GOA:Q4QIQ9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ9"
                     /translation="MSDYGDAQHNGGDSGARGEGGYGGGRDGGYDGGRNGGYGGGRDG
                     GYGGGYGGGRGGDRYRSGGGYGGGRGYGGGYGGGRGGDRYHDRHGGLGSNLHRIDWDA
                     VQKVATQWNFYKPQKPRSEEEIATWLRENSITIYGDRVPQPMLEFSDLVAPDAIHQAF
                     MDAGFQKPTPIQSVSWPVLLNSRDIVGVAKTGSGKTMAFMIPAALHIMAQPPLQPGDG
                     PIALVLAPTRELAVQIETETRKALTRVPSIMTTCVYGGTPKGPQQRALRAGVHVCIAT
                     PGRLIDLLETNCTNLLRVTYLTLDEADRMLDMGFEDQIRKICSQIRTDRQTLMFSATW
                     PREIRNLAASFQKDFVRVHIGSEELVANADVHQHVFVVEGYHKEEKMEEILRQVGPQR
                     VLVFVKTKKSCDILQDRLGRALRQTVLAIHGDKLQSSRDYVLDRFRKDERAILVATDV
                     AARGLDIKDLDVVVNYDMPLNIEDYVHRIGRTGRAGKTGDAYSFVSSADNSKTIRDLI
                     DLLLRAKQEVSPELYAVCQYARSDGGRGGRGYGGGGYRGGRGYGGGGYRGGRGYGGGG
                     YRGGRGYGGPGGVPGGPPRSESFTPY"
     gene            complement(<159614..>161584)
                     /locus_tag="LMJF_07_0350"
                     /db_xref="GeneID:5649192"
     mRNA            complement(<159614..>161584)
                     /locus_tag="LMJF_07_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680888.1"
                     /db_xref="GeneID:5649192"
     CDS             complement(159614..161584)
                     /locus_tag="LMJF_07_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649192"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ8"
                     /translation="MSMQLFSFGHPCEHQLHRACIGGLNCPLNGYPDTWCCSFIKGKI
                     NFKRDRPCEGPRCHWDYVHPSQSQFDEVTQVLEQSRPIAAKLDEASDTDLLSFNISNP
                     HIIDTVQCALHMMRHPPSVCARRVGQLLAYAALLAGDQDVFVQLLKTMKKPVDGYILG
                     AYAFLRQGKAGHVGSAGKGGSGNGSGVKKQNKKKDGKEDITATLANIMVELMNAALSL
                     GGQLVDREDQHVLQAMLIQALSTYPKSDKRHQEMLEKAVAKFGHRRLEDEEEAAAVKR
                     EAAKKETATTASMATSVAAPTAAATALKIRQEPTEAPTPNAVTATASAGSAVSAVAAI
                     NESVDPATGEEPTTVTASHVPAAATATAETAAAPAAQAAAGVARIASRSSFAAAAPGA
                     AAADGSMRAAVPTVLPALVGDAVAIATGTGSAAAVQLLGIATSKATVSSIPSTPSRVA
                     PSTPGATPGPITFSTAIQVQQHNVMPVPINALAGQGSAMGALGLQATTAAATPAASTP
                     APARTAIVGISKLHPYLAGRAANMRDEVPGLSPIYDPKSHSSGLFICGGQFTVEPLVW
                     NYAPLGDAAANRRLDSPTREYMRIKEENRQQRREAREAQAARLASIAAGNLASTSERF
                     PNTFSINLADSEDSCAWNDPDWQGSSSDFSFD"
     gene            complement(<162822..>163379)
                     /locus_tag="LMJF_07_0360"
                     /db_xref="GeneID:5649193"
     mRNA            complement(<162822..>163379)
                     /locus_tag="LMJF_07_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680889.1"
                     /db_xref="GeneID:5649193"
     CDS             complement(162822..163379)
                     /locus_tag="LMJF_07_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649193"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ7"
                     /translation="MRTRLCVRVCVCVCVALGTCSPVPDNYVAHLLHPRICPSHRSHA
                     PRVSLHLPAKPLSANPSFHSHLFHCFRSPFEFILMLRRCAPLLIGVEGDTFVSAIKDK
                     QYLAHRLAILGKEDPNFKAQCMSDDDIKRFTTSLGSAESLFNKQAGAIPTNVVDEETG
                     RVIGSTQPDPTRYGDWEVNGRCYDF"
     gene            complement(<168105..>170876)
                     /locus_tag="LMJF_07_0370"
                     /db_xref="GeneID:5649194"
     mRNA            complement(<168105..>170876)
                     /locus_tag="LMJF_07_0370"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680890.1"
                     /db_xref="GeneID:5649194"
     CDS             complement(168105..170876)
                     /locus_tag="LMJF_07_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649194"
                     /db_xref="GOA:Q4QIQ6"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ6"
                     /translation="MRDSCRARTPSPSHLVPRDCEGASSNTCGSGGGDPTVRPNSTTA
                     RPRQRPRHHQQGPRRGCHFTDTPESSGKSSSSSRGSVGGCVVSTWMNAPPNVVGGVER
                     MANNSHQSSPSSCAAAAVNRPPGTSTSPTTQHKQREAAARPTSRAAPTLLAAAVAFGP
                     SACMVASGVAVSGTQRSDHNPTDTAARVAQMPVPGASSAAATPQHDCPLRDSSGYPRG
                     SSPTSLRLHATASTAAGTATCGNLADAQRRRRLKPPPIMSDIASASGRRSCSCPSTRS
                     ATAIEATIASSPLATYTVVAASPRAAAAVTHPARTLRSAGSLSSPSNMLPQGPVSPPN
                     PDFKPLGLWGTSPASAAASTSATTLELEASRATASGADVGSLLTHEMDGGVVIVDPHQ
                     APDDLVCGVCMSVCRQPTAAACGHLFCRRCLQSWMQENRAATCPLDRTPIRVELLHTD
                     ARAQRQINALQCRCPASLSRASQWALRQLGSASHVLGDRTGEDEADKDDARGDGRAQL
                     EHPRCTWAGCVSDAAAHLRQCPYIIIECPFAKHGCSAEMPRADMAGHVKNGVADHLLL
                     VSQALDASTEQCRVLQGEVEVLRQRCPMRYPVALPDVPTGGPAGISEPAVSMYSLSLH
                     GADVPTAALAPALVIAGGGSSRGATPIAITAFPEEVSPESGSPTRVVGPFGRGASAAV
                     DYPFPVFSQSQPPYPHPHHGSSTIATQANVRRRAATDDMLLVAAHRVPSGHDATMPMP
                     ADTTALRTSSPLHFGAPPASVSVANTAAAAPTFALPAGAAALIPAQAASALPRAAPVV
                     GSGHCVDRFVWVITDMASRQAPCYSRSFTSHGLPWYVGMDTTASWEQCGVYLFTEGHE
                     HRVDFRVILYHEDPARDVVHVVRDWQEDYIGKGWGPLRFINRFTLEQDGFLVSGCLRV
                     GIEVVSGPY"
     gene            complement(<172448..>183226)
                     /locus_tag="LMJF_07_0380"
                     /db_xref="GeneID:5649195"
     mRNA            complement(<172448..>183226)
                     /locus_tag="LMJF_07_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680891.1"
                     /db_xref="GeneID:5649195"
     CDS             complement(172448..183226)
                     /locus_tag="LMJF_07_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649195"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ5"
                     /translation="MSSSPSSSPLHEPPRVLFPQECTHDTHCMSHTGNLYTALITGGN
                     RLVLLKNGVVLAQSCPLFDEVPTAAAAETAVSTAPPTTEAAATTASRGATACTRGESA
                     RALPASESHVCAVSVYHFTDDVLRVAVATTTDVFLFELDDAGQLWRDTRASSVWRTAE
                     VTNAVHGSGIPPPSSAAASPGKAGSSASRCTSTQGRSNLFQASNACSLSAAARGSDPI
                     TSGEQLSQRQCGFTGRLRWRRVTFRLGATLLATHPGPTEDGNTSSSSTTPYRGAEPTT
                     AGVRLRGASAAAAAVPVRISTPAHPSVVRAVDFVSADTLCIVLDTEAVLIVLGNSHGA
                     PALPSVEGSAAAAVQLPDRVVWRSMGAYRSLAVCRVNHHVALALGHATMAVFPSCVFP
                     ADDQAPMSSPASPMLVDERCFNRVASTAAPSLFTTNPPSGGAHVTETVESRNFAVAPT
                     QAFSPTSHPKLLGDFAGMTGQPTTTSGASASPAAGAYTTLAERALTTSVGIYHITDMQ
                     WHCVSSHTLLCVTCTHPQEETTYMMLYTVQSLSSVPRYTNVMREHADGGWGPCRGGYD
                     GEELDIVDASLGLSGRSVKNIVQLVPAGVIALAYTPSLRMAGQHAYPCANGSTAFPVG
                     NAASPASTADTPLHHPSLQPETPDVAALSVSTVAGTTWGGAPPPPIAEMHTSLVPNFS
                     HSAEANSMSSRMEFVHVEGDGTVRTSSYAFGRQKHASFAKQRAVGLACRELLQPLLRL
                     YSSLVKVTVLPTWRTRPIELGHDTSKQPCAVELMLGAARRYRMILRFTSGVVLAVMVD
                     LSAAVYRVECFLALGCAPLLSLRTVVPLAEAEKAQRQPPPSSVWNSAGSSTILIAGLL
                     GFPKPALPIPSETPLSLPKALASFLEGREEGAKDLEAAQRAGGSISADSAAVTRVASA
                     TSFHNAAHDASDSVAAAMPPRTVWAVALLQVEPSGMQARVLTAAPLTEVHIPGVSLVG
                     AQDGGGGGSDVQRARQQPRSAQMAASARSMAARDVPSMPLTAASTAAAAGCAAQVTED
                     DVVSFMTLKCPEKLRFMPALLKAAQQDAGRLLAQLIAKYGTVEESGEAVGVAQASEKE
                     ARMDDGAVEAVPVTSRPHPVVPSLSVLASGCIGAGGEVLLLVRANALCGGNSEGGEGG
                     GAAALIRLRPPCLEALAPVHHLVAAGSCYIPFEPVVAEYVPVLAEVQQRWWSEPLRPA
                     QLSSTCGATSPRHLEGSAQDAREALCACQRVSAAAEEAAVVQCQVVPGSPGTAYVRVR
                     SPLSPDTGEADAPTALQRLSLPSTVDPKTITRVTGTLLVNNDVVIGVLCRTAEDSSAA
                     SSVLYLYGCPAVQSLAARGAAGAAATAKPSDNRGVAVTCLTSGSSAFTLEATLPGVDA
                     FYLSASGEAVLLRRWPVQVGMPPPSAESAAVHGSRFERWLRCFPKESDSGYSYVQDCT
                     WCPPCGTTGGLLGIGGRGSAVAPETVTALMTLDAAGAWEASAAGLSVADAARMGSCRT
                     STRHVLYATTSNSFIHVRQLPLRSSGATASASGSSSASVVGEAALPQYHPDSVMQLVG
                     MARWNALAKVLTCVAEAVRAVVAPVGADGAASTVDESWSVMLFNQPPEELARRLCTSA
                     VARNFHDSPQMAQDEEVLRRVTPPQLSVAALREEEMQANATAPTPSSSVPCTTAAVRL
                     YDFSATCGALVNELTQLLPQVTLSGLDSQEHLKLLCILQALRDTLPLSRSVDEAAARH
                     LFYSRYMGLGRRLRLTNVDAPAAAATDSCAPINSVLHFEVDRTATGALTTASYLWAAM
                     SDSQLTLLSLLFDKARTVYVNGDTGGAAGGLGASGGGASAQDLTWEQVRQSGVAFWLR
                     SAADLRAIADRVARHQYQSTKELTDCALMYCTARKAGTLAALAKAQNNQRLHAFFSRD
                     FANNVHHRAAASANAYAAISKNMPQYGAAFFLLAGDVRSAVQVLLQRCRNPSLALFVL
                     RAAGDGLEEQPSAAETALEWYIAQRTAEAEVCGALDIWELTCLSWLDVNPPRVSPEVA
                     VQRRIRALQRLAAHPTAHPEALCALRYARDCVAALAYRGDQFLSPAREVVFLLRLGRY
                     CLAHRLGLNGYLHYHDAEAVLRGLRAEAAAAGCSGTLQRTGNGGGTSRRAPPQTPKMA
                     VDFNAGTLLFRGFDGSDDDDEGGSDDGGAFAHAQQGSSSSAVCVSAADASSPLFTLSD
                     RAAAAVEAEVQYVYARTGAIVRPDSDTASSAGVTAHAGECEDILRCMLLSFTTASSFT
                     MTPNVAAADGGGGAAETVLMPSLATLSFSSESSSVGANPHEPFQQLLTSLLRLLSAGE
                     VSVQQERRATVGKPSDSNGTASRIANVAQGRSPVAVPPQMQLAGTSLSSAVAAAVPSL
                     SIATPTAADGGWHALCVPLLHFLLSNVALHCANYIVLLALQRVPVSTEGVLKAAAQAK
                     LLSDDGDALQGASDAPPPAVDAAMAAPPLAAPPSPLHRPLTAFFHLLVHHMRRHYRGA
                     WAAGGGRLGGRQASTSPGHQLEAGGGKGYVWGVANDDDAEVMAGEDGAMRGGSEDDDQ
                     AHRSMFDALFAAATAAEESSNRAARVCRTPCSAGASRCSFRARAVADGAPIDADAPDD
                     SMPLHLTDSAQVSLLLSCCQAQLHLRLMEHLKQLTRAELDSEVITTTTQRAMDAGILY
                     ADALSLEAQAALVQRRVLHCTLLLDVTSRWSTLSEECMMRIYAAQPQYAPGPLTDPNG
                     VFLEVQQTVRLMQAVLVAVLDAPPRYMQASTSPATAEASAATECGGAKRAGHRALFDS
                     VMPPPPKSSTSWLEDSTLAMLELCATQLELFWTLPAPTLAQCCQLAAPTRAALELLQE
                     STASHTSARALLECMLRPMKVAADPLAEYNRFSNAGTPFNDAASASQGLFVFSAAATP
                     VSSSHMTRTASPSAPDFTPSPDEPQQYNGHTGVYCPALSYMQLAWMRRHHTHALLRGL
                     LLMVTLNYGQGQGQCPVSTDRLILAQHNHSVTGVHFDASSCDSVVWTTEFGTSVGHGF
                     RELLAGDNEEALWKQATERNLATAAFTLGLTAQHERLRLATEHAEQQYTPAVIEAVAA
                     KSALESRPRLGEAANAMPSSHPHLPFFVSRHLDGHLDLYPFASPECVASFRCAARHGQ
                     SAMGRSSGTRGGVGTSHGNACGWRAWGVAAGPTAAVPAHTARLACSAVGAAVSSSRSS
                     DEGYAVTPVAFSPNGYIIAAGLSDGSVAGWRFAAAAVESPPAFFFPPLFAPFGIRSCT
                     FCGDRSSLMVVVGVAKEPHQYRHGYATADSTPSLGIRADAPLSALGHPLVPSSVAAAP
                     ASAFATWPSTAASFDAGEMVGEMLILDTMLGAGAITARCALPFIPSYAVYITSLRAVL
                     MVSVDGMLATYAVATGRLAVLGTVPVTTVLRSALGPSLGADCGDAGAGAASSRRGASD
                     SDTVYITCVARSSYDPLVALGVSNGLVLLLHFRSISAAMARAERRIRDEGEETFVYYP
                     PRAFSAGSDTTGSRRSKRRVAQQTKSGAAASASATARVTSEVAAPAMGREFLARLPAK
                     TMLSEATYMQVAPHINTRSAIVDLVFSPSMLLAGLQDGKVMAASLIAHATRARLTAGC
                     TIPSDLLEWP"
     gene            complement(<184141..>186930)
                     /locus_tag="LMJF_07_0390"
                     /db_xref="GeneID:5649196"
     mRNA            complement(<184141..>186930)
                     /locus_tag="LMJF_07_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680892.1"
                     /db_xref="GeneID:5649196"
     CDS             complement(184141..186930)
                     /locus_tag="LMJF_07_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649196"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ4"
                     /translation="MHERWCSGFERIALFACPSPTFHSVVWTCEEMEDLCPRRVWGFS
                     TGCILAPGRWTLDVASHHLSHTHVKGGKTATDSAAPGNNNIREDGLPLGTSSNTARFE
                     SMDETGATLYVTELFVPHVSHANDAGTAASDASGQSSWSAERLRASLLRQPSWRASPA
                     QGRDSAASPATAAAESGCVERERVPLRAWVVEVTAPPSPSSTLAAVSPSASADIATTT
                     AASCSIAAALLPFFRLFLEVVWDGGTSTSAVSRTVDDAVHRIVAHLESLYRTPALELD
                     GFRCFVGGAAASDAAPGGSARVSPPSAKAMTAASVVTQLREPCSPHALADMGTDALSS
                     AWGASLYSAAGAAFVQLLQPSSALQPPPPPHQSAVDEAHGSQSCWSLYLVSVFPAARH
                     GGAASAVQHLLQHDLQLCWEGLALSTALAGAETVVAVAALPLDSAGAEPSSIYSFPSV
                     ERAWEVHVHRFLSQQRGQERTRGLGRDATGVDSAVGRHDTVREWELRRLSTSSRPVSE
                     QLDAMLHKAELQQCVVDDPSLSSGARSMRLVARDVGAPLVAPRCTSYLLRIRRGAAGG
                     EQVRANVSDDHAYGFAAVQTPAATDATHTDTQAEERYVLQLHAPRVLSTHALVVCMAV
                     PTSLVAKESRPGKRAATEGGTEASAVSADDVGDLAAAAAAALSAMYRIAPYVPSLWLP
                     CEVALRGGSGICSRSGRLLLHVPACDARYGNIHVAPVASNVFTTLGSIIAWSAQSPLS
                     RQGDAAGRDTSSPVSPTCASLANTCAVWTLIGDGRSAAAYLEDTLSEYMYDTGAKSLL
                     NVGQPSQHERQPGLFLVRRKQKKRYSTTGTATVSGAAKGTMSSLAVQEVCSAWLDVGE
                     THRLFLSVRDVGAGEVLLAKGSLVGPHTEFLRRDRTSRDAVTAALEAASRAEEEALEE
                     WIGGVAAAAVAPQRR"
     gene            complement(<187967..>189802)
                     /locus_tag="LMJF_07_0400"
                     /db_xref="GeneID:5649197"
     mRNA            complement(<187967..>189802)
                     /locus_tag="LMJF_07_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680893.1"
                     /db_xref="GeneID:5649197"
     CDS             complement(187967..189802)
                     /locus_tag="LMJF_07_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649197"
                     /db_xref="GOA:Q4QIQ3"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ3"
                     /translation="MPSCLSPFTRESAPGAAGTEDIDDAPGSTIIATQRSRLRELVDR
                     AYNETIRTAAHLRLLMTLSKYGLGVALILCVTVIWVASSVWIQYIFGSLEFNKPFFLT
                     YFNTTGFCLWNAGFFLSARWRRTPWDETSRTQPVCIEDARLDSREPSSTEEAEADAGE
                     DDASIGAVREAPHHSRSVSGVSPTLSHTVPHCRGLAERELQRSLSHCSPSSDLLSHAV
                     PHSTQPPHYGHAPLSRSAITAVSARHAGTPPSTPRLPPHQVLISVDATGRSLLEDNDD
                     IDGGSDVGSGHGVTRSTAHLQVADECRDYSLATSSASSAREEVVSVILTDEDELADGA
                     LRQVATRREVVISSKMLRHNRTGAPPRRRYRQRARRQRLRRYSLRRIWRCALVFCPLW
                     FLANYLFNLSLSITSVASNTILSSTSSIWALFLSHTVLRQPVGAHRLAAVILSVSGTV
                     VVGLSDKDAAGGHSTVGGNVVALLSAFFYAAYTSVLKARLPDDERFAMGMVFGAVGVL
                     NVVFLWPGLVLLSVTGAEKFVWPSWQQLWPLLINSLVGTNLSDVLWARSVVLTSPVVA
                     TLGLSLTTPLAMVVDAISKNAHFSGAYVAGAVLVMVGFLLANLPI"
     gene            complement(<194511..>196058)
                     /locus_tag="LMJF_07_0410"
                     /db_xref="GeneID:5649198"
     mRNA            complement(<194511..>196058)
                     /locus_tag="LMJF_07_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680894.1"
                     /db_xref="GeneID:5649198"
     CDS             complement(194511..196058)
                     /locus_tag="LMJF_07_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649198"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ2"
                     /translation="MMRWAVDVTGIDVAEDLEREQRKCVYKVPRAANGESWHAVDDWR
                     ANASEYNDELGKVWALTRDEVQDAIAERALTANALFCNVGRTLAGALQRQGSITIAAG
                     CASQLRGSCGRGLQWDGLLSNTQSIVSNDFACDAVPSTREVRVFSTFLNAEGKRMTVT
                     VNMTQPTYRGVDVVAAFLQQAVATNESLSQRYSTNPRLYKLFIADEDTGEEEMAAQLD
                     LGAQNFSCYAVNPMPAAKLFLFPQRTALLNTTTRDVNLTVQVRPLDPQAKAVQRQCVV
                     PADMLAESLEATICSRLPASGIIQGSLRIMHGPMELNINEYYNFGAGCGQPNCPIAER
                     TVLSLFRFGVREVVVNGRAVEEAPTEVLRDLTEDIIIDMGVDEAVSFQQFEVICINKY
                     GARQQRLLCVDGEHLYTMRPNASEALPKTTERTIKDIEEVRIFADKPKYMEIAYTKSS
                     HFEEDHFECTTTYNCALLNEKIRIVRRELRKREAEEQAASVKNETAMQRFMTGIRSRW
                     FGGALQS"
     gene            complement(<198310..>198639)
                     /locus_tag="LMJF_07_0420"
                     /db_xref="GeneID:5649199"
     mRNA            complement(<198310..>198639)
                     /locus_tag="LMJF_07_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680895.1"
                     /db_xref="GeneID:5649199"
     CDS             complement(198310..198639)
                     /locus_tag="LMJF_07_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649199"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ1"
                     /translation="MRRTVRALYNSFERGWKDKTVHPLDRRGRFNLDEAAAELQLDEA
                     YVASLYKPLHYTYSMKGQRYPAEQGRTSRPGSLAASRDRMFPLYRRNYKLNRELRVLD
                     HRRISTD"
     gene            complement(<199669..>200142)
                     /gene="HTD2-2"
                     /locus_tag="LMJF_07_0430"
                     /db_xref="GeneID:5649200"
     mRNA            complement(<199669..>200142)
                     /gene="HTD2-2"
                     /locus_tag="LMJF_07_0430"
                     /product="putative 3-hydroxyacyl-ACP dehydratase"
                     /transcript_id="XM_001680896.1"
                     /db_xref="GeneID:5649200"
     CDS             complement(199669..200142)
                     /gene="HTD2-2"
                     /locus_tag="LMJF_07_0430"
                     /EC_number="4.2.1.-"
                     /codon_start=1
                     /product="putative 3-hydroxyacyl-ACP dehydratase"
                     /protein_id="XP_001680948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649200"
                     /db_xref="GOA:Q4QIQ0"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q4QIQ0"
                     /translation="MSSETAPLVIRVGSRATRTVHISQENVNTFGDVIDDHNPIHSDP
                     EAARAAGFPTTICYGMYAGSLFSGLMAKEMPGPGTVYLSQNLRFTAPVFVGDDLDVIV
                     EVREFRKDKGLISLSNIVQKTDPSTGKTTVCVEGSAVVMNKTLQFEGESEWSVTK"
     gene            complement(<201260..>201733)
                     /gene="HTD2-1"
                     /locus_tag="LMJF_07_0440"
                     /db_xref="GeneID:5649201"
     mRNA            complement(<201260..>201733)
                     /gene="HTD2-1"
                     /locus_tag="LMJF_07_0440"
                     /product="putative 3-hydroxyacyl-ACP dehydratase"
                     /transcript_id="XM_001680897.1"
                     /db_xref="GeneID:5649201"
     CDS             complement(201260..201733)
                     /gene="HTD2-1"
                     /locus_tag="LMJF_07_0440"
                     /EC_number="4.2.1.-"
                     /codon_start=1
                     /product="putative 3-hydroxyacyl-ACP dehydratase"
                     /protein_id="XP_001680949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649201"
                     /db_xref="GOA:Q4QIP9"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP9"
                     /translation="MQAAARRIIRVGAQASKTVKITQRDVVTFGDLIQDHNPIHSDAA
                     AAKAAGFPSPICYGMLAGSLFSGLMATEIPGPNTVYLSQSLRFTRPIFVGDELEVIAK
                     VTRFRRNKGLIEMSTIIQKADPKNPSVKITCIEGFSVGMNKMVDFEGESEWTRRL"
     gene            complement(<202263..>202763)
                     /locus_tag="LMJF_07_0450"
                     /db_xref="GeneID:5649202"
     mRNA            complement(<202263..>202763)
                     /locus_tag="LMJF_07_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680898.1"
                     /db_xref="GeneID:5649202"
     CDS             complement(202263..202763)
                     /locus_tag="LMJF_07_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649202"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP8"
                     /translation="MLSCKGVLLMRHIGQDVPRRHTHFVLESRLMYEKSFRDEWLRSL
                     CQGLANVDEPLAKSLSGLPQQMLQRKVTCFSYNQFGLFKVPYYRLANVDRYYAVQGAL
                     GTREWVPYANVSSWTMNKMVRSGNILVHRVHYKGWGTDNALNQGGWEHRWNKVMQRNA
                     LQYNRI"
     gene            complement(<203579..>205138)
                     /locus_tag="LMJF_07_0460"
                     /db_xref="GeneID:5649203"
     mRNA            complement(<203579..>205138)
                     /locus_tag="LMJF_07_0460"
                     /product="putative acyl-CoA dehydrogenase, mitochondrial
                     precursor"
                     /transcript_id="XM_001680899.1"
                     /db_xref="GeneID:5649203"
     CDS             complement(203579..205138)
                     /locus_tag="LMJF_07_0460"
                     /EC_number="1.3.99.-"
                     /codon_start=1
                     /product="putative acyl-CoA dehydrogenase, mitochondrial
                     precursor"
                     /protein_id="XP_001680951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649203"
                     /db_xref="GOA:Q4QIP7"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP7"
                     /translation="MRRVFSSAPRRYVRHASYAAGLFNSRVVPEELFPYPSRQLDSDE
                     SETVQVLIEQIRSSDKDLNLAGARIATEYGGLGLGHTAHALVCEEVGTNGDSKLLQTI
                     QHCGFASYLLSTVGSKEVKGKYLTGMSDGKVMMGWATREGCGNDISMNTAKATLTSDG
                     RYVLTGCKRCEFAEGATHYLVLAKALTQTATEAGPMEVSRNTFFVLEKSAKGVSVNGG
                     TVSFEDTPAADVVGVVGEGFKDRMITLFTEQYVYAATLLGISKRVVQELRDSVPEQWA
                     TDTVASCACIMYAMESSLYALTANLDLPTEDSLLEAALVSVFVQSSTNEWLSILSTAT
                     PMSEVLEKCFANARLLLSMMESTDFLYSSAVCCGVEDYGLVFQRTSTLQMVQLRTMRS
                     MGMKDRVPVRELDCSAIDSAVVAFGNAVEATFVRNGSQVPQQQLIINRLGEAASLLYA
                     ASASASRAAMCQSKRLPTAKTERELASTFIAMATNRVIQLSEESYNIGMTADDSYKRI
                     AVEMCDEVLRP"
     gene            complement(<205658..>208081)
                     /locus_tag="LMJF_07_0470"
                     /db_xref="GeneID:5649204"
     mRNA            complement(<205658..>208081)
                     /locus_tag="LMJF_07_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680900.1"
                     /db_xref="GeneID:5649204"
     CDS             complement(205658..208081)
                     /locus_tag="LMJF_07_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649204"
                     /db_xref="GOA:Q4QIP6"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP6"
                     /translation="MQLSTIFLSASFLSVGSFLVQIARSCTMARNKEHKQRFASKHAL
                     ADKSKGRQLQSKQCNVKAGPSAHNKERSKQIAAAIRDKRARAALEQRRLGSADGIPRI
                     VGIIPANESGNTEEILQGFCKSLHADFPGSDQPFSVVSRERKAAFTFVCEKNCNDQDC
                     IDVAKVSDFMVLTLDCSQAVQNTIRELQDTRAFTDDDGAETIATTWFSDVGLCITGYT
                     RDLVAAINSQGTPSVVVVIQNLHTFADRQRQKVLKIHQRYFNSVLSDTTKVVPVVSQD
                     DYTKILRHMQVSKIRTLKWRDQHPYMAVEEKAYNPETQELTITGHLRGMPLSATQLVH
                     LTNHGTFQVCKIEEVRKGDERVLIETSEAAQRESLQQVQANSTLEDDGFPTDADVLYH
                     QEIAGTHKIRVPAGVSSDQAAWYDTEENIVKDSAPKHQHITMDDEDAFAGDAMSYRTT
                     QTDVDFLKAEDVVRLERMTDEERILEMEKLKELSEEETWNPDMVDTPVNIPARQRFAK
                     YRGMRSFHTGRWDPAENLPPQYAYIYKLQGYSRIRESAIDACEGGMAEVGMCIAITLV
                     NVPQSVWNACERCLLIASGQLQHEQKWSVLHFQVQRASELDEPIKSKTPMLAHIGFRK
                     FYVSPLFSDISSGDRSKFARFFHEGDRFRMATFFGPISYNPCPLLLFQVPSLEEQAEG
                     NPLRLACFGGSLPPNPETLLLKRAVLSGRVAVIHKKQVVVKYMFFNDEDIKWFQPVDL
                     YTKFGRRGKITKPVGTHGLFKAVLNDQIMQHDVVCMDLFKRVFPKWTTVAFSMSDVPA
                     GHTENEEER"
     gene            <215727..>216206
                     /locus_tag="LMJF_07_0475"
                     /db_xref="GeneID:5649205"
     mRNA            <215727..>216206
                     /locus_tag="LMJF_07_0475"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680901.1"
                     /db_xref="GeneID:5649205"
     CDS             215727..216206
                     /locus_tag="LMJF_07_0475"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0475"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0475"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649205"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP5"
                     /translation="MTAESDRQRFARYVLEISQVQRNHVADRVEQLAHHESLSWQYFF
                     GCIAFSTGSVLAAFKAWGPRHIFKNSMYYARPLPPAISMGVVLYGITFTCRGMLMRNR
                     ICIMIEDYEYELKRVKAHHCEEGVTQLAWLEFVLDQLKQGSEQRFDFQKLRETPAIR"
     gene            <216408..>231029
                     /locus_tag="LMJF_07_0480"
                     /db_xref="GeneID:5649206"
     mRNA            <216408..>231029
                     /locus_tag="LMJF_07_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680902.1"
                     /db_xref="GeneID:5649206"
     CDS             216408..231029
                     /locus_tag="LMJF_07_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649206"
                     /db_xref="GOA:Q4QIP4"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP4"
                     /translation="MVNRFVHLHLFLPLILSFPFADTQTMESSKSHEKVGGRLEKVLR
                     CYWDGVPVPLMCNEGKQRSQTFVCRRLAFAPDYHGETMELPLLQTQKSQLFRALCEYV
                     DSPQSVSCRIGSHYSPHVGLFRFDEGKRLHGASSQDSESVVRVPKECCEKSDEGTNAV
                     SMLHRRIRTVKMVSLYKPLIKEYSPLSRHSLRNILILASRGCTSISKEVVAREICDVN
                     EAYAEAVSEGIFYYMCLNHLFRRILAPLQLATEPEPIIRSITYAAAQEAPLSREHFKA
                     AKEQLKSQLLWNPLTGNYFRGLMSIWEEKFARLQFFSIDVTVACIDVVAFLKQVCKAM
                     SSAVSRIRVEFYGCVEALFFSYFKTAREVLLLTEREYEGSVFKKVFVATEVFLVNRIR
                     SLFFDALDSLVRFFDCDGLTNEVRISPRARRLPSLRVELVVGESFQPRAPSFSLLLFG
                     IADFFAEVEKSINGLPRLACAIFREPRLGDKKLTIVSHVEMASYRASITGVLEGASVL
                     INKILSSYSKFCKIPVHNLAIAKTGTPAEVEELVVLARRNLTDIRHVSHDVLFYGRLE
                     ISCRPLRLELTQKWENYLSAFVSAFQNTIVSIVDEAKAKSRAILDMLQATPSTVQELE
                     QHLRNTEAAIALADYLCDTSHKQIADRVSCIENLFIPVNEHACRSVLEFKKLPGELRG
                     QADKSGDIRAKCTPLLRRKLENVRRTIRDYYRTLSTGVKGLYHMFDLDTCDIAAQTCA
                     ELRKLVERIEKMQKNIKHEMMVLGLPSEDSFDDYLPLMTHFETIEQFWITVFESTKLR
                     ELYRTPVSSVNASGFVERAREWRRLIHSSIRNLRAYPALVHLGREQELALAKFEELEL
                     FLELITTPGLRKSHWRDIAKLISVQLRDDVMLVTNMTVTVKRLLDAGLLDHIVPLAQI
                     VSQARCDYEVENELEEMRSYAKRTHLVLENTAAKNDLSALLLQEPQREMMYRIEEYVL
                     KCRAMRRRPNLGPSVLKSLDEWVDACEKSRGVLLAWDQVKGRWVNLRACLSSLRSAVA
                     EGICSAEEARLITKSLTMASDAFKELCAILRKPQFSLYTAMMQDTIQDFLLTIKSEVD
                     DAAELLRGMTERRRALFPRFRFLPDSELMGFQSVQSAHSFAHIFQYLYPGITDVEVID
                     GVATAVVAADGARLPLSSPLALTKDTPDAWIQCFDRAVRASLVAAVKECVAAYYRCNL
                     ESWLRQWCGQVTVLALRILHTEGLRRALQLAGQNGLIAYITKVSDLCSAISKLAQRGY
                     DKGVKGGQPRSYEAVVAAALAYEEFALREVQLAVEWHVSSVTELESTRVVQTFLTPAE
                     DGICVRMMGVLFDYGLEFLGHASAPMMSAAQWVQMAPVLVDMELSRSVSLVSASDDIA
                     AEGEVLEAAAMLLGRFFFRVEATEHVPTETLQRLLRGCVEVGALACVMNCEAVPRAVL
                     EEAVLPIATASVEQRRSSVWQLPYGGKDDMVSVSVHPLFRLAFSAAAPVALPRSLDLI
                     CREVRVAPFDVQEALHDYLTRTGVVPAGPLSAEEAEFAKLYRQLQELHPTVFTARQLR
                     VVLREAFASVDARDGRGPTVIGSSQQRVVTRLLTALGSVFTAFFSTDGEAVQRSLETQ
                     IKAKLLLPSCHGVAPPGWYDPPVQRTTQTAAADALLERFTSWMNVHRRVLLVGPPFAG
                     KTRLWRTWAGSQSPLIVSLSLISAADFYGTSTEPSFLSLITSHMTAARHRSKAPVVVM
                     EDVGSASSFALFLGSWPDRARVLEGELHNSNSVIPSPLVRVIGTAQGLHHVTPGTLNR
                     FAMMALAGPSSWHEGISHALGSMPDAEWVARVLEKLLPPLVERASRASPELVGRAKEL
                     TNMYAVAQRAAALCSRWYAYALTLHTHRGALELEEEEDEVPLRLFAVRCAVMAATWSV
                     GLSLPMGDRDILKLSLLGAETDVMKALADCELSGEIFPVLSKDSVSPLEQVVLPRGWI
                     SFEEAATRTDLPLSWSADTHTDPHLCAWSQVFLTPSRAAILRATECLINCGQHVLFHA
                     GPVAGKSTLLHTMKANEVDWVVQVYNASGGMQPIHIQQRMASELVQRSDGRHSPTLGR
                     RLVVCIDDLHLAPVVARNGDDEAHTAAMTLGGCLIRFCDKFRAISTPRTGTMPLANVV
                     FCGSSLFQAGSGSQCSTGALSGCVDVRLPGFDSDEIACGVHLLCNLASSRKRTKEFSQ
                     GCATFLGLVHGAYTHLRLRVAALAPCPMVAVTHTAFTPASSISAVLSTPLNTTNVDAS
                     ASRQGSIPSFYAEYLRDALQAAEVVRLHLISNASDVQVATRVFLDVTAFYEAQLRAPP
                     SPKVTQCSESLPLSPPPPTVGVGLEANDALRALHGSAVEAAESSMRECIRGSVNFADL
                     VPQLPNLPEPDAIAAEDESFVADCIAEFASALQDEREEDLSTLEERRGPGGGANIKGV
                     PTRAETRCASVFVSYPDFLRKAAVRSGGAHKGMLVRRSSSMAALSGNSSLRGSFAITP
                     GCANGLSMAAAVFQQQKLRPSTHIVTTSTYQTTWLTTRLVFLQDTLSAPHAQVVFLGE
                     SAFGLRRLFRLWCANTHVPLMWFRMHSSASPAEANATFRHDLRSAITFACMNSIHAVI
                     YLPPELLRMPEVLLIVDPLVRSGDVSGLFSDEERNSLMRGFRVTHPRSLKPFTLVDDT
                     ELRDRLRSSFNFVFHLRDAAEVKRIAAAYPFLRQHNTSVLRLYTEALRSSLVQELVLS
                     VLRSSGGADVDGIPTLDSDDTEEGEDEGVKEGGRDGDDRPVSLSQRAVCRALCAIFAH
                     VSERHPTSLTQLVEFVSLYRDLSSAARVEVLESARTGTVIMSRGDEAVQMVRTVSQRT
                     RAIAEGLAAEQLRIASLSERLRDEENELTTQSLEAQALGDKLQETREALVLQRATLAD
                     ALKKAEERLERAARQLRKAKVNNMRALAVSRVPDKGTLLVRCLYAVLGEDLPKHNDNP
                     HELWSTAMKRVCTKEFTMTLTGIAPDEDRTALKTYLLLRQELDAVRYAPAQPYAQLLA
                     DFVVEWVDYGKFRAEDYATGVQDIEKSEDDLKEGEELYATRLKGVQSALGTVACTKAE
                     IDAAQRSTEALQGEQRQLAGIEARLMKYTGLVDRFSRFLVAPADVAERAKFARCAAAD
                     TFLVSAFYSLLAMHDKAEDTYVSLQQLLVETVHPRLHSTAPQEAFAYMLYQTHAPRTR
                     ALMLPGSEHFAWEYRALFMALFKRVASRWTLIGAATPLIEQEVCKYLSLSCTGCVVMS
                     MTDPSAKERLIAAMRAGEGVLLRDVHDPASLDLIRYLNPLYCKLKVHWNAELGPRRGS
                     TIIATAQSPQALAMPSAPRHADEEDATARSVSLLLEGREVRVHPSFYMVCTSSLAVPV
                     ETNAVCDAINVYNLCTPMPQRLYYECLLRDAVCTTSVSTKMCNMREEITTQQQVYFRV
                     LQEFVQVHDAAAKLLAADIGDIRDGLRGDTLVADANRALADVDMYEGQLSQTVYYVQS
                     WQKAVHEGWGPVLPALEAVASFAELIEAERLQRPWSASALDRCLMDMVRFPPVFMRHF
                     APQSFSDLPAPLKRYYATVHYVQRVVEQLAAGWPVPVRGIFSLLLLASAMAAAPVVFA
                     AKTDARVLTAEQTRVLQVLLREGLSCASLSTGKNEKDASISSLFSLLSSAGATEEELR
                     RGMLELYTTSEDALLHRVARRGSTVPGEEKDLSNDTEADVDENQFYVAHFFSSMAKLQ
                     VEQANHYAASLYGTFMESVTRLEGTAGEPKPPAMPLAADGRTGKRWMRTSTDMPSQHI
                     ANETQESGMNSSRSDSGKDNAEEVELRDVISVGVQMERAAMAQQPLCLITDSGLTSSL
                     SWLRHEAVEAKLDFVWQELNLCRATTAVYSAATVSPARSGARGATFVTATQTLISLTK
                     QFRFSGKGRGVCLALVVDADVKEGVNEKDARIFREELQWLLSLYTNTFRPSGGGKVGA
                     AVYLAVICSPATERVLWRGAAAGHVTPCCYIPLSTITPQQRLVQLLQPSRRYFTDRGV
                     VQACETILQNVAAEMAHRSNINATHSPPPNNTMRVRGPTLAKLTIHQNVAQASMPLPT
                     LPRFTSPAALTALQNAVENLLCCAHLVHHEMVVSHVVSTIRERMRCEGNKLGCYVDDP
                     APLVQLHDLLSEWVVRCYEALVANLSRSTAEEVQSPTNDRAAAAESTAKAEGAFSKAS
                     FNGDLVLPLALQSVLQRDAVERNALPYGLKAYYYLRRRQLGWQLLLERHFQATRQTSQ
                     EPTPVSSHASVERFTHAVLSIMTANSKMGDALPSRSSASRDSSLVDLQVPSAAELPLH
                     LERSSQRSAQRSLVERAVKQWRTGLFAMARQFAFFFMSCRQRNDPLPAVERQAQWTML
                     RALIGTPEHGDEVSCLWGQNSDAYSAGEAWQTLMLDARYLDHFRLEVDIFPSDLMELC
                     GEAAPARRLRRMQLDSLLHLCFPTRGSSTYESSKAAYKTLVDIPSTAPAIAAAEDLGR
                     PAHTGDEPASNLASPAVPEEAESRCGESPLHLPAASSSSHRAVVADILQSFSMGLACH
                     APVTVGEPYTQVWLPSLRHPMLDLEFLTTIVHRPASSPSDSATEARVAHVTSRDDKPF
                     ADGLLEEGQQDGHYRCAGERDHNAVASRLILVVTQRRYLFPSDVILTGARLSLALVRQ
                     LAAQTQWSAGRDGDETTAGLTAAVVVVRRVLVRPRVQNVEGCWEREEASARIPTYEVG
                     MWMWPTTSSWDTTHSSSQLRWYAVTCSRLPADALLWDTTVVCRPTATSVAHSSSTASE
                     PLRRREGAADSTFVTEMQESAKTATPKQADLDAPRSWSVTEVPVPVRWHPLSGDSSRG
                     VRGKGAIMLELYLCVEYEPLATQSYGFGSDASSSSPSSSSMTTATGACASCATRGAWD
                     TLQLHETLDAYVWIE"
     gene            <232549..>233745
                     /locus_tag="LMJF_07_0490"
                     /db_xref="GeneID:5649207"
     mRNA            <232549..>233745
                     /locus_tag="LMJF_07_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680903.1"
                     /db_xref="GeneID:5649207"
     CDS             232549..233745
                     /locus_tag="LMJF_07_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649207"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP3"
                     /translation="MPSSAALSPTPGGAHLEDARSAEPAAVPSSSRTSSSSSAGFPQW
                     WQRLYSAHTFTEGLRVVFEVVPLWVPVAGVITTAGTYYVTFRVRLFLAQWRIAERRRA
                     ERKYELLDNLRGMKIVPVGAVHALGDDDDDDDDDDDDEEEDETAVSRRDVDEFRSSLG
                     IRLPRDEDLMAIVERMLMSDTLPDGWVLYRTSAGIVRFMNLNTQELFFFPPNKRKEKA
                     LIESELKKRNREAMESRYNFSYEDEGMNSSSLSPSRPDTQNFETLHRSAREDGGTAGG
                     NASPIDFDDSAGAEDPNDGLSSTFRRVFSYFLEREQKKIEQGVALARSSREGSVLGGP
                     SAGPSGAFSGGTGSGQGSGSGAGGASGAAGGGYDGATASHRTSASMTYRVVSSSSIHG
                     GRGGTN"
     gene            <236044..>236838
                     /locus_tag="LMJF_07_0500"
                     /db_xref="GeneID:5649208"
     mRNA            <236044..>236838
                     /locus_tag="LMJF_07_0500"
                     /product="putative 60S ribosomal protein L7a"
                     /transcript_id="XM_001680904.1"
                     /db_xref="GeneID:5649208"
     CDS             236044..236838
                     /locus_tag="LMJF_07_0500"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L7a"
                     /protein_id="XP_001680956.1"
                     /db_xref="GeneID:5649208"
                     /db_xref="GOA:Q4QIP1"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP1"
                     /translation="MPGKEVKKVTQPAKAASPYKKPAVASHFAARPKNFGIGQDVPYA
                     RDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEALKLIKKYAPET
                     RKARRERLQKVAEEKKKDPKKTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDP
                     VELVLWMPNLCRANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRS
                     VNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHARNAGVDAAAIIQ"
     gene            <238083..>238877
                     /locus_tag="LMJF_07_0510"
                     /db_xref="GeneID:5649209"
     mRNA            <238083..>238877
                     /locus_tag="LMJF_07_0510"
                     /product="putative 60S ribosomal protein L7a"
                     /transcript_id="XM_001680905.1"
                     /db_xref="GeneID:5649209"
     CDS             238083..238877
                     /locus_tag="LMJF_07_0510"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L7a"
                     /protein_id="XP_001680957.1"
                     /db_xref="GeneID:5649209"
                     /db_xref="GOA:Q4QIP1"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP1"
                     /translation="MPGKEVKKVTQPAKAASPYKKPAVASHFAARPKNFGIGQDVPYA
                     RDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEALKLIKKYAPET
                     RKARRERLQKVAEEKKKDPKKTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDP
                     VELVLWMPNLCRANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRS
                     VNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHARNAGVDAAAIIQ"
     gene            <240097..>240807
                     /locus_tag="LMJF_07_0520"
                     /db_xref="GeneID:5649210"
     mRNA            <240097..>240807
                     /locus_tag="LMJF_07_0520"
                     /product="putative QA-SNARE protein"
                     /transcript_id="XM_001680906.1"
                     /db_xref="GeneID:5649210"
     CDS             240097..240807
                     /locus_tag="LMJF_07_0520"
                     /codon_start=1
                     /product="putative QA-SNARE protein"
                     /protein_id="XP_001680958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649210"
                     /db_xref="UniProtKB/TrEMBL:Q4QIP0"
                     /translation="MDSFEIALDDLDATLAALRLKVEMVIVTDTLPAKKKVEMEARPL
                     MREARQKLAALRAETRRTLDLDARQAHEGICKDRDQTIRNYDAEMKSQIYPRHSASAR
                     PKTYQEQREEEMMGRGRADGTGFTDSNQVLNAAINVQKDALQSLQRTERLQNVTEEAG
                     KTTLVELQKQTERMYHIDEELQNLQGQIDHASRDLRWFYRQLARDKCFLSLFGLCIVA
                     LLVLVFVSIYTKRVRSKQ"
     gene            <244072..>245166
                     /locus_tag="LMJF_07_0530"
                     /db_xref="GeneID:5649211"
     mRNA            <244072..>245166
                     /locus_tag="LMJF_07_0530"
                     /product="adp/ATP carrier-like protein"
                     /transcript_id="XM_001680907.1"
                     /db_xref="GeneID:5649211"
     CDS             244072..245166
                     /locus_tag="LMJF_07_0530"
                     /codon_start=1
                     /product="adp/ATP carrier-like protein"
                     /protein_id="XP_001680959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649211"
                     /db_xref="GOA:Q4QIN9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN9"
                     /translation="MPTTSVAAQGSSSGSGGGGSAYRAGERSSVSSSSSHGGTSETDH
                     AGSYSSLSREPASQHGDQRRLYEDDGSTLISVEYIQRLWLMRAISRTVLAPLERVKYV
                     MQCQKELQRAGVLQCEFKTVWSCVRYLKHMEGARSFWRGNLIQVVSLLPILLAQIFVA
                     YPTQSFIFNSCVVHSVAGYTVASYAALLGGALAATAVSYPLEYARFRLAVDVKSRVGA
                     PYQFRNSFAFYAHPVVSECPHFLYRGLTLFIFGSVVYQSVQSVLLNVVAPYVPPDEEG
                     SGWTPAIIQTVCGLAVSGTTTLCLHPVDLVRHRMMVAVMEDRLRYSSAMKCVARIAQK
                     EGIRGFFRGGTVTLTKMIAATGLVLAGLPY"
     gene            <248389..>250620
                     /locus_tag="LMJF_07_0540"
                     /db_xref="GeneID:5649212"
     mRNA            <248389..>250620
                     /locus_tag="LMJF_07_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680908.1"
                     /db_xref="GeneID:5649212"
     CDS             248389..250620
                     /locus_tag="LMJF_07_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649212"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN8"
                     /translation="MTTPVPRRWRHSSAPPPPVSRRGPSPSSLLWGWGDSSGEDTHRG
                     AATASTDAATAASPSPYELRGRRDKHVWEEDSVRASYVNSASASRPVPSVLSAPHSPP
                     KAPAARRDAAYEEVREDQSSQSWRQPLQRPPLAPSPPCATSTTAPPTVSAERVLHHVE
                     PVEFVSCHNAHEHAANVRRIARYLKNYYAREAGEMERGVESLSAEDVAGLVQCFYIDL
                     YRTVRQARREAGMETSSFLVEDPTENVIASVAPVPPPPPPQRERHDSYTPQQQRSTTS
                     DAQNRLVNSSATSDTEPTYRAPNAQLAFSGGGTHPVQIITARLPAFCNDDITTAGDGP
                     SALGHLRPSVALSVSPAASSTASASRAHEEARARVSPAGPASVGSDALPYDLDNENTE
                     AVSSLVQAATPSPPYRHLHRAVDSAGAAPSCATVQHHQPSSFQPHEVFGVSQRHPFSA
                     PNGFVAASAEPSSSPQLNHRQGDTNSRGRHNRYGLQDASLHTRGRHVRMRNGHVGGSS
                     SSSSGEGGDHGGETGRCDGRRDAGSGAGRAKLAASQPSSGIIKRPLKELMPLLRSRGT
                     LAVKHIHNRRRPHLRLFQILDCMDTYRGSEVLMPHFTWATPAEAHQHDRLPRAKRMKH
                     GAPLPTGLSLAQQAVPYETALNLVHLEAVYVGAGHGIAAAHMALFRRAKCEGNSCGSD
                     SRVDGGAAVVDHGGHPVANDMCAVFVFASRPVAVSFLCEDDRQAWVGAMMGVVERNRT
                     LTA"
     gene            <257876..>262537
                     /locus_tag="LMJF_07_0550"
                     /db_xref="GeneID:5649213"
     mRNA            <257876..>262537
                     /locus_tag="LMJF_07_0550"
                     /product="cysteine peptidase B (CPB)"
                     /transcript_id="XM_001680909.1"
                     /db_xref="GeneID:5649213"
     CDS             257876..262537
                     /locus_tag="LMJF_07_0550"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="cysteine peptidase B (CPB)"
                     /protein_id="XP_001680961.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649213"
                     /db_xref="GOA:Q4QIN7"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN7"
                     /translation="MRDNVAGSGQSSFTTPTPPQPQLSLPTDSGFRSVPSLPPPLTPP
                     PPYVATPAPQATFGAGTFTTAQDLVAHVRLLLPWTVVAAKRRRRVLAGADEFGNDLAL
                     SPLSSSWRPIPAASERATSANSSSSAQSPQHRVLSTDSAATTNSTSFMDDEVTLVSDR
                     VDAVLPTWAYLSSHIADAVPPTLFLSVPTVALARDDSLAMTSTGSSRRRLTHSPQSST
                     ASSIVDGVPPPLLSMATAPLIMDEGADRQSCLYPYELAEACALARLRRPTSKTAAAAA
                     SAQSSLHLLRLELQVDVQHIPPTVRSVAPAQRQCILDQALTEFTLTGVLSNTVLRGVL
                     NDAALRLLASVDDEVLRRIAGEVDQASQAEVEPREGGASSVSAVPAVTPQARCQRVVP
                     LSLQVHALQGGPGIAASATASPLLSSASVHSATASTVSGETDPPRHMPMVPTATPTRL
                     ILMVLVQVQHTATTSTAPEAQETRMADGEQRPQPNGHDRERASKTVEASSSSSSAADA
                     TTRMDENAAVSLASAVVPHLFPLTFGLSRFTTRLSLSSAVDYDALCTATRTSDAESWP
                     SSTAEAAEEVAAASAETSGRRAAEFCEGSTATTTEEGTRITGAEAAAQPWSWQDISVD
                     SVRVWCGLPELKPPPTPAAAPLSSSPSAFSRVVSSMAVGAGGTASMSASLSLQSTPKR
                     QRPFQKTVQEAATAAVPESEAVRDAVADQAVAFEREAKGQLGEAGKEEGEFDDGGAIS
                     ETLRRCDVGKETVMLTSVVEAVHRCVDALCGHARLLRALMETGEAAVEADEASNGAVG
                     CWGSESEGKPQKEAPAGQQRTVAFEETGCTSKADAVHGHRCVGDHAYLQDIMVATQQV
                     LVCGLTRLLIAGLSVPESAEGSEVSASAESAAAFDAERRSAGSRSVLFSMLASAEDSD
                     GSAAAHTGGIAQQLRRWFSMYGRYLAERLCAPLERLEAFIAETTASAAAAPTTATTMS
                     GICDNVHRGPSDTPSTSRRVVPGAQVMAKEKRRHRRHTAGVKASQDGAKWDGAGKAKE
                     ADAYAVDSSVLPALSIAKATVQLCRTMAGTWAPLYDAGAVASCKEPSSHQHTPTTSTD
                     GDGLATMSDTASLIQPHCRQHYRSTSRTPSASMRTVGATASAVRLLHERVAPLMDAIT
                     SVLRLFEAEERRWAALQEPLACLRGHWRDMRAIINEECVQRCEVGQSSLVALERQMRD
                     TLAMREVRGWSSIVAEEVVAAARAAALATGGESASAERAELGELTVPAIRPRTSSQRS
                     AAQQPTLTPVATLPLMPDLSGAHLPPTHSLKVPQRTVIMAEACKRERVAADSGEHVGL
                     TVEETLLSPSPPTPSHTWDVERDEPEAAEEGELKHACVEDVVMVEDSDAGERGDDGIE
                     ASAETLNNRPMASAEAVVPPLSPLLSAATSSPLATTVMQQQTPQRNQPTQSGCAKRSG
                     HAPMTQPQSQTQSRGKAAGSRAQASKSSAAPPISLQNSRAPTAASNSSARPSQQRGTA
                     STDYGAGAAASVEGALALAVRQVQRRSTPAPLYVDVVVLRQATPFVAVGAVLFFLLLF
                     L"
     gene            <263878..>264555
                     /locus_tag="LMJF_07_0560"
                     /db_xref="GeneID:5649214"
     mRNA            <263878..>264555
                     /locus_tag="LMJF_07_0560"
                     /product="putative ras-related protein rab-14"
                     /transcript_id="XM_001680910.1"
                     /db_xref="GeneID:5649214"
     CDS             263878..264555
                     /locus_tag="LMJF_07_0560"
                     /codon_start=1
                     /product="putative ras-related protein rab-14"
                     /protein_id="XP_001680962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649214"
                     /db_xref="GOA:Q4QIN6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN6"
                     /translation="MSHKYIFKYIIIGDMSVGKSCLMHLFTEQRYRKDLPHTIGVDFG
                     TTVVDINGELVKLQMWDTAGQERFRSVTRGYYRGAAGALLVYDISRRSTYAHIGTWLT
                     DARANTGPETVFILVGNKSDLEEEREVSYEEAAQFAAEHNLLFVECSSLNGNNVEEVF
                     LSTARRIHEKVKSGVMSPVDPESGVQLHTAAIPTSTANSGQTGGPVDLKAGTSGGVAA
                     AAESSCC"
     gene            <266339..>267733
                     /locus_tag="LMJF_07_0570"
                     /db_xref="GeneID:5649215"
     mRNA            <266339..>267733
                     /locus_tag="LMJF_07_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680911.1"
                     /db_xref="GeneID:5649215"
     CDS             266339..267733
                     /locus_tag="LMJF_07_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649215"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN5"
                     /translation="MPPSNVRKEEAELRQIAKQARLARKEVQQRERKQRQRERRAAAK
                     NGEAATAAQQTAASSAMRTRGAIILPDEVQELRQRLMGDDAASAASAADSPARKTKKA
                     AARKAARSPAKKSAGAAGASNHGAASSSTLVPTYHQEVHFKKKMFFVDVVLHHVPHQK
                     IDISETNTNRLVVDTCGHTKKYRLVLPYPKGMLCDAAAATYEFENGILQCRLPIMDGA
                     IPASLEAENAKMIEKMRQQRALRFRVTRDGDLTVRTRQALLTQAPAAQAALPEAKKAA
                     AAQRGDDTDSDNEVVNAQAREAKGTEKMASPKSRKRTRDGDEEDSKETPQQTRSVSAK
                     KAKGAAAAVNTLPTEAATASKPAAKKSKPDVFEAEHAKVMEAAKAAAAKVHLSMRERV
                     KLAKAVQASREERLQTRSLRKERKEEQKQQSFHRILEEQKRQLLARASMQQPAPSPTA
                     KVNASAKAVHFADE"
     gene            <269215..>272805
                     /locus_tag="LMJF_07_0580"
                     /db_xref="GeneID:5649216"
     mRNA            <269215..>272805
                     /locus_tag="LMJF_07_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680912.1"
                     /db_xref="GeneID:5649216"
     CDS             269215..272805
                     /locus_tag="LMJF_07_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649216"
                     /db_xref="GOA:Q4QIN4"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029007"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN4"
                     /translation="MEASPASSPRSPALTTKTSQLPFTAPEALPTAVEEVSEAVVSAA
                     VAAHQTASSSYAQDDGQETLLLPRQQKPVIFSRQWRRQLFAGTASSSLPLESGKPITG
                     STVEDVLRGHVQSIGRRARGDVRESDSDSVADEEGDDDEEDASPFGKASVIKFSRTED
                     SGGVPGRLAAVPSSGDSGDGEDRLSAESAFMMQATAGRAVHGRRNGAALQSSGALTRR
                     QRHQLRQQAQEAREHHRVRRHMAGFDPDFLSRQESRMQVHRERDSNEEGEDEESGAHS
                     SEGETDYSASSTAESEALSSVSAEGDDDEGEEAEEDGDVDGDLLDPSASAPHGDLSAA
                     GGGGFGAAERTEHERQGRAHDKSGTAAPPAQVDEPGDSGSNTSPAAVRSQFFQSFFFA
                     CHEDRMCRSGCHHTLVGLRDSVTIKGPCGIIGFGLGEVSVNGFYLGRKQLTLWHEEHR
                     AVLMPMKRLKTRHAQDMELPQWHRVPAPPWPSRSFSTAAAAGESTSMDAGDALGQPLN
                     PLYYRGVCDASRSRTSATVNGTPAAPAAAAAEGPDEEEAFLQSLQWSCESVFGAVDWD
                     WVEATVQSWRNLFSNQLPPIFLILQPSSSMRRRGGEGPTRRFYLTRKRGRQDGAAGGQ
                     SKVSKKGGASQDADAAPSSTYMDIPSFVAHRSEPSVDLALVPSIVPSIAAQGCGSVMV
                     LGSANIGKSTLCRYLANVLLSQHGLCYWLDLDVAQPEFGVPGQLTLSIVRRPLLRAHD
                     ASCAQIVAAFFIGASTPAPCPLTAANALAAVCAQARAVSREHPVVVNTHGWVLQTGRR
                     VSVEALRRLRPRQVIHLHKAREELWVQDTAALLDPRNGLNAEVVQRRFLVRYSSASSP
                     AAAAAGENSGGPAAGSKKNRIKGAPLSSATPSAALLCRLPYPHAREDAVQPPAPSDRE
                     SPVSSPTTTSSHRWRGQVHSVRVEREETYSSIARIKATKGSRGRQQRWETYFSALLRH
                     YAGRTAAGAKAASDHPNAEEPETTLLEAPLSALHSIVLAERDEKLGDVCLVEPTLPSS
                     SSAEVKSRATAAVAGAERRRSRQTHAELAAALEHAVVAVLFHAQPSAVAAHGQPNGGE
                     RCGVVRSLASLQNGFPVSCYGVVESGERELLHGVEAAQREKDASSSWGSSASAGWIRI
                     RVPLRPSVVAAMLSNPESGPAAAAAKRCTCVSIAYSAALRSETAFVDAWR"
     gene            <275054..>278827
                     /locus_tag="LMJF_07_0590"
                     /db_xref="GeneID:5649217"
     mRNA            <275054..>278827
                     /locus_tag="LMJF_07_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680913.1"
                     /db_xref="GeneID:5649217"
     CDS             275054..278827
                     /locus_tag="LMJF_07_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649217"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN3"
                     /translation="MPFQGNSREPHEDQQATSLHRDAQTTLQRKPACEAGEGQHGAAA
                     EAAQQEASSTATAETAPALLEAVTTWSTSEMPQQTWAAQAHEGTEGEVPADSTSVPEA
                     QEQPALGHHRMHQQWAEGGEAGGDGATHSAGNTTADDEVLGGMAGASVEEVRPTEAPP
                     PEAEESTAEEHASAAEPATYAATAEVSETGCAAAPRTDDSPSHVVKVAAVVTEQALDE
                     RRANGDGQGGSDVPMTSEENGEAAAYAQPTDGQAERGDANPEADVDTISHEERAMESE
                     EAVTSFWEGPDDIAAATAEIAFKGEADGAVRGAAVDLDEVDDDGLEKDGEQLSSSSTA
                     SATISAPSSSTATQYHRYEHDVLHPPSPPPSRLALSYLYYHALEALYVDENVTLFVQR
                     ARDVAPYGHARLNWLLGVLHAYGIGVPRSERDALMYYSFAAMEAVPEAHMALGYRYKL
                     GLGVVASCESALAHYREAADAVAMTYDGTAAASGGGAEPMTAGAKTVGSGKGGRSGSM
                     SFFAYRDDAAVSDVRKQRRLDLISLKYQADIGNVDALLTLGYLLLKGDYQVVRDGRRA
                     AAYFQTAAGKGSARAHGALGQLYMAGDPSISPPLLPDLRRALHHFRLGALQNDALSLN
                     GMGFLHAVGYLYQDKQYSATGADNNGEAAAPPSNGPPDFSTAAQYFYRSHCAEGLYNL
                     AVLFLHGRGVALDKKQARRLFERAAKQGSVLAQWQLANMLSEATEDGGALPAAECERA
                     LALYQRTASFGTWQHRAPGNRHWGGGAGVGADNADLQRQPQRHGQVKGKMGGDGGRDA
                     RLSKETRSRRVPSHNGSGSEDDGDGANEDDAADRLDGFVRPRSEAEYQVLLSGLLDRL
                     HAVEESLVSSDEDEGPTTTSLASFVELLSLAETGDAAASWSAVQYVDDYLEVADTPLP
                     DGRHASKSGAVPLLWPLTSAPGGTSQYLSGEAAASELLYHLLQRTVLHHTHTHTTLGA
                     AYLRLGNFYYYGESPQYGVDMERALAYYRIAGDHHHNAQALFNVGFMYQLGLHKASRA
                     TRVVQGMSAQEVMERPEVLRHYTSAPVGAEWKVHSNPPEYLRASPAFHLALKAAANAW
                     NRASADPMARGVDVYLAWKYYTASLRQEERGSMAVHFALAVLNVQWSLRHFGIFRLLP
                     QLESSASPAVSPSASAHSASSMAEAGADEVDVTLWTGAEGTHQVHQDKRDVLHGLLST
                     LTTTLQAVWNHLMENAVDALGTVLAWYKPLEDAVLYGAISVAVVGLLVRHHVA"
     gene            <280032..>281759
                     /locus_tag="LMJF_07_0600"
                     /db_xref="GeneID:5649218"
     mRNA            <280032..>281759
                     /locus_tag="LMJF_07_0600"
                     /product="putative electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /transcript_id="XM_001680914.1"
                     /db_xref="GeneID:5649218"
     CDS             280032..281759
                     /locus_tag="LMJF_07_0600"
                     /EC_number="1.5.5.1"
                     /codon_start=1
                     /product="putative electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /protein_id="XP_001680966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649218"
                     /db_xref="GOA:Q4QIN2"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN2"
                     /translation="MLRWTSRYLCASAAAAAGPEVHRDVEEFAVVIVGGGPSGLSAAI
                     RLKQLAGDQRDSFRVGLVEKGSEIGAHTLSGACVEPHGLDELLPGWREQEGSVLSSMT
                     PVTSDAFHVLIGPSRSVKVPWLPSTLHNRGNYITSLGGICKWLGEQAEALGVEIYPGF
                     AAADVVVDEATGAVTGVQLNDRGVDKSGRRTAQYEPGMIFRAKQTIFAEGCRGSCTKQ
                     LEKRFGLRTADNPQTFGLGIKEVWEVPKERHHPGTVMHTVGWPTTDKGHDNTYGGAFL
                     YHYGDGLISCGYVVGLDYSNPYCRPYMEMQKWKTHDLIRGQLEGGRPILYGARTLVEG
                     GFSALPKLHFPGGVLAGDCAGFLNLPKIKGTHTAMKSGMLAAEAVYEDAFKGGKEEAA
                     SGVECKSYDDCFRSSWLYKELYTVRNVRQSFYKSFKWGMLYTGITSLLLHGREPWTLK
                     HTTPDNLSLKPAKECVEIKYPKPDGTLTFDLLTNHSRSGTAHNADQPCHLRLKDSKVA
                     EEVNLKAYAGPEARFCPAGVYEFVNDKLVINAQNCLHCKACDIKDPTQNINWTVPEGG
                     GGPNYQGQM"
     gene            <283125..>283715
                     /locus_tag="LMJF_07_0610"
                     /db_xref="GeneID:5649219"
     mRNA            <283125..>283715
                     /locus_tag="LMJF_07_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680915.1"
                     /db_xref="GeneID:5649219"
     CDS             283125..283715
                     /locus_tag="LMJF_07_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649219"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN1"
                     /translation="MLNCFFGAELKPDGVPISFTIPKGTTLVITQCAVTSVVPPQQST
                     DAGASSSPAVVAKAYNPVTLCVQGHGLPTRFAVCSLSPAQHITYCPLQLLFSKPVSFV
                     LVPQTGSTAAAAAASSSPSPAPHAGKKTGRNQKHSKTTAGAHGAGAEATAVYPTVHLT
                     GYYERAADEDEEDGSMAMDVMESSDDGENDDLSDDE"
     gene            <284547..>285320
                     /locus_tag="LMJF_07_0615"
                     /db_xref="GeneID:5649220"
     mRNA            <284547..>285320
                     /locus_tag="LMJF_07_0615"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680916.1"
                     /db_xref="GeneID:5649220"
     CDS             284547..285320
                     /locus_tag="LMJF_07_0615"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0615"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0615"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649220"
                     /db_xref="UniProtKB/TrEMBL:Q4QIN0"
                     /translation="MKPIALGLQIPSLRDACEPNARHSGETSASAWTLTVPYPIGKST
                     LQISGIHARLGPVKTSACKSNGTVKHVQQQHTKSVPSSLLPGDALTADIIVHAHIRGE
                     LSSAPRPYVVAVIPLRFDGTAAPVPSGPVISSSAKSMHAGASTLPSTPHDSRVVNAQA
                     RGAGRSPSPGVFASAFARIDLRTQMERVRLSFTVVPCSRTGDAGAATNRTVANSAAHA
                     NVGKRLREEAGKAADFESSAALPDCTIDVTVVGTVSPIA"
     gene            <286364..>288220
                     /locus_tag="LMJF_07_0620"
                     /db_xref="GeneID:5649221"
     mRNA            <286364..>288220
                     /locus_tag="LMJF_07_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680917.1"
                     /db_xref="GeneID:5649221"
     CDS             286364..288220
                     /locus_tag="LMJF_07_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649221"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM9"
                     /translation="MPSPRTHVVDLACMPRENLIEIAKKQANQIREKNTRISAMEAFI
                     ESLTGTSAEESLLQLPHANSSTPPHNSSTDTPATASASQLLQLQQTREEEQLQNTLRV
                     SGLEEQLRERQREYDQLQAKVDAWKTKVMAIMTADQERIRGLEAQLAAAAAASREPSS
                     SSAPFNAPFGVAAAPSPDAGESYMTTQLQQLQAQVSAPQQELCTVREEPQQAQSQLQE
                     QHRSALQALLPSAAATLTTENLMSAPSAALRPPPSTSSEELPGNTLSLPPAPIAAADI
                     PPEVLQEAVHLQLASWKEQVEMAMLADKNRVQDLEAQLEALGTATGVDRACEAERAAE
                     MEALHAEVGRLQAALEAARHERDLVQEADRSEVESYRTAFKRQITELNCEIDELRAAA
                     ATAKEDREALLSACAAERAAEMGRLQEALEAAERERDDAAVSMKALKATMDEWKVKAG
                     SVVENGELQHRALEAEVQRLKEDRVAAGAGGDASCAENCQGKGDGELGAASTSVDRKE
                     AWSQADVVAYASGDSTATRPAAGALQDVAVQTSIAAEVPLRVVMDVASVPSPVALPEL
                     HLQSTQALLMECERAAIENRRLQRVVAQLSRFREEVMREVHAVAAPPSAPAS"
     gene            <289984..>293298
                     /locus_tag="LMJF_07_0630"
                     /db_xref="GeneID:5649222"
     mRNA            <289984..>293298
                     /locus_tag="LMJF_07_0630"
                     /product="putative vacuolar-type Ca2+-ATPase"
                     /transcript_id="XM_001680918.1"
                     /db_xref="GeneID:5649222"
     CDS             289984..293298
                     /locus_tag="LMJF_07_0630"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /product="putative vacuolar-type Ca2+-ATPase"
                     /protein_id="XP_001680970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649222"
                     /db_xref="GOA:Q4QIM8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM8"
                     /translation="MAPLNATDIVVSTESPQHRMAGAAAVPHPAPGTFTSTERAIGGE
                     IQMPLEDIFARANEAVPMYEKLGKVEGIANTLHTSLKSGVDGNTVEARRVFFGKNALP
                     EEPPLTFWEMYKASWEDRMIRLLAVAAIVSLILGLTVPDPGETEVNYTTGWIEGFAII
                     CSVIIVTTVSSVNDYNKEKRFHKLTEENSAQPVRVRRGGKDVTIDVTEIVVGDIVSLS
                     PGLVVPVDGFYVTGMSVVIDESSVTGENDPKKKSASAPIILTGTVVNTAEDAYMLACA
                     VGERSFGGKLLMESRGAGTPRPTPLQERLDELADLIGRIGLGAAMLLFALLSLMEGFR
                     MLQHDPGASYRHFLDYFLLCIAIIVVAVPEGLPLAVTIALAYSQNKMHDDNNQVRRLR
                     ACETMGNATQICSDKTGTLTQNLMSVVQGYVGMQHFSVKRPGDLPEPVPLSGMRAISL
                     RQLSEGIAINSSSEKVVSTTDKEGHTAAPYWQWVADKGNKTDNALLDFVDRVAMTEAD
                     ARDMGSRPHQRIREACRQRGFTIFPFTSDRKRMSAVVRQEDGTLVHHVKGGSDRILPL
                     CDRYVNEAGDEVPMTDEARARIAQQVKKLADMANRTIGVAYAVLGGTELPEDEPTESL
                     VWLSLLGIQDPLRPEVADAVMKCQAAGVTVRMCTGDNIDTAVAISRQCGIFNRSRGDL
                     AMTGQDFRNLVYDAYGDEERMAKFWPVLDHMTVMARSQPLDKQLLVLMLMTRGEVVAV
                     TGDGTNDAPALRLANVGFVMRSGTDIAVKSADIVLLDDNFRSVQRAVVWGRCVNDNIR
                     KFLQLQLTVNYVSVALTFIGSLMAGGHSSPLTTVQLLWVNLIMDTLAALALATEEPSE
                     ECLKRQPIHRKAPLVSRRMHMTITLIAVYHLVLALVLQEFGYRWFGLERYSREHSTII
                     FNVFVFGALFQMFNCRKLYDEVDFFEGFERSKLFVFVMCFCVVFQIIAVQAFGGFMDV
                     CRLRFSEWTATIMLTFATIPLGMVSRLIPVEEAHFERELDAENIDEDARQFLVKLAKD
                     VERTADERAGRSGEALNKAKRARVLSLWYRAYAEHVGTLRVVNAFRRAHFDRDMTSEL
                     SRNVYRQMVELTSPNP"
     gene            <295200..>296207
                     /locus_tag="LMJF_07_0640"
                     /db_xref="GeneID:5649223"
     mRNA            <295200..>296207
                     /locus_tag="LMJF_07_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680919.1"
                     /db_xref="GeneID:5649223"
     CDS             295200..296207
                     /locus_tag="LMJF_07_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649223"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM7"
                     /translation="MYAGFPRLNVTEAQETVDLDFELTNEKGCVKVTEFPVPKVVNLS
                     FPAVCALLYNARTATSSRNIFGSVIGLQLQDTVEVTDVKTNPSIDIEEDDRMTEEERM
                     ERVRKERKLLDADKAIFENMYNQENLDTNVIGQFVVSSARFNPFSTRTMRKLQELHRE
                     SLPAILLTYDPFRTGLLGRPHIRAYTPTAAYYKYDSLVSTERGYQRRRSLAQYAKESG
                     ITKEGVLHEIPVKLEVDAFHKLNLMNVPPTAVGDSFKAIQSMAVSNYIEALLSSIRNN
                     TDQLKQKLDYEGNVKDNGNVPVGQDAETMLLMKHVRDQTDHLDALCDSALLYSSLLRD
                     L"
     gene            <297892..>301251
                     /locus_tag="LMJF_07_0650"
                     /db_xref="GeneID:5649224"
     mRNA            <297892..>301251
                     /locus_tag="LMJF_07_0650"
                     /product="putative vacuolar-type Ca2+-ATPase"
                     /transcript_id="XM_001680920.1"
                     /db_xref="GeneID:5649224"
     CDS             297892..301251
                     /locus_tag="LMJF_07_0650"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /product="putative vacuolar-type Ca2+-ATPase"
                     /protein_id="XP_001680972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649224"
                     /db_xref="GOA:Q4QIM6"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM6"
                     /translation="MRASAMEDHHAPVPLSEATGTSRSYGTYTYDVHEFDRMRKEDLA
                     SSVRRRFTKRSHTVITGSENFGAGLQDSLEDIFARANEAVPMYEKLGKVEGIANTLHT
                     SLKSGVDGNTVEARRVFFGKNALPEEPPLTFWEMYKASWEDRMIRLLAVAAIVSLILG
                     LTVPDPGETEVNYTTGWIEGFAIICSVIIVTTVSSVNDYNKEKRFHKLTEENSAQPVR
                     VRRGGKDVTIDVTEIVVGDIVSLSPGLVVPVDGFYVTGMSVVIDESSVTGENDPKKKS
                     ASAPIILTGTVVNTAEDAYMLACAVGERSFGGKLLMESRGAGTPRPTPLQERLDELAD
                     LIGRIGLGAAMLLFALLSLMEGFRMLQHDPGASYRHFLDYFLLCIAIIVVAVPEGLPL
                     AVTIALAYSQNKMHDDNNQVRRLRACETMGNATQICSDKTGTLTQNLMSVVQGYVGMQ
                     HFSVKRPGDLPEPVPLSGMRAISLRQLSEGIAINSSSEKVVSTTDKEGHTAAPYWQWV
                     ADKGNKTDNALLDFVDRVAMTEADARDMGSRPHQRIREACRQRGFTIFPFTSDRKRMS
                     AVVRQEDGTLVHHVKGGSDRILPLCDRYVNEAGDEVPMTDEARARIAQQVKKLADMAN
                     RTIGVAYAVLGGTELPEDEPTESLVWLSLLGIQDPLRPEVADAVMKCQAAGVTVRMCT
                     GDNIDTAVAISRQCGIFNPYYGDLAMTGQDFRNLVYDAYGDEERMAKFWPVLDHMTVM
                     ARSQPLDKQLLVLMLMTRGEVVAVTGDGTNDAPALRLANVGFVMRSGTDIAVKSADIV
                     LLDDNFRSVQRAVVWGRCVNDNIRKFLQLQLTVNYVSVALTFIGSLMAGGHSSPLTTV
                     QLLWVNLIMDTLAALALATEEPSEECLKRQPIHRKAPLVSCRMHMTIFSVAAYMLVLT
                     LSLQAYAHVWFKAVPLDGVEHSTIIFNVFVLCSVMHMLNCRKLYDELNVLEGICSRSA
                     LCISVISFCFLFQIIAVQAFGGFMKVTALRSEEWVVCVILATGVLFIGFVSRLIPVCE
                     PQFEKTFDGSMLDEDAKAMLARLDSAVTKAQAATDEYKEGIYLERARRLRARALWSEA
                     RHHHLNVSRVVNAFRRRRAERIEEGSLLSVM"
     gene            <307492..>309045
                     /locus_tag="LMJF_07_0660"
                     /db_xref="GeneID:5649225"
     mRNA            <307492..>309045
                     /locus_tag="LMJF_07_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680921.1"
                     /db_xref="GeneID:5649225"
     CDS             307492..309045
                     /locus_tag="LMJF_07_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649225"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM5"
                     /translation="MFLRIRGKGSCPENSQALVMHIRGFRHTHSPPPSDFYYSVLLLP
                     PSSESASSAADAAASTETLAARPTKVMQPFRFPLFPVGIQAAALTALQAQSITQSPAT
                     NSGEASGDATTAAAAPPLSPMETLDKEVARMLWRETWNLYDILYDEVPLLPWVETAGD
                     EAAAALVETVERELRELASSDATAATATALHSLASLADKIDNFKLASARMGNRQVVVC
                     PHYYSSAALPRSSFGGMGRHCASESVAPQSATSPMSMEGPVVVLDLADLPIAQAGGKT
                     MVNIAWYTAFAGIQPDSVLLHCRAVVVRLPYTSVPTYMQACGRCVSPTSSAAAAPTMA
                     DAFREMVDFVGEHMAAVYQGMLLTLQATSPELAAKHTAAPPVVVVGSTLAALSGCLGS
                     LFGISASPNIDKSDPVKVVVLYGDHLGTAAAGSTDTSGEHDAAEACSAHMLAQYKSVA
                     EAYNYPMTFETVRVPLKALLDGEEEPWDEYTLRERGRLNFCPCCGDCCNDNKDHADGR
                     VHVHGHGDG"
     gene            <310314..>310814
                     /locus_tag="LMJF_07_0670"
                     /db_xref="GeneID:5649226"
     mRNA            <310314..>310814
                     /locus_tag="LMJF_07_0670"
                     /product="putative Qa-SNARE protein"
                     /transcript_id="XM_001680922.1"
                     /db_xref="GeneID:5649226"
     CDS             310314..310814
                     /locus_tag="LMJF_07_0670"
                     /codon_start=1
                     /product="putative Qa-SNARE protein"
                     /protein_id="XP_001680974.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649226"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM4"
                     /translation="MRAEVKAKPGGGNESTLIEHMKASVQPSTAAAAEVQRAPQNAAA
                     SNLQSGYSGIGSGPSAAVPPANSAVISSTAQKTRENIERALRMNEATNNSGYATLQSL
                     GKQREVIQNSLDTVDSTHQHLSDSRQVIRDIRVGVYKEWLIKGCVISFLVLLIVIIIY
                     SKFIRK"
     gene            <311980..>312552
                     /locus_tag="LMJF_07_0680"
                     /db_xref="GeneID:5649227"
     mRNA            <311980..>312552
                     /locus_tag="LMJF_07_0680"
                     /product="putative 40S ribosomal protein S9"
                     /transcript_id="XM_001680923.1"
                     /db_xref="GeneID:5649227"
     CDS             311980..312552
                     /locus_tag="LMJF_07_0680"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S9"
                     /protein_id="XP_001680975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649227"
                     /db_xref="GOA:Q4QIM3"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM3"
                     /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRV
                     NMTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPD
                     ILERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADA
                     SPFGNGRTGRVKRVRAKAAKRHAGGGDDDE"
     gene            <315092..>320158
                     /locus_tag="LMJF_07_0690"
                     /db_xref="GeneID:5649228"
     mRNA            <315092..>320158
                     /locus_tag="LMJF_07_0690"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680924.1"
                     /db_xref="GeneID:5649228"
     CDS             315092..320158
                     /locus_tag="LMJF_07_0690"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649228"
                     /db_xref="GOA:Q4QIM2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM2"
                     /translation="MAQPPSLAPATDTAVDAGARSGNRDMRFAQCSAPPLQMAHDSAA
                     EFHDRCATPAASAAPSPPPPESPKALLSNYYDLEPYARRGLAGGAHGWKRVFGLLKPE
                     MRRRSGRDEACAEDGGAAAAGMSGRRAPGSLTRTYDGSRVTTIDSPALLRESPGAIVP
                     TTAAASTRSPTRRASTAESVYRSSVVKGDVSVHSSVSGSPVATGKPRTVRWYGDDQKL
                     FSVAAASSASASTPAQPLHPPRLSVSPVAGAPSPPSRFLNSFFFPVLQHLSFCVSRSV
                     GSGPGDSTTTGEATSGTTGSGVHTASTTNTFATSAALAVAQRNLQRDISNLVATTASV
                     RLGASASSAFPGSHIHTARCSAVSSVAVSPRVGAAGSCKLQQQHEGVTAAASSSSLAV
                     LHAGSSPICGQCRTGVVVEDEEGAAQHVAGSHVRFLSAEKQQPGMRGSLRRQSADACR
                     QTPASSQKRDPSATWSGAGPCKPSIRESAQERRMPPHPAPCAAATAAGATADSGAAPV
                     PPEASSTEAPNAASTESAGKPASSPTVAHRCTIAEQLAVLTSRREQQHRYTQQLQASR
                     RSAGLGAGAVNALPSPLATLSSPAYTGAVAASTAMNFSSAELSRKTGGMRSPFPWASQ
                     YYTDTASGVFYSSVLQPHHYENHVYSDVTTEVQQCRRRCQLDRVPSLGAGVTAASKAG
                     AKDEDVGHETHTATSMATGAGAATAASTRRSMERPAAESSLTAGLQPAAARKVSVSAG
                     TAVLTSGVGNVAPLSHSKPAQPSNERRVDDLTVKYREDGSASYTISLTYHDSETGTSR
                     TVNTSALPPLRRCDAGASIPGLSSLSGGTTARAAARTTRPTTTATLASSAPGAASLAH
                     SRSVSGGEAAHAFAVNSPPARPAAATTTGKSLTHSQPHQASDAEDNDNASTMLGLAQA
                     ARTGGGRPRPARRSSISVGGSLKHCSSPAAGATAAGSGTSSPTCDAAAAATTTTSGKI
                     NPFAAPLPPTEPPHGPRLRGVAGRSGEMAIGAFLGGGACGKVYECLNTETGQVLAAKQ
                     IVFDAKDRKLRTRLKQLELELEVLTLAARHHVRWIVGFFGAEKRGHSVLMYLEYCQHG
                     SLLDYMVEGNSTDAAVWNASSAPDDATPQPSTASAGRSAGCHFGAAGSPPVAAVEVWR
                     RHTESVNEDASYLSTCSPLQGLREVRESHTEAAAALKTNSPKQQRQQAADDGSAAAGH
                     VQRAGAEATEATGHASPQVRRHREESVEDEEYPARRGGGCLSAAAASVSSAASSVALS
                     SSALDMMPLSEALHPQMPSLSIEQAQCFTKQIVDGLCFLHQHNYAHLDVKTANVLVAA
                     VDECRLADLGCAMRIQPPPPGSPRQQQQGLAGMDKAVRGGANGDLDDVLSPPRYPVLV
                     DRDAITELRGTALYMAPEMIRFESHAIGSPADVWSLGCVVMEMTTGCAPWRHIAKDKL
                     RVLYRIGSARDELPLPPLIRAWAEEAREWLAQEGLPATADAEKQQDEVAACAMEAGGA
                     AQAPRNPSASKADREVSRVDRDSGVVGGDLDNTVSDALDEPCSQRRRVDHGTYGDDGR
                     CVAESAVDRACQHDPPPSSVGDTSCSGCEVAATPRSSLVLTAKMPASVRTPATSTRGG
                     TSSSSFARAASATTAGLQLGGSNAADEVRLFREQRHVMRLYVALQDFVAACVRVRPED
                     RSSAAELLRHPFLTLCKDDV"
     gene            <322168..>324918
                     /locus_tag="LMJF_07_0700"
                     /db_xref="GeneID:5649229"
     mRNA            <322168..>324918
                     /locus_tag="LMJF_07_0700"
                     /product="topoisomerase-related function protein-like
                     protein"
                     /transcript_id="XM_001680925.1"
                     /db_xref="GeneID:5649229"
     CDS             322168..324918
                     /locus_tag="LMJF_07_0700"
                     /codon_start=1
                     /product="topoisomerase-related function protein-like
                     protein"
                     /protein_id="XP_001680977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649229"
                     /db_xref="GOA:Q4QIM1"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM1"
                     /translation="MKRRGGRVVSSKSTVVGASSAAVTPEAPGLSAAVNGHDASVAAA
                     ATAAAAASLSPSVTSPATPVARDEPRSSGNPVGSASAAVMDVPTPTLTIPTLDIFARF
                     QSKRGDFDEDWLLLQEDPSARDETPRIAAHVADKLRRHQAQLGAHRAAAAADRSRQDK
                     DRVVPVRVAAKTVSSVSGDSLDTVATEGPRQARRQRRPETYDSAEDSGSDGAGADADI
                     GTVAADYDGDDSDEYVPEDRTASQYKRPKNTKKAAAKDEGSAGVALSGGSPSVSTPVE
                     RTAAAAAEAASVNPLTRLSEGGEQLDVEAEHEGLTGDYLNFRLTSATGSRALDADALQ
                     ATVHLQPSVSRGEKRNVHDRRSSRSQEQRRQTPPSPQQMEQDCVLVVPLWSITRMEQH
                     GGYCSASPLIALHQEVTDLVDYLRPTEAEVTMRRYIEKDIGRLADRLWPGSSVLVYGS
                     MYTHLLLPLSDLDITLLDVPVSAEEALTSLAKEISSAGMCENVYPQVILKTKVPLIKF
                     VHKGSLIDVDISVGAVDGKRNSECIVQYMNMYPEALPLTLVVKYFVMQRGMHEPYYGG
                     LGSYAATLLVVAFLRQHPIYTTQPEKRTMTGLGRLLVDFFRMCGQHWNYRRVAVCLTN
                     YAVPSNADDAMAVDVHDEGDFRIRADCGGRMQSPVLASPPRGPMGPAQVWIEDPVDAS
                     NNAASSLRFFHSLSAMFSYAYLALTADFDRAAADAGRPSSPAPSSPAPSSSPSSNDIS
                     RRPTLLSRIFHADAEMVYRRRAVAAAYKRLSAEVPAYMKEVQDFRRDEDVAMLQGNGD
                     GVAHSWRARRLRRREGDPVPFPQQRRVTSLEERLVLSQLRESSSPPPPASEVGTKRRQ
                     REAEDEMSRRKVQRNRRQDTVLPSRSSSPSSSCTTGSESHASSVRVDVSRRTERSRKL
                     RQ"
     gene            <325874..>326437
                     /locus_tag="LMJF_07_0710"
                     /db_xref="GeneID:5649230"
     mRNA            <325874..>326437
                     /locus_tag="LMJF_07_0710"
                     /product="putative centrin"
                     /transcript_id="XM_001680926.1"
                     /db_xref="GeneID:5649230"
     CDS             325874..326437
                     /locus_tag="LMJF_07_0710"
                     /codon_start=1
                     /product="putative centrin"
                     /protein_id="XP_001680978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649230"
                     /db_xref="GOA:Q4QIM0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QIM0"
                     /translation="MSIASNTPLRPSTSASNANTELSKDQLEEIREAFDLFDTDGSGT
                     IDVRELRVAMRALGFEPRKEELQQLINSVTGGSGYEATTTRLPSAGNVNASSDVITFS
                     QFVQIMKHKVSQRDSREEMLKAFVLFDTEGTGKISFQNLKRVAVELGENMTDAELQEM
                     IDEADRDGDGEVSEEEFLRLMKKTSLY"
     gene            <327887..>329662
                     /locus_tag="LMJF_07_0715"
                     /db_xref="GeneID:12982577"
     mRNA            <327887..>329662
                     /locus_tag="LMJF_07_0715"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721729.1"
                     /db_xref="GeneID:12982577"
     CDS             327887..329662
                     /locus_tag="LMJF_07_0715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0715"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982577"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ2"
                     /translation="MESASDACREQVRRIQAALLRLGWHQRTGDRGAFLNTPVHSTAN
                     PSDPLTASPVVTMQSALATAEARAGGEAAEVTSPPKSIARAPPTSAPPGVLGDHDVNW
                     SACERCRDCLMSPPASRGAVHGSTRLCLQALQRHHNSSARAAAPSIHRTTKPHTFVRV
                     VCDGERGSAPAAADVLACPSSDSLPLPSAGRVAVAHAFDDLIARAWGRAEVATAGGAG
                     GVGGGCTTTTAPHSGVGRHWGCEGCAAPPDAAPSCTAEVRPPAASPGRAATPSDVSAS
                     VSSMLPFTATQPPPSTQLHDDGRSSRYQTSRLGAPTTRIASLVGADAASCFSTRVDLS
                     KDALYAEVCPSATASHALPPPPSPRHALAASQLQRRMLRAVQLLDAALHSSSDGSSGG
                     AATRRLDNLHQILMTLTDSCGQPLALPSRATGAALRRLRKRLVQELLLGNQAPGMLRR
                     SSTSSRMPSRPSRSPARHAAIHDGLEGIRDEANARSGGTFSLENVADDVRRANPPPFP
                     ASDASSVCFAGTRSDMPAPTAVAAPPPALPPSPPPSSALDPYTESQQRFQHEVATLHQ
                     AQQRRLQLQRQRTHALESTRASVQR"
     gene            <331014..>334787
                     /locus_tag="LMJF_07_0720"
                     /db_xref="GeneID:5649231"
     mRNA            <331014..>334787
                     /locus_tag="LMJF_07_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680927.1"
                     /db_xref="GeneID:5649231"
     CDS             331014..334787
                     /locus_tag="LMJF_07_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649231"
                     /db_xref="GOA:Q4QIL9"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL9"
                     /translation="MQTSNPLYTADELCTIIATILHGADNAERRRNEADLTTALQQPP
                     NVGHLVTILCGTPDGTPPTAPAGVRQMAAVLLRKRIFSLWRVLTTEQQHQLRHLLLQR
                     LGDEPTRPVRFAIAHVVTRLAKADANRGGDGWPELQHAIRAAAHDTRVEMRELAMVLL
                     YSFGEVFAEENALSGLAAESVVRGLGDSETVVQAAAVKAAMVLLPTLHEHPAVRNAFL
                     AHLVPTCIGLLESGAATEAKVPLCVSVLDLFEQLFDDLPVKKYGALVQDVAQALMRLM
                     ANPQHHPRVRENCGTALGQLATLKPKFVAAPALLEPLVQVCLGLMSEDNTISISDQGS
                     GGVDDEDLDDSDDDVDMLHVTSACMVGCQLLSALATTVPSKAFTAVLLPYISRVTDAP
                     ASVDARTRKATMIALACLAEGHASYLRRRVGYVLTVTHGFLCDADPAPREAAAFALSS
                     FCGHLQPEILLHHEKLLPMVVPLLEDTSDLVRRRVAQALDTLCENLQENLDRYVPTLL
                     PAVMAAIPISSLETQCRLCGVLSSMGMAHSAAFASRGPELLEVLRQPFGLKTPETMAL
                     RAQATETVGVIGSAMGRAAFAEYYPFFMQEVVANLQTRHAAVREQSFGFLANMCELFR
                     EDFAPYLNDSIHCALETITEDRAVYKNKHPLASDGSGDALAAFAAWKDNGGDDDESDE
                     DGGDDAEEIHLRVRTADVEEKSSAVYCVGVFADVMMGQLGEAQTAACWEALTGLDSHY
                     YPNIRSNALIALAKLAKASAGLPAKAMQARSRAAIVAGRTGAADSSGSLVQDVLPLSV
                     RDRIDELLNLLLRTIEEEDAENEVVGAACEAVSIVMDYFGTQCTIDGPDAVMRDVVQL
                     LRGTMPCQRRGNELDDDECSEDDGADNMSYEQYQQLRQQRGDSTSADRAHYLQGKDPF
                     FRRADEAAEAQASAIMAAMAQHQQNGDAAAPPSSQLPSAAALPPWYRLVAPEMVKHGV
                     HLPEDHDGVILDAAAEMLESVAKAYGALLQPYMPYLVPLLAMHADVGTRPPEGLVTAV
                     GTLATVLQAYGSVDANGDGAASPASEQLLAPFVEAAAQLSFSVMAGSDESTARANSAY
                     LLRILVEGCPSFFTQQPAVVPQCFQALWSVVGNEEDEIPEAVDNAVSATCSFVRCLPL
                     PLLPIAQVIPPLMAHLPMKIDKAENPNAVRTLCYLLGNDHAASTAAVSSWLPSVVGAV
                     ANVLAAATVEDADKQRLVQQGASVFAQAHPQAWRQQQQGLSDGQRAVLQAWQL"
     gene            <335864..>338245
                     /locus_tag="LMJF_07_0730"
                     /db_xref="GeneID:5649232"
     mRNA            <335864..>338245
                     /locus_tag="LMJF_07_0730"
                     /product="malonyl-coa decarboxylase-like protein"
                     /transcript_id="XM_001680928.1"
                     /db_xref="GeneID:5649232"
     CDS             335864..338245
                     /locus_tag="LMJF_07_0730"
                     /EC_number="4.1.1.9"
                     /codon_start=1
                     /product="malonyl-coa decarboxylase-like protein"
                     /protein_id="XP_001680980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649232"
                     /db_xref="GOA:Q4QIL8"
                     /db_xref="InterPro:IPR007956"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL8"
                     /translation="MRCVYRPASGTSGSAAATASSGTTLSAGTLAYALRHFSAPTRLW
                     RSEPPPPPLPPLPGAGATVSEERVARWCRRLWDLTRKSTGSVASAHLTPQLQLAAHRA
                     AAALLSSSSSSPFTAPPQIDDDGEVTGEVVLSSLRRAIRSDQGRIPGVIVESVWAAFD
                     VLVPPIVQENVTEDSITPATGDNFFMFISTLNELNFDLHAVAKASTQLTAKVDAYVGL
                     LRQAEAHETQRATTAEARGPAQVAIDGCELMEQLMKAKGEVVQCCFEARNAGSPLYYT
                     WLWHTAAMPDGLRRLMHFRKLTHFFESLCKRHIKHLTEQQQQQWQSMLSSSAPATGES
                     AGTLPSAAAASATEKSRCAGELSKWRSRLIEVGLIDGAMSLLLNDLFSKEYLVMEELT
                     WLLTPPSMLDQIMRAESVHPFVRGLEDMRHRLQPAHHRHLFAFLHPAVVEEPLIAVQV
                     ALTHGIASSVDQILGRPTPLSDPANTSKAALYFRHALESSAAVDCAGAAEDGNVNTAI
                     FYSINSAQSALRGMDMGNRLIKRVVQEVEGNINARRQARSLTPIHTFSTLSPIPLYVK
                     WLADEVAALAAAAATATAMAASGIFGKQLSTTEEDTRYLGPLREAIAGYVLRHPDVLP
                     AEARAVMSAAATSSRGNHTAANVAALQYLVRLLQDASSPPSFPRDGLATFAAGSTSTQ
                     RHQQPWWADHTLTMALEAPLLHSVATYLCTVKRSGDGRIRDPVGNFHVSNGATVYRLN
                     FLANTTPKASRESACIMVNYWYDLPTVSANAARYEVSRTVPLGEPIKTLLGDM"
     gene            <341164..>352482
                     /locus_tag="LMJF_07_0740"
                     /db_xref="GeneID:5649233"
     mRNA            <341164..>352482
                     /locus_tag="LMJF_07_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680929.1"
                     /db_xref="GeneID:5649233"
     CDS             341164..352482
                     /locus_tag="LMJF_07_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649233"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL7"
                     /translation="MRLHDVATASVSGRQSGQQDAPARPSAAGAALAVTPLARSLPSP
                     RSRCATSATPPLPLPPPLVRPAKKAVAVGGHGCSTNGVVGGALLFRDWSTNAALLDEV
                     LNTPFFQLLPKSTENTVAPSAAAHDPALQSVTLPTSDTPLPSILLIALADIEVLQQSF
                     CAHTLVNPVKNQLSEFKRLVAASMRSELTHRHEPPHTENLAAEAQPAAAVAEDVHAGH
                     NAVDGEGEKTAGAAMHDDDSADDSALIVSSLQAHDAAVRAALRTAHGFLYGSETVPVG
                     VPVVHLERARREWLTRYRIMHVQPHLQKAQRRRYEAWAQQHPQIQGFTDGSADDAAHQ
                     HGASASQSAMTPVSMCAALQPTYWRTITMERPSAGLTTTHPGTANMPPAEVGEAAGGS
                     SVVPPPTRRLWSSSSAHSASPLHALSPAKTTAVPVLYKAAWDVDLYDDLGLAVSAEQL
                     DIMVRQATSRTAVEAMELEELASQFSTTAANASFASPTEPSAPPPLIRAADLTQMQLT
                     LPVFVYVVSRYLFVAHYAAYFPTGLFSRALIDPFYFPDAAQCAPEYALRAAPALRREM
                     RRVYASYAAKLADAHRCFPDRTRSTEVPLPPNDMFHLWELLCPPQRQDVAGRWNPIPW
                     GQLMPEEEEALLDEEFKSVAHAGQDAVDKHVSHEEPLLSYPYARAARLTYRQRLQQLA
                     QHPLLLAEVHRLLSQCEDVAMQFFTMIDMEQKGCITWEAFTNALIEEADVQDHQRKVR
                     ERAAHLTRTSASVFDRYVVEPLPSTLARLGYTGNVLEVRHSASLVMLEGANDYAVCDG
                     TQLGSIHQRFLVRPMEVLCKELEEEPHDAFGRLIRGLRGDRGGGGGDGEIYRRRAHSN
                     TDADGYDAALRQRPWRNNQQPLRVYVRYEDGRRLQESTALNMLQQLSPSKARAVTAAG
                     RGTVDDHEGAFTSMRAHQPAKLVSLEGILVVENVSPCVPYPVFVTRGNDMLLRLYGAS
                     RAVQALPEAGVLRCTKTVSSMEWAAGGRRARRSSVSSTGTTSNSAASRSAGVHGDGRE
                     LQGRRSGNPAQGDRTLSPAVAPLSPHQRTHHDRISVQREEYLLLGTRDGTILLVDLYA
                     LLNHVPRLAMPADTHSGSTVEGVSNSAAGDGTGDVGGNGGAASTMGAAFSVMQSTSER
                     IGSSESAWSGYRDLARRTYYGDIGAFVVHTRQVHTPGTLVSSVVAAATNGLVVSSGLD
                     GDVFTMRLAYPFSWITAAGTQRTPSGVAAGVGPATADTSRPLVCIEVLHRMRVSDTGV
                     RYALPIPFLSMLAVQTASNKVYLYHTSVLPTASALVDGGRSDAASTQVSPAPLSTPRA
                     VPEGVEVAADGGFSLVPAASSATSPRLELYDAAAPHLGSIVAMILVKELDQLITVDSS
                     GYVKVWSLRQTQPLTSFYAWAPLNIPNSGSGVGDAGRLTGWSSSQGSGAAHRGNGHGS
                     SMSAGGVPTSSSALLRTTKNSIEVAVDAAEYRLQPCRSAAFNYTGRQLFVMGSHNAAH
                     CFFVSGQSSSRAHTQPLRVLLVDTATVSRVGGVNHRLISLSSADCRVWSLLTGTMELG
                     IRANSAEYRHLFNNRLTGNVRGRSSSIAKSVEQQRLSRKGGRGCRSRGARPRSSYRTR
                     TYNAHDALVLAAASSSTTTGEPQRLLPPSVDDVMRAVLARPWSTHSYSRHHDAPWRAA
                     GAAAGPRREAAVAAATASLPLLTAGKQPHGSAEAPGNSGGTGGGAEDDTDELVTNVMR
                     DQNLLLSDIRCACLGPGGEWVGYALLHGDVRLHRSDSGRLLHTFITTPPSTEDLIEAA
                     MQYQHLFTPVTAAYALPPLHPVTVGDAAAAASNMPAGMNTAYGGGGGASGSLTTVVPP
                     SQSPTARLPPIAYAKAVALVLERLLATTIGVTCGPTGAAPASAPSADGDDRLGRNVHR
                     EPLHMLYLDASQELLVAYADGLLRSFTLLSHSSTATRVIVSRTLMNRALTQVRHALAW
                     NSRHAGAARPATAAGTEVPGRRSASLNASLSVLPPKELLTAGSLRGVGIGDAEAIEDH
                     NSLVATDRNSVPPSRVACSEGAGGGPTVRLNNADAAEVMPAASPANIARAVMVSLSTR
                     QIEPDVVLLATASSPLGLICLVHASGLVTVLDVQSRSETDGAARMRMMLSDADDVKGG
                     VGGGCAEQKPESGRGRAEAGVVVHSFMTTDEVTAAMFLGAYPCLVLADRQHQLSFHLM
                     KGSSLLALLGEFAEQLEKDVMACAAGLREQAEPEASVSATAKLSLTALRSTSSYTAAA
                     SSPRLPPTGRVETGAERGSNPTATSSTLVWTFSVADTCASQRSLGYITALTFDALYAT
                     VYVGTSQGYIVSYLVRRFVMAFQLTPVFLRGVDGVAVSTYAAELQRALAAARPGASPC
                     NNPSRDFLHNYLRVVFDVPPSVATQATETRLRSPRKRHVSLTGNPSTAATPASQSPKE
                     LGGLIDVYKCRRDLFHVSWRGVTGKRRGGGGSGMYAAAPSQAISICTSSEALIAAAVL
                     HDAVTRMTTVASACGTAAEACPGTTATPDETQPWWCTPAGRTVKEYVTRKCRGDAARG
                     GMGESTGAANASPADLGELELGAEGVQLLRGWVAAVLAEQRRYLPRNTSDAEAVSEAR
                     QQRQQESFSTTPVGTQGGVSRTSSSRSRSSSGLTAVPPVLTSACGHDVFTSGVSHAGA
                     DQGAAADAVGGGAATAASQTATAQQLAEALVQEVQEELLFGKEAPATVAAAHYGYGPM
                     SELTTPAATPQHPITDSWVELLFTRQAMCTTSRSPLCLLTPPAMLERARRERQDRRGR
                     MAATAAAAAGNAAGDAPAIPEWNAYVEGALPDYLADILSHPSQVLTEVERQALQQRSI
                     TVLQCRRNGYLCVGHADGGVTLWTPYACARLESLCPSTSLAATLDRLAASVKTQFHCL
                     HERILLERQRLAFEGSLRNSRHTEEERVACMKRRIRAMLLEHHLAQLQLERTEGEGEG
                     DADALAGRAQETEPPSMFSTSAKSALNPRKRSTPNARRHSSRAAVAKAQGLEKCSTST
                     QPFVCGSMEAELLAMRPLLCLLLGVSSPAELRARQLSLEDLFFLPFKARNLASLEAFN
                     PHSYDVAVAVAMRRLRRDLIEEAEEYATEEPGGNPQLLPDALTAAVTQAVSTASHTVT
                     SPASPVSLSGSAGHLQRKRQESVYDYRLSSLARAWHDGADRPQKGQSSDASGAATFPG
                     VLRLLLHRAMERAPYLSNGAVAATSPLTAASAAAPVNAGKMEIAHGTAAHAAGAQSPS
                     PTPAAIADGTAPADGEYYEVCHVLQVAEVQAESKWEVEELGRAWRRLQASTVAATAFS
                     TTARWNSGRDRADVCDSPPAQLPLSSAAAVSAAVDRQVKRGLEARIVALSHRAVAAAL
                     LRNVQLCCRSAHTRAALVPPPLHPGDGASGAYSAWPPTTSRRGGGLAWVQSVLRQQVQ
                     QAFTEPLLTWLQLASSSVSHAVIPIRYGSTWIYGQQRSPALAATAMPVLSGEEGLLPS
                     PTNAPLQALCHTSSTPGGGGGDGDPHAAPAEGCRENKKAFLTEVPGDANGAGAAVGSS
                     LCPPERVGFGASGHTAVTGGTDRRAGQRSLSSRLSSTADRPSLGDVGMALSSKDSRSP
                     LPSPLPPLKSTRASTISGHRLGSLGVHDARAMIADRGNRAASAMGDTASLISRSLSST
                     SSLSMTSIPPNATLSSPAVYPTPQVRQRLLTSSALHRTKLAHTGSCGGAPHQQRPVTT
                     GVTGRGGAAGNYTVVTNTLHAAAARTTVPPATSTGYGGGRRGGAGGGGGTRGSRAAAV
                     QPFTYYSLFGQAGTTK"
     gene            <353839..>354255
                     /locus_tag="LMJF_07_0743"
                     /db_xref="GeneID:5649234"
     mRNA            <353839..>354255
                     /locus_tag="LMJF_07_0743"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680930.1"
                     /db_xref="GeneID:5649234"
     CDS             353839..354255
                     /locus_tag="LMJF_07_0743"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0743"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0743"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649234"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL6"
                     /translation="MDALSMRQQQSHVHQTDNLVPTRTAVLHLRPAPTAEEAERAQRQ
                     HDMRVTWNPDVREPVDQHVSKCCCVFHKKKLFGESSSDSSSSSTDSSDDDADSAGGVG
                     HQGGCGYDCQHAHHHPPRKQRPKCTKEHCYCGTRFH"
     gene            355648..356675
                     /locus_tag="LMJF_07_0745"
                     /pseudo
                     /db_xref="GeneID:12982573"
     misc_feature    355648..356675
                     /locus_tag="LMJF_07_0745"
                     /pseudo
                     /db_xref="GeneID:12982573"
     gene            <358538..>359425
                     /locus_tag="LMJF_07_0750"
                     /db_xref="GeneID:5649236"
     mRNA            <358538..>359425
                     /locus_tag="LMJF_07_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680932.1"
                     /db_xref="GeneID:5649236"
     CDS             358538..359425
                     /locus_tag="LMJF_07_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649236"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL4"
                     /translation="MRLGTEAYQLLRRIPYGVRQHILRGEGQSGGVGVRGRFRGPHDA
                     NFTFTAEEYAKVQRIYQGDRHRRRRHRGGRDKSGGADDGNGDGDEALFDARTEEGRRR
                     IARLNEFQTRVVEMRRRGIRDDLPPWRVYENDKGADTAGDSRSASTSGGNAGDGHQER
                     HGSRAGGTGLRNTNRLGLHFFNVTTASLREVRDLYRSRPGFAGMDGSSYDNPHSAARV
                     APEISTNPHLHQYILMKSRAQEKAIVDRAVGRPLLLFLLLASLSAAMVMMAATVRSYR
                     VRMQKDEDLRRRDEERGGA"
     gene            <360859..>364584
                     /locus_tag="LMJF_07_0760"
                     /db_xref="GeneID:5649237"
     mRNA            <360859..>364584
                     /locus_tag="LMJF_07_0760"
                     /product="putative
                     6-phosphofructo-2-kinase/fructose-2,6-biphosphatase"
                     /transcript_id="XM_001680933.1"
                     /db_xref="GeneID:5649237"
     CDS             360859..364584
                     /locus_tag="LMJF_07_0760"
                     /codon_start=1
                     /product="putative
                     6-phosphofructo-2-kinase/fructose-2,6-biphosphatase"
                     /protein_id="XP_001680985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649237"
                     /db_xref="GOA:Q4QIL3"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL3"
                     /translation="MNAVVPRGATYPTARPAVDAEQDYQNLSSQAGDEPSRGDVATAA
                     VGRNGGLRRGSPQRQQRSVARLHADTVAAEDSAPCPHRAGCHHNHHHCHRAHRHTHHN
                     HPARARKAVAPTATTTTAAAPAADTHPRTFSQDLLLAQPSGTSDRSGSCGSSCPSSSS
                     SGSHSTCSYDTFTANCSSATSFISVQTPVSLIDTTYHTLFSPELSWLNREAIVEHIVG
                     HRPRAYHKWVWRKARDYQELHALSVHKNSVYQQLTTAAGRSVVMEARTGGMTAAHLHS
                     AFKVSPTASLTPPPGDAAGGASVGSGRASLEIPLQTAPSDPSSSPVAPVVGLADAREG
                     VSDAGRGAAAESLARTWTTAASPPTESPLGLHPLPSTGSSDKVAGGSRLPPISSSASS
                     DMPCELMSQLPMYTIPTSQQGPECFKTAAQGGTSTLIIVMMGLPARGKTFLAQKICRL
                     LRWHGSRAKMQNIQVAWRRMLLDWEAAHPEMAACSAHAEAEQAEEQEQEASAPAGEGS
                     VADEGPPGERGASHRIPRPIGMPADEGTSTASSQAAASIAPAPPAFTRSNSLADTNST
                     PVARNLATGSLNASARCAVTASLSSGSALTSSMPSARKTTAATATTVNAIFRAGYDYS
                     CTLSDTGVAAGPLTSANTSIVCLDCSASPVCPSMQAHTASSLEDSAAIPASDVASASS
                     LLSGTRHPANVVADVTANAPRGFLVRHSSTAAMSAETTSDSGGPRLEASAGESPCTTA
                     GVDSFPPPPPPPPEVLRTRHFRELIKRPASVARRLYRHVLQSFSEDCRLFFQHGGEVV
                     VLNDDFITEELRQEAEALFRPLATQFFYIEVIRDAEEDPLDFVRCKIRDPMEYPLSVI
                     DPASASDDFHERLAFLESVYETLTEAPNTKRNARQTPTARASGATASVDIADGLDAKA
                     SVERDTGLACPPTTSPESTHHRQQSTRTRGYVKIMNSSTIETHGISGYLASRIISYVM
                     NLSQVKIQHPIYFVLHGESYYNVEGRIGGNPPLTEQGMRDAVALLEFLGSLKRHLEHV
                     DRVQRAHHHNQQRLHSGAAGNDEGSSTATEASANTASTLEMWTSQLRRAIQTTELSER
                     LLNIRTLRWSSLNEIHAGVCEDMTYAEVKERYPLIDYFSKLNKYSFRYPEGESYQDLV
                     IRLEPVIMELENADKVVVVVAHQAVLRCLLAYFGSTSAESSIGVEVPHRTVWRCTYDS
                     KGIAILDELKLDSNEAGSHLPRREGSPTASAANTSST"
     gene            <368318..>369526
                     /locus_tag="LMJF_07_0770"
                     /db_xref="GeneID:5649238"
     mRNA            <368318..>369526
                     /locus_tag="LMJF_07_0770"
                     /product="DNAJ-domain transmembrane-like protein"
                     /transcript_id="XM_001680934.1"
                     /db_xref="GeneID:5649238"
     CDS             368318..369526
                     /locus_tag="LMJF_07_0770"
                     /codon_start=1
                     /product="DNAJ-domain transmembrane-like protein"
                     /protein_id="XP_001680986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649238"
                     /db_xref="GOA:Q4QIL2"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL2"
                     /translation="MKALEAAANTQSAATPLVLLASASPPCSCGTAQSIISGSAAASA
                     DSSSTGAAVTAPAGSLHTARRCYSSAASADSPTAATTAASATPQPESAASRVAADSAV
                     SKAGCSEHRPDEREGSAADSSSSVRERFTEEEKAKEDCETAAVPSFAEIYDAFRTLQL
                     IQDDGHVVREWTATHVKQAYRTLAKQLHPDVAGGDDELMEQVNTSYDLLMGLSAELAD
                     NYRMWLETGGEAELQLQRAHDQQDLLGSRWTSREVEQLMMVGWCATLSGFAMYAVWRA
                     LYGTSPVVNSVGGAATIGGSAVGGCSKVHCSINVAGVHPVATRLTFPRAGATVSTAAG
                     VQYGVVSIGNSALWMPPHLSFQMLQLVRTAVSRYALAVALTLAAWMNTVMLQRVLQRM
                     LIGGGGESAG"
     gene            <373134..>374033
                     /locus_tag="LMJF_07_0780"
                     /db_xref="GeneID:5649239"
     mRNA            <373134..>374033
                     /locus_tag="LMJF_07_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680935.1"
                     /db_xref="GeneID:5649239"
     CDS             373134..374033
                     /locus_tag="LMJF_07_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649239"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL1"
                     /translation="MYGQYYQQDANNAYHQAHSKGQHGYWNHFHNRGGSGGFAENPFT
                     SRSPFSMYAQVQRARFMPPGSLLIQGLVVYLVLSTMFLFAYRSYRDWRHDDGWRMSES
                     LARHEQMEELHRIRQEMHERARAMQRLDDEDAAAASYRSRQYVGESPTARAYEYARQR
                     RIQALQAQQETAANLPELRGWPKVGEDKGRIIKRAQDPSGIVFFEPRKEDSRRRQIEN
                     HRRGSDFARSSSSESPSPQLNEAARGPLCGAATASPLAADSSAPLPPEANVSSVVVKP
                     VGSEQEAQAVMRGIFGDLRKIVS"
     gene            <374789..>375667
                     /locus_tag="LMJF_07_0790"
                     /db_xref="GeneID:5649240"
     mRNA            <374789..>375667
                     /locus_tag="LMJF_07_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680936.1"
                     /db_xref="GeneID:5649240"
     CDS             374789..375667
                     /locus_tag="LMJF_07_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680988.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649240"
                     /db_xref="UniProtKB/TrEMBL:Q4QIL0"
                     /translation="MCTHLPLPPPPPQPQEQQANKRSLRNDTHAGQMLREQQQMMEQL
                     MSTGLVQAADLLEFGFSAAELRAAGLHLPPPHHRAGEQTKGGLEAAQAERMADAHGED
                     SRRRGVPRKRAWCDDAAQARPQKNERVAPSPVVSGAAATTLSAAETTREPQTVAKSVA
                     TPALLSEETRARSLHAAKLVEQTQSLRRHRGDQDCARWLCYDDTDDEEVSSTASTGTS
                     SGEATAALASMARAAETLPKARCNTALAFSGLDVAVVREIAQRLQDESGHDASVESRR
                     TREYVESRENGNTPYM"
     gene            <377170..>379182
                     /locus_tag="LMJF_07_0800"
                     /db_xref="GeneID:5649241"
     mRNA            <377170..>379182
                     /locus_tag="LMJF_07_0800"
                     /product="flavoprotein subunit-like protein"
                     /transcript_id="XM_001680937.1"
                     /db_xref="GeneID:5649241"
     CDS             377170..379182
                     /locus_tag="LMJF_07_0800"
                     /codon_start=1
                     /product="flavoprotein subunit-like protein"
                     /protein_id="XP_001680989.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649241"
                     /db_xref="GOA:Q4QIK9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK9"
                     /translation="MPPSQPPVEGGANRIIIVGGGLAGVCAAHASLQHGGSVLLLDKS
                     AFLGGNSTKASSGIAGTPTQAQIDAGVLDGVKLFTEDTNRSFHGVQAGEKPGPVSPLV
                     SEMARLSGPSLDWLVRYFNCDLSKLGFMGGHSRPRTHRGKERFPGMAITYALITALEA
                     VQKVDPARARILTKARVVRLVRHPLDGPVTGVVFQDREGNQHMERGAVVIATGGFAAD
                     FAQDDSSLIARFAPQLTKFSTTNADHATGDGIKIAEQAGAGLVDMDRIQVHPSGLVDP
                     RDPNNHVKFLCAEATRGAGGIVVDKHGQRFVDELARRDQVSAAMLKHDSASPFYLLLN
                     EKSAREMEWHCKHYVGRGLMKRYASGYEFCTATNTKPEALAATYEQYKKDAAVNAASR
                     GADSAAAGAAKRGFSLFGFGEKRAATGTAVAKDSSRGTPDQFGKTVFRNVDAFSMDGP
                     LYVAWIAPVVHYTMGGLHVNERAEVLDAKTKKPIPGLYCAGEAAGGVHGKNRLGGNSL
                     LDCVVYGRVAGEAATKYLLATYMGPFSNNRLNTIYSHLAIEDLPPVPKAAAPTKPAVA
                     PAASKEAHAGSDASPAAAVDGEKHKGLKRYTRAEVAKHNKESDCWCIVRGLVLNLTEF
                     LPDHPGGKQSVLMYAGGDATKEFDLVHQPEVIDKYTPDAIIGVVSD"
     gene            complement(381406..381477)
                     /locus_tag="LMJF_07_TRNAARG_01"
                     /db_xref="GeneID:12982574"
     tRNA            complement(381406..381477)
                     /locus_tag="LMJF_07_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12982574"
     gene            <381932..>382990
                     /locus_tag="LMJF_07_0802"
                     /db_xref="GeneID:5649243"
     mRNA            <381932..>382990
                     /locus_tag="LMJF_07_0802"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680938.1"
                     /db_xref="GeneID:5649243"
     CDS             381932..382990
                     /locus_tag="LMJF_07_0802"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0802"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0802"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649243"
                     /db_xref="GOA:Q4QIK8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK8"
                     /translation="MPLTMHSSPHYKFFVSGIARHVSGDVVEAYFRGYGSGVRLQLMR
                     DKDGLSLGYGWLTFESVDVERVVASQHELGGSPVMLRYQPGKKSPKSQPAASPPPPPP
                     SQPINVPTQQGRSQEYFPKHKRYREETFRPQVHTASRTAQIQTEIMPPKPQTLPGPQS
                     LPKESRQPETEPSPTPMPQTVPLQHQFSSSPQEPVAQPVFACIPLSICPGAFLHDPRV
                     FCCTLDPSQVGKLSILVTPTPHAALPNHHAEQAAYVVPGIPQQQHSTYASVNSKRVSP
                     QTPLSMPPLSSGPAPSPPPPPGPPPPHLTAPFRETVPPPPGPPPPPPPPGPPPTKSCS
                     SGIPLRFPPPPGPPPRRY"
     gene            <384022..>385815
                     /locus_tag="LMJF_07_0805"
                     /db_xref="GeneID:5649244"
     mRNA            <384022..>385815
                     /locus_tag="LMJF_07_0805"
                     /product="putative N-acetylglucosamine-phosphate mutase"
                     /transcript_id="XM_001680939.1"
                     /db_xref="GeneID:5649244"
     CDS             384022..385815
                     /locus_tag="LMJF_07_0805"
                     /EC_number="5.4.2.3"
                     /codon_start=1
                     /product="putative N-acetylglucosamine-phosphate mutase"
                     /protein_id="XP_001680991.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0805"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0805"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649244"
                     /db_xref="GOA:Q4QIK7"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK7"
                     /translation="MELEEMAASHPHAIFTSLFFDQLKSIIDSEFPLRHDPVKSPLTY
                     GTAGFRFKADLLPPVAARVSMIAALRSVYCQRKRAVEGHSVPCTVGVMVTASHNPYVD
                     NGFKIIDVDGGMLAESWEEWCTRAANASSGSDLARVMMDCLAHDPSVFQPKPYSYCQV
                     HFSRDTRPSGGEIVNAGLRTLHLLRNTTARSYPPVSTPCMHFAIAKANELGLADESES
                     PSYYNELLAGFEEMYRFAGSGFPSREKEGNPQQLVVDCANGIGSLMVKELINASRQQS
                     DFVALATFFELHQVDCNCQDETMLNTKCGADYAKQHATPSAAMSAWPSTCPPGVNPTT
                     AHFYSLDGDADRIVAFLYDPKRDSKWVLLDGDRISILYAMLLHKWLGEEQMRALDVAV
                     VQTAYANGASTEFLEKQLHMQVYTSATGVKNLHPIARARDVGIYFEANGHGTVLLSEK
                     VLAGAASAGPEKAALFAAMRRLMSQYCGDAIADMLMCEVALKALNLTFQDWADLYVDR
                     PCKQIKVTVAHRGRITNTPDERRALAPAGMQDEIDAAVSLALSRCEAARAFVRPSGTE
                     PVVRVYAEATDPSVCECLSAEVAKIVEAYCS"
     gene            <387327..>387518
                     /locus_tag="LMJF_07_0810"
                     /db_xref="GeneID:5649245"
     mRNA            <387327..>387518
                     /locus_tag="LMJF_07_0810"
                     /product="cytochrome b5-like protein"
                     /transcript_id="XM_001680940.1"
                     /db_xref="GeneID:5649245"
     CDS             387327..387518
                     /locus_tag="LMJF_07_0810"
                     /codon_start=1
                     /product="cytochrome b5-like protein"
                     /protein_id="XP_001680992.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649245"
                     /db_xref="GOA:Q4QIK6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK6"
                     /translation="MAVVADSRAERLPCADVAKHNTKANHWIVMHNLVLDVPRHMLLH
                     PSGKRILFDYADEDSVKGF"
     gene            <390652..>396636
                     /locus_tag="LMJF_07_0820"
                     /db_xref="GeneID:5649246"
     mRNA            <390652..>396636
                     /locus_tag="LMJF_07_0820"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680941.1"
                     /db_xref="GeneID:5649246"
     CDS             390652..396636
                     /locus_tag="LMJF_07_0820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680993.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649246"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK5"
                     /translation="MAPRHQLRAAALFGVLLITGVACVGVTGVDASSDAVVQTTPTYP
                     LLDVVFLATASMDPDRTLYISSASNCSSRVSPICTLGRTQVGVNYNSSTCIFNVTSAS
                     LGLNAATASSIPALHWCSSATGTTSFATLQMNAVRMTPGYAYYSEETTFTFNQATPVG
                     AKVGLYRESSCDTLLNGLPLTTLQSSRELTASIGPRTVTYVCASIPTVFNNATVIAVR
                     SVVYGVSPYDIYTTQGIRHRSVAISASSSFHYMSLSTDPQCRTLAQPYQQTETGDGAL
                     TIKVPRGTYYFCGVVIRGLEGVGVFVPALSTFEVLEYGIQPHTMYAAHATPMSFSLDA
                     VAVQSKLQGALFTTADCGVSGSKPVTSWSASMTWTVGVAGTYYACVRTSGSTLAADVG
                     YVNQVVVSNIPAVSLARQPAISGLGELATVTRSALDDVPAAVVTVGLSTSSSCATLFA
                     GGSTTETGSTASFYVPENSPSSTFYCVSNRLTTDASGGDSSEPTKAVYYPLGALELRT
                     YGLSYPALRTQATMEVGLDSDVVFGSGTSICLTPALLPSSSSSTSSSSFVDHDTCDTA
                     IAANSDIAMTFQLSSLTSKLTPVLFPVAGSWLLCVREPGVMGSTYVRLRTLRVYGNAT
                     VTPDGVIPGIPARLAVTAIPPSTTVSLTTDTACSIDMPVVTTTQSSLTGTAALVFTHT
                     AVGNLLLCVGYHGEHMSQGTAAQLMVAGTVASTNARVVPPLAVDSVPTQLTFSARGAS
                     SLSGYTALLVPPSPSGRVATTCPTSETAELIQLPISAPPSATTGSIAVATFTPASSTV
                     GTAYLVCAGAAGKFSSAGTVTVAAAPAVTTDPSPPTFGLPAHVTFSRAIMSLSHADIF
                     TVIKATDSCTSDMSIATVFATGSVDTATGVAQPFVVPTLPRTVTSARLCVAKKGQLVG
                     STLGYADAGVIALDTFTSITRYAQQGRPNTLVGKPLLSTATLYLVRCTGAECDASNAD
                     AACSSTDATKYTTSSHSPLTAPAGTYFLCQSVTVGTVVSVVGSNTTVEVVEPFKMHLS
                     VDPSAIRAYVPFAVTMSGGPGGAGAKYTVVAQPASTPCGETAAESQRFVTGRDTTDIT
                     ITDIVPVQNIRFCVQPSPADSFEVLTGTLQHYMTPAAVIGDRATTLTSGGVRRGATAV
                     LSRTADCLGVVAGGGAAPIVDARVTFTVTSCGANGALASLYYCEAASGGAYASRGAVG
                     LLRASGCSGGADASIAEVDAAPGAAIGSFGIDTAYLARPRLSASPDCDVLLDAAVASV
                     GYAPGAGERAAFHVCAVLAGDASVTFTTARPTLRVANWAVSPTAAVSRYNATLGAAAA
                     TAVRVNYATPSSETFLSTASDCSVRTASAAGLSGASRSATYSTTGVRGLVYVCTVAPL
                     SGKTLAVAQFLSVTPPAVLRVSPAVVRGGEYSATLVVDGAPPLYSMVPGADSGYTHSG
                     YYTSASREVYLSGDACSGVLAGTSAATVSSSGSVSLATAGVAAGVSSVWLCAVTAAGP
                     AVVLAGVAVAPGRVHPTTMVSGALGAPVFIPSLKGTAVQLSASASGCGSVAGMPSFTT
                     DAEGYGAVDLVGGDGGALAPGTYTLCYGGAPRGGGGGAAALESVELVRASYFDVRGTT
                     FVVGVAGRMPLLQDLTAEALVPGFSTARDCTSVSSEHGEWAAVTSTSVSVTATSVYTA
                     GLYLCARAPVNGTLVALPGQWSEARSVQFVASAMQLPSAGWDACTTYTLGQCYPPGAS
                     ASGATSVVAVVHGDCCSESSRSAVVGEASMASGTCELTLDYDKVSAYPAGSTYHVCVW
                     DSADDSVCTTVSEARVSTNCTRGGRGLSRGAVAGIVVFCLVLGCCLACVGLWCFCCVH
                     VDVELAEEVEADIPANPSLVVKLHGRRSAEVHWRGDSPNASFRSFSGSMSSLGTDMSL
                     TLNPLLVSAAYNSGAALLPDDLPIVPVTVEEKIRSLPKLEWEHRRRLAAREGEARRAV
                     RRRCEADLQVVKAEVVVFVSASAYRDGDDEDPTRLE"
     gene            <400733..>407887
                     /locus_tag="LMJF_07_0830"
                     /db_xref="GeneID:5649247"
     mRNA            <400733..>407887
                     /locus_tag="LMJF_07_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680942.1"
                     /db_xref="GeneID:5649247"
     CDS             400733..407887
                     /locus_tag="LMJF_07_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680994.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649247"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK4"
                     /translation="MEGRTSARCALVCMTSAALALALLIPAACGFVGAAAAAPMTVTT
                     TPSLPLLDVPFHADVAGIGKGHSLFVSSQSDCSAASKVTSVCTLGSAVDGVSFANGTC
                     VFHVTSEALGVDLTRPRPTVPALYWCSSARPGASVGALQMNVVSTVPLFFYRAEYNEL
                     TFSDATPLGSVIRWSSNPDCGSPLPNHANAVLGSSRVVPLKYSGDTVYVCATIPTVSG
                     AMTALEHRATVIGTYLYRISPTSGVRHRTISMTTTITESIAMISVSHDPYCRTLEQPG
                     KFYASLTSFDFVWSVAAGVYYLCVITNKDVGLPSSNSFTVEEYDVQPHTMYVARETPL
                     TYGLSAAGRDAELETALATTTDCIGGSLVVPWGASMSWAVAKVGTYYACVRDRGAAST
                     AGYTSAITVTDVPTLTFSPSPAVLGVPVSATVSHALSRKNVFRVRVSKGGTCDSEGAT
                     GATPRGSATATVRMPLGMPASVTYCVSNPLGDGEDGADTPVGGAVYYALGALRTRAYR
                     VGHGALLTNMRMTMRLDSEVLLPRGTSVVLAPSARVSGTCPGAMAAADAAGADESMAF
                     DVSGASAILSPVVFASPGAWLVCVRDGAGGDAGYTQAAQLQVYSDAAALSTDTVLNGV
                     RTEVVVSRLPPEAPVTVTSSSTCGLSMESVGAGTTNSDGVVTLNVQSASAGPLLVCAG
                     YPTASESSATDVGIEYAPAGTVRSANARVYPSIAYVSETTTLSFAGIGGMSLTGYFAF
                     FLPHATSCSEPDATVLGSGLKGPDATSTVSYGTVSGSALERGTVYRVCVGRSIDDGYC
                     DAGVVAAMEVPSVSTDPPVPVRGLPVRLQLPPSFTSTAAVTFYVVVGDTARCSGDLSE
                     TRVYGSGSVDRTSGATAAFVAPARASGVDAVRVCVGSNESLVSDSLGYTHGATLRLEQ
                     FHTSMVYLQRGVPNVLSGAPMAATGSLYVVACDGKECAADNADGVCRAKMSQGATSSA
                     TAALNAPLGRYFLCQRVTVGTVVSVVGSNTTVEVVEPFKMHLSVDPSAIRAYVPFAVT
                     MSGGPGGAGAKYTVVAQPASTPCGETAAESQRFVTGRDTTDITITDIVPVQNIRFCVQ
                     PSPADSFEVLTGTLQHYMTPAAVIGDRATTLTSGGVRRGATAVLSRTADCLGVVAGGG
                     AAPIVDARVTFTVTSCGANGALASLYYCEAASGGAYASRGAVGLLRASGCSGGADASI
                     AEVDAAPGAAIGSFGIDTAYLARPRLSASPDCDVLLDAAVASVGYAPGADERAAFHVC
                     AVLAGDASVTFTTARPTLRVANWAVSPTAAVSRYNATLGAAAATAVRVNYATPSSETF
                     LSTASDCSVRTASAAGLSGASRSATYSTTGVRGLVYVCTVAPLSGKTLAVAQFLSVTP
                     PAVLRVSPAVVRGGEYSATLVVDGAPPLYSMVPGADSGYTHSGYYTSASREVYLSGDA
                     CSGVLAGTSAATVSSSGSVSLATAGVAAGVSSVWLCAVTAAGPAVVLAGVAVAPGRVH
                     PTTMVSGALGAPVFIPSLKGTAVQLSASASGCGSVAGMPSFTTDAEGYGAVDLVGGDG
                     GALAPGTYTLCYGGAPRGGGGGAAALESVELVRASYFDVRGTTFVVGVAGRMPLLQDL
                     TAEALVPGFSTARDCTSVSSEHGEWAAVTSTSVSVTATSVYTAGLYLCARAPVNGTLV
                     ALPGQWSEARSVQFVASAMQLPSAGWDACTTYTLGQCYPPGASASGATSVVAVVHGDC
                     CSESSRSAVVGEASMASGTCELTLDYDKVSAYPAGSTYHVCVWDSADDSVCTTVSEAR
                     VSTNCTRGGRGLSRGTRIAIIVVCVVLGTAFLCLLFWTVWWCCCRRQLAEGANWKPEK
                     GRQLVGFQELGDEDRLVGYVMSGRHPLLYYPSSSARIGRSVSASLGYPSMSGSGCGAL
                     EAVEDEGRDQIALQEARARYNLRLTFAERLQLLELAEKNAAADAAGMNTTYASGDSYL
                     HGVAQPERRCVESILTEGGPRESEMDFPVRAAAPRHAGAKELELAAFEVPEEGDISLS
                     ADANVSLEMDPITGEYQKVRSRSIESAPRRCLSPVESCWTNEDFEEREEEESYRKVAV
                     EAAIPDSELSVRMWPRQAGGDHEEPQRVAVRHFAKPTSFKSRRSASLNRSGSGGHRRG
                     PTGSASDDRKQQPHYDPLAVMPVTPKALSTSKGLTNYILSPPDGENDSPPDLRTNTAH
                     EVGDTTTAESAIFSRSPIAHAGTHDMSEEALPVGMARVRSSEAIAGKVNSDESEDDLL
                     SFTTTQRFYDEKRFLREQEDGRRQRLCNWEEEERAQLAQDELNGYMALSSATGAGGDT
                     VNASSYHSENSDTEYNAGGSLGKGHYGKTTAKHEGEDEQVSHIPAAPTTLPSLPPAPR
                     PQTLQNDYYYVVPTGDTGAS"
     gene            <415473..>422504
                     /locus_tag="LMJF_07_0840"
                     /db_xref="GeneID:5649248"
     mRNA            <415473..>422504
                     /locus_tag="LMJF_07_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680943.1"
                     /db_xref="GeneID:5649248"
     CDS             415473..422504
                     /locus_tag="LMJF_07_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001680995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649248"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK3"
                     /translation="MPARGFRWLCRALVCMTSAALALALLIPAACGFVGAAAAAPMTV
                     TTTPSLPLLDVPFHADVAGIGKGHSLFVSSQSDCSAASKVTSVCTLGSAVDGVSFANG
                     TCVFHVTSEALGVDLTRPRPTVPALYWCSSARPGASVGALQMNVMGMSRQFVFVSVET
                     TVRLNEATPIGTTIGFYVISTCITPLTIPRSFTISATRTITLRATGAVPMYVCATIPT
                     VSGAMTALALRGVVAGAPVYAVQPSRGVRHRTISMTTTTDGAAKVALSRKSDCDTLAQ
                     PAQLATLNEHFSFRITAPAGVYYFCAAKGLSTFTPSTNTFTVEEYDVQPHTMYAARET
                     PLTYGLSAAGRDAELETALATTTDCIGGSLVVPWGASMSWAVAKVGTYYACVRDRGAA
                     STAGYTSAITVTDVPTLTFSPDEVVGGLPITATLKHPNATTAEFDVMLSNKFDCVDMF
                     AIVRKPTGTAMVTLPTVTTLQGDVTYCVSNPREPREDFHTVSYALGTLRTRAYRVGHR
                     ALRVNSTLSFVLDSEVLLPRGTSVVLVPEADGSPCAGSMTAAAAMGEGSGMMMFTVSG
                     ASAILSPVVFPTGGLWLMCLHSGDGRQLRYLDLRRFWIYGTTAQLSQDLVLANVTTPV
                     RISGLESDHDVTVTSSNTCSPSTEWVANGTAKGGVVTLNVQSASAGPLLVCFAYPAES
                     ESSFTDMEANYAPVGEFQSLAARVYPSIAYVSETTTLSFAGIGGMSLTGYFAFFLPHA
                     TSCSEPDATVLGSGLKGPDATSTVSYGTVSGSALERGTVYRVCVGRSIDDGYCDAGVV
                     AAMEVPSVSTDPPVPVRGLPVRLQLPPSFTSTAAVTFYVVVGDTARCSGDLSETRVYG
                     SGSVDRTSGATAAFVAPARASGVDAVRVCVGSNESLVSDSLGYTHGATLRLEQFHTSM
                     VYLQRGVPNVLSGAPMAATGSLYVVACDGKECAADNADGVCRAKMSQGATSSATAALN
                     APLGRYFLCQRVTVGTVVSMVGSNTTVEVVEPFKMHLSVDPSAIRAYVPFAVTMSGGP
                     GGAGAKYTDYSLKVQPASVVCGATAYESQEIMVEGGNAEVSIKNIRAGKQIRFCTSSP
                     LLSSVSMLTGTLQHYMTPAAVIGDRATTLTSGGVRRGAAAVLSRTADCLGVVAGGGAA
                     PIVDARVTFTVTSCGANGALASLYYCEAASGGAYASRGAVGLLRASGCSGGADASIAE
                     VDAAPGAAIGSFGIDTAYLARPRLSASPDCDVLLDAAVASVGYAPGADERAAFHVCAV
                     LAGDASVTFTTARPTLRVANWAVSPTAAVSRYNATLGAAAATAVRVNYATPSSETFLS
                     TASDCSVRTASAAGLSGASRSATYSTTGVRGLVYVCTVAPLSGKTLAVAQFLSVTPPA
                     VLRVSPAVVRGGEYSATLVVDGAPPLYSMVPGADSGYTHSGYYTSASREVYLSGDACS
                     GVLAGTSAATVSSSGSVSLATAGVAAGVSSVWLCAVTAAGPAVVLAGVAVAPGRVHPT
                     TMVSGALGAPVFIPSLKGTAVQLSASASGCGSVAGMPSFTTDAEGYGAVDLVGGDGGA
                     LAPGTYTLCYGGAPRGGGGGAAALESVELVRASYFDVRGTTFVVGVAGRMPLLQDLTA
                     EALVPGFSTARDCTSVSSEHGEWAAVTSTSVSVTATSVYTAGLYLCARAPVNGTLVAL
                     PGQWSEARSVQFVASAMQLPSAGWDACTTYTLGQCYPPGASASGATSVVAVVHGDCCS
                     ESSRSAVVGEASMASGTCELTLDYDKVSAYPAGSTYHVCVWDSADDSVCTTVSEARVS
                     TNCTRGGRGLSRGAVAGVAVACIVCGAVVGLAVFAVWYWCLSRASRGGAEAGEDSKKT
                     SGTDDDVLASRSWLSSSTEYGDTTVSTPGGCAFPEEGHELGDELQRSGDSGPVFGDHP
                     VMRSMSRRRESGLEMSDKLSLKSVSEVPLAPLTVKRVSQLRRGSGSCRSSMKQQIETW
                     RRALQPISALEAQPAVLPTASPQEDPSIPHIYRVLPPAAEPKAPPKPLQRAPLAAAAE
                     SSLLCPPTSKPWPQSASQAPLQQMPQHTRPADVQSWQPLSPERQTSASTRSRNPLFSV
                     FSLDLSLEKSVPWILSEGGSSSEEAVVPHAQCSPRGTAPPFEATGPTARHLRTVREQD
                     RFLRRNYEEDMRQWLQSTMMAPEVQAYLAQLAANARSSSPQPPPPVPPQGPANREKTP
                     PAPRTQKPVPFEKARAMPAPQSTAPGVARTNAAGAAPPRPAQPPPWPLPEERHPSPGR
                     GFNSVQFPAAARSDTVSLDVSSDTNGQLRLPQCTLATAAADAARLTRKPSMPRLPQPP
                     SQSSEYPVMYSDYGPTGIIGPAVMAGWPRPLSAEGQR"
     gene            <426138..>426686
                     /locus_tag="LMJF_07_0850"
                     /db_xref="GeneID:5649249"
     mRNA            <426138..>426686
                     /locus_tag="LMJF_07_0850"
                     /product="putative ubiquitin carrier protein"
                     /transcript_id="XM_001680944.1"
                     /db_xref="GeneID:5649249"
     CDS             426138..426686
                     /locus_tag="LMJF_07_0850"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="putative ubiquitin carrier protein"
                     /protein_id="XP_001680996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649249"
                     /db_xref="GOA:Q4QIK2"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK2"
                     /translation="MPNPLVRLGKELKEATEHPDPDIHLELYDPTKGSDGSRSSQGAA
                     LQPSQQQPGLYTWLAILKGPPDTPFAGGSYRLVLSIPHEYPLVPPKAAFITKVFHPNV
                     EFNTGNVCLDILKKRWSPVWTLSSVCRAILNLLAEPESDSPFNCDAGNLLRAGDMEGY
                     ASLVRYYAITDAGAPPFADNEE"
     gene            <436928..>441199
                     /locus_tag="LMJF_07_0860"
                     /db_xref="GeneID:5649250"
     mRNA            <436928..>441199
                     /locus_tag="LMJF_07_0860"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680945.1"
                     /db_xref="GeneID:5649250"
     CDS             436928..441199
                     /locus_tag="LMJF_07_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001680997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649250"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK1"
                     /translation="MPLGDVRDASLRSPTAATTSVASFWGDSHHDRGAATAAASTKSP
                     STFPTTAALAPLTSSTSSWSSVTVANNTRGTRNAAYKGTRAPSGATTPAGLVALSSEG
                     KRTPSQKSSVVSADLSSHSERLNGSIGGGAGIGTFKYTAASLVVEPPHSTMPTTLRDS
                     DDGDDEAFDIIEESIKRQLVSIEEDELVSATTHDNLAAALRQTLQLQPHQHPQQHRHL
                     AVQLRGGASSEAAGARRTGGDDRIIHITSAAAPPALQSAAAAAAVRQGEITTIRCSSS
                     PVSVVEQLAAISIAQSSMPKASVPLTSASCGDAKGFRSKPPPWQPQSPQAPAQKAVQL
                     TSEQSSEQPPPKRAPATVHPLNAAASRATLFEQQRQPSANSVGGKACDASSRAEASIH
                     AGGLRIPLPPSGARSMGDRSGSGEIAAEAATGTPSHRDPSRDIGGGAATATATATATA
                     TATARSSTTSTTASSSSTSTTLQSCRFSSERSSLSKEEPASSGHHYRQYPRQLRSGSS
                     VEQLRHCRRPHQPQIQALQLEGLQEQYPTNSQQKCLHKDTQQQRRPQRVQASSMMFQG
                     GPRFPNLPPHLQPQPLTQAQQQSHLQHPVSQTQFHQSQQQQLGASAASPSAAMMPGKI
                     YAATPHGRLILLTPDGVRAPQVQPPKHSLPPPPPPPPPPPSTATSSALTGNYVTASNY
                     SALFCRNNPLHSMRYPGSQSESAGRLAGEAGRPKDEKGTAATPFSSAERSSTQASNTT
                     VSSVASEKNVPTSLNAGQSRDDAAVNHAEARVSVAPAVATAGIVSAETPPLPVGRSAA
                     TTGASAATGGGSAAAPAGHGSQPPTASVAPLLVCSSHGASAGELVQRLGRHPSSSSSV
                     NGGGRSLQLPTFPTHEDISTSSSAGGANHPNLNAAPVSSSSSNGAAMPSLSRVQPTLV
                     DSDRNIGLSVTNTLAQPPSSVKTGGSNAQIAVPANGSGTAATGSEGGVVAAELIGPNN
                     NALGNASTFAHLPTALKPHDSGLGADATVARNSGHAAHFTESASQPAISAPASSASYT
                     PLAALGSANGSGAAKCISTQMPLRQEPAGNSQLASRADLFAPAATSAWPDTVSSPSKQ
                     APTGAPPLPLPQRQPPQLPPSQQQQQFYIQGLSPPPSISHPPLGGRLHTAADNSVVVT
                     IPVTGGDGTITAAVIAVPPPFSYTEAGVQQYCLGALQQQHPQQQRLHPPPPLQQHFHH
                     QGAPAEEQSTASCAGEEAEWRRKQDMITLQLEQHRQQLENELRKVQLQQAQQQQQLQH
                     VQHHHNQHNQHQQQQQLQYQQSLPPVQTTMVTIDGRLYRMVSASSGEAFVNRGQPCRD
                     LHFVDRSALVSDGSAGADGRTEAAAPQPSNHPGVCMPVSPQAELSPQQQQQHMIITVA
                     GDRSALGETTSAAAAASLAKSSAPGTNVMLVMPTPSASHKVKYGY"
     gene            <442453..>443571
                     /locus_tag="LMJF_07_0870"
                     /db_xref="GeneID:5649251"
     mRNA            <442453..>443571
                     /locus_tag="LMJF_07_0870"
                     /product="splicing factor ptsr1-like protein"
                     /transcript_id="XM_001680946.1"
                     /db_xref="GeneID:5649251"
     CDS             442453..443571
                     /locus_tag="LMJF_07_0870"
                     /codon_start=1
                     /product="splicing factor ptsr1-like protein"
                     /protein_id="XP_001680998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649251"
                     /db_xref="GOA:Q4QIK0"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QIK0"
                     /translation="MSQSLSRSGSQRGVATRSASRSASGSRSSSNSMRLPGPTAASAT
                     VAEPAAVPAAVETTTDDAGQPHAPEKEVASIFIGMGPAGRTVTLAELTEYLKSKAMDP
                     ANVKDIRLRGRCAFADTTTVEEARHLIAQLDNHDYKGKFRLAVQMSKQTMAEAKENKR
                     KRQEARGTKQGEEGHYVNEGRQVFVNLGPAGKDIPNETIRSRIEAICSVLRFERRGYC
                     MYVDVPTAEDTRRVVAALNNMMIGEVRVLVQISTLVRKRERSPQRVRDAPRRGGDRHE
                     RDSHHHRRRSDSREGRRRHHRSRRSYTPSSRSTSSYSSRSRSHSRGRRSYSPDSEDSR
                     DRRSRRGGYHGSDRRRGGRAERGSDRRERRGDERRTRR"
     gene            <448623..>452693
                     /locus_tag="LMJF_07_0880"
                     /db_xref="GeneID:5649252"
     mRNA            <448623..>452693
                     /locus_tag="LMJF_07_0880"
                     /product="putative protein kinase"
                     /transcript_id="XM_001680947.2"
                     /db_xref="GeneID:5649252"
     CDS             448623..452693
                     /locus_tag="LMJF_07_0880"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001680999.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649252"
                     /db_xref="GOA:Q4QIJ9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ9"
                     /translation="MDSASGISDSACGSTHNRPRVFCVVCGGYSEDLILRKSGLKCAS
                     CVGKSSNKHYAKLQKRQAKKLFSNAFPAQSPTAGLDTASSVQPGDSSRTNHLFSSASS
                     SLPPAMEDYSGTTGVSTARSITLHPIEEYISGTSVYRAAMEQACYSGENDRSAGEGGS
                     GDRQTLMSGADGVTRSTSDVLSKVPQENTASGSHTNASSSAAVGDNAGVMRGTPPPLV
                     TQHQESGGVRCSDSRSEKSGRDAVGKTQRCRDSSGIPPSPIPHKGATKKEPDNQAPAL
                     CDKTVPSRLPPRNGPRMTKGAPRLPPPVADVSKVSAGHTVSTKSIRKAMDTSSPNGAT
                     ASPPSSAITTASAAACCGEGQHLMPKSGNDVLRDATLPPVDSAADQHHSHSSTPRGDE
                     GATPLAAGLCQNLAHPPQVPRASRQPPVMFPDASVGLPAPRAGSCDTSITSSAMGRGP
                     ASRPPALHSHAGSNGGTQVQRDSQGGAQRSSAAPAPVLMLPNTSARPVDAHGAAGTGV
                     PSLSRMPNSSGATAAALDSSHSVGSSSRRRRSKRGSRGGSSGDSESASSSVSIDTSTM
                     DSSSPLVVSPATPEAVAGEDGAAASGTDTRRALQGGTNALNAGTKKRTKKVSKSVDGT
                     TKKGAGDSAGHGLATTPLSSYIDALHITVESVQPSLLNAPETTTSAPCGGDEVPQTST
                     SCNDESSTTTGDTHSRCDSIRSGSFRTNDGYQRQVYVAGQSGNFKVTRHIRQCSGGSD
                     VLAGRSSAVGVSSASGTLTVKRLRSRQQHGSSGDTMGTGAVEVKRISYRLVIKHRHSG
                     DVLLTQERRLYTQIIPALERVKVIAGGELPAVPMKRLPSLRFATEVFTEERRAEVEAF
                     LQAVALSPFYIRHIEIVKLLGLELYLTDAGAAAATGTAAAKGSRISGADAYRPSKSPR
                     AMHAKSSPSMGVGADMEATPQVRRGSASDSKYLNCHSRDGEAGAEAAAATGCGEAGTG
                     CLTVDALNAYCSSTMGGVGGGTADGRNFCRSQSCSSVQTSCSSVVRRRKLDEVTMEDL
                     EHIQLGNLIGRGTFGSVYLGLVQTQRGSLMVAVKVMRVGEAVAPSEMESLQRELDVLC
                     AARHKNIIRFLGSSLNTTTRDLRVFTEYVECGTIRSLVDRFGALTMLAIQQYMQQILS
                     GLQYLHSLSIAHRDIKGENILVTKNGRIKLSDFGSSTGAPCKVVTAAESPSKGSSGGS
                     ADSTANGGLPVGSPQYMAPEVIHGTVKSFAAVDIWSLGCVGIEMMDRPIWCESPCTNP
                     FVFLYRISRCGTPPHGLPTDDELAALKAEGKKTECEGFSVYLEFLRSCLRVDPAQRPS
                     AAELLKHPFMTYPYAKHLRWMPPMSATAKPSVLKSS"
     gene            <458271..>460160
                     /locus_tag="LMJF_07_0890"
                     /db_xref="GeneID:5649253"
     mRNA            <458271..>460160
                     /locus_tag="LMJF_07_0890"
                     /product="hypothetical protein"
                     /transcript_id="XM_001680948.1"
                     /db_xref="GeneID:5649253"
     CDS             458271..460160
                     /locus_tag="LMJF_07_0890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649253"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ8"
                     /translation="MSSSVQNHQQTLLQARTHVAARDTTAVAILGAKAGSNGSSQSFR
                     PAAQCLEHTQSSFNQTDISQRPPFIASEAATVSLLRRMEVLDNGRAGSTSDNAAANVV
                     PSHQSVQRQRVTAHTLNKTTLANNDVTGEAPKPPSMAESTLKAGAQRRRIVKSNRNAV
                     ASRGPSESLKKCGPAVNVNDDGHRNDSAMAMNVPTQITVAARGGARGRVFHSNPFVTR
                     NGKRFSAQNARRGISTATLSPPHTAITVSDDYSADFSVHDAFDVLSPMTPANPTYQKT
                     LQVQQQQQWHSGSWIYDLNAGANTDSFTDDGSPIEFVVEDFELDDTVLGGTKHNDFGG
                     QASKGGPDRFSTAAASNPDRLRQQNHARWAASRGPTRGATLASGTTATQQAGGARHLT
                     TKSTMGSDPAGPDSPSGVLKERARLAKGVKLHNGPPMIKIPPLALDVINANRKTGKAS
                     YKVSHPKPGVVVPDIESSSTECSDMPNNSSLQGNFEALGVKVSNSPLGGRGSIEGRGN
                     DKRVGGVHNGSLLSGSAVDGHRAGAAGSSAYKGSLQNCGRHGMLSMPFDGTSNDSQVH
                     EASPSRNAREGFRGNSGGFGMHGGPFGSVQRQRWLVEADKHSSGESRPPMTNARKKAK
                     CCVVM"
     gene            <463745..>464635
                     /locus_tag="LMJF_07_0900"
                     /db_xref="GeneID:5649254"
     mRNA            <463745..>464635
                     /locus_tag="LMJF_07_0900"
                     /product="putative serine/threonine kinase"
                     /transcript_id="XM_001680949.1"
                     /db_xref="GeneID:5649254"
     CDS             463745..464635
                     /locus_tag="LMJF_07_0900"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative serine/threonine kinase"
                     /protein_id="XP_001681001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649254"
                     /db_xref="GOA:Q4QIJ7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ7"
                     /translation="MGAPKRLGKYELGRTLGTGNFSKVKIARDTETGKEWAIKVIDKE
                     QLVRERMEEQLKREIAVMKMLRQPNIIELHEVMQTSHHIYLVLELVTGGELFEKIASA
                     KRFDEPTARHYFHQLICGINYCHRQGIAHRDLKPENLLLDANDTLKISDFGLSNLQRT
                     SVSGGTMLQTVCGTPNYVAPEVLKEQGYDGLKADIWSCGVVLFVMMAGYLPFDDENVN
                     ALFTKIERGEFRMARHFSADARDLISRMLTVDPQERISLDDVIAHPWFCVDWNPAMLT
                     RGESHSSPNTTQISNAIRNM"
     gene            <468448..>473982
                     /locus_tag="LMJF_07_0910"
                     /db_xref="GeneID:5649255"
     mRNA            <468448..>473982
                     /locus_tag="LMJF_07_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680950.2"
                     /db_xref="GeneID:5649255"
     CDS             468448..473982
                     /locus_tag="LMJF_07_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681002.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649255"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ6"
                     /translation="MLRQSAFSSSSGLSAASSRGSCTYTDSNTPLRSEASTLEPLAAG
                     LATAQPSALVTPVVNVLSASAVPEPHALPLVVSWNARSRGAENVAPGPPVREDNALTT
                     TATTGAGSVGADGEEEPLCVPATYSTAADLAPDVANTDAGSSWCLRTVDEATTERSAS
                     SLADCSGAPESRTAERLPTQQRPQRRRQHSQQLLPTSLPLLPIPVSTTHTYPQSHQSA
                     GLSRRAAGPSELPPSSHTAASLPRPSSPLMTSSVAGLSADGRRPKPHRRRPSQASSDD
                     ITASSMITAPCRVTSGTASQSEVVLATSPSIGRAPVASGSSAGAAGSASVGSPRRYTA
                     LGGGGDPRLDAWEIDEEVAQLARSLRSQIAGQPFVLTPPFGASPTAPAAATSRPSSSY
                     SDFSTGSRGGGGGSGQRRTRCSPSHAAPMAAATTTGFGEDLAATTACTATAAIGRGLL
                     ALLDSSTSSAQTSMDLSGAARRLTTPQYRLSKSRQLSLSTSQRSPPSAQGSRTRPQCF
                     PSVQPHPGVGGDAVARNDDGVRRDGVDSAAALSHSSDPGQQTPAMCCDARPLGVPPSS
                     SSHLSTVTDAVPLRAARGSWAAAEVVTQTADAEHNQRRSRVAGDAAAPGLCEGFDAGL
                     SDVAELRRRLLTEDFFSSPCRKLRRDGRFPWKLTTSVLLCILLLVHVTWYQLPLACAN
                     EAMRLAITKHFMGDDAYFSKDQGDIVSAPTEWMENLYASIERYVQVYYNLTNASSSEM
                     TYRYNNANPTSWCGTGIERTNSVVDGGEGNSMAREGQWWWRRRGPAGWRPSLLWNARA
                     AASPSPFSDPASVAGPCVHSATATAASALGNSEELPPPYIPVSVIAPVLMRVEVDVYS
                     RREGTQHKRVKLSPLKTAAPVRWLSGEAAAENHGGHADESGEEAVADAVNLEHRWLTF
                     SVDADHPLGPFAKHKEAVRLLRLARRQERHRATERTTGDAAGRPAEFEGASATDATAL
                     PGSAGGGSWTEVDAALSVVCMPRYDDLSGRYYRPCASTQATTIIGGAAAAAAGMSTHI
                     VPEFSLMDNVRRIQLEVTLRHETDEVDYLISAAAAAASMGGSAAKKVARGANAFSVGN
                     LEIRSASSSTGRLKSAFAASASAVFQWHVVKDITVHPGGLVETQLHVSTRVWPLGLLR
                     NFWTRRLMTVLLGALAVLQIVLELRALQRIAQHKRRLGRERAAFLARQLQYAPIGGGA
                     EHGASKVWTLPTHTASLQPAILSTKTTVYEWGMPVSLPFGRPSRPPQSGRIAGYAKAT
                     DSAAARAPANSYPSGVKPSNYGTIESRHDDDDHAGRPGSHSETVLPPSLMLDTSLSII
                     ASQGQSSYSRSRCASQEGAGDASVLPSWPCEEAASFFPLRNSAESHQHGFDSSVGPPT
                     WIPSALRRFLLGRLAQLLGTPTSSQRGSFPNTPVPCTPGHYPRSDDGSDMRASGAPES
                     LPLRFCINSSGTPVSAVASHASFPPPLHAPLTPQLAERIAERSYVDVRTAWRHHLQQS
                     TGAGWHRVAIIAAAFTLSYSALLLAPLLPFAEVAQTGAYYAWTSVLLGVAALMSCVLL
                     LSYLRFFPTFYFPVMASIHVVPKLFLFGMCVSPLFLGFAFFCVIAFGAHSNGHFATLS
                     SACMGLYFTAYGDSLLATRDVASDTPYAVTAFFASLLVVSFVLTFMMIMLNMAMTITQ
                     HEWLRLRRRFGAALSTSSVLFAVRSREEAREEAIEAVRANLEVLWLMLGEDEEEERQK
                     TGAAKAPAATPSTSSADAARLSQPATSLDPSRTTTIRESDDDGAAGEEGAGGGGDQKR
                     RLRHRRRCHKQRHAHQIREADDAHSAGSPFHAGHCDRTETFAVDSSYEVSAASTAPPD
                     SR"
     gene            <477785..>484651
                     /locus_tag="LMJF_07_0920"
                     /db_xref="GeneID:5649256"
     mRNA            <477785..>484651
                     /locus_tag="LMJF_07_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680951.1"
                     /db_xref="GeneID:5649256"
     CDS             477785..484651
                     /locus_tag="LMJF_07_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649256"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ5"
                     /translation="MLGSSSLTSIPSLSGVPNTTAGAAGAGSGAAGGAGAASGGGVAG
                     AGELCFLMHPSGGWICRAMAFNEKEVSHANGAISVNQSLTSKCALINEVAKGKIMARI
                     LSTYQYVQERYGLSHVEVTVDNQYLSRSDMFLISEALRERILYEGEEMHVCGFRIRVR
                     EMLQEVVSTPNTAPSSAATSLAPPAFSAFLPGVSASSAGVSSAPATPAGVSSSGGTTG
                     TAASGVGASGNAMSIGAGAAGAAGTAATSAAGAIAHIRVGNGIVLPTTRINFQSLSPV
                     HYILLELSCEMWETTMDGRIALTLAIRKFLSELLLKQLPKHKASPLICVVFTGRLRKE
                     FQFSRHGDVFHLLELPRDLRSNVDIVEEIRIHCEALVDRVLREVHDSAWRQLEAEVRA
                     YREAAAASHSRASGAKSAGCRLANDGDDLDTDPHLLREKEGCVVAATTSAPSQLPPAS
                     ETLKGGRTSAAFSAATAATEATFDAYVRSRQQYIESITAKRLFVHAKQSNTLEALSIL
                     LERCTHNYIDRNLTLCGHAVTVVSAGKGFYQVTNNLVQVVCARLHDTGIEKIHVVCIG
                     RPPLHVTPLLEYTSDDDTLRSQYHLHSRVLSGAGVSARGMRGGAPTPSLPSGEAERYY
                     ETPEWMFVFFFHASLQYKSGGETVFELLPKECWLREHSVMAALKSLWTTPPESQQQAR
                     QQQSRVYSASTLLHGGAAGDGGEEGGSASAGADATTSMNGRGGVAAAAAIMGSCGSPS
                     VAAGELSLPGGNPPLLIPGLGLRSYPVPEVTLPVHPHSANLLLYANGWGAGTPESQHV
                     VLPAGVAAGLAVAAGGIGGGPSQPPAPLPLQPFFAEPFSASWTGSMSAEQAPSLTSPL
                     CSSSGKAAAAGWLGAAAAAPVSTVSKGSSPLLVRNTTTTSSFFASPTAPTQGPMPRWI
                     TGTGAQAAQAMACQQAQLQQGLQPMLTSYTFPHSSASNALLQHARYAQPIQAFNGMPF
                     MAAGAHNGGNWGIEVAPTSAVTWGSAQPRRSRTGVAGASGAACHHLAAPNGNGGHHTT
                     MVAVAASAFGGGRVSHPNSLPSYYATSAKPALHISRSFDQKTTANLEHYSLGGLEHSL
                     RSVGSPLLGLYANAPRLQTRSLLWRDRSTSKSSMTSIITSVAAATTAAGTDLGVSCSS
                     AGGGLRSVQLRLEDGHMYRDVMGVAASFAFCAWYCLHASKPHQDCGGGSTAVTGTGAT
                     NAPVSHAMAARHGGSGAAAGAAAESSYGDASLQASVKSWHKAPSGTRSDAVFCGCNVV
                     DSDLRNGYLILEITISAAVLPKSFWSPRLLLDDNCWAHLMSCFTGRDDRLTLDDELEF
                     VSKDGTDDDALTIHGNRTDGQSSPLNGSSGRRWCEEDAGGNVTSSAAAATAAAAGNEP
                     GGGTRGVPESGGAGDDYHFQSDFRPAEVFCRSHSGITPDGRTLIIPTHSNGVYFQSSE
                     EILLRFSPQLFVSTVDEVDEAALEQVGPTTSTVPHHHDTAAADDEAVERWSTVSCVSR
                     PISCNEGGEALSGGAAVEPAGRQAVCGRLQKEEEGSWSLPTSGSAAAATTTGATDDVG
                     GEGQAPVPPHPTGAELMQSIVESGSRSSADSVVISRAKTAKDTTAAAPRSSNSACASG
                     SVNIDAEVMEPAADAPSRQTAAPATEDAMASTESLPTPKDGTARSTKSATSTSRPYPL
                     HLRPTVTVTNSRAPAAGAPLQLRMTAASRQGSSSIAGPPSSSPTPTTATYSAGQHPAY
                     SSLHHDEVPLMPGTTVTVGFVQLRNSLLFAIKPINPLRHGSEEEHREDLTALSQSAES
                     VSTATVLRRRWQWKHPDIASEPQHLASWTRLCTCRLLPLYGSKPAYPRESFYTVSPHQ
                     YTVTSHGGSHADPAEDKRRLLEFVLQRLQQQYQIVVDSPGLAAGSQWPRADPSPNARL
                     EMSLGHQTHTLKVGETAKTISVTRMLHRGMYSNGQVTHMLRYRYLLWNYLADEFTARE
                     VHMEAQVGERSAFRWESLDGWLQERPKEFIPRGPDLWLRSREVAVALLPEDAAHPPPY
                     EEFCRFINYSFSVHLSTYGKVAWRPHEDGVSLDISEPMPLILPATPPLMEVALVHDNP
                     LTFDTRNIVDRVTGRTVGFEVPVQERFTSIDISLPQEYDSHCCYFLKVSWLACAACIV
                     VDWMGSFIANAARFHFHAVPVGCYYNSPKAESLTAHYDVEAASPDEEPALRRALVELL
                     MTPAYHYYPDTPVLTRNCRLVHVSGLCCVVVPPSATTVAQWYQNAFVRQGSVEQLELL
                     AQFKEAVTKARLRVADVAAGPASAAGVPHPTTGGSVSCSQ"
     gene            <485374..>486381
                     /locus_tag="LMJF_07_0930"
                     /db_xref="GeneID:5649257"
     mRNA            <485374..>486381
                     /locus_tag="LMJF_07_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680952.1"
                     /db_xref="GeneID:5649257"
     CDS             485374..486381
                     /locus_tag="LMJF_07_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681004.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649257"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ4"
                     /translation="MMSVANAAYLPLIGSCLTAGEQTALQCSLPLLSQRYRGTPMQLW
                     GKVTGIKANYWVAQAFPNGEFAPAVSFYSIDGGSTWTMLSELTEEQAALCEALRGPYQ
                     GVPSYEYMMRQDLPAETDEAAVTMPTPDDILKKAEDDIAAARAASDANSDADESEGDD
                     EEQDDEEEEDEEDAGAVLAPRKRMAKFRILSVTEAMRLAHFVQLHDADCRLTVRGMYV
                     LQDGAAVGARNSTFGGQPLHNAKKPSCYVKMARAGTEERNRILYGLTYNPHTDYLMPI
                     TDDAPAGVWSVKYNATANVVSVRNLFYEGSLFWYRPGTLECGQVYCGPGERNFDLCFM
                     L"
     gene            <488580..>495929
                     /locus_tag="LMJF_07_0940"
                     /db_xref="GeneID:5649258"
     mRNA            <488580..>495929
                     /locus_tag="LMJF_07_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680953.1"
                     /db_xref="GeneID:5649258"
     CDS             488580..495929
                     /locus_tag="LMJF_07_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681005.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649258"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ3"
                     /translation="MSSSRSWSSSDGDDNDHAASWWSDGSDAANSVTDEANANVATPC
                     HRSEEDRPAVDGVADRVWGTGRLEPRERIHRYIDQCIPPALMSHQRSADGPLLVQLCA
                     ELEAFGTPKAWANHVPATVFDEYAATVEEDARGIEATHPASAALELGPRADLFEAALY
                     SCEDVAYPSHPSLAELRRAAECGSGATVPWSTLTRHLSYLSVRLHGVLSAPHGCCGAY
                     VLPLRLQAAVVPLLYAWATHWPLIEADIECWRAVVRCFYVACRPPSPGKGSSGANAAA
                     ACRSTFTLPWQPLAALCLSARDKRNAELPSWRSTLTAIVTSLPSLCRRASPHFSAAAV
                     DGLWGLVAGQLAPTEDGVAALSLFVRLVPYRHLCQLQTDVVVTHGAIENEVTTSTREN
                     DRGSHRQQEGELASTTAAAAPPQLTARAKQILRFLLVETATWQPPGCPSPAVAPSGAR
                     GKKSKASPQDFYLTWEKAVMTFAGSLARAHPGVAGMDAFAEPLFTAWLQALQLPAGSG
                     AGLPGASATSAAAVSHLMRKGGHEANSPRGSNTARGGTDASSRASSRTAARYVRLLNG
                     FPDTGDSPLWRHLERWLHATSVLVRPGMPCTKGSAADRVCHCYSSLAREAVRRCALSE
                     KRAAPKLQASRGAAVVEGPDAQASAPPDDAAAESTAAQAARRWSPATVERFVSLLLPH
                     AVAAFQARARQAQPLLWALLRLSPATVLPDFLNCVRTGLRSPTEVAAQRAVSTRLLTG
                     AVPTILADAEAASPLSSNTSSATLLAFLRETLPSMLAFVNPSDVVSALPVLSLVAVAT
                     SYAGAEEVFGTVDEVDAFAKAYVARVLPLFAANADVSDGHFPNAEVMVRAFLRTLPST
                     ALSMVTREVLREAQSRDHGARMAELVRMVAACAPAEAWDWAQKHWLRVLLDPSARDAE
                     VEWAAPLLAACVADLGDRSLARAHAVSIWRGVQLQLRILTSKKRRTAGAQVMDALMTS
                     LMRPRECAETHLRISSGKQLRLQQLQAVAAAPGCTRVPGAATELPLPRIGTATEARVY
                     VEWPGAEDVQVAVDLFNASLEDCVHLIEEVSSGAVLNTAAAGATVAVSSDGDISLYAQ
                     FFAVASTATAAPSGGADAVLCESAAAVTRYSVLEGTLHWIQRLLCACEWVFIEPTPTA
                     TAADPQQTRGVPWWDVNPHVPWRPTGAPLLPASCRPAYTRAEVFEVLRRCVCLPMLRQ
                     HVVVPLRQCGVELKEWFGASSGEEASTSADDSQADVMELLRLLQWLSSSIVRLPQQRW
                     RPAASLSHYLRRIIGRQCPWVRRRLPLGCWADRSLQLQVEAVAHGHLPVTQKTFSDVV
                     SIAQSLCLSPRRSVWGGAMRLLVHVRLFGALDSASLAMFEGRVRAVAADIVSQWRAGV
                     ASAASDAAVAKAALRPQEQLRLLPATTTAAVESPGYGNGRAGQPLVLSTPAVIGVAPS
                     ATLRLHTLQGAMEGVQTLLMSLALNREFFEAPTTCMKSLRFLVRFPEELRSVTAGLLL
                     PQFTERVRSAKTLLITGAARSPAFTEELVQLAYELAATYPARAVLLVAYAHLVYWPSP
                     CRWVSLRAVRYLARLSLSSHVVLRCVAADLLQAVSVPVTVREPTWTVCAVPGALAVPA
                     SFLLPPDAAKELLSEMEQRAHEAAVAAVQDCVQRLTEACPLMPYYVGTKGLVLPLSYL
                     TVPRCAASALGLHPVQPGAEATSSHCTAITGAAFVDAITYMQPSGAAAYRRQWLATLL
                     GGMNGGGGGVTVVDADEEESCRAADATARQLSPHSWVLRLLALPVECSQVHHDRQVAS
                     PTTVVKLLASLSQEPAVNDASLPFSSAASLLLEWGDDALRAWRRRRGKTNQPRGGEKQ
                     RTCAADINDCDGPSVSLSERGVAETPPTHLTGGEGDAQGHAGEHDGKEGTREVEEDEM
                     YRLFRSLAIVSSAVLRLTAPLRPAAAPSSAHKGPTDAELRTRAVHFFSDVVACVCSHA
                     AVPHRVAQRVMFVAFTTLGESLASEELWMVVYALVGQLGSTAHAETATTAADDACNGG
                     SDTWSQRRQRLLSFIGALFCGVPPAVIGANLPRLVALVEAQAQVFSFSSADQVRQMAA
                     MAVAQLIGFTALQSSLRVEFNDCRTAADALMVSLMQRANTTVFHGRLPLVCLGVESED
                     SLSKALPATRVATAISSGEAPDSVGAGSPTSQDAALLTFTALCLQQSPADMLEAHARD
                     MVLLLCCCLDLSFTEVQRLHEAVEAALASLVALPMSKARVHELIEQLCSVCTGSVSYG
                     TSRRAKVACTRALRRLIFPNLHRIGRFAVMEQVAAASLAALAHRDAGIRSEGSHLLAV
                     LTKVAAEAQTRVLVQRLIQELRQLPRETAAAASAVSEHQREDGPPRSGAGTVSVGRRV
                     VLVQALGAVVLADPGEPSSYVPKVMVQLAGCAREGNTECGRVAKRVFEEWWHAHREGW
                     EHVYKSRFTPVEVDAMSDLLLAPRYYA"
     gene            <500162..>505981
                     /locus_tag="LMJF_07_0950"
                     /db_xref="GeneID:5649259"
     mRNA            <500162..>505981
                     /locus_tag="LMJF_07_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680954.1"
                     /db_xref="GeneID:5649259"
     CDS             500162..505981
                     /locus_tag="LMJF_07_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681006.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649259"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ2"
                     /translation="MVPRDATSPEEVASEGGDGSVSAGSMSLSSTMPDLPATPLPPLP
                     GFTTLEVSGAPWRTPSPQPATSTVVALPSPTLQGIVVPGADNHTAGSPNGAAVSSFRS
                     RAGSRHALSGAFPLSAGESPALPTPIMISSLPRTSSQCAEASEQLHPYRQSLLGSSLP
                     PGTARFTTLPTPFVSRAGAGMQSSGARSLREDSAVLSRASSFTPPAMRFVQRVRRRIL
                     TLSQMQLQLSAWDLFHTDHIGGRSQAALQVTAAASGVTSPAVSLTAAAQGGWRAKNEP
                     ESRGSSSGSRSSNSRSQEYSQHLCGSHAVSEMPQQALPGPHWLLSVSEDGFLRYEPLP
                     SAAQPPPYMQSPPVVTTADFAFLCVPYEALARGIGPEVGHHSHISTSGPLGVSAGGVG
                     VVAISGDGAVEEVAAVFDVLFGLFSGTRQQHSPAHQQRPPPHRGTTGAKSSLLTVNNG
                     GGGGATVSTAHIQSGSSPVQDGEDPLPQPMVCAGRDDDGQRTWRDKRHAEACSNSYPQ
                     VAARPIIDNAGGKGGHGDAMASREVHSPEASSPRMRVSKARTSTAADFPLFISKRLQP
                     AGCLDSDISVLPHQNHVVPGLPLSLTEDWLLPLRQALVNRTIFLLVKPGSEEAPASSP
                     RRANATSSAEGSDSAMNERVVQRFLRFAKTHYGVTVQPWRVITFSYRDATRARNVMLA
                     VYGQRLRKKQQQQQHEQSANWRPASETLSPAPLTRGAGADDVAGTASPADGADVLAAS
                     TAPPVPRSGCSVTPLEPSCVTPGLPVIATPGGAQTPRGASLMSTSRLTLTSLVGGSEW
                     RRCRNDGASRPQDDEGGQQEFSDPFYTLTQELSVQPLPTALEEYRPLLERHAATQMSA
                     QSGASAVAATTSPASGICTQASCAGGTGPATSTIGEGVQALVDVARRLSSAAGSVPAI
                     EGPATGDVSDDGVDAAAAAACKHAQEVVWRASGAAGVSSALRHFQHAATAHRVGRAAL
                     PVMMWSWQLCSLLPVIIKDAQSRRNRLLHNSRHCQHKLQGVQRSITLHLAASPAKNVA
                     ALEVRLQAGFNEMAQRFLRDLRRLFISTASTATTAAFSPISQVSSPLWPATGAPGHGQ
                     RQQQALPLAPLDALLVYDSPGLREAYQRLARAVLRFHAFYLAGHFAFDARMPSQPSRT
                     GHDAAHERKLSQSPWPISVYEQRYAALREAVCLSQLPPPPPPPPPTRAVTPATKTPTI
                     PAVRLTPSGSAARTPASTKSEAEETPVPKVELRSNSRRRSSSRITSAAGSAASLVEEP
                     SPLRSVRRREPAAAPHRESVEGGGGGRRSQRSFLSPSFLASAAREVVAAAACPRVACT
                     ELTAMKNGMDSVSGVPGWERGTRGISSEQVADEGADGDGTPRLSLEELQQRRVAMEHQ
                     LIAHVSQINTEIINFLLATCVAAVPHLQQDCIGAELARVKDAQAEMVSSFTTAVRGRK
                     DAAIAMSHLYARLEEWSAEMSHLVSVVRSRPYLEKFITELRAALCEDEVRALAVFRCD
                     SGDRPDSGTAAWQMPQVDDTSPSPSSAATKARRGIYATAARLPLASARASVSASGGLL
                     DSTLKGSAEQNAAAPSPSGTPCACASKSLAAEVGYRSARMLRYYTRLACKRRGSSGSD
                     KLSDTSMAANAQRSGVFGEMLASPSPSRSLRSIQGVNSTLTSPHRSSRVKGGGGSGRG
                     ALGLSTSLSSTSAVWSREEACVRVEGGARALRVYDAGDAKTTALAFFASPTQPVVSAV
                     AAEVLAMLEVRKREPLRSPSSTSAAQAVVGAESRGAARDGAASSATPAAAPAHRSVDA
                     DGSAWQKRLVQWRSAMTDAERPADDASAAPLLWIVLDTWDETLLRMPYGLLLQLDTPS
                     YAESLNHMSDELLNTQESWKRSCEGLLARIQRQLQTLEGDLKKISDDRGEVRTEYVRE
                     LRAVFDAASDLIASRDDATAMSACPFCELPGSTRGGIRA"
     gene            <507574..>510978
                     /locus_tag="LMJF_07_0960"
                     /db_xref="GeneID:5649260"
     mRNA            <507574..>510978
                     /locus_tag="LMJF_07_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680955.1"
                     /db_xref="GeneID:5649260"
     CDS             507574..510978
                     /locus_tag="LMJF_07_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649260"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ1"
                     /translation="MPPLLRGSVLPAPSVCVFPAPRHDVFPVVSGLRADSANGGGAVG
                     LSVAPLTTTVANRSVEAALLRREWELRSEYYRLYAEDQWHIRQQRETKRRQDDEAERQ
                     RVMELSRLIEEERARRVAEQQERLLQRERELEEWKLERLKEAETARRRQQEEDERRRE
                     LQHERELARIKEEAASRAVSAQKAEEVMAAVEQSLQKMQSAMQEQLREEVRGLEAAHR
                     SELTRREEEWVHRVNAMEVSRSTELAELTHQLKLDQTRATRSEEQLCEARNQLTKLLQ
                     EVDQLRLQLQSSCPRSEQDRKAAQQLVATHRSAIERLQQMYDDDKRAQQHRYAEDRDR
                     AKYEQDRRLEELKDCHAAAIRCKDSEIDHLISRVRQLETDLHDESVKLALLRTNGGHA
                     ISTDIEKARMEDEVRQLHTAKAELEEIKRRLERNLREAEARVESQSRQLRELQTDTAS
                     GQRQLMAEREELRRNNTDLKSQLAMARDGYEEEVERLQKKLKSAEEAAVKLNVPDIEQ
                     NARNAVERAEEARRSAEKNLAEVTRKLKLAEEEAQSSRRSAEAARGDVVQARSRIQEL
                     QAKLEERSAQVRTLETEVQGNASLGYEAREAKRRVERLQAEYDAERESCRRQYEAALE
                     AKDREVQQCRADLLEVNKKLDALREESASSKFDKEGHQQRLTCQLREREEEVAQLRRQ
                     LEDSRQSLEQWKATYDELQQRSGTSTDGYQKAVREREEELQECRRRLRQLQEEKAELE
                     HRMRAEETARISATAQSNDAQRVLREREERIERLEREVRDLRAQLVPLSAPAVPVASP
                     LPLSGPPPPPPPSAPKVPPLSHAALTGVPSITAGTTVASCGAAPSVTPSANVSGAPVA
                     PAVHGADGRPTRVPPAPASAWDGSHPPPPPPSIPAAEKPPAVALQLTPFLDHGTTMAD
                     GATEGTPLSIPVPVSLSLSSFHVGRRSGEGPSLTVAVPTPAGALSHTTSPAQYAISPT
                     PVTVAPRSPRGGSAALQAAHAPSVPTPPLLLPAPATATTNVSTGTYSIPSPAAPPPPP
                     VPSVTGGIHSGGVGGAPPVPVPAISSYAAVPVPKVSVPSVPVPAPSSTSPSPSAGGYS
                     APPPPLPIPVPLTVQSLTSTSVPAASGSVDMDGRHGHRSHRHHHRS"
     gene            <512694..>515333
                     /locus_tag="LMJF_07_0970"
                     /db_xref="GeneID:5649261"
     mRNA            <512694..>515333
                     /locus_tag="LMJF_07_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680956.1"
                     /db_xref="GeneID:5649261"
     CDS             512694..515333
                     /locus_tag="LMJF_07_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649261"
                     /db_xref="UniProtKB/TrEMBL:Q4QIJ0"
                     /translation="MALPAFGCEQQRSYTFPMHCKRSLNPTLTHQFEVTWPWPALQRK
                     RRSRVASGTGNAQVVVSSSNTPQGVLFKEEDEAEEGEDDEGEVPEEGTGKEGVPGSDA
                     SAAVCSSVSPLWRERRRYGRPTFILDLSSDPFLGGHETRRASVLLSPGHRCLLPLVEL
                     GEPAQLPDRAGVAFWRTAFKPPSRRAESLSSSSHPSAAYQPPYCAELVVGELPRIERA
                     VRQRRERAIASPRRNKTHASMRPSFLSRILLEPLTQLSAPPPTAGEEENLPAESPGRP
                     SPCAKPEKETAPASSVTSATEHGHGQIAAASSPPAASSRSQRGSAFAPTPVLTFFFYT
                     IPFRLRWLSQLPGCIVVSLPCEERLLTLHAPHANGDHSGARQPSPSLVRGGGSTTPTA
                     IIAMSEVHSYALPRGVVPLDISEVFDRPFLAIGTAEHGVLLCHLDTSTGAVQSIARWI
                     SLRGYGSSLYPVTRLAAVFPARQPERAPGCFTDFPAAPPWARHAADLESLNDGALVCS
                     SPYEATTAVVKLGVAAEGVVEDFSVLRGVDTILDVSATVQPDLGPLVCTVARKLLRLR
                     VVDSAAEAAERRTAILKKKLDSGLADRVSPCLTYDRMARLECPVLHVASSPAVVQSFT
                     EKYVSRRSYTKHWQFAVDSSNRVALLDRTVSQYIVHSTFQLCRRGSAAGEGRVAPASS
                     LLPVSITADRRNERRAKSPCAGEEEDVLGNGCEAAAEDNEDNMPLPSPPSTRLSPTPV
                     GGQKRPRPAPKTSRSKRRSEPAAKRRGAAAVPSSAGAAGAKEERDEDEDDGEDDASPG
                     KVNSFHAFASAIPIEDACSGVVVTRVQDQMIQVAAAHDRDCISLVTWRIGLVTPPPSP
                     MSSAAATTITEASAACGMADAQP"
     gene            <516266..>516625
                     /locus_tag="LMJF_07_0980"
                     /db_xref="GeneID:5649262"
     mRNA            <516266..>516625
                     /locus_tag="LMJF_07_0980"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001680957.1"
                     /db_xref="GeneID:5649262"
     CDS             516266..516625
                     /locus_tag="LMJF_07_0980"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001681009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649262"
                     /db_xref="UniProtKB/TrEMBL:Q4QII9"
                     /translation="MEEFYGMEVFAGKTAKPNISADRVLHVTQVALPPNASHAITLLV
                     KTEGKSFVLATLDPQQALFHVSVDMLFSGKQKLAFTCEGATGAVHIIGYTQLAEEEED
                     AIDDEDDDDMMDDEDVA"
     gene            <517961..>519019
                     /locus_tag="LMJF_07_0990"
                     /db_xref="GeneID:5649263"
     mRNA            <517961..>519019
                     /locus_tag="LMJF_07_0990"
                     /product="putative nucleolar RNA-binding protein"
                     /transcript_id="XM_001680958.1"
                     /db_xref="GeneID:5649263"
     CDS             517961..519019
                     /locus_tag="LMJF_07_0990"
                     /codon_start=1
                     /product="putative nucleolar RNA-binding protein"
                     /protein_id="XP_001681010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649263"
                     /db_xref="UniProtKB/TrEMBL:Q4QII8"
                     /translation="MEGFYGIEVTAGKQVKAKIPEECALRVTQLAVPANAAGAVSLVV
                     SFEGKLFTIATLDPKKGVYQMSTDLVFTEAQDVSFSAQGAGAIHVTGYVQPVGNDDMM
                     MNAMAGESGEEDESDDDDDDLEEVSGSESNEIAKTPASAAAGAEDSDEEGEDEDEDEE
                     DEEDEDDEDMPPADLDDSDMGEEDEEVDEEDDDEGQVDHEEGEDDEDNDDDDEDEDEN
                     EDENEDEDEDEDEDDEDDEDDVPRKFQRAERGDHRDGFRGGRGGDRGGFRGGRGGDRG
                     GFRGGRGGDRGGFRGGRGGDRGGFRGGRGGDRGGFRGGRGGDRGGFRGGRGGDRGGFR
                     GGRGGDRGGFRGGKRGRY"
     gene            <521699..>522685
                     /locus_tag="LMJF_07_1000"
                     /db_xref="GeneID:5649264"
     mRNA            <521699..>522685
                     /locus_tag="LMJF_07_1000"
                     /product="RNA binding protein-like protein"
                     /transcript_id="XM_001680959.2"
                     /db_xref="GeneID:5649264"
     CDS             521699..522685
                     /locus_tag="LMJF_07_1000"
                     /codon_start=1
                     /product="RNA binding protein-like protein"
                     /protein_id="XP_001681011.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649264"
                     /db_xref="UniProtKB/TrEMBL:Q4QII7"
                     /translation="MMQEFHAFSVSPNKEHKLEIPEGCGFHLSVVSLPRGTNGKSTVY
                     VSADGKSYALASLDSQQSVLQAPTDLIFNYQQQVTFFAKGSATVHCVGYRQELDLSDD
                     DDDVPFAMESGSDDDTGAVKKAAVKLPADAITDAETAKRKPAAATESVSEDEEDEDEE
                     EELTDSAEDASADAASDEGSDGEEMEEGEDEDEENDEEYDDDEIDSDIAKEPKGMQTR
                     HVDPTAPSSEDEEDGSDGNDDEESDEEMDSDDLAAMEEDEEDVDDDDEEEAEPPMKVI
                     RSEGRPSGGSPQGRPSAGGSPQGRPSAGGSPQGRPSAGGLPQGRHRPATASK"
     gene            <524024..>524728
                     /locus_tag="LMJF_07_1010"
                     /db_xref="GeneID:5649265"
     mRNA            <524024..>524728
                     /locus_tag="LMJF_07_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680960.1"
                     /db_xref="GeneID:5649265"
     CDS             524024..524728
                     /locus_tag="LMJF_07_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649265"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="UniProtKB/TrEMBL:Q4QII6"
                     /translation="MLLLLFRPVYQCTVALLCRSLPAYHPCLLSTDSPPPFFTVFCHL
                     DDALHAMRRRSCSLRRLEVHTKRRAHAIMAELANPNPTVFEPTHDPLKGRTDAERAAE
                     DDEDTEDPIDAWEVFEMIRRIRDPEHPNSLEQLKVVEPSLITVDWKKRHIRVLFTPTV
                     PHCSLTTLIGLSIRLQLERSLPEYTKVDIYVTPGTHEQEAQVNKQLNDKERVAAALEN
                     RNLLNVVESCINEFDE"
     gene            <526001..>529669
                     /locus_tag="LMJF_07_1020"
                     /db_xref="GeneID:5649266"
     mRNA            <526001..>529669
                     /locus_tag="LMJF_07_1020"
                     /product="putative PIF1 helicase-like protein"
                     /transcript_id="XM_001680961.1"
                     /db_xref="GeneID:5649266"
     CDS             526001..529669
                     /locus_tag="LMJF_07_1020"
                     /codon_start=1
                     /product="putative PIF1 helicase-like protein"
                     /protein_id="XP_001681013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649266"
                     /db_xref="GOA:Q4QII5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QII5"
                     /translation="MTTPDAVGAAAAQDVSSPRRSSVAYPLTVSTTEHVAEITAPENG
                     QDAEEVHSCMTLSSTATSPGTSPVVAALPPLPQQRRVLLSSSSNERQYTLPATASHTE
                     ETAQPLSCSGSLPSIITAFTPPATTGETAAHAPPSVSPAPSKPPVGPSAAAATAMLTR
                     YTRALSDAEKQDVKHEARGRPYMLLDSDCSGRSADCAAGTRAASTANEQQRRSLHATE
                     TRAPPPDGTVCDVEEAEEAAPAAPSAIIRPAAAERALSSEQRYAFHVAVKEHRSVFIT
                     GGAGTGKSHLLRTIIRALPASSTFVTATTGIAALNLSGSTLHSFVGCGIPDRNSKGDS
                     LLSIVLSKQRCVRSWRTCRVLIIDEVSMLEPSFFDLVDYIARHVRNRPHEPFGGIQLI
                     LSGDFLQLPPVSRERRGSSPQFCFEAEAWWRVNPRVCLLSMPFRQRSLRFFAVLNEMR
                     VGELQPDSVELLYSMDTTERVHFVRRTDVATGVTVEDDHGAPGVVRVGLKREADVSAE
                     AAVRSAAACKTEMSATNMRQTRLELVNGFGRAMDAPFDGYTILRSTRAEVDAENERYY
                     RQLNTEIFMYHGFHTGKGDFPDSTLTRIVHLRKGCRVMLIKNFDPRLGLVNGSTGTIT
                     DFVSFANGYLFKTQGISAADAQSICVGRGTMMDQWHTMLPIVAFDLRCADGTVATREL
                     VVEPQEWKEMLGSREVSRSVQIPLILAYAITIHKSQGMSLTQVDIDFKKVFESGQSYV
                     ALSRCTDMASVRLHGFDAHRVSANPTALAYYKALALQQERLRWRRTHVPQMVAAEEAM
                     EAFSCTPYGYVLLNEAETLVRHGREDRATGFSTSLDSFASTSTLSSRSPASDGDRLKS
                     EDFDEGNGAAVKVVGKERRDGWGEGRTQRRRQKHHRHREGHAWAGDHSAGRSRAYARD
                     GLDGESSDGSDEDDEDGDDMNETVRLDKLRRRITPLLTTAAMVKRLVTRQAMPLHHVR
                     NSRIVVDAHALFQLVAGPESAAAFDVLFGQQDNMMRVPLCVHTLVTEAAAYRSCSESL
                     SQPVSPHQPVDGSRSSHGDALVGYDTLRGGLGGARREPFDAPLLAASHAAAEALAVME
                     RAKQDFILDVQRPEQTCALPAADLGWLRFTVVLPLLRHRQAKARAKDGAGVDAASDAG
                     GTCREVDFILNRDPREILHHRAILEYAMYLQASFGEGVVICTDSVLLAAYAFAWRLRV
                     ASMDYLCGDNSGADDVAA"
     gene            <530703..>531050
                     /gene="PIN1"
                     /locus_tag="LMJF_07_1030"
                     /db_xref="GeneID:5649267"
     mRNA            <530703..>531050
                     /gene="PIN1"
                     /locus_tag="LMJF_07_1030"
                     /product="putative PPIase"
                     /transcript_id="XM_001680962.1"
                     /db_xref="GeneID:5649267"
     CDS             530703..531050
                     /gene="PIN1"
                     /locus_tag="LMJF_07_1030"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative PPIase"
                     /protein_id="XP_001681014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649267"
                     /db_xref="GOA:Q4QII4"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="UniProtKB/TrEMBL:Q4QII4"
                     /translation="MPTSSWRAEHLLIKHSGSRNPVSRRTGQPTTISYEEAVTELQKW
                     CQSINDGKVTFEEAARQRSDCSSYARGGDLGVFGPGEMMKPFEDATKSLEVGQVSGIV
                     VTDSGVHIIKRIA"
     gene            <534477..>535049
                     /locus_tag="LMJF_07_1035"
                     /db_xref="GeneID:12982576"
     mRNA            <534477..>535049
                     /locus_tag="LMJF_07_1035"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_003721730.1"
                     /db_xref="GeneID:12982576"
     CDS             534477..535049
                     /locus_tag="LMJF_07_1035"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_003721778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1035"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1035"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12982576"
                     /db_xref="UniProtKB/TrEMBL:E9ACQ3"
                     /translation="MRCATRISRSLFKGADRGTGSPWCGTSIVRAVGAIHGLQVGTLD
                     ITGVSAGLQCTLSTSSFFSVDDDGGGGPAAPLLPSERAELHTPGVVAQPEMSTEGSVY
                     IVHVVGPAAFVAVVAEVLSDDVLVDLAGRYHVEPYAYWRSGKHKCPTVRLSYDRLRRT
                     EDSLRILRAPDNTVARQRRLYHAVFLASQP"
     gene            <536290..>537264
                     /locus_tag="LMJF_07_1040"
                     /db_xref="GeneID:5649268"
     mRNA            <536290..>537264
                     /locus_tag="LMJF_07_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680963.1"
                     /db_xref="GeneID:5649268"
     CDS             536290..537264
                     /locus_tag="LMJF_07_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681015.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649268"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QII3"
                     /translation="MMRCGNGSGPAAPSAASPRSHEGCLPHWMECSSASSSFVEDRVR
                     CLVHPVGVTSLLPAPLQRILANVLRILQQERAQLKGQRPCRRHSRSLGTGVDAEVTEC
                     IVDAAQAPSLAAAADIFSAFVAAHPMDGLALLSSPVALVGAALAEVVTLGQVESCVIP
                     MPELLSFLDAAISVGHPGAMHSVAICLREGTAGLQRDVTSSETWLRCAASSGYLPAMH
                     ELGETYERGAPASSKLPAGAAEDAADWGEAMQWYRRAAEAGYPPSQLNLGKLLLAASE
                     HAQSAGSAAAPQVAHLFTEAKRWLHACAATGVEEAVRLVKRIEEQGAR"
     gene            <538323..>542057
                     /locus_tag="LMJF_07_1050"
                     /db_xref="GeneID:5649269"
     mRNA            <538323..>542057
                     /locus_tag="LMJF_07_1050"
                     /product="putative cation-transporting ATPase"
                     /transcript_id="XM_001680964.1"
                     /db_xref="GeneID:5649269"
     CDS             538323..542057
                     /locus_tag="LMJF_07_1050"
                     /EC_number="3.6.3.-"
                     /codon_start=1
                     /product="putative cation-transporting ATPase"
                     /protein_id="XP_001681016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649269"
                     /db_xref="GOA:Q4QII2"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QII2"
                     /translation="MPTENIVENTMIRQLRLLRRREWYTWITVWPFTVLYVVSVVLYL
                     YPELVWDRVTYLVHQTYIDFFHAICFPILVFLHSFLSLFTIWSVRFRARIIYRAVAME
                     QLTEVTDVLVETHLHKGESEIVPLHQEGDDGQPPYFLFQQRKWKLDGRGGVFVKPRFP
                     TKHSFSYYIHWEGLNKEADRTKQVDAYGLNKMEVVIPEFQDLFVDHALSPFFVFQMFC
                     VLLWCLDEYWYYSLFTGFMMVGMECTTVYQRIRNMRTLRDMAEVPVRDIDVMRGGKRV
                     TIKTDALLPLDIIVVPSNAPCPVDALLVKGTAVVNEATLTGESTPQLKEAPDDVDVAL
                     SVKKHARHMLFSGTQILLSNGPHEASEEGAHNRDRSTALAVVLKTGFETKQGKLLRTI
                     LHSQGRVSENSGEAFGFIGVLVVFALAASGYLLKRGLADPHRSRWKLFLSCVQIVTSV
                     VPPELPMELSLAVNTTLLALTKLQVFCTEPFRIPYAGKVDTCCFDKTGTLTTDEMLFG
                     GVDMIDGKGLLNKLKAIPKYSEMVLATCHSLVYLDEETLAGDEMEKAAITALGYRIDS
                     EGSILYDPKLPRGGDREGQATAKKGAAAPQTTYKVLLRFPFLATLRRMACVVSAPDGK
                     YIVAKGSPESITALCESVPADCLKIAEETAAKGYRVIALAYRSLTDAERASKETILAL
                     RRENIEKKLQFAGLAVYVCPLKKDAKETIENLTGGSHRCVIITGDSVQTAISVGKDVS
                     MLLCKRQLVAKDAAGGGVEWVDSVPSVVQPGTAQDIIANTFQRSRRHLAPREGEWDLC
                     VNAETISPESMQHIIETYNEHVTIWARCAPTQKEEIVTDLKKKNHVVMMAGDGTNDVG
                     ALKQAHAGIAVLNSASVAPKAENKELVVGPQPHNEPDVPADLKVPPNFKFTVLPPEPP
                     VGTPFMQMMQWKMLEAKRKVEIKQITAWNKQLKEAEKAKAGKKAAVPPPPSNGTGDSD
                     FLMESLFNSDDENMGGPPMIKLGDASIAAPFTCRSKALTSVCDIIRLGRTTLVTTHMM
                     YKILALNCLTQAYSMSVLHCAGVKFGEKQMILAGIILSVCFLFMSRSKPLTHLCRQRP
                     VTKVFHPYMICTVFFQFALHLYCMMKTLWMVAEVDAATMSDMGKNYEDVEFKPTLLNS
                     TMFLLTTLISGVTFAVNYRGEPFMQGIRKNRPMLIALIILGFVVFCFASEASPELNEE
                     FEITVFPTEEFRTRFTQLLLLDAFGCFVIEKASLMLFTDY"
     gene            <543940..>544278
                     /locus_tag="LMJF_07_1055"
                     /db_xref="GeneID:5649270"
     mRNA            <543940..>544278
                     /locus_tag="LMJF_07_1055"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680965.1"
                     /db_xref="GeneID:5649270"
     CDS             543940..544278
                     /locus_tag="LMJF_07_1055"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681017.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1055"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1055"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649270"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:Q4QII1"
                     /translation="MSSPAATPMADAGEERPPLTAPAPTEDNLLPAAAATNAAANDDD
                     LSTLSTQVYLERTVLGVLALALEDVCRVRPPNPVDYLGSYLLRRSTANNTVEVTYEDT
                     VPKAVPTTDE"
     gene            <545218..>546759
                     /locus_tag="LMJF_07_1060"
                     /db_xref="GeneID:5649271"
     mRNA            <545218..>546759
                     /locus_tag="LMJF_07_1060"
                     /product="putative lipoyl ligase"
                     /transcript_id="XM_001680966.1"
                     /db_xref="GeneID:5649271"
     CDS             545218..546759
                     /locus_tag="LMJF_07_1060"
                     /EC_number="6.-.-.-"
                     /codon_start=1
                     /product="putative lipoyl ligase"
                     /protein_id="XP_001681018.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649271"
                     /db_xref="GOA:Q4QII0"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="UniProtKB/TrEMBL:Q4QII0"
                     /translation="MWQTVVRRYRLQPTSLAAFLESNCMVAKPPTAALHSDSNLVVAE
                     TNSLSIFENLAAEESLIRGLSLDTKQRLLLFYVNRPCVVVGRNQNIFQEVSLRRAAAD
                     GVCVARRASGGGAVFHDEGNLCFSFITHRTRYAPEKTIQLVRLGLCASYAIDPARLTT
                     TGRHDLFLDGRKITGSAMRVQRDIAYHHCTLLVDTPHASVGRYLRPEGDYVAFKTSSV
                     GSVRSPVTSLAESGCIADGPGAVAALKGNMADFFLAEGDRVLNAATPWELDAVELRQR
                     FTTARHRCANAPLFALDVVGAVAADMPFIEREGRQPARGDAATLGEAVHKAASKEWAY
                     AMPTFTSTVFLSDSELRRRLKTLSVRQHVALLCSLAEEELLAVLQRCVLEGSEGPEAV
                     AGTEAGLHLVTTVEHRLVTSVVVRRVAPTTATASAVAPSSASSGGWVQRYLSALLVGH
                     PCDAAIEGLECVGDTTAVVQGLVHEAGSLCPDLPDAVGDAALLMVARVLLDVWRDKNV
                     FDIAT"
     gene            <547167..>548672
                     /locus_tag="LMJF_07_1070"
                     /db_xref="GeneID:5649272"
     mRNA            <547167..>548672
                     /locus_tag="LMJF_07_1070"
                     /product="putative RNA-editing complex protein"
                     /transcript_id="XM_001680967.1"
                     /db_xref="GeneID:5649272"
     CDS             547167..548672
                     /locus_tag="LMJF_07_1070"
                     /codon_start=1
                     /product="putative RNA-editing complex protein"
                     /protein_id="XP_001681019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649272"
                     /db_xref="GOA:Q4QIH9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017083"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH9"
                     /translation="MHHYQLVSSRQRLPYKGVGPISHTHTHTHLHTRTHTHTQRQLLP
                     PTLFPSSALMRRIGVATCQRRWLASAMLPRAGKCGTPWSGHSFILDTAASLTTAVREV
                     RSTAVCCAPKDAQYQCGECGKTFRLVNALNHHIMTRHGNNAKALMKKDGKLVPVETDQ
                     LKGGAHCVSSSSSSTATASSATPAGAAAAASSSPLSGGTTSPFPVHFAAPFGAAAASM
                     GGVASSSTPPGTAPGVLQAPATAAAGATTAGTDENGSGADGAAEEREKRMFVCTVCQK
                     TFRLEAALQHHYQAKHNMDMPTSASSPSARGGASTTAGAGGASVSTPGEPGANGGGSA
                     GAFGGVPGVAADGAAAPANASSFGAAQYVRQQEGALPDAPQYHLDVAPNAPEEGDIAA
                     HWRCVNMCVLMGDVQEVEEGYVFEDHVLQFTVATEFATPAPGDPDMDFHTVRVYGHEF
                     WAPLKADMQSGGRFLVTGRLCMVPQFDTQLKKYYHYPVIQVFPGTGNVVRV"
     gene            <550155..>552674
                     /locus_tag="LMJF_07_1080"
                     /db_xref="GeneID:5649273"
     mRNA            <550155..>552674
                     /locus_tag="LMJF_07_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680968.1"
                     /db_xref="GeneID:5649273"
     CDS             550155..552674
                     /locus_tag="LMJF_07_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649273"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH8"
                     /translation="MNVLHKASADGRMCCAANEEVWVAKQSGGIAVFSARSGDHVTDI
                     ALRADDGSTAAQVTHMMAVFGEVWVSTKEGRVHFYELATHTPVDSMLIPGAEKKVQVV
                     NLSFNGHVAIVATASGSVYVHHPVNHQRLGTLSTSASPCTAAIQFYSFVVGGDASGAL
                     YLWDPVTGECVIYHGGSKSEVVALLHEPTTGTIWVSRANEHVDIYAVKDGALQLQHRV
                     SGIGRVTGMVAVSGTVVATTCTKRVVQIEATTAKITVNVAGAHDKFIHGCCKAMHQEV
                     AQVWSVGNDGALRVWLVAGLQVPVVPLPKLPPAAQAALTSAVEDTLNRQQSELRAEAR
                     AELHSRMSMEDKLMKAREEAQELRLRVFKEEERRLMVDVELTAERKHRNELEERNAKL
                     AKEVTDIASKVAVAERERNSLRVEVTQLKMDLSNARTETSVKQTEKSNIERQLSEERT
                     KKDTLEQRLRDVEGRLCSLQAEHRRVCEALGSATAHQQTSKAPTDESMSRGAALSAEL
                     EHARKMNALMGAAMASMEYTIRRREEEDRDLVALLNAFRGRVADRVTDPNLSALLLAT
                     IVRHAPRFDLPCNEFTKAELMERNGPFLQFIQTLRAADPEAYRKLMQYLQNPSMAQGL
                     PAETQALLDRFVALASKEGEMSGEDIANFKKTILCLTDSVSVQDAGQIASGSGTAPAD
                     FPALLGADAAGSGKPGGDVVAPGRLLGNNTGGGLTTQEEVANNALMRELHGQRVLDEN
                     YIREQQTMFEFILKTRRLLVESLAILQKRTVSARQVVDALGVNTSAHNTSSPATTPSR
                     RNLQTLHSIFSGIVRELEELTTEVVRRYLSGAEKQRLGVAQ"
     gene            <554299..>555552
                     /locus_tag="LMJF_07_1090"
                     /db_xref="GeneID:5649274"
     mRNA            <554299..>555552
                     /locus_tag="LMJF_07_1090"
                     /product="delta-5 fatty acid desaturase"
                     /transcript_id="XM_001680969.1"
                     /db_xref="GeneID:5649274"
     CDS             554299..555552
                     /locus_tag="LMJF_07_1090"
                     /EC_number="1.14.99.-"
                     /codon_start=1
                     /product="delta-5 fatty acid desaturase"
                     /protein_id="XP_001681021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649274"
                     /db_xref="GOA:Q4QIH7"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH7"
                     /translation="MALDNVRPHQPNEVLIDGVLYDCTDFRHPGGSILKYYLGSGDAT
                     ETYQQFHLKLPRADKYLKRLPNRPAPPQHSVNVDEQKRLEKLSRDFKALQDACVEEGL
                     FNASWPHIVYRFSELILMHAIGLYMLFRLPILWPVALVILGVAEGRCGWWMHEAGHYS
                     VTGIPWLDIKIQEVLYGLGDGMSASWWRSQHNKHHATPQKHRHDVDLETLPLVAFNKI
                     IARRGKRNASIRRWISLQMFLFGPVTCSLVALYWQLFLHVRHAMRTQRYTEGSAILCR
                     WIVVGVICHQLQVSFWQGLGGVLFSQAFSAAYIFINFALNHSHLPMLPEDEHAHFVEY
                     AAIYTMNVTPSWFVTWFMGYLNYQVEHHLFPTMPQFRFVQLAPRVRKLFEENGLKYDS
                     RPYMESLQKTFKNLGDVAEFIVAGN"
     gene            <557093..>558013
                     /locus_tag="LMJF_07_1100"
                     /db_xref="GeneID:5649275"
     mRNA            <557093..>558013
                     /locus_tag="LMJF_07_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680970.1"
                     /db_xref="GeneID:5649275"
     CDS             557093..558013
                     /locus_tag="LMJF_07_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649275"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH6"
                     /translation="MTMGASDDAALSSEASLRSSSSGSSAAPLSEDDDMQDKRARCAA
                     LKSLSGQHTVETVEVTKLRLQREQRLRRVLSQRHLGQPEPVPQNAFYCTRAALSEEDT
                     VWLYTLTNRACFERLMHDVHSTAMPALAGQLDAVLSHANPLFYFSYRMPVKVVDGAGD
                     AAATSLREAPAMRRWLEDTPPVLRKRPAPEKEDAGQQQRDADGELARGALQKHPKTSA
                     SSVSASSGLVAQSMKAWEAHLTATLTEEGETIENFRHSRTKSSYTDKKRFQEKAAWQE
                     YVREVRIQAQQRDREMKRALRRGEMDEPRG"
     gene            558687..559983
                     /locus_tag="LMJF_07_1105"
                     /pseudo
                     /db_xref="GeneID:12982575"
     misc_feature    558687..559983
                     /locus_tag="LMJF_07_1105"
                     /pseudo
                     /db_xref="GeneID:12982575"
     gene            <561270..>562358
                     /locus_tag="LMJF_07_1110"
                     /db_xref="GeneID:5649277"
     mRNA            <561270..>562358
                     /locus_tag="LMJF_07_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680971.1"
                     /db_xref="GeneID:5649277"
     CDS             561270..562358
                     /locus_tag="LMJF_07_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649277"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH5"
                     /translation="MSLKHVASFGAVGVLSVVGMLGGRRWHRVELRRAELNEEYTKLM
                     NEMRTFNEKRLTRDERLAAKEAEAKVTAETVDILWSDRLARYAQVNKDLHAYLAALPE
                     AIGVLKGLSNHYRYMSEEMPKFTGFDIACSKMHNLALMLEHGKAVGIERVAATVQAMF
                     VAEPLVQAVCTSILAAPAPPHPSSIAAASAAFTFCMEELDRAVGTVAMRYAAALEEPP
                     NATPGILSDSVRKLVSMMRTDTLCKGQRQLAERRRDLERTLRRAQRQLHTEEDIRAAL
                     DYTRELDQHLQAAAPRRTDLLLSSPSRKDNFLAAVRSDSEVKKAIQQIDLWRDSATTF
                     LVHRQAEDALQSYYFLLAETLTAVNELK"
     gene            <564202..>565242
                     /locus_tag="LMJF_07_1120"
                     /db_xref="GeneID:5649278"
     mRNA            <564202..>565242
                     /locus_tag="LMJF_07_1120"
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /transcript_id="XM_001680972.1"
                     /db_xref="GeneID:5649278"
     CDS             564202..565242
                     /locus_tag="LMJF_07_1120"
                     /codon_start=1
                     /product="putative proteasome regulatory non-ATP-ase
                     subunit"
                     /protein_id="XP_001681024.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649278"
                     /db_xref="GOA:Q4QIH4"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH4"
                     /translation="MVEACFLCLDSTEYMRNGDQYPTRMMAEQDAACLLANAKLQANA
                     ENTLGFLTTGGNACTVYETLTNNVDAIMTSIGSIPVNGKRCNFSSGLQIASLALSHRT
                     NSRAEKRIVAFVGSPIGETAAELEALAKKLRKDDVAVDVVAFGVESNVELLQAFVKKV
                     SKKENSRFLAVAARENLTDKLMSNAILLGEDLPEGAEGGGASMSGFGVDPNMDPELAM
                     ALRLSMEDEMQRQAAAAAAAASSAAPESAPASGSAATPAAPAAPAAAPVVDEDELSYE
                     NMSEEEMMRRAIALSLQDTAQGASDTASSPSVPQPATTSEACRNEEENEDDFAKGVEA
                     ALEEEEDEENRS"
     gene            <567491..>569221
                     /locus_tag="LMJF_07_1130"
                     /db_xref="GeneID:5649279"
     mRNA            <567491..>569221
                     /locus_tag="LMJF_07_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680973.1"
                     /db_xref="GeneID:5649279"
     CDS             567491..569221
                     /locus_tag="LMJF_07_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649279"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH3"
                     /translation="MSSSLHVLLIGTDAFHVEGALQGTAVHTHRAWNTSYQFSCTSAL
                     SVDKVDKRLLLVCHIIVLCKGCRSPANKSSYSDRAVLALPDATAGCVEELRDNAFFYG
                     TCPLEELKTRVLTIGLAPPHVIFDAVHGCFTPVGKAAFERAFWLFDRDADGLLRLPEL
                     VGWRKQVEAAAYSAEEDIGLFLSEWGGAVAAEKLADQAQFLALHMEWLQKGYTLEAWA
                     TLHATGIHPDGLPYSWYDLHCIRVDRGTNTYLSSHAIQFFTNVYKLKRFADTPDMWCI
                     TPGCPWDSVEGFRKTHMPMVKFVEYWKYMALVQRDEVIRYARYWGYKGEISYLFTRRA
                     ARAYRLPDETVPNTIHVLVAGSENCGRRSLMNALTNSGPDGFQGSEHPAGTYVRTTTF
                     FATKGHEGVEEAQTLVYSTTSAEACAQLLSDSELSKTIDVVLLCYDGTDIDDSGAYAM
                     SLFEQVSASDACERLPFVVAMTKADAAQPVAGGKETRAGQRLKDFCLAHQLLWPPVIT
                     SSEQPDQSEAASLNEYMYAVASDPALAVGQPPLTYVRILRRATFVAIVAVAAARIGQT
                     LVSVLRRRRR"
     gene            <570090..>570620
                     /locus_tag="LMJF_07_1140"
                     /db_xref="GeneID:5649280"
     mRNA            <570090..>570620
                     /locus_tag="LMJF_07_1140"
                     /product="putative methionine-S-sulfoxide reductase"
                     /transcript_id="XM_001680974.1"
                     /db_xref="GeneID:5649280"
     CDS             570090..570620
                     /locus_tag="LMJF_07_1140"
                     /EC_number="1.8.4.11"
                     /codon_start=1
                     /product="putative methionine-S-sulfoxide reductase"
                     /protein_id="XP_001681026.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649280"
                     /db_xref="GOA:Q4QIH2"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH2"
                     /translation="MPAPIRATFAAGCYWGTEHFFVRNFKDSIVSHQVGFMGGIEGKA
                     VTYSEVTKGTTGHAEVLDLMYDPEKVSYKDLLSFFFRMHNSTTVNRQAGDIGTNYRSA
                     IFYHNEEQKKEAEAYIAKLNGADEKLHSSFSKAFAGAPCITGLEKAGTFYPAHEGHQN
                     YLEKHPNGYCSHRLYF"
     gene            <573903..>581531
                     /locus_tag="LMJF_07_1150"
                     /db_xref="GeneID:5649281"
     mRNA            <573903..>581531
                     /locus_tag="LMJF_07_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001680975.2"
                     /db_xref="GeneID:5649281"
     CDS             573903..581531
                     /locus_tag="LMJF_07_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649281"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH1"
                     /translation="MQQMVITYVLSGLANIADVNPRDVHTSLFNGNVRVNNLSLRPET
                     MNKILPLPIEEGTVPEMELQIPNPSTATPMEVKVHRGRLLLPLDLSSPPLDRTPEQIL
                     HGVTEHSILGAAAAEAADASSEPVSPVSEPEPASYDYSCANSDMDEEDFVSCASDGDL
                     SDSDSTCGGSGFGSPTSADEMQAAEVAKQSAGWFDYLRSRAAQSVEWIWRRQLRITFT
                     DLTLILPCDARKKIHFEISVNSFVVTIEPAQTTGREQMKIVSMEIGGGSVFASADDVR
                     SCVIVVEALSIKITTVYETGTERVLRKNVALSFNGTNTLTADEVTLLALLKCHLSRQM
                     RLSVPAYCLPFSSLRARGSLWPYVKCCVVQGLRDYRQRYNFNASHLRFYAHARERYVQ
                     LLNECHRNQNVEDRRQALADAEQDLRYEDVILYFRRLVQAKYAANAAAPVAEDVAKLE
                     SAVVSSTHFEWKLVKVVLPARNTVFARNTALVFRNGETVFTIASISLDTNGAVQTMIA
                     PTTSTVAPWELRNSTFNEDTALVYLHTKEDYVSSETKVILQQIALKGSMEGVLCCLMP
                     IAEALQQIGEQEKCGATTQVVQPGRLGIPPAAGVVRPSTTILAVHSVSVQLDDFCFLL
                     DRLSATSAKAPGTPDKLGCTLRQSYLRHKTTYVLAPLEVRMTARGGVVVSRVALEVPR
                     ETWTVWRRDADSLRLLCQKLPRLASAGVAHATAAPASSSPSTSLDALKAMTKVLQWSP
                     VSSCPPFEVEEVAVNFSPLDCTIALHQVAVQTVSPFPSRSYGTHFTLRHASVECHYTG
                     RLGLYIALEDGMRVGMSTEPAAALAMSIPSIYITGRRDKEAAELSLLEIRRFEAVTHS
                     TVQYASMSGVSVAGSVQLAEVDLIYKTDPSVAPLADRPCLTSYVQVAVRVNAIDLGQL
                     CAVPSHAVACVLGEIYRFACAEIVSEEYYRTFFSCFSDVALQVVMRECVVRYGPIGGH
                     PTPGKELLLSMSNTASEERVTALDVYQPHLFATPENFPILILNDVGRLSMDVDVSQLT
                     VLLSTPVATSPSSVAVIVNVMHWRMPLEKMPFWCAEAQEIPPVPQQITLEAVRVIARV
                     DRTRADLQPALAASLSALTAETVSGAGAAAADSPGLPISRDLQLSPSESDRGSCASST
                     EEQCETTQVSMRRWSVDVDLSAPVSDLGKLQHMLSAVASAQQCLTRRIVLRESVTATN
                     FDLDDCGDVFLDAPTQILVVESCSFRGSSSDRHVVVCPGTSAVFRRCVFPHRGGDDLI
                     RVSSRSALFLCEDCCAEGEAAPVAMASPAATTAPTVPSPRSSAADTGVRPRRRTQVTV
                     EEGCVSIGLDASSRVVLTQRALAFTYKQKTRRSFFKLRNGEVRIEYADAGQRVPVLTK
                     TSVEGDFALYLPNRSCSASCSVTCGEVTIPLLLSKVHAAQERLELLTSFSRAEAAGAA
                     ERAAASADDLSAVAYVVPPPPSASPEEQQRFPYNSWKLLLSLSLIPVTVRLLGGMTVA
                     RVTFSNAFVWSKREPFAEAQLEARIAVHDMALWEWREQSFQPVVASPVFVGVQGRMPT
                     SLSATVTASVSPIEAAVSTDQVKLMLHALSSKAAAAVSARAATARAQMESISSQGLCW
                     SNYTGVALQARGGHGAIVRVPARPQAAGDAPSQVSEATSAVAPFIVKEIDGTAVDHVE
                     RDVVEKEGSGTGSAPGYLTPLFVSRKTVVLADKRCFHVTSTLKRDLVHVISVRTLVQI
                     ENETPLPLVLTTGGQSAYVVEPFTLSCVPEAMLHCTDLGVAVKLTRAGAATLREPLLP
                     ESIPAMDFYQWCHQQGHAPADMAREFVSQLDGSSTFMVTMFELQGPVLLLRFRAARPH
                     VVNDTVYPLRVTAVNTLGAMLASEYVLAGGRAYFLNLPPTGAVHGDVHLCVDDDVYEA
                     HVDEALFDRETARRNSSVLMTHQAHPRRYFFHLRLSVESRGPAGEHGVAVTAGCHCLV
                     KNCTTVDLFFSTDEGDSVGTMGTRGLPGFTASGAVGYVPSNVVLRIKPKGAALSEAFE
                     IDGSGEGCVIQCDHAPEASAFSALYFLLRIVSASPAHRLAELLPAVVFRNRDARNTLL
                     VKHVVREAGAVKILEETVFEVPPHSDYCYYTLSKYGYTNDLLFAWCSSSGGCAATASS
                     FSSVVETDLAPGTTWSGLVCVGATHHQIDIAKGSLYETAYVTVGPAVLPRVKLVNLSS
                     INFRDVGRYQVAFPRPSKNNKYLLLTSADGAVYTVDLLQEEPLELEAGVTVQTIRDEC
                     DRCCVVLSSRWAFTTKGKTWAEEVQISVNVQTNGVSLRLRDASTVPLHLWWRSLAANV
                     LWTQTISLQCSVAGICLESNYEGRKQQVAEPFDADVSLREMRRTSRDVYLKGFYLGLQ
                     QLTITVSEVLLYQLQMVASCCRVDTMFDPLAWVQEPTVVALLRSLPATLPQHLHIGSA
                     SIAETPLELSWDRSTRPPHDFLLGDSAISKLIPSLHHAMLVLPKLQLRNVSRVSLAEL
                     IGRVRQILIMEVVKQIPKMVTTVGFFKKNSSLLEKVTSTVSSFLFRPSAATDTTDDGG
                     SALI"
     gene            <582350..>583825
                     /gene="AAT19"
                     /locus_tag="LMJF_07_1160"
                     /db_xref="GeneID:5649282"
     mRNA            <582350..>583825
                     /gene="AAT19"
                     /locus_tag="LMJF_07_1160"
                     /product="putative amino acid transporter"
                     /transcript_id="XM_001680976.1"
                     /db_xref="GeneID:5649282"
     CDS             582350..583825
                     /gene="AAT19"
                     /locus_tag="LMJF_07_1160"
                     /codon_start=1
                     /product="putative amino acid transporter"
                     /protein_id="XP_001681028.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649282"
                     /db_xref="GOA:Q4QIH0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q4QIH0"
                     /translation="MSRLPGEPLSDAAQRELTAPACHPEYESVNTKPESKLSGVTDQQ
                     DSNPELTKKPHVEADDANTGEPLDEDDAEEVPRKKHCSKFRRWVEKVVPPGGVIASSF
                     TLGSSTLGAGILGLPAAFNSMGFVTALLVLILVTVLTVFSLWLLARCSDAAKVRTYED
                     VARVLLGRGADYVAAIFMFGFCLGGAVSYIVSIGDLLTPMFDDPSVPEFLRTKIGNSV
                     ITSAVWFVVILPMCLPKNIDSLRHTSIISVSMVVFFVICIMQDSCDFMAKNGWREDIK
                     FFNTGNGAIQGLGTVIFACLVQINAQEIYYEMADPTPRNMVRNSTIAMSGCGLLYVLA
                     GVFGCARFGSTVKSSILLKYQPREAPQFWFAYFGIVMKICVAFALHQLPLRDSIYHFF
                     SWDVYRMPWWRNALICGCLAAFVLIIGLLVPDLSIVLGLVGSLCGGFIGFIFPSLMIM
                     YTGKWSLKNVGFLEWSLTYILLLVGVVAVVFGTCASIYSIV"
     gene            <589284..>591728
                     /gene="SCG1"
                     /locus_tag="LMJF_07_1170"
                     /db_xref="GeneID:5649283"
     mRNA            <589284..>591728
                     /gene="SCG1"
                     /locus_tag="LMJF_07_1170"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 1"
                     /transcript_id="XM_001680977.1"
                     /db_xref="GeneID:5649283"
     CDS             589284..591728
                     /gene="SCG1"
                     /locus_tag="LMJF_07_1170"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 1"
                     /protein_id="XP_001681029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.07.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.07.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649283"
                     /db_xref="GOA:Q4QIG9"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q4QIG9"
                     /translation="MQEENNVPAEWAPRDTHRLDLLQLLPPSQRHCGQSSAAESGQGC
                     HSRSRGKPEVHSTRASSGGKRSTGTLSRSDDCLNAIAQTPLFNSCGHPRRSAAQCLRL
                     HTRQRRLVALAVLLALIVMVHWVISQFTTNVGSQQKSSIELLNEANREYESSSPFSVL
                     VQHESAVERLTTTQRGLAASGAGSLARLDRDQLPSWTLRVIDEDCTMCLDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTDDVDVAAELPRWQWV
                     TWSYAQQRRFVHTSQSRSTGERPRHLIVLGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAEHDSEDSTHSAVDMVQLAPTVSEYAAATEQHLAVEGGDVN
                     NAPPYLQRRVVLRDGWRDIPRSDDAVWRSPCAGVRTTVVTAASLVAGTSSLAALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNSLWLDFLTDRKPTTKKKMGMGISWGIP
                     TEIGMSQKTVLWLNYAYTAFPDVPYIMKGDDDMYLKVPQYLSDLRHVRGGWQKPRNLT
                     VTIPHRGVIPPTLAIDDAEECLYRVWWIYSNKIAYGNGVGYILDRRLIQAALNPFDGS
                     NALLMKLLTNPYDYRLEKEYLSLNMQHEDKHIGKQIRDHHDAVERFCPKKRVCYMADR
                     RFRAHQILRPKPVKLTWISVMAHFGMSAIPYYVHYFHKNEFKVAEEAKRLIAQGIDVK
                     TIEENATQRMHEWVASQVPSTLVGLGASFDLDWVRGDPRTAYTVAEEDEVAVYDVRYK
                     LRRRNDIPCVLESDKR"
CONTIG      join(FR796403.1:1..596352)
//
DBGET integrated database retrieval system