GenomeNet

Database: RefSeq
Entry: NC_007252
LinkDB: NC_007252
Original site: NC_007252 
LOCUS       NC_007252             582573 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 11.
ACCESSION   NC_007252 CT005250
VERSION     NC_007252.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 582573)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 582573)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796407.
            On Jun 1, 2012 this sequence version replaced NC_007252.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..582573
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="11"
     gene            <1985..>2497
                     /locus_tag="LMJF_11_0010"
                     /db_xref="GeneID:5649890"
     mRNA            <1985..>2497
                     /locus_tag="LMJF_11_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681417.1"
                     /db_xref="GeneID:5649890"
     CDS             1985..2497
                     /locus_tag="LMJF_11_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649890"
                     /db_xref="UniProtKB/TrEMBL:Q4QH79"
                     /translation="MEGRLKQCSAMHVSAAAPEQSGRSKSELAYENRDLSEKLRSCES
                     ENANLSARNRELRKEVVVLQAENEALRRQKRMDEDTLEHLRKRICESERKERHLLVTV
                     AARELEAGSPLHEKEFQEIIRSSQQQLTAFYEEKMVAMQAEMDRFYAEASACIQEKDA
                     IIAALKEEEA"
     gene            <2936..>4033
                     /locus_tag="LMJF_11_0020"
                     /db_xref="GeneID:5649749"
     mRNA            <2936..>4033
                     /locus_tag="LMJF_11_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681418.1"
                     /db_xref="GeneID:5649749"
     CDS             2936..4033
                     /locus_tag="LMJF_11_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649749"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:Q4QH78"
                     /translation="MFPKPKEDYQREQTRWGAVLSVSTVSIVILLVLWEGAAYLRGRD
                     AYSTDVSLDKGLSEDMPVHFDVLFPFMPCNRLSIDVVDTTGMAKFNYTGRLHKLPTAL
                     DGEVLYKGSLKDLDNEMETEEVRTGKKCRQCPPSAFDGVAAEVRSAAASKCCDTCESV
                     LGLYKELGRGVPGTEYIPQCLEQLYQRASGCAVMGSLDLKKVPVTVIFGPRRTGQFYS
                     LKDVIRLDTSHFIRKLRIGDETVERFSKNGVAERLSGHKSSSKTYSETRYLVKVVPTT
                     YRKTKTKNAKASTYEYSAQWSRRTILVGFAGAVPAVLFEFEPAPIQVNNVFERQPFSH
                     FLVQLCGIVGGLFVVLGFIDNVVDWVVAFGK"
     gene            <4567..>5490
                     /locus_tag="LMJF_11_0030"
                     /db_xref="GeneID:5649750"
     mRNA            <4567..>5490
                     /locus_tag="LMJF_11_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681419.1"
                     /db_xref="GeneID:5649750"
     CDS             4567..5490
                     /locus_tag="LMJF_11_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649750"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:Q4QH77"
                     /translation="MFRTRFLGCALSGAAKVPEQLPDWAIEKRTYLSLALDRWALKVQ
                     RLATKLIAVSDRMMGVQPKEDLYRIPRLLKVSGKRPTVMDNCFIAPSAIVTGDVHVGR
                     KNYIGYNAVIRAEEGESIHLGESCNVQEKAIVTGNTTVGKWTTIEPMAIVESADIASC
                     SFVGASAIVMKGSSIESGSMLCTASVLQAGAIIPSGEMWAGNPAQKVANLTEKEKDAI
                     IKAAKHSVLLAIEHHDSWELTWEEIEDQRDARELFARYAESNRELRIKAMYIKEPPRP
                     NRKKMGRRTPHELVDGSENAPALAESIHQGY"
     gene            <6203..>7096
                     /gene="ABCH1"
                     /locus_tag="LMJF_11_0040"
                     /db_xref="GeneID:5649751"
     mRNA            <6203..>7096
                     /gene="ABCH1"
                     /locus_tag="LMJF_11_0040"
                     /product="putative ATP-binding cassette protein subfamily
                     H member 1"
                     /transcript_id="XM_001681420.1"
                     /db_xref="GeneID:5649751"
     CDS             6203..7096
                     /gene="ABCH1"
                     /locus_tag="LMJF_11_0040"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     H member 1"
                     /protein_id="XP_001681472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649751"
                     /db_xref="GOA:Q4QH76"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH76"
                     /translation="MDPIISCDNIHKTYLLGIEGVPALRGADVDINLGELLVLYGTSG
                     GGKSTLLNVLGTIDTPTKGNMFLFGKRVTDQTPDSELAAMRLQRIGFVFQSFNLISTM
                     DALGNVSLPMVIKGSLSASDIKKRATALLEEVGLGHRLHHFPSMLSGGEQQRVTIARA
                     LANEPEILFLDEPTGDLDTKNTLIIMNILLRLNRERGLTMVMVTHDVYIRQYAHRVIY
                     IRDGKVSTTETVHSNVRERAWNELQESLLKANTWTERPKTPTSEQRAPQDYATFSAQG
                     PLNLDEDPEMQQVVDVLFGPQ"
     gene            <7680..>10556
                     /locus_tag="LMJF_11_0050"
                     /db_xref="GeneID:5649752"
     mRNA            <7680..>10556
                     /locus_tag="LMJF_11_0050"
                     /product="putative SNF2/RAD54 related DNA helicase"
                     /transcript_id="XM_001681421.1"
                     /db_xref="GeneID:5649752"
     CDS             7680..10556
                     /locus_tag="LMJF_11_0050"
                     /codon_start=1
                     /product="putative SNF2/RAD54 related DNA helicase"
                     /protein_id="XP_001681473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649752"
                     /db_xref="GOA:Q4QH75"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002711"
                     /db_xref="InterPro:IPR003615"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH75"
                     /translation="MEYLLPVETCFRCGHRYAFRLSRFGCVFSCACDECIDVLKVAAV
                     FSAAVRGRTAAVPFVPVMSSPSCELTFSMKMVSVEMDFVRDRVSAHFRNFHDAEVARI
                     AFSLSLALREQLAGSGAVLTGPAPVMEQLTEELLESAQDPALPFFVSPPPPGLRKAVA
                     GILSSAVPETRLDRIPHLLRRTMKAHQVEGVRTALRWGGRILFADDMGVGKTMQALAT
                     VAALEAYPLLTVCPSALKLMWADLIEQYLHEQVSVEEIHPIHGANDALSSDSQPKVVL
                     VSYHMAAVLEKQLQSRSWKCLLCDESHLLHTNVSGADATYTRVVVAIGKRTPYCLLLS
                     GTPATDNPFDLYNQIDMLRPNLLGGSRFEFAMRYCQLTFSPYLQVGESTRRVEFLSLL
                     RSCCMLRRLKEDVLELPRKSRVVMRVAHRLSPHSDARRSGEAPYQERYANSWKANWNG
                     IAEAVEHCCSKYDRVVLLAHHIELIDSLVQWARGHCKRAVCIDGRVPVQQRGDLLHAF
                     HRGEAGIAVIGITACAVGISLAPAQCAVFCELPPDAAWMRQAEDRLHRPGQREEVVVY
                     YLLGLHSQFDAELFSRLCRGVSIAEESRGASLSLSQIAHASPPTLQPKPASKAPTHGL
                     VQPMAEPLLFCISKNTGRIHVRARKSTGFYTTFPWHEARQCVQQRQDPMWQQLDTFLE
                     SVTRLSPFHRRQLVLCQAWLPPVFQWKSVGAAASTPRRRNRYAKTMTVGWGVWWEVRR
                     SYFPTCYYFGPLTAAASNKYEAGCLNCAASLPQLDRRAYIFVPGAICGAANGDSELFC
                     SGKCRLSFFIRRSAGAIRRSVEGVDKSVCSHCHVDCERLCTSVAAAAGRQERVAVIGR
                     LHPQLLQLPALCEKVVSNPIPGNFWHADHMVPVACGGGEATLDNLQTLCVVCHAIKTH
                     EDMRQLRQQRALLPVQGPVARTTVDVAWVKVTASSGSRVTWRKV"
     gene            <11506..>14886
                     /locus_tag="LMJF_11_0060"
                     /db_xref="GeneID:5649744"
     mRNA            <11506..>14886
                     /locus_tag="LMJF_11_0060"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681422.1"
                     /db_xref="GeneID:5649744"
     CDS             11506..14886
                     /locus_tag="LMJF_11_0060"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649744"
                     /db_xref="GOA:Q4QH74"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QH74"
                     /translation="MAKEVLNNIQPCLPSGMPCMMQIVSTVASIVECGIDPPSQQQNG
                     KAQGEPKVLSAGQSSSLTPVPLKAKEALKLSLFAFHLLKKCCHMKNPESNEEAASNFD
                     WLVKYLLESVRIFPEAARSFFPWNGISSSRAFAANIESALALPPDQQGLPKWLWEDEG
                     RNPRIQQGSEGRYRNEFIQQRLLGAGGFAPVYVCRKKIDGRLYAIKKIAMTEAQSEKV
                     LREVQTLAALNHKNIVRYYDAWVEDGCDEDLREFVDTDAEDEEDEEDEEIKHGGKMLS
                     PQSRAAARASLSSDTDRTASLYSSAEEKSSSVDTSEEDDESGESCSDSGDARSDVKMH
                     EPKGRRPSMNFQTLYIQMELCSARSLRHLIDESDSSDSGGIFSSANGETVAVSILRQL
                     LSVTAHTHRERIVHRDLKPENVLFEMESNHNSEAGIIRVADFGLARVMSGVKRIRSVL
                     DVDEVNTPTNLVSANYPTGNCGSVLYCAPEQEKGLEYDFKVDEFSIGMIAFEMWLAIA
                     GKGFRERFTIMGEVWRTGKLPQWFARWNPTMADIIEKLLEPDPRRRTTCEAVLSTAEL
                     PGDPADLTSALDTVDRYGERIAGRIIQKIQRIGSEFRKPSRASRDDAQFVGSSQCTDV
                     VQAVQVIGMLHGAVPLALFDPTVAMNPKLAEMNVDCVMDSSGRSVAYSALPYFATASF
                     LGMQENSSIGSFYQFYHRVRSYVIFTTPLPHHGVFNECVLEPLLSLCHLLALTKTTEP
                     MEVIVSHVDWLKTVFPAEIGTRSPPPALCHLRSEILTADQIGHAISSITESLCAAGLL
                     LCDERDEYIKKFTMAVVDVINTFAKHMNTHLTLVMDPALQPSDLLVARKALETGVIFE
                     CRSTRGAVPLAFGCFLDNFTANCTVVNPDVSAFSVVVDVQHLLNVGKHVHVTWRENLL
                     LDGVALRRHDLYSLTQLPHVVEAAIQLWKGNIRACIRADTDARALARALKAKQIRWLL
                     VDGKRIVAVSTNQQGKVSGHSGDIALDDLRQTVRSLSVKDKSTSSASIDVQFLSGKVE
                     TRTADKIVELFSTMMTPPPSTVVVVNTDVKRIHECLEQFNESAPDSPPETLAEPTLAR
                     WIKANAATSSVVPVYSLTEGKIVFFVNYKRFKVSGKKK"
     gene            <16318..>20322
                     /locus_tag="LMJF_11_0070"
                     /db_xref="GeneID:5649745"
     mRNA            <16318..>20322
                     /locus_tag="LMJF_11_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681423.1"
                     /db_xref="GeneID:5649745"
     CDS             16318..20322
                     /locus_tag="LMJF_11_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649745"
                     /db_xref="GOA:Q4QH73"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:Q4QH73"
                     /translation="MDRFFKKSSSDAAQAKEEVELLQQKIKTMSEVATALEAQLNDEK
                     AKYALLLTKTNTWKEKVKALTESDRSRIAELETQLAAYHVAGEANGGELTPEIRAAVQ
                     ASLHGIITKHAEEMDACKQQVAAVQATLSTKETTIAELTQELEAVKAVYLESQQRFAE
                     EMQSVTDHHEKEMAHLRCQPESFQELEDLKSRFQEQQKEIASLENHSLQNVQIMSVLQ
                     QDLASSAEKNESLSQEVRTLQESLATLKQKQAVWKEKVMQMKTKDDETIKQLQSELAL
                     TRESSLETNHSPPVPEIPAICQPGTTATAETLDPESSSAAMPPPSPPEEHLYKLSIQL
                     EDEPTTPPEFQEKLETWKRKVRHMKMQDMRIIEALQTECEQLRHQLAAGADEQVQAHE
                     ALRAELAAAQHERDNAAQQAQRHAEDAACVRQELEAKAAQLEQLEANVLIWKEKVKAS
                     KSQAAQRIALQEKELEQLRHQLAAGADEQVQAHEALRAELAAAQCERDNAAQQAQRHA
                     EELEQLRHQLAAGADEQAQAHEALRAELAASQRERDNAAQQAQRHAEELEQLRHQLAA
                     GADEQAQAHEALRAELAAAQHERDNAAQQAQRHAEELEQLRHQLAAGADEQAQAHEAL
                     RAELAAAQHERDNAAQQAQRHAEELEQLRHQLAAGADEQAQAHEALRAELAAAQHERD
                     NAAQQAQRHAEELEQLRHQLAAGADEQAQAHEALRAELAAAQHERDNAAQQAQRHAEE
                     LEQLRHQLAAGADEQAQAHEALRAELAAAQCERDNAAQQAQRHAEDAACVRQELEAKA
                     AQLEQLEANVLIWKEKVKASKSQAAQRIALQEEELEQLRHQLAAGADEQAQAHEALRA
                     ELAAAQHERDNAAQQAQRHAEELEQLRHQLAAGADEQAQAHEALRAELAAAQHERDNA
                     AQQAQRHAEELEQLRHQLAAGADEQAQAHEALRAELAAAQCERDNAAQQAQRHAEDAA
                     CVRQELEAKAAQLEQLEANVLSWKEKVKCAKLRDSANISSLRKERDCWQREVARVSDA
                     VRVLCGGANICSNVESPTEWAESLCEAVQDGQAALVCLSLELWTGGTWAGIQGFKEQL
                     TAYVGACASAAKEAAERVEALEVEVLRLKESEASLSARCENTEAHARNVEEDLKRAST
                     QAERVSELEQETSDLRTRCNLLRKELQRQREAMQRDRPQPHETANSETAASPITENAS
                     AVQSVLLAAAGCVSERDVATFVGSRGSQDGSLKLSKVGAELLIKENAELKRENAHNNG
                     VIAQYIRELEGYKANERVQLSIEYLRNIVQQYLCAAEDLRPKMIPAICTVLEFSSKQK
                     EDVQTANPRCPRFH"
     gene            <21325..>22002
                     /locus_tag="LMJF_11_0080"
                     /db_xref="GeneID:5649746"
     mRNA            <21325..>22002
                     /locus_tag="LMJF_11_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681424.1"
                     /db_xref="GeneID:5649746"
     CDS             21325..22002
                     /locus_tag="LMJF_11_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649746"
                     /db_xref="GOA:Q4QH72"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="UniProtKB/TrEMBL:Q4QH72"
                     /translation="MGKRDLQKEKQQELAAIWGSEVQGDARFPKRRRAAQKQGLGAVE
                     NNDDVDTDVLSDIVSDAGSITSKHSDTAKKETRKTAKKKSTNYRLHCFVEPGTELNAV
                     RTVFEAYEPKVEIRTAQKGNLLNKSQFAVLTFRNKAMALHAVKKLDGTNQRDLLGVSS
                     LKLNLMLTRQQSKIARKTFNRKIRQEKERNQLMEEQADLAFIRNFLKQHSGAKKDKQN
                     GKALSLS"
     gene            <23140..>24720
                     /locus_tag="LMJF_11_0090"
                     /db_xref="GeneID:5649747"
     mRNA            <23140..>24720
                     /locus_tag="LMJF_11_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681425.1"
                     /db_xref="GeneID:5649747"
     CDS             23140..24720
                     /locus_tag="LMJF_11_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649747"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QH71"
                     /translation="MRHGHGTQAYPDGSVYEGKWQCNARHGNGCMRYSTGDIYEGAWS
                     DGTPCGNGVMGWVDRSGCFYRELYKGEWKAGCPDGSGVSTYMAMPKDCLLGSSSTPLV
                     TPSQYAAPAEALLNVYVGAYRRGQRHGRGIFYYADGSCYEGGWAAGVKSGEGHFTSAV
                     GEVREMNATSEQEAEAAEEAVAALTLEESPSSVVPSVSPHGLGNLLETEDDLQVTMHL
                     LLLRYNTTLKTLFKDYSHRSAHVALPTTRSDWWQHRLPGRMTLTQCLCLLHDAHILGS
                     RFSIGAALRAVAEVLRVEAETWKGARAATTLAATLTLVNEAEGTLNYRQFCEWLIRVA
                     VTVNGGPTCTTVKAKVSALLDGSLSRASGASSRAVATTFLPNSLQHTEDVQHHLSSLK
                     RCYAELQSVKDGGRYGVSLRSCLTAMKGTLAKCQISSACVLEKLAWLTDESESRYRTA
                     PNAKTVAEEPSLAQEMVTSAMARNRQVQQLDKDAGTEQSFVEFVETVMTIVEVARHRG
                     CTNVDALLVDLQRRLFAQ"
     gene            <25676..>27100
                     /locus_tag="LMJF_11_0100"
                     /db_xref="GeneID:5649748"
     mRNA            <25676..>27100
                     /locus_tag="LMJF_11_0100"
                     /product="putative seryl-tRNA synthetase"
                     /transcript_id="XM_001681426.1"
                     /db_xref="GeneID:5649748"
     CDS             25676..27100
                     /locus_tag="LMJF_11_0100"
                     /EC_number="6.1.1.11"
                     /codon_start=1
                     /product="putative seryl-tRNA synthetase"
                     /protein_id="XP_001681478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649748"
                     /db_xref="GOA:Q4QH70"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:Q4QH70"
                     /translation="MGLDIQLFRDPEMADIVRESERRRYARPEIVDDIIEIDKRWRRT
                     QFLTEASKKMINTCSKAVGAKKKAKEADGDVSEVPADVMSAAQEGTLDTEKLEPLCIL
                     QLKELSKALSTQVESLAKLAAEQEAERDRMVISVGNVLHESVPVSNDEETGNVVVRTF
                     GDVTRRMRMTHVDCMERLGLMDTSKTVTAMAGGRAFVLRGGLVQLQFALISYALNFLI
                     ARGYEPFYPPFFLNKEYMGAVAQLSDFDESLYKVSGDGDEKYLIATSEAPIAAYHTNK
                     WFTEMKEPIKYAGVSSCFRKEAGAHGRDTLGIFRVHQFDKLEQFVVCSPREDQSWKML
                     EEMIQTSQDFNESLGLPYRVINICSGALNNAAAKKYDLEAWFPGSGAFRELVSCSNCT
                     DYQARSVNCRFGPNTKGSTASNTKEYCHMLNGTLCAVTRTMCCICENYQTEEGIVIPE
                     VLRPFMMGTEMLKFPAEAPAADKE"
     gene            <28692..>29885
                     /locus_tag="LMJF_11_0110"
                     /db_xref="GeneID:5649753"
     mRNA            <28692..>29885
                     /locus_tag="LMJF_11_0110"
                     /product="putative cyclin-dependent protein kinase"
                     /transcript_id="XM_001681427.1"
                     /db_xref="GeneID:5649753"
     CDS             28692..29885
                     /locus_tag="LMJF_11_0110"
                     /codon_start=1
                     /product="putative cyclin-dependent protein kinase"
                     /protein_id="XP_001681479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649753"
                     /db_xref="GOA:Q4QH69"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QH69"
                     /translation="MGGELDNQNKDVPDDGNAACKRACMERLLPSMQQRFAELAHTGV
                     GESSLTVEALFQRYQRVLKVGEGTFGEVFVLYDTVAHTYITMKRMHTLLSLRRRSLGI
                     HRCTFREVELLAALQHPNIVQVLDYHILSDGSLVMLMPVIAHDLTSLLRRWPSTPQSS
                     DHGTASTAASTRPRMPLHVVKCIFRQIIAGVAYLHKHKVVHRDLKPSNVMVDHTGVVK
                     LIDFGWSRFCAAAGAMTGPPCVTAFRPPEVLMGAHNHYTFSLDIWCCGCILFEMLTGG
                     TPFAKSRNEAECLANIVDWLGSPPSSSEVYYRRAARCPFPLAPGRPDTFAQRCSNYGI
                     KSAEAMFLRRMLCLEPGERATAEALLRDPWFTTAPTMCVPRAVPLPAHNMFRLVEVKR
                     KELEH"
     gene            <30894..>31448
                     /locus_tag="LMJF_11_0120"
                     /db_xref="GeneID:5649754"
     mRNA            <30894..>31448
                     /locus_tag="LMJF_11_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681428.1"
                     /db_xref="GeneID:5649754"
     CDS             30894..31448
                     /locus_tag="LMJF_11_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649754"
                     /db_xref="UniProtKB/TrEMBL:Q4QH68"
                     /translation="MLNDAYSERREHYLDLFADEEAQAGQYKEKMRCFLTLEEVVERL
                     REQPSIHERIASIEEFEEPTGPLSVLNVFAKSRCFVVLQTASYWWSLERREDVIVVQR
                     SQNFSSVHSRCKGAYRHYRWPIESAPTARRRMWCRGGSKLSEVFSAMLRDHVFDPKGC
                     ASSSWEFSDYVFHLCLSGRNADPM"
     gene            <33468..>34307
                     /locus_tag="LMJF_11_0130"
                     /db_xref="GeneID:5649755"
     mRNA            <33468..>34307
                     /locus_tag="LMJF_11_0130"
                     /product="NGG1 interacting factor 3-like protein"
                     /transcript_id="XM_001681429.1"
                     /db_xref="GeneID:5649755"
     CDS             33468..34307
                     /locus_tag="LMJF_11_0130"
                     /codon_start=1
                     /product="NGG1 interacting factor 3-like protein"
                     /protein_id="XP_001681481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649755"
                     /db_xref="GOA:Q4QH67"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:Q4QH67"
                     /translation="MALLQRVAQVMQEVAPLSLADHSWDNVGVLLESPAPNKSNAIML
                     TIDLTPEVMEECLEKNVEVILAYHPPLFRPVKRLTLQDPKQRIILQAASAGMSIYAPH
                     TSLDAAEGGINDWLASLVAGDGAYTASPIQPTSSYAPNAAEATKATGMGRLVKLKEEV
                     EFCSMVGSLKQQLGLATVRVALPDSWEPSHKVSSVALCAGSGTSVFRLLRLPVHVLLS
                     GEMSHHDVLAATAAGQAVILCEHTNTERGFLKAVLQRTLQAKLEGTTVLVSDKDSDPL
                     TAW"
     gene            <35361..>36239
                     /locus_tag="LMJF_11_0140"
                     /db_xref="GeneID:5649756"
     mRNA            <35361..>36239
                     /locus_tag="LMJF_11_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681430.1"
                     /db_xref="GeneID:5649756"
     CDS             35361..36239
                     /locus_tag="LMJF_11_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649756"
                     /db_xref="GOA:Q4QH66"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4QH66"
                     /translation="MMNTSLLGQDVDEIQSAVDRWYHQSSSNLQASHAAFTAQLRQLQ
                     ERLGLDPGAPTLSAHVDAMITPPRHMYLSDDNNSGSPPMASPPISRGQLNYDHLLDEV
                     INKGASMPPFNPEEEAERRRRPNAESVRAPSTPPEDCNGPCQVLVEFKRKRVLQYESP
                     YYVAPGEHVVVGGDRGEDIGLVTHSWRDAEAHQLGENRDKGVGKVLRVASVLEVTQLQ
                     GVQTELETRAVEVAQEKVQESGLPMRIVDAEYQFDRRKLTFYYQSMHRLDFRTLVRDL
                     YKTFRARIWMEPDTSS"
     gene            <37065..>39722
                     /locus_tag="LMJF_11_0150"
                     /db_xref="GeneID:5649757"
     mRNA            <37065..>39722
                     /locus_tag="LMJF_11_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681431.1"
                     /db_xref="GeneID:5649757"
     CDS             37065..39722
                     /locus_tag="LMJF_11_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649757"
                     /db_xref="UniProtKB/TrEMBL:Q4QH65"
                     /translation="MDLDDIDRWRAGGSSRDHYRSRYAPQYSRKWNDAYQSTYDPPPP
                     RRYFNDDPPSPKLPSRRSAPPPPPPPPPPPPPPHRSESQNAKRKHKHYSKPRRKHRAR
                     SASFTSSNATSTATTRASSTSSTDSTASSTTTSSSSSSSSGSYEPSDSERGSATTSST
                     SSSSTSSKSTCGSSRTSSHERHAQPRKTQKHLQRHANARSRVAAKPIIAAQDEEIAAA
                     AACRAILSKEAQLKEQELRLLQQKRNFAAEVQRRSSQPHRFGVEDDAIRQMQRLIDLT
                     DTTPALEEFLRRTYKAPPASGASTDAGALTYLRSYEGALSRNGVAPLLSRIVAPPPTP
                     ATAAAANARCEERLVIVGDAPPAPTSQPSGSPETAPPATTPFIAAAAPTASERVELRG
                     TSAEVDSLLEHSLPVEGHLLTRSPPPTPTDSARVRALSERVPAQSLAIDAGKTENQVL
                     AASAPAEGAVTAANDEQRQGGSAVPAKEKAAETAEPAASRPLKGGRATYNELAQRRRM
                     KVKVRRRRSRSHVPTHQSETDGDSALENDPSPNAKRQDRAASPPAGNSQPVQRQQSIG
                     APLQLLPPPPSPASRAVDERQLIFGNPVQQYSQGGAKKQPWAVANWPCNAPPQRLTHK
                     GQDSPPALWYASNSPVPLSHHEFKSLLCSEYVSPEMTTVLAPGAASATIAGVDADKRL
                     SAAPTSTKAGRDAYVPYGGGAAHVATPSRATGAGERGPQRNSRNRSVRIQDAHEDSEP
                     PFAVESTHGEGDSPARIPAELSAPPPVALRSDEDELVVEFPPPPHMRASDMPPPGDVG
                     SDGEDSCCGCGGSRCSCCSAPCAGFRSCWSAMFSCLFPCCCGKKKPKVAQSTEPQRRL
                     AFQRPYPASAPPIPPLQMQIAPTTTNAQP"
     gene            <42074..>45142
                     /locus_tag="LMJF_11_0160"
                     /db_xref="GeneID:5649758"
     mRNA            <42074..>45142
                     /locus_tag="LMJF_11_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681432.1"
                     /db_xref="GeneID:5649758"
     CDS             42074..45142
                     /locus_tag="LMJF_11_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649758"
                     /db_xref="GOA:Q4QH64"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:Q4QH64"
                     /translation="MEDAAPTKQDRRIYKVLRDRCDAPRVLFSTEDPLVLVRHGDRCH
                     VFLFSTKYYTYMVKSKGFKLYAVWANRQLSVTARSDQITLTSLDPHAMKATPQSHKET
                     TDAAVNRFSTVTLETKSALKAAEVEERIMYLVESAQRTAAVLEQQERGIALDGGRYLG
                     DNEDDAHSGSSSDSEDGDGGGTSISATLASAAARAAVQQGDGGRKTKVSEGGLHMSPS
                     RYIAITSLVDGEFADYTALKNAYMRHEEEDLLRDLGVFIKENEGQVEALCEHHYPALI
                     HAAQQCVSISERDAELVGEELSGATALVRSAVVNMKKATSSLLLSRSTRDNLQQVHGL
                     LSKAIAVAEHLETAESQTQRQQLVGAVATLRELIRLAAPLSEYAIGEYVLHVRIPALM
                     QDVFSYAVQHLNNWLRVLRDKAYPIGKAAMEWQGTVTAGRLSLHLVMAEASEQWWLNE
                     EFVPAQLKLAPFAEAEAITAVSNGAGIQAVFIELHREEYLDKYYTEGRWQQARADLLE
                     CPLTLANLSPAEVFSKFREYCATAMGFILIEDIVYGGTSPHLRSRAEIIQLWASLSAK
                     IAEHALKVLQVLLANPSETSEAVQQVQVLQSLIRCAADNVKCVELSNLPLMRAMETAS
                     DQLISSWLQRACVDCMQLIMSDTFAPAVATDAAQYAELVARFCFHRCTSLELSIPSAY
                     TSGALTLPYSAVVPRIGECVLGFLTQCYSTIITDTSTVVMQSELNNVDEMLLKYLTVL
                     FRTVAESMQGQLMSIDARAVLQLAVYVTSCSMMPVLISCAEQQYMLHWQCDYEREKAQ
                     TMGAPKLMAHCVKFFTKSLQLGIERLLSAIMKEVEARLQAVDSMSYWKAQVEARRQNR
                     KDNGEAFASCVEYILMMIPKLSSVLQSTVVRSVVGTAITRAGVLMQSSLHTAITNAYQ
                     DGARDFGIWKEAIEEYERQCTMGVPLWQRRLGELLPGISGAQRFPLNAAVAAQEVRQW
                     IDPKEQAYKASQPQILAGIEGAGKAVAKGFQAVGKGVVARASVFGKGSQQ"
     gene            <45757..>47910
                     /locus_tag="LMJF_11_0170"
                     /db_xref="GeneID:5649759"
     mRNA            <45757..>47910
                     /locus_tag="LMJF_11_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681433.1"
                     /db_xref="GeneID:5649759"
     CDS             45757..47910
                     /locus_tag="LMJF_11_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649759"
                     /db_xref="InterPro:IPR022587"
                     /db_xref="UniProtKB/TrEMBL:Q4QH63"
                     /translation="MNSTLVHDLQQFRYVTAFTNPLPWPHVRRVSIPGLRHEAPDLPF
                     MANLISALSDCDVSLHKIHEHNDTDILQLVQVLQACLQFSLWSQNILKEKLLEVQATH
                     VAKGVSAQQLENLEKRYHALEGEMAALHKDRGMLSLGTANLRTSLAQMEKTIKRQERQ
                     LQQERGRNAQLVAKLEKALCARAVAAPLMSAPRLPPPRESQQRPAGNRHASAPTHRTT
                     KATTVYDSSRLPTDNADAHRDSIASLTSDTSYGDSCLSAEVAARTHSHVPQPCDSLDP
                     PPPPFLDWRTLVRYIIHEEQRASVWASNHASPTAARATADERGIASKEELMPAAQHPS
                     KPAAALPAAATQRVTEAQLDSFFAGLTAGVTTEVVAYSRAVAARVEEMVRAATQQWIQ
                     ETAEAQQALMAQVQAALGSLGAELAVHKQLKDATPSPALRTVAMPVATSDASDPHAQL
                     APFSPVLASSSVRNSAAAALPAPCQHAGNALVTLANAPPTNDSKPLSQPPQTSASPLT
                     PSIDSSPPASFLNSFVMSGTALCHSTTGCEVLDGGSKTRTPLPDFSPDILRTPPTSEH
                     GTAAAPLGTGSDGPRSVVSRADDADERDVDVDLLPLDSSSSDSSSGSSQRSDGTADGV
                     AEVSHAYARVLAKPSSPPPMYPNKTPTAAAFVVQPAAPTHPSANRTLSLHFSTRSDVS
                     EGSSYGSSQMLRETRAQLQALLEEEEAAGRAKTHR"
     gene            <48521..>49111
                     /locus_tag="LMJF_11_0180"
                     /db_xref="GeneID:5649760"
     mRNA            <48521..>49111
                     /locus_tag="LMJF_11_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681434.1"
                     /db_xref="GeneID:5649760"
     CDS             48521..49111
                     /locus_tag="LMJF_11_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649760"
                     /db_xref="GOA:Q4QH62"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:Q4QH62"
                     /translation="MTTSASLFKKFTLENVAQIASSSHKEQKEVREELAEQYPALEAY
                     WEEILPKKSDIFIIRCQGQVHCITLVSSQPEVLFFNHHGGPYLPHLKLLHKYPFMLTR
                     HQVDIGGCRYVISGANVMCQGLTSAGGIVADGTEEGEVVAVYVEGKEHAVAVGTMLMS
                     SDEIKEKNKGPCIENIHHLGDGLWMNPVLSASHISV"
     gene            <49901..>51730
                     /locus_tag="LMJF_11_0190"
                     /db_xref="GeneID:5649761"
     mRNA            <49901..>51730
                     /locus_tag="LMJF_11_0190"
                     /product="putative DEAD-boc ATP-dependent (RNA) helicase"
                     /transcript_id="XM_001681435.1"
                     /db_xref="GeneID:5649761"
     CDS             49901..51730
                     /locus_tag="LMJF_11_0190"
                     /codon_start=1
                     /product="putative DEAD-boc ATP-dependent (RNA) helicase"
                     /protein_id="XP_001681487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649761"
                     /db_xref="GOA:Q4QH61"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH61"
                     /translation="MQRHSRRGLLKYLSGVRVEYGGSAAKLLDSYLHQDAGAKHAANL
                     PVSQRYFYIKNRNNDASLSSATGASQQHQTVQLRLGAAQMLSSSQHTSIDNLNEAHPL
                     YYAQTSPSAAGLAAPLVLALKRLRIRQLTALQGALVPLLLKGKHVIAHSETGTGKSFG
                     IALALANRIIRDQLNYRLHTVVLVPTEELALQYDKWLRHFGGCTSQVVQVAIDSIPLE
                     AQLAKLHNIQPHVLVGTPQRVAEIVRLSPSILGEKLRRKVDCVVLDEADMIIHANVVY
                     GRQQLSGANLVDRLFRNRREEVPAQLVAASATVDGVTAQTLNTWTRNDRTVRLTTSFV
                     EHTIPPTIQFYFFGASRAYPLERCLLLSLQLICTQRPDARILIFTEDERVAEVCTLLT
                     SAEVEGEMRRIAPGALSSTKVFAGALHALPRSIPSADNKESHGPDNPVSHRRVPLTTA
                     TQQAAPFSAIRGSGNVYEDVRAHQVIRQHGDVYVKNNSSLSRLNEGKLVVGVGSFNSS
                     RGLHVNGITHVILYGACPSAACFVHCAGRTGRMGAEGDVLVLYPPSSGRQVQQVCSSL
                     EVPFHSSRMSAVEDLLRSGEARTTESAAGAVTESASGAAADNT"
     gene            <52479..>53033
                     /locus_tag="LMJF_11_0200"
                     /db_xref="GeneID:5649762"
     mRNA            <52479..>53033
                     /locus_tag="LMJF_11_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681436.1"
                     /db_xref="GeneID:5649762"
     CDS             52479..53033
                     /locus_tag="LMJF_11_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649762"
                     /db_xref="UniProtKB/TrEMBL:Q4QH60"
                     /translation="MSDKTMVSAAGSSATSPLPTMPPALRQLIIAVERLNAASSLPSD
                     VDAVSSLKQSTRELPEQSTSDPPAADTVAPTVELLRQVDALQEHYRRLLVLAQQPYGT
                     QSAAHAESPSGGGSDTVEAQAESLMTEFEAAVGQLQRGIRSKQAQAIRLVLLNALRRE
                     AAERRQCVAKMEGVLSASHQHVRL"
     gene            <54060..>55391
                     /locus_tag="LMJF_11_0210"
                     /db_xref="GeneID:5649763"
     mRNA            <54060..>55391
                     /locus_tag="LMJF_11_0210"
                     /product="acidocalcisomal pyrophosphatase"
                     /transcript_id="XM_001681437.1"
                     /db_xref="GeneID:5649763"
     CDS             54060..55391
                     /locus_tag="LMJF_11_0210"
                     /codon_start=1
                     /product="acidocalcisomal pyrophosphatase"
                     /protein_id="XP_001681489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649763"
                     /db_xref="GOA:Q4QH59"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4QH59"
                     /translation="MSDDTRYMYPARKAHAMDLGSSLNPEGDQKQTWGSVASVADAMS
                     PTAEIKPSAPQVTHFGTGLGMQSSTGDPTLQEADSDGDKTEAVNEFDLAAYSKEDLTQ
                     TLHKRIMSRMFSAFDVTQVGYLDINKLKELCVYVGRNMSQEASEKMFDELKGIDGHIT
                     FDVFWNWWTTYPDTKMTKDTFSLVSADFSVPYHQQQLKIKDEGEIFTPSYRVKYYFKD
                     METGLRRRVSPWHDVPLYVRDPVRTKPENIRANRYNFICEIPKWTRAKFEIATGEPFN
                     PIKQDIKNGVPRFYKHGDMMWNYGAFPQTWESTEVIFEDGVSGDNDPIDGVEIGMRQM
                     RVGEIHPVRILGVLGMIDDGQMDWKVICMSVNDPVARFIKDIDDIPKFLPGCLDALRE
                     WFRVYKICQGGVENKFAFNGEYKDKTYAMKVVDESHYMWENLRKIKKKEEV"
     gene            <59370..>59705
                     /locus_tag="LMJF_11_0220"
                     /db_xref="GeneID:5649764"
     mRNA            <59370..>59705
                     /locus_tag="LMJF_11_0220"
                     /product="putative opterin-4-alpha-carbinolamine
                     dehydratase"
                     /transcript_id="XM_001681438.1"
                     /db_xref="GeneID:5649764"
     CDS             59370..59705
                     /locus_tag="LMJF_11_0220"
                     /EC_number="4.2.1.96"
                     /codon_start=1
                     /product="putative opterin-4-alpha-carbinolamine
                     dehydratase"
                     /protein_id="XP_001681490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649764"
                     /db_xref="GOA:Q4QH58"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:Q4QH58"
                     /translation="MRRTAPLCAPKALSAPAVTQALQSLPGWRVNGNNQNAIERDYVF
                     ADFTEAMRYMNMVAPVCEKMQHHPCWSNIYNRLHVQLTTHDAGNKVTQADVDLAKAMN
                     AAHEAMRRH"
     gene            <60347..>61912
                     /locus_tag="LMJF_11_0230"
                     /db_xref="GeneID:5649765"
     mRNA            <60347..>61912
                     /locus_tag="LMJF_11_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681439.1"
                     /db_xref="GeneID:5649765"
     CDS             60347..61912
                     /locus_tag="LMJF_11_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649765"
                     /db_xref="GOA:Q4QH57"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH57"
                     /translation="MMTSSTDALPVKSEAHAFHRRMPDNKAFFVTPDAELCARHHASL
                     AQVWTWRTQLSQQQSPLYHRTYTITATSASGHRDPQDTTETTLEGDTLHSPHRPCTAA
                     DLLRSCCRPTPPHPLAGSGRDAHGRVSTAATAAAAVVAASSSHLVIPTGLRSLDSALL
                     GVLRRGWVTELTGLPGTGKTTLAAAWCRSCLRHARLCGTAHDCVWLQSGSAVHSAVLT
                     TAHEEADATELPSLADAVHVACLSNLDGLQQLLDRWHGTEGSASPLSTVGLIVLDSIT
                     DLMRRSFRCEDDDALQRHEALATTLQSLKRLAEEQRLAVLVITQQQRHPWPAFGRSSI
                     SHTNRGVYEEGSNEDEDDSEAWGSGCSRHASGGAGVVGPHACRSDFSSEDVGQLGRLF
                     FHNVNVRLQLRAGVRSAGSRPSPSRPFAAGGPEGDREALRLRWQLEVLKSPLCAPFAV
                     GLRLRVPTPLSCSDDPSRVSGLPLCVEEIDGDDGSPGSAVPLAPNTQVEEGLSLVSLD
                     PWDYTEVPSFLYL"
     gene            <62870..>63613
                     /locus_tag="LMJF_11_0240"
                     /db_xref="GeneID:5649766"
     mRNA            <62870..>63613
                     /locus_tag="LMJF_11_0240"
                     /product="putative proteasome alpha 7 subunit"
                     /transcript_id="XM_001681440.1"
                     /db_xref="GeneID:5649766"
     CDS             62870..63613
                     /locus_tag="LMJF_11_0240"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome alpha 7 subunit"
                     /protein_id="XP_001681492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649766"
                     /db_xref="GOA:Q4QH56"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QH56"
                     /translation="MSYDRAITVFSPDGHLFQVEYAQEAVKKGLAAVGVLGSDCVVIA
                     VEKKSAVKLQDSRTIRKIYKVDAHIYLAFAGLSADARVLINKAQLECQRFSLNYEDTI
                     DVGMLVRYVAGVQQKSTQSGGSRPFGVATVIGGFNEDGKPHLWKTDPSGMCSAWRAVA
                     IGRHDQTVIEYMEKNYKDGMLRDECVHFAIKSLLEVVESGSRNIELLVLQYKEERYLT
                     EEELQKFVVEVEKEREEEAAKKKRQAEQE"
     gene            <64954..>67926
                     /locus_tag="LMJF_11_0250"
                     /db_xref="GeneID:5649767"
     mRNA            <64954..>67926
                     /locus_tag="LMJF_11_0250"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_001681441.1"
                     /db_xref="GeneID:5649767"
     CDS             64954..67926
                     /locus_tag="LMJF_11_0250"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_001681493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649767"
                     /db_xref="GOA:Q4QH55"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q4QH55"
                     /translation="MLGDGRTLENLHFAMSTSEAECNNSGSGTLEGRARASGGAGKFD
                     KAMKMYQKSMAIRRRLTSMASSTTRFVGSRDDGGCGGGALNEESAAAQTSLSSLRGPM
                     LRSSTQITRVAPASSIASFASPQHSRALPEMAFGVATGCEPTETASQPATTLGTGSSV
                     ETRSSMAAWMLHSHVPLPALNSARRLSNPPDVERKTAPSSSSPFSLAIPSRGRTKRGS
                     DDRHKKVAAGGGENDAVWRKGSPTCSAHLDFPSLFSAERQHTAWRHNSGGASECFDVG
                     IHRYADQLSTSTVDSPLLSPMPSFHQMLGRSYDVPALDAIFRGFSTGVDRRQQGRRSL
                     RSPPSPTHTTMPVAAATSVPSVSTSLQLSSSLVSKMSVQPPVAAVTKQMPTASVSSSA
                     ATRAAAGVHAVPAGNDGFSYPAQAPTRKNRSSSYPADKAPPEASGRSTVEGGDGVHTS
                     GSLALVKTMASAPNLKPNEAGLLPLGPSPLDESSTATTTTAQFYTTALLAKTFDGAQY
                     LNDYILLHEIGSGSTGRVVLAFSTSMNKSVAIKIILKPKEKHRLQHRVSASTSTSVLG
                     QHSGGGAFSGGRAAAALATTTPETMQNFKSSSSSTQRRSKHRQTPSTPFTTVADKTRN
                     LQREDEVMKDLNHPNIVRLYEVINDPKANSLFLVLQYVDNGAVAQLDSTGRIRAPLQP
                     WTVLPIAAQVSDGLVYLHEQHIVHRDIKPENILVNRDGHAFLADFGVAELMNAKAGQP
                     TAATLAYQGTPLFMAPEIYAGIDDEDRDEDAERASGRRTRRRSSTDADESSSMTASPS
                     CEEQRDSRAIDPFALDVWALGVTFYTLLIGHVPFTSMLQISQTVEKGVDIPASLPEQW
                     RTVLRRTMEPRQELRISSAELCHMLHAMLAEQEAAEVRAGGRSRTASLSTRSQSATLG
                     NRRKTSHQPCTGGRTARSASLAADAEEESMNLGSSRSSGDESGTSEYSQGVLSLSITS
                     VDLNILQPTRTQKKQGLS"
     gene            <69921..>71705
                     /locus_tag="LMJF_11_0260"
                     /db_xref="GeneID:5649768"
     mRNA            <69921..>71705
                     /locus_tag="LMJF_11_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681442.1"
                     /db_xref="GeneID:5649768"
     CDS             69921..71705
                     /locus_tag="LMJF_11_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649768"
                     /db_xref="GOA:Q4QH54"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="UniProtKB/TrEMBL:Q4QH54"
                     /translation="MMRLSRLGVTAAAAAPSSFPLLQQLRGVRYANIQETLKPIPGQT
                     AGQISILNEICCNPDAEEERRKPVFRAEVMPDAAAAAEEDNYLHTMHKWGYDSLTLFK
                     KTNEDPGPWWNANASTLASNWSQVGDYANAGMWSGVWRYTYGIGEYNLRPYELRGRAW
                     GRKDPKTGAVMIRYGKRSTSKPVQRLCFPHTKEHEQHHRIKNPANKDVKEISALHGKR
                     ILRELQYHLGQGLRFYLVDGVFGSDPGTATPYRIITDTPTHAYFASMAAIRTFNYVAR
                     QEVTLVKRLSQSPIDEWGWRRPGVLIYHAPSYDFESPRIVEEFGGPRPKDMGLSHNRF
                     IATEPYSIPMKCAMGGEPSCDALLDSTAMLCGRWGFYADEKGYLTVPGESIMSKDGRS
                     LTLVITGDEADADALRTSPQLYGSRHHRIANGVVSRAWDVVSMPACATGAKPLPTDIV
                     EQDLQRVQRSLPTRMGLPHTLSHRHHGRRHVSEYGFKWPHNYTEDVSTKAYAGGHLFK
                     APKTDKLAGHQPRPSRFLMKDVDVVVIGEGVDAAAAVVSTLKDRGMLYAEEAPLKEAM
                     ATALKAAKSVKVVPRASSKVVLGKLTHV"
     gene            <72713..>73750
                     /locus_tag="LMJF_11_0270"
                     /db_xref="GeneID:5649769"
     mRNA            <72713..>73750
                     /locus_tag="LMJF_11_0270"
                     /product="NADH-cytochrome b5 reductase-like protein"
                     /transcript_id="XM_001681443.1"
                     /db_xref="GeneID:5649769"
     CDS             72713..73750
                     /locus_tag="LMJF_11_0270"
                     /codon_start=1
                     /product="NADH-cytochrome b5 reductase-like protein"
                     /protein_id="XP_001681495.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649769"
                     /db_xref="GOA:Q4QH53"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4QH53"
                     /translation="MFYDVNKGYVTRVAVVFATAFGMSYAVYKLVLQPMQQRRPLAKR
                     WCWCAPPVPITLVEKNGEKDSNMFVYRFALPNSYDYAGYEPVSSVRMMSGNVRELSSL
                     SRWYTPISHPDERGFIEFAIKDCDPGRMSARLRYLEPGDIVYLGRWMREFPYQPNTFK
                     ELGVVCTTSGASVALQLMNIMDKNKADDTTLSLLYCHHTATGIPFKDTFFKAYAERNK
                     NRIRVSYNVLAGGRRKGSAAPIEQNMYVGNIDPETIAAALPPPVRVVEAGAGVGGGTA
                     SQPPTYRPQLLICGPQSMLAFLCGRVSSFGNYGYWQGPFYRYSGFLKDMGYTRSQVYK
                     FGVSTHFLADH"
     gene            76830..78671
                     /locus_tag="LMJF_11_0280"
                     /pseudo
                     /db_xref="GeneID:12980839"
     misc_feature    76830..78671
                     /locus_tag="LMJF_11_0280"
                     /pseudo
                     /db_xref="GeneID:12980839"
     gene            <79588..>80979
                     /locus_tag="LMJF_11_0290"
                     /db_xref="GeneID:5649771"
     mRNA            <79588..>80979
                     /locus_tag="LMJF_11_0290"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681445.1"
                     /db_xref="GeneID:5649771"
     CDS             79588..80979
                     /locus_tag="LMJF_11_0290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649771"
                     /db_xref="UniProtKB/TrEMBL:Q4QH51"
                     /translation="MLRQCERLIVQLSQQVLEQEKDIHSLRAALHSSQNRRRRHRQRG
                     GDEKRERAAAVSMAESFSVSTERRQHHHTHHITVKAPTQMTMTHEDSRLRLTLPSSMT
                     PQVSPIHLSGDAGVDSATGPYPEAAVVAPHSPQSSGAGSAVPSPTRSVGKSSGEHGMA
                     AALAFPSIVCDVSSFSDKTNVGLTPSAACDHPPSGESATADGLWASSLLSEPERSSSS
                     SSLARHRRNTAQLTRNAQFETPRVNLDNQDAMSYLLCIFSSAKSTREADGGATAAMAE
                     AGEAAPCGREHRGGAGVRSPNAPLQQQGEHVARRLFHLDPVDENEGSESGNEHSSGGA
                     VSDYDRPAARRPFLPPLRDKRGDGDGSAPPNHKTCGAFDEDDAFLQERYARIVACALA
                     AEFAASTTLVEEDEVEQQRGCKTGPRAPTAAWCRTTSRRDHSASATVSELLRLFTFQP
                     ATRHQPYSDGKGL"
     gene            <81942..>82631
                     /locus_tag="LMJF_11_0300"
                     /db_xref="GeneID:5649772"
     mRNA            <81942..>82631
                     /locus_tag="LMJF_11_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681446.1"
                     /db_xref="GeneID:5649772"
     CDS             81942..82631
                     /locus_tag="LMJF_11_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681498.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649772"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:Q4QH50"
                     /translation="MTHHAFVSNRTQRLHGALSIAAAHAQQVLRTLETVREQRERERH
                     QVRQQLQQRSGSSASPATRTASPSVANGAPTKEERQLYMRLEKARIDLRRVLPRAVAE
                     VEGAENVTEGDVTSTSGRSAASTAAALRSLLHTRSMLSVELKKMDTAVQGLAGSSESL
                     AALQQSLQDVHSSMEMAHRMVRTLLTVQSRDDLLLRVSAVLFALVVLYVVAQRGFRLF
                     PTTVYVALDEA"
     gene            <83804..>89227
                     /locus_tag="LMJF_11_0310"
                     /db_xref="GeneID:5649773"
     mRNA            <83804..>89227
                     /locus_tag="LMJF_11_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681447.1"
                     /db_xref="GeneID:5649773"
     CDS             83804..89227
                     /locus_tag="LMJF_11_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649773"
                     /db_xref="UniProtKB/TrEMBL:Q4QH49"
                     /translation="MRLHQRHVAALDEQLSPALEQAVRALLTSEEHHWQLELQHQQEQ
                     KSGVCLVPSSASPVPLHKMAALLQALQLVLHQTSVSFIEAQNRKATAAVATVEDTCDG
                     NRYAGRHVGLTSTSSSSTEQEDEVEAQHALELEQRREVLQAALNTERALAEEVKQQVP
                     TALPTGAGVSVVTLPRDRPVPAPVLRLEAAVSVAVLSSMIEKAESITAGMGFASHLLR
                     QYILPHVYADYAGWAAVRPRLGTLSEQVTHLATLPLRVQQQQSLVDAAMQAQADAKYL
                     EGVVKSWTMRAWLHGVIRHRQCLAQQTATERVVARLRGRIELHRMFSAWRREAQRGQQ
                     LVRDAQMEAAYIEFLNESRLSARRDGQAYVGTAATMATALLMYGPETSAAPVATMWSR
                     VQQQQQQQQQQENGQRQQELAADSRERSSAAGIHASAASTMVDIPAEWAVAPRHSRGR
                     SAQASLSPPPSRHRHETHSSKRKGAGYSRVQLSFIRRKAAGMASAEQERAGEADHRGL
                     QGSNASAVDDAVARDGKGDMMERYIVRDASSEDQNEGSSDEDNAIDGGGTLAQLVYLE
                     SHADDIQEEGSKSYHARSTAPSTFPASDINASLAEVTSSRGGDAGDVPMHPLFQTMLA
                     KLHEINQVNAYLRAELAVQSRRLRKVEAANHGLRQRNRQLEDGTLQLLRDKLEAVNTA
                     HEQLMTIKEKNRQLRHVRSRLRAHRHRPWQKTVLRVVGDMCEVSTAAAEGADEARVHA
                     DRFGTGCTTSDDDDGGEGERGNASPHAAKSAVAAEATADGREATATMSVTSTSTENRA
                     ALPGSESDEERLFSRIAPIVLRSDRQLPDALVIIADWANSCLDDLECLDDMKDGPLAE
                     RFHSFSEEARSGVLISRLLYYLALPRYRTTTSAAEIERDVGVSVGLSDSAGARLDGVD
                     RRRQLLEQRGVQLNPPFPVYAACFGDLLAAPPVERMSQLLAFATELMAGQDVAAQEQN
                     EAWQANTTNGENTNWQASVDVRLSAAEVGDVTRSPRAAVASLPTLSAPLPLHTVVDPH
                     AILRGERSAVITLVALLYIRFAHPFHHKSRQSAKRERSALLYLWSGGQATAAELNGIV
                     NDGLRDAAGGGGSPTEITATLDRAPPSGYSIEADMLRQLPTEDKTAWQLFRERCLPVF
                     GTQAHPFLLRGGFWPSEAFESPELAAMLSTLAMVLRRSLELHRWHVTLNCLVPVRTYG
                     GLSNGVFTGPCASAPALLLGLRQDGKESLSIEHPLIHQCVEQRQQAYLSALASESFST
                     SLTSMDGEADKPPTQQQHLTDPTAETASLTDAITGLWQEDLLSLFVQRATLSAHLALP
                     VLDLGSWRMLCSDLGVISLASPDSEDAGAHDAAALRRRESGQSPVSVQSLWPRQPKPQ
                     LQAMDMEVVTKLFQRAVMAVSFARDEVDPAVLQSARTAREASSQTAPATTGQRGEGDD
                     RQSRSPQSSMQHQTLPDIQMDMTYPSFVMALVLLAHRLYPAFTSATLGVAVQPLSSPT
                     AFVGSWESSALANSDDGRLVGPASLPPDGDEANRSRHVSSSKPAYCSLMEAFRLMMQG
                     IVLPSSAAHLQATDPRFVLHQLTRGVKTQVVLRNCAPALLLVYQTYSKEVFGEPGMVR
                     KDLLRLLRDAMLTSTELSQHRIHELFSSCSVLRQANEEVAIANRKEMDRLAHANSSPG
                     SLLLSARRPGYRAVRIVDPDAATESAVVHAAHRKRAHVLTFEGFCDFLCVLCGFKQPN
                     VFVPFEERLLSFLHHSLLQPLTHMVPALAPLVSRSQLAKGSNSVLVSSGAAGAGSVNN
                     DGISSHTGGGSSSGVIGARSTAS"
     gene            <93982..>97653
                     /locus_tag="LMJF_11_0320"
                     /db_xref="GeneID:5649774"
     mRNA            <93982..>97653
                     /locus_tag="LMJF_11_0320"
                     /product="putative PIF1 helicase-like protein"
                     /transcript_id="XM_001681448.1"
                     /db_xref="GeneID:5649774"
     CDS             93982..97653
                     /locus_tag="LMJF_11_0320"
                     /codon_start=1
                     /product="putative PIF1 helicase-like protein"
                     /protein_id="XP_001681500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649774"
                     /db_xref="GOA:Q4QH48"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH48"
                     /translation="MNNISAFDLDGEQGDGRAINEERDRQLDGDASAATASPAHQEGV
                     SKDDWDDQSYGAVDKDIKGVEDWVSDDTLPIAPAACAGDAVRTADKRTRQLILDPVEW
                     LAQASDAPLMDETLLESNTHIKDQLTEALAPSAAAKYTEWLRHRTHDATFSDAEPAIG
                     EVPPSAGRVAAMVVRGFDPATAAFMASASQQSIEAEEDTSLQEALTAELYADVSRAIR
                     KQQYHRPRNKKAKRSEAAAAAPSIHADTDRDRFTDAEHPSEAPLSRENDAATMQAEAL
                     PPAAQSAALLNPDEGADGTVGGALPTPCHEVATASFGPPKRDNTTALAAESDALVYNI
                     FTRRVAKAGSMSIRTLALMGIGVDRTTRELCVTDAEALRNLAGELRAHRVSWPKVWSH
                     GPLYQQIERLLSDAAVEDPVERVSGLLKLQYNRSHLQRQKPGLVVGGETTESEQRPSA
                     AVEATTAQPSMMESIDDKLFTLQDLNAEQQAVVQLVMQGHHTYIGGGAGTGKSVLLRV
                     IKQQLVREGLAVAVTGTTGIAGSQIGGCTLHHCLGISPLGEFTRRKDLSSYDVIIIDE
                     VSMLSRDLFESLEVHLRRANNTNLPFGGVQMILSGDFLQLGAIHAQPLITSTVFRRNF
                     VHLKLHTVVRQNGDLCFAAQLQQLRRGRVPLDLPKSVRFMSREQVVAEHHAASELRER
                     QQAQLQQVLSTTTSKPSIDPHTETLATSNAADESLRTQSAAATTPVRPFPQVRRRDSV
                     AAFVDGAVNLLPTNREVDATNTEQLDRLDGELITFAPQLLPPSLVGTWSPTYVLRIHA
                     PPKLNMKTFALEMRRYLAAFYTHGQRASSQPSSRLSARLSRREKDAAASSSTAAASAN
                     FSDGAWLLHPSLSERSIVLYPLFVDALALRVRLPPTIDKEEAQAFLLYLSELDRHLEN
                     IDNGVRVRDVLMHADGMHTEQDEFTLSQYVQRTPLARPLGLKIGARVMLRTNLAPGLV
                     NGSLGTVVAFRKLEMDQLPRYIVGNAQREESILQYADYLKYEQGFEVPLVPVLDFNGR
                     QEVIPPVTHFVGGLPNTHFYSMGIIALPLSLAYAFTVHKVQGLTLVGRVHLELSRMWP
                     CEHLLYVAMSRVRNPEQLSVSSFHPSLVRAAADCLLFDDSLPPVTQVRIAPYMVAATW
                     RRSSERRKKTVLRKRLEAYVKRRQQRLQSEASKGDIRAEIRLLEEKMLKQRVRASAAH
                     RKRRSTPGKLGAVAGSPMV"
     gene            <100546..>103530
                     /locus_tag="LMJF_11_0330"
                     /db_xref="GeneID:5649775"
     mRNA            <100546..>103530
                     /locus_tag="LMJF_11_0330"
                     /product="putative PIF1 helicase-like protein"
                     /transcript_id="XM_001681449.1"
                     /db_xref="GeneID:5649775"
     CDS             100546..103530
                     /locus_tag="LMJF_11_0330"
                     /codon_start=1
                     /product="putative PIF1 helicase-like protein"
                     /protein_id="XP_001681501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649775"
                     /db_xref="GOA:Q4QH47"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QH47"
                     /translation="MAKPKKPASRRCTQRETATPTPAAVTAAEAPVAPANPAADAFRE
                     SLDEESFFSSLLQPGKGVSGIADPRESTLVYNALTGRMTSETSVTMQCLRELGFDVND
                     QRQVIMKHPEVLNALAERVRAGTAALPTKWPVTVARVISAVVMNRHISDPAKALEQMI
                     QVKTNSVMRSRYTSVVSAVNSDLDAAMAQTTAAEQAGMNGGHDPDQAIELNDEQKRVI
                     DIALRGHHLYIGGSAGTGKTVLLRAVARRLQGHRLRVAMTATTGVAGCHIGGSTFHHA
                     LGVTSRGEFMRRSIILDYDVIIIDEVSMFPQSLFEEFDRVLREEAGTPDLPFGGVQII
                     LCGDFLQLGCINEKSLIGSPLFHKNFVKIRLETQVRQTANSQFANDLQLMRLGIVPSD
                     LPTTVQLLPPGTMVDSAVNLLPTNKEVHAANERQLQELPGDSLTLTPETGITSLQCET
                     TATLLLRTTPDFNEAEFARHTRSLLQATLDLPRASLLSLYRVYEDGHVMRVMLPPGES
                     VAWRDAMRERFLEIAGLLNDLELGATVTEIIPNGDGLHTPEIEDYLHKVMSKHPIAQP
                     LALKKGCRVLLRSNLSSNLVNGSIGTVVDFVECKEESFPEYIKTESVRRCIDRYRVFC
                     FTECGMPVPMVPVVQFHSGEQIAVPPWEFSVGGGPNTHFYSLSSVALPLSLAYAFTVH
                     KVQGLTLVGRVHLELSRMWPCEHLLYVAMSRVRNPEQLSMSSFTASMVVANETCVHFD
                     KELRGALQLTVADVAKYPISAWKRCNDTIYHLRCRGASLRRLLEGVTSMSGSISPLMV
                     SGSGSSQAHDSRLDRSGRSFASRSRSDGEDDHEALSAHEMTSTSDGSRVMVRVGKHGS
                     GGTGVAGEVNTDDPAFNLEHLSAIQQSVLVARRMRKLVRHVERVARLTEARHRTKSNG
                     RNSKGPAAPEGAAHAASAAVAVVNGSDDASSRRDGAEAEEMDSDEPCDVERAASVMVA
                     SVAAAAAASPAISLAVGEEHTF"
     gene            <104943..>106448
                     /locus_tag="LMJF_11_0340"
                     /db_xref="GeneID:5649776"
     mRNA            <104943..>106448
                     /locus_tag="LMJF_11_0340"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681450.1"
                     /db_xref="GeneID:5649776"
     CDS             104943..106448
                     /locus_tag="LMJF_11_0340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649776"
                     /db_xref="UniProtKB/TrEMBL:Q4QH46"
                     /translation="MVYKRKRQSKKARRTPARKLPKAVEAAAVAAALVPVGGADEGAA
                     VQRCDAGFSSALSTDDRAISCAPVTINGTCGNAAAAESPTEANVGSAHKEMPQEQQSE
                     KPQQQQQQPGTSGYQCCSDTSGLLYSAPPTPADLARLSVASSAGLPSVLAATHLPCIP
                     GVASCSPQCGEDGSGEGHYVAYLLSEQLSNNTTMPMTMWGVYSLRSGDCLQVVRWHHS
                     PAAHASPVTNGALHPSSTTPQAQQTKELIMRVDATGLCFMLAPSSLVSVEGGGAAGCM
                     TPASVSSEPDAAAAGAAASGDVYWLIPSMMKESFLALLQAQEWLRTAPPRHPASDTCV
                     RRFECQGWCVQPHPTRWASVTPSLKATASAAEAWEPRESPSPPTAALPAPRRTAQKAK
                     RRRGSPSPRAQPPQQQPSIMAAAAAAPLQNTASTTRSRLALADATPSSPSHYRIPYVA
                     AVPQLQKRCSGATASHLPLTAGPAAAVTPVVLLLGNRIAPYPADGACGAKT"
     gene            <107267..>108028
                     /locus_tag="LMJF_11_0350"
                     /db_xref="GeneID:5649777"
     mRNA            <107267..>108028
                     /locus_tag="LMJF_11_0350"
                     /product="putative 14-3-3 protein"
                     /transcript_id="XM_001681451.1"
                     /db_xref="GeneID:5649777"
     CDS             107267..108028
                     /locus_tag="LMJF_11_0350"
                     /codon_start=1
                     /product="putative 14-3-3 protein"
                     /protein_id="XP_001681503.1"
                     /db_xref="GeneID:5649777"
                     /db_xref="GOA:Q4QH45"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:Q4QH45"
                     /translation="MTNVFKVPEKREELVYTAKIAEQCERHDEILFCMKRAVKMNPRL
                     SSEERNLLSAAYKYIISARRACWRSMSSMAHKEDSHKGKTASLFNGFQHQVEKELAEI
                     CSDILELLDKYLIPAADNDESKVYYYKLKGDYHRYFAEVESGSDTQKNLALEAYKKAS
                     EFTTSLKPTSPIRLGLALNFSVFYYEILRSPDKGCQLARQAFEEALSDPEVLDEEQHK
                     ESALIMQLLRDNLALWTEDSRPEGQDDGTAMEELE"
     gene            <110080..>111264
                     /locus_tag="LMJF_11_0360"
                     /db_xref="GeneID:5649778"
     mRNA            <110080..>111264
                     /locus_tag="LMJF_11_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681452.1"
                     /db_xref="GeneID:5649778"
     CDS             110080..111264
                     /locus_tag="LMJF_11_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681504.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649778"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="UniProtKB/TrEMBL:Q4QH44"
                     /translation="MVALPAFKFVFLAIRQVTRPVAKQIVSRANTKRALTYCVCMGLG
                     RVSLGLSGVIAEWTRAEEQKQREARLKTAQATGAGAVQSAAQAAMDVVGKTSTASGSE
                     PPNTVGSSSGTDTAMSSAAKAQAGKAVESSIATTAKSAATPATVTPRSRSLLQSVVYG
                     PQPKGGTVDTRDSTVFLDLSRTVGEVARVFIRNPSRSAWDVFRQTFLAPFPEDRLVAA
                     GADLLIELVAYTVLCTLLVVELYQQSRTSAAKEAHLQARLEAIESKVNELVECSNRAA
                     SSPPVQELPPVRELRVTGRRSTLWGAVTGGVGFVGDSVSRHTDGRRKSSTSSSLATEE
                     LERLAQSGKVVVPQRTNGSNVAYAPPRDPAVKVSKHDETIFVQEELDQVMGNVVLMEK
                     RA"
     gene            <112650..>114497
                     /locus_tag="LMJF_11_0370"
                     /db_xref="GeneID:5649779"
     mRNA            <112650..>114497
                     /locus_tag="LMJF_11_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681453.1"
                     /db_xref="GeneID:5649779"
     CDS             112650..114497
                     /locus_tag="LMJF_11_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681505.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649779"
                     /db_xref="UniProtKB/TrEMBL:Q4QH43"
                     /translation="MGKWKEAVTTQLNDAARKNKKLREELRLLREEKANALSELRVQL
                     TEEFQERTAMQRDELEALKKQTATLREEKKTMAATHEAELQATRMKLREVIQLELETE
                     YKRREEGWEKEKTQLQMLTAAKETERAQAEHECGVLQLRLSRLGTHYDELATLLQPEG
                     GVTAETRVLEAGDHAANGTRPESASATAAGASGTGSAALDTNGSNAERQKMAMAAAHA
                     RQIESIKADLQSKQQHTQFLLGRTKQQHEAEKTQLLRELHLREEELKVAHTLLKQVQA
                     ENSRYMERVSHAQAERQALEQRYAAKVSALSQELAERTHAMDEAQLANKRLQEQLRNS
                     QQQVATLEEESTMREEAFHSLMFSEDSKRITMDLQRAVQAARDEAEEWKMQYYASVTA
                     SQPPPAAAAATSQGGPSPQKSAEADSEHESAAATASAAAVRTPEAWHDQLAAREANLD
                     LQAAQLARKAALLAAAEAKLDKMRSCMASQASLLLQQSKSGGRAGGSSSVGGPYGRRE
                     NGDSSVFTGGGDRSNAEDDDSDRGLADTSPLISTAASLLPSSLHGSLRLLEAQRRRLH
                     LPGTCGLCACCFSGGGTTGVPRRLRRNAFLTTVAALMLLFMLTSFRAVA"
     gene            <116491..>119895
                     /locus_tag="LMJF_11_0380"
                     /db_xref="GeneID:5649780"
     mRNA            <116491..>119895
                     /locus_tag="LMJF_11_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681454.1"
                     /db_xref="GeneID:5649780"
     CDS             116491..119895
                     /locus_tag="LMJF_11_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649780"
                     /db_xref="InterPro:IPR021301"
                     /db_xref="UniProtKB/TrEMBL:Q4QH42"
                     /translation="MFKKKISSLTTTVASAAAATTATAKVKATTSAHTPVKRGSKAKT
                     LALIEKHRKILDEARRQKEEMDQLTLEQGERQRQQQKLTHITVAPPLPATSCAAASAA
                     AKEEPPRDTFTALVEHFLASTQPLADLDETIQEAHSSAGASNEAPFKSPPPRQTRSAT
                     AAASPSIITYRSFAASLICPKKLFLLQNRSDLIPKASLGDMMHFDDSVGFNELVRRWD
                     RLQFGSRAVLVKENEFYQAVQRTEQLITTYFQGPYKSLAEQAPSLTIHRPAFAVEFPG
                     GAHQTRADGRGSSAAATDSAAMELRARPAVVRYRPKENQWVFFESQAVIDPLSSPSRI
                     SSFVQRFHFTALCFRLWLTQPHLPIEVRKKFLQVDLDGITCENLGGRSLESSARAAAP
                     IDLKRSGLLHIRQFFPGPATLMDCDPPRLVKFIQRVSLEELIAEDSKHYSKDGHGRQY
                     SNATARAGGGGADYFSRHGFGGGGSGAGAAFDLRNFTSAIASHPVLAGHAAKVELAAL
                     ELVGLHNSRATRSQRHKDEVHHRLFEAEQRFMEELLRQHTLPLLKRQQQQMAAFSSAE
                     GPASSPLTAFSNLLGDDGFVRVSCAADAVGNGKHTKGVKSAAQKVKAAAAGGRGKRQG
                     PVTDEDEESKAEVEEDAGDVGMRGGDNIDSPCYARYVGTHCLRGGDACPFFTEGMCLP
                     RKVDDAIVARDNHLFTLPSTSLARKAAWWAQGKRTVRDVLAAYERGESGVRLTSPQVR
                     YASALRQGKVALNPKEIDAFFARIRYPLFVIDFEAVQFALPPFAKEVAYQSIPFQFSL
                     DVFQHDVLTEEPTHYNYLHFGKGYSPNTDPRPACIAELIRIVRLEREKKRKAMEASGE
                     LERIASERAAEEEAAAEASGRCRRRGKMPKPPKITKSNPLEQPLHPYDGCFIAHFASF
                     EKACLEKLGQLEEKYKDEIKSFWFLDTLDLIKKGYLHPNAHGSNSLKKVLPALCPDFQ
                     YGVFGSETTPAVMVTANDGLLGVGGSGNAVPVSDASASKGSAGEGQDEQKGENAMGVY
                     RLWHHMEGGGTVQDLERAKLGLSGGTQQTPNWSESVRTTMTKEERERLWQTLRIQLLE
                     YCSLDTKALYEIMREIYKEREAAAGIKTHDKTGWVLIDPVPREVDF"
     gene            <121421..>122947
                     /locus_tag="LMJF_11_0390"
                     /db_xref="GeneID:5649781"
     mRNA            <121421..>122947
                     /locus_tag="LMJF_11_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681455.1"
                     /db_xref="GeneID:5649781"
     CDS             121421..122947
                     /locus_tag="LMJF_11_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649781"
                     /db_xref="UniProtKB/TrEMBL:Q4QH41"
                     /translation="MYTPRRSVSSAAAAAAQTSADAGGHGGSSMPCADVLTTTLQYIH
                     TNKYLKNKLHYTVETTCASTVFARDNTDHSVLSEAGAAPAGGTAASQAAHGRAGQGQK
                     RASCSAGGAGSARRRSDRRPSQRQIDTAAEISAGSSNNTGDGTAPERQEAPVSIPENE
                     KRAMAVVKYATARAAHHHVTAVLLGVGQRQDGKVCTVGAVAQGVLLELRSLYPLYYVK
                     KDGVKWRPALSTTTTTTAATPRRFTIVVAVPADARWESATAAETRSGNEEAAAQTTAS
                     IETPSVAPPQVPIHVQEAVAATVQYVQTRCMRLHAALQVEQITFAVIATSSSQDGNSI
                     TEPDRGENGGHVAAGPDASGGKDGSTWISPLEAYKRHLESLPFVECKSIPPANAAAPL
                     LSPVNRINPAAVGETGGIEQHLPEDGAAMMCVEGSATGAPAPRGAASPVAVCVLKASK
                     KNPLLSLDSEPEVALPQIIKQVGSLKPEVLVMPKSLVPESLQLALLATSNPHCIVLPF
                     "
     gene            <127425..>130706
                     /locus_tag="LMJF_11_0400"
                     /db_xref="GeneID:5649782"
     mRNA            <127425..>130706
                     /locus_tag="LMJF_11_0400"
                     /product="tubulin-tyrsoine ligase-like protein"
                     /transcript_id="XM_001681456.1"
                     /db_xref="GeneID:5649782"
     CDS             127425..130706
                     /locus_tag="LMJF_11_0400"
                     /codon_start=1
                     /product="tubulin-tyrsoine ligase-like protein"
                     /protein_id="XP_001681508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649782"
                     /db_xref="GOA:Q4QH40"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:Q4QH40"
                     /translation="MHSIPKHTQATHTSPRAPTTAESASSQPHQRHTVVRVEAASKSA
                     ALESASASASASATDVSVEHWASSPSHSTITIAVGSPQSQHPDLAPAVQSKVRDDGGN
                     GVSREVVEVATPSVLIPAFKIADTVENAKASAASDAPQKEAIMTAEIHRDKRIVISRP
                     SSMHVTCMTDLTRPSDAYKVALRLSRPSNALTRRSRQPRKVVNVCLTKYPLIRKIAEE
                     MGFEMETTEDELNEYKFNLCWSDTVLSLMRLVRLRNWQRTNHFPSMYLLCRKGHLSTT
                     LGKMRRKLPSHFAYYPRTWSMRSERMQLTQYMAAVRQRRILKYFILKPNSGCQGRGIV
                     VARDPLTALDEHILDNYIVQEYVHRPLLLEGKKFDLRVYVLLTSIRHPSIFLFNDGLV
                     RICTEPYETPNEENVKQACKHLTNYAVNKKSSEFVFNTNVEHMDVGNKRNFGFLNRWL
                     AEGGHSPDVFWNEVGFIVVKTILAAQPLIAKVYDSCFPTGFNEGYCCFEVLGFDILID
                     NKMKPWLMEVNHTPSFATETPLDYQIKSKLISEVWSIIDCKVTDYERDRQRERDEFAK
                     RNMPPWASNHPLYGSQLKKNTSRGAGADGADSPDHNPATTACANAEEEVPPYVHARRN
                     FEDTKLKNFKRIYPSPNSDVQLVYDTIQSLATLEFANSRLYYNSTVAAPVPVPMSSPP
                     SPGVRTSSALPFRVRPPLLGPLLTASRNGSSNSSPSTVLPPRTPATLMTPNTTSAAQG
                     SGAAGTATPIAAIPAAHLATSGQTVTSPSVAANNASAPAAPSVTPTPLAGREGQPAPA
                     TIFNLMEKDILRRRRSSDAPSSALALSHTSTTRSSTTPSESGGTATSTPAAAQSPHPL
                     RTHTPQLLPTHVRTNSFAEKTLSSSQKPSVKATAADDTAASRAKPRVAEVHRLVTGSP
                     PTMIPTTIDIPASPSANDGTPASNAAAMPASEALQKMKPMETDKPDDEVPSLARTVAP
                     HPAANGPIHISRHPTPGQKLRTPSPVSTPNTNGRPRANSHELSSMTCKSVSVSGSTRD
                     LDLSGVAHSGRRSQECQMRSILPHQEPTEEELARLATLQAMLDYEAAADPQPDDDDDD
                     YNLTE"
     gene            <132854..>135280
                     /locus_tag="LMJF_11_0410"
                     /db_xref="GeneID:5649783"
     mRNA            <132854..>135280
                     /locus_tag="LMJF_11_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681457.1"
                     /db_xref="GeneID:5649783"
     CDS             132854..135280
                     /locus_tag="LMJF_11_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649783"
                     /db_xref="GOA:Q4QH39"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028598"
                     /translation="MTSPKGKPSPKRSAPAPATAALTPCAEERTEGATSSASASASSH
                     ISSSFDSPRDDTVVLTGYTAESEHSAHGYERLHDIILQGSDTDADSEDGRANEDDVIL
                     FPHAEELSNAAAGVGGDDDNGRVVRLGTTQHLDESDSSEDEPTLNRVGDIPLEWYKDE
                     DHIGYDIEGKKLMKKERSALERLLEATDDPNAMRTIYDALHDEKKTLSNADLQLIFNL
                     QRNRTTNPNYDMYSEVQEDTVVFDPLNHPLARSGGPSKKAFVPALHDMKVIAKMVRRL
                     RKEEAERRLRPAKEEKEEEDQLLWDDSHVEMDTHTHFKYFNRIPKPKLPPPGTFESYR
                     PPPEYLPSERAKQRQARLRTIDRKEHFLPQSFDALRHVPFYHHTIQDRYQRCLDLAFF
                     PRAQRTRLVVDPDKLLPELPDPKDLRPYPEKLSFHYKGHTATVRSVSVSPNGQYLATG
                     CDDHLVRVFEVQTGRLMKRYDMGAPVQQVEFCPSTSLNILAVAVEYSLVFIVPTFAAH
                     TLVNDHTIRFLRAPGLSAGQREAAHALGAVDTLGGRAVTQTALDADETAHEATADLHD
                     IEEREKRAEFVDASAKERNAGIVVKIAMHAKVKKFCFHIKGDYLCALCPKDHVKYRQT
                     IMLQLSKRKVFCPFRKFSEVVTDCRFHPREPIFFLATTNSVRCYNLMAHRLQRRFKAS
                     GGVTTCLSIHPEGDNFLVGDTTSHTSWFDMDFSDKPYKRMRSHKGVVNALAFHPKTNA
                     YPLFATGASDGQVHVFHGMVYDDYNKNALVVPVKILKHQRPVYAVAWHPTLAWLFTST
                     EDGVVTAWTE"
     gene            <136506..>138830
                     /locus_tag="LMJF_11_0420"
                     /db_xref="GeneID:5649784"
     mRNA            <136506..>138830
                     /locus_tag="LMJF_11_0420"
                     /product="putative chromatin binding protein"
                     /transcript_id="XM_001681458.1"
                     /db_xref="GeneID:5649784"
     CDS             136506..138830
                     /locus_tag="LMJF_11_0420"
                     /codon_start=1
                     /product="putative chromatin binding protein"
                     /protein_id="XP_001681510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649784"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q4QH38"
                     /translation="MPVDDLTSAPATVAGPVYTAIAVCGCGHDGRLGIGQDAPSAMSE
                     IALLDDFLPTFASASTVGEVRQVACGAYHTLVLTNTGLYGWGLHEDGQLGLGRPSTAS
                     TAAAAVDGALGNAGATAASVPTHVDRPVRIPFAECPGGDGVLDDVSAAIISIHCGANH
                     SFLCSTAGVYVTGRNDCGQLGFGHTDNVYTWTRLCAALPQTTADDNARHTTTASRAAS
                     PMMSAPPSACDSVLGGRHARLLYGRLTHISCGTHHTLLAWSDAVVLRAAAPSSPASQQ
                     SPANSNDSCELVNYPSLLMACGRGDFGELGYNGDTWAVLQAQAQRQERALRSSLQQQQ
                     AHDNANEGRHGATDNAYKFKWKAAAAVKQRRPPFNSAFFELVEGVEHLEESAVRLPTT
                     GAEALLPALLHRGCTAHELAEYVIRQCHESTAADRMCLPPTASARQTGSGVQSRWEVA
                     KVQAMHHHSAVTLRRRHDEGGEQQLVLHWGCYYCSDIEDAAASHPRDAFADVPDASHR
                     DDAGAAAAALRGLCVGIHAGEESLLRYRATRTPSVPASAAALARAEDEKSAASPPCGI
                     TPPHVPLLQIMGSGNLGLGTDDSFTRTWTSLAFSDAPVATGGQAMVRSVVGRSHYLIW
                     MHDQRASSPTGHSSAAAAPSHERSTVASSSCVFGFGDNLHGQIGAPALQARDVPGDDV
                     VVAPRPVLRDGNVLRVATAVQQTLRDAAAPPARHRRLAAAKTLESFTSGVEAHYEVVA
                     IRAVEAGARHSVFLVDVRPADAAAASAAPATTSS"
     gene            <140343..>142277
                     /locus_tag="LMJF_11_0430"
                     /db_xref="GeneID:5649785"
     mRNA            <140343..>142277
                     /locus_tag="LMJF_11_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681459.1"
                     /db_xref="GeneID:5649785"
     CDS             140343..142277
                     /locus_tag="LMJF_11_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649785"
                     /db_xref="UniProtKB/TrEMBL:Q4QH37"
                     /translation="MAHVLQKCAHVLGISLSATGVYYAKGKMPYPATSSNEGTSSAES
                     MGGSPGKAAKSNTVSAVKESQAATRKSKAQGNSVATAAVHTPSPPSSTEMNATNLDAT
                     SPCSSAAGPVGFFFDVGLHDLPNPPRDFDVTPSALAVDGTHSSANGAVIAVRDFVSHI
                     PPFFVPVTEVVANMPGYTAEHLEVYLNVNSLELVTVAGERYVRLYGSFGDLSLSGSEV
                     SEKRYAHYRPDVALVAAFEAAFEGIYDKWMPLPELLRRVGPDVTAQLPYQGPAAITYF
                     AQMQHRFAFAVREVPTTGGGAAGALSSPQFTTEAAVLLRKPGYSGLEAHSTPTPKSFQ
                     ALMSLVPGDTQVDIDVVRCQLTSEVRAELSRYYDGLEGFFAAHKPVFFVPPETPTVVM
                     RMRYRLRTQRAKLPLEEQLRIATDARDKARIRSLRRKIAFRDDPSHPLHDPENLAKEV
                     SKHLPRRGFVHLRIFLKRNVPEELLMYMPKRMRCFFNNYPQYFTQFEYQSAGTWCLCR
                     PDQPLPRGVIRQNFSDGDLLRLIAEFLQQRGARAASMVHTNLPFGAQEVIRRRYGGVY
                     FFVTRYPQYFNVVLKTDRQNVKSSAVVHLIQVPSQELSDATMAASAASLNNPNAPSHD
                     DDDHESGDDDDDEDLDDGLD"
     gene            <143368..>145128
                     /locus_tag="LMJF_11_0440"
                     /db_xref="GeneID:5649786"
     mRNA            <143368..>145128
                     /locus_tag="LMJF_11_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681460.1"
                     /db_xref="GeneID:5649786"
     CDS             143368..145128
                     /locus_tag="LMJF_11_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649786"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QH36"
                     /translation="MQVDLRRRGLQSFDPAEFANTDEHLHLLLQVRQLDLSYNSLYTI
                     RGLEGLTHLTVLNIAHNGLRSLGGGLPLTLRELDASHNNLASLQNAALLPLQSLTSLN
                     VSFNNLEDLRGVPNVTAQLTYLDVRCNRLGSLIGIEHCRQLRTLHAEGNLLREVADVA
                     SLKCLSLLSAVFLSGNPLLLRKRLLSQLHLLLPSSVEQDDLPTTAPPSSVRSSTAPPP
                     SVADTSSVGSLDHSTMASVSEYREEGRCGSGQNSRPASAHQGTVLSMRNTTSVRDSSA
                     TLERTAPQHEHPSSPRGHHRLPHRGTSDSARPSYLSAAAPTTTTASAASTGVVGGSSD
                     SLACPRRALPHEHRLTETPGSASLSSSPDRTHVSWSPGPLHSSNGRGSLTTSLFPGAA
                     SSPHQYGAVVAAPQATRYGESHSSELVRDDLEEQLVRVTAERDDYRREVVALRRELRE
                     LQLTFARQCSHERAEDREGLAQASVRSVAAAAAPGHGEGDSSGAHRKPCHRRQQQEQQ
                     QRQRSPSVRILAVEMSAHSSLCSQDGESDTPDASNDNLRSAPPNSAAMSSSVGTSKMD
                     RREIAALFMTKLQQSSSSSK"
     gene            <145965..>148202
                     /locus_tag="LMJF_11_0450"
                     /db_xref="GeneID:5649787"
     mRNA            <145965..>148202
                     /locus_tag="LMJF_11_0450"
                     /product="putative DNA ligase"
                     /transcript_id="XM_001681461.1"
                     /db_xref="GeneID:5649787"
     CDS             145965..148202
                     /locus_tag="LMJF_11_0450"
                     /EC_number="6.5.1.1"
                     /codon_start=1
                     /product="putative DNA ligase"
                     /protein_id="XP_001681513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649787"
                     /db_xref="GOA:Q4QH35"
                     /db_xref="UniProtKB/TrEMBL:Q4QH35"
                     /translation="MALSTLDILEQRLLAAGLGGTTNTAATPKSLVAPSASSNYSEAD
                     KADQLKWFSSSVNAPFFISPKHDGVRLISYVSPTTATGPPSAQQASSKTKTGAATVAP
                     PPLMTCYSRYGRPIYGLFWIEEELRLLRALCGDASLIIDGELYLHQTDMDASRGGREG
                     RANASDGRKRKPARTALPSSDADGVNSFNTGFLAVSALVNRFRSSTFRCASKESVLKY
                     VPSLPRLCVFDVPSYNPCANPLAPPTRNAPTAISAASRLHVETKASVKYDGSPQQVLA
                     ELQRVRGNVTDALRLNDVEQLRIVPNVTPFSQRLRTMHYLFELLSRGMKSPVLRQHFC
                     PTSSRMCGAPTTRPIRNCRKHTPTAAQVQPPHSGIGQHHGGHFVSRIPYQLVKSLEDT
                     TQRMLPMYLDAGYEGAVIRAPVNTYDFKEKTKGTLAALVAPLLRATETTKTRRGRHLR
                     GTSTGAGEASGRRARNRAALLLSLNTGPVLGAATPLMVHAYRGDAPRREPMQPILPSD
                     AGLTDAELDVLDVVAVGRRAVLQSAKLPQRSMTAVKVLTYHDREYPILRPLLKEPSKN
                     PRTRELVSIPRSHVRALGYPIKRSTDTALSDGDGATTLTPATPRCGKKKTKSMNHATT
                     AGQGSAVFYGLQCLAENGLVFNTSLPKMTLAQQKTLLQHLLSAGRDPMREGREAASAT
                     MKTPHNKRSNAEAPYGGAAHPSPSKIVSLTGLYATVKFSTLTEHGLPRFGSIKAIRGG
                     KGWFM"
     gene            <148695..>150626
                     /locus_tag="LMJF_11_0460"
                     /db_xref="GeneID:5649788"
     mRNA            <148695..>150626
                     /locus_tag="LMJF_11_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681462.1"
                     /db_xref="GeneID:5649788"
     CDS             148695..150626
                     /locus_tag="LMJF_11_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681514.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649788"
                     /db_xref="UniProtKB/TrEMBL:Q4QH34"
                     /translation="MRRSAFCAQRDAQNRGGSTHSSTSNNNNGAKSSPGAAAAASLNV
                     WTGTRLLDSTAQILAAQPADPLRVLSVRFSTEAVLTATYPTTSAPTGERKLEAEAGRV
                     IGAPSAPGAVKSTAYNNGSENPNLSLVTNGRNASVPPVEHLIEQTWVRQRLQPYGLHA
                     VARCACACPPLRPPPAAPSRFAVSTSPVGSAEGLDTATARAAYATSSPLLPQWMDMFA
                     LLHRQSRMSYVELAAEAKHWDARSCSAAVMPPVDYSAAEEIPASAVLLCVMAVIEEHL
                     RRAECGGRTSGAERPPRLCRRLQISVKLLALQLLAAFMDLQHNVESTQCSSNSSSASA
                     LDPKQEDEVQESNHDDSNTITGDTGVCHITHGVYLLTAHQLDELHHWLHCCLREMIIS
                     PLSPHTAGTTAVDGRDGCGTRSGEADDLDAGSPLEALKSRATAYLTRVLGSPAHGMAA
                     PASMMGVVSLDTFVAFMERLAAVVVAHQQTAVSMAIALSARLPPTATASAGEAQLPAW
                     VIEHVSKCADAVVQQQTVLQDDSIPDPITSTVPLAWRVYVNQISELLEPFQRDLLAHV
                     CREQQEEKNHRGTLNDGILCKLQRRLLSWATEAVHRHAQAQKRLTPDDFSPAVVAAEV
                     VGVWVSHVFEAYTVTLYPN"
     gene            <151284..>153539
                     /gene="PUF10"
                     /locus_tag="LMJF_11_0470"
                     /db_xref="GeneID:5649789"
     mRNA            <151284..>153539
                     /gene="PUF10"
                     /locus_tag="LMJF_11_0470"
                     /product="putative pumillio protein 10"
                     /transcript_id="XM_001681463.1"
                     /db_xref="GeneID:5649789"
     CDS             151284..153539
                     /gene="PUF10"
                     /locus_tag="LMJF_11_0470"
                     /codon_start=1
                     /product="putative pumillio protein 10"
                     /protein_id="XP_001681515.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649789"
                     /db_xref="GOA:Q4QH33"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QH33"
                     /translation="MGKKAEFARSRFKEVRQKREERMQRSRTERDRRHGIDKLERKIG
                     KVVVQRPLPNEAQQALLLAQFAQACRLVAPSTDMCILMRHYAKVAEAAEQKSKSTTMV
                     TTSAPSAKSTTRKRKRDEAEEEEEEAPAAGATFLDTVADALLQTQNAPAVIEEAAASA
                     KDGENALDDDDDDDDTVTVLQDILQDDNGRRVVATLLASLNAVHSSKCEAVAKAVLEQ
                     FEENEHLPQHHVACRVMSALAQFGSDPTRQGVLNLLRQRSTTIEGVERLLSDRHTAGT
                     IEQLLKSYSRETAAWLCEALSLSTPVTSPSAAEAGGKKKKAAKQRDAAAEETASGERI
                     TTEKLMELVNGPVSGQVLLQLLHTDARRELLKRLPIVELLRSKRGTTFLTQLLMSTAS
                     VASSKGDEGREAEAVALFSDVLERLGNDLGEMAIDKRANFVVQALIQLLPAMGPQSAK
                     QLERLERGLGGAAGISALVAHGNGVHVVLSLIDAALTLSSESAVEGLAEQLVTRQNVT
                     DLLYHKHGSLVVRRLMPLISRKASKVGRLLQGMVEQDFSNLVYTEAGNLVVTAYLTAL
                     GKSGASLLAQKLAGGEELLSMCRSPYASHVVFTLFELVDPITHTLLCNALKAHVLPLS
                     IHVNGRFIVEKMIAASRDVRESVSRQFLSLAQERGTQHVLCALLARMDARGKQACVEK
                     TIMPNLTALATHQCGSIVLQKLMQAEPTVLSAVRQRLSANSLVRSDLAQNFFGKFVVQ
                     IAQQPEQEQPQ"
     gene            154394..156088
                     /locus_tag="LMJF_11_0475"
                     /pseudo
                     /db_xref="GeneID:12980855"
     misc_feature    154394..156088
                     /locus_tag="LMJF_11_0475"
                     /pseudo
                     /db_xref="GeneID:12980855"
     gene            complement(156787..156909)
                     /locus_tag="LMJF_11_5SRRNA_01"
                     /db_xref="GeneID:12980840"
     rRNA            complement(156787..156909)
                     /locus_tag="LMJF_11_5SRRNA_01"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460095.1"
                     /db_xref="GeneID:12980840"
     gene            complement(156961..157042)
                     /locus_tag="LMJF_11_TRNALEU_01"
                     /db_xref="GeneID:12980845"
     tRNA            complement(156961..157042)
                     /locus_tag="LMJF_11_TRNALEU_01"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12980845"
     gene            157116..157187
                     /locus_tag="LMJF_11_TRNAALA_01"
                     /db_xref="GeneID:12980850"
     tRNA            157116..157187
                     /locus_tag="LMJF_11_TRNAALA_01"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12980850"
     gene            157249..157319
                     /locus_tag="LMJF_11_TRNAGLY_01"
                     /db_xref="GeneID:12980846"
     tRNA            157249..157319
                     /locus_tag="LMJF_11_TRNAGLY_01"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:12980846"
     gene            complement(162726..162797)
                     /locus_tag="LMJF_11_TRNAALA_02"
                     /db_xref="GeneID:12980849"
     tRNA            complement(162726..162797)
                     /locus_tag="LMJF_11_TRNAALA_02"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12980849"
     gene            162871..162952
                     /locus_tag="LMJF_11_TRNALEU_02"
                     /db_xref="GeneID:12980847"
     tRNA            162871..162952
                     /locus_tag="LMJF_11_TRNALEU_02"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:12980847"
     gene            163007..163126
                     /locus_tag="LMJF_11_5SRRNA_02"
                     /db_xref="GeneID:12980851"
     rRNA            163007..163126
                     /locus_tag="LMJF_11_5SRRNA_02"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460096.1"
                     /db_xref="GeneID:12980851"
     gene            <165143..>168325
                     /locus_tag="LMJF_11_0480"
                     /db_xref="GeneID:5649797"
     mRNA            <165143..>168325
                     /locus_tag="LMJF_11_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681464.1"
                     /db_xref="GeneID:5649797"
     CDS             165143..168325
                     /locus_tag="LMJF_11_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649797"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QH32"
                     /translation="MLNVNAKAFVPPGVIEGIPPSFHTIGWYRYRLSVPVERKMSVLQ
                     EDRYLNSISSLLSLKYLYAERGGVDDDSLQYFLNGQFMVSNNIPSNGDEEHVSSGFLL
                     SRSILTLYTELTAVAHLNDSRGLLVHLDLPTEFNGDVAIFLANAWEAFFAAVSENASV
                     SAIGYSRSVVGMGGSQTNGTYRHYFFAACTSPESLEVVVRDIMSESPVSVARIVRMKS
                     VVPYLCSPHLQLGVMITFGEEAKLSAIKDRRANFSLKMKYRADDFFEAWKALRDVETQ
                     LLEILNGDVKWDRIHVLHLHVDPAASENPVAIPIWDIIWYIGLLCDDCSASVIGVSFS
                     TSSLDAATRELLSSNKRAPFYVCSNLDAMLAADLSLDTNHTYYGGVPSHVKKVLPCWA
                     WASAASAVELWQRAQKHLSPVEMLTRMSFADAADSFARGTYTVHRKAVGTPVVVGTDA
                     KGNIFGFDVAHHSVFGLPLCFGGAVDPVISCVFKGTVSPSYRSSLDYRIIIDDVLLFK
                     GKETKGIPFAERMRMLNSVGIEDESTWPHAHPAHIVILKAECLPLDSSKKLVDTPVFD
                     HSNMGLVFTPSIQPDDDSVFPTFVWLPPTSLTVRFSVEKVVVANEMNEGFDRAYLGVS
                     SNSVHKRVIIPYEGEFADYQREAYPTLAVGSIVECLLRRADDGAHWWDVLQDFDAAEN
                     CEADSFDHVDELVHSPGVTQEEMLWLLKAPSYQCERCHKVNDVGRRNSRHNAYWCKSC
                     WIETGHGDCMYCGRAFALGMLDGTSNLFYCEECWRAFSTFNTDAEIGYHVPPPPNATF
                     TQQVTTRCVSLLIDLMNPKTPSNDVLDLCCGGSVVRKWMRNKTLRYVGIDLKRSVVDA
                     TTSVISSSKEMPTEARYDVICGDVFSDDFWMSTIVKIHPRQFHVINCFAGLHHAFYSE
                     EKARHFLGSIANALVPGGTFLGMFIDASVLFAKGKKYANSIMKAGWSVDSVPRIGHTF
                     QFTTNNGPMRDVNVIPIDFLIAVAAEYGLHAVSEAYLTFRELIEKDPSWTKVPSADEK
                     EYLCARRTFAFKKESNELAPFSPARKSDTA"
     gene            <169313..>170536
                     /locus_tag="LMJF_11_0490"
                     /db_xref="GeneID:5649798"
     mRNA            <169313..>170536
                     /locus_tag="LMJF_11_0490"
                     /product="tetratricopeptide repeat (TPR) protein"
                     /transcript_id="XM_001681465.1"
                     /db_xref="GeneID:5649798"
     CDS             169313..170536
                     /locus_tag="LMJF_11_0490"
                     /codon_start=1
                     /product="tetratricopeptide repeat (TPR) protein"
                     /protein_id="XP_001681517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649798"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QH31"
                     /translation="MPPKGLSKSSAKAQRAKAKKERQLLEARMRECYEKCAEARGYLE
                     PTGRSAEPNFTKAKTALDAAIEACDASSLAFFLLGQWSRMQGMYKEAIECYSHALDLE
                     PTNVQALEWRANCFQTLHDYLHAIEDNTSIISLDPENDHAYNMRGLCVLQSSVPGLRL
                     RSVHFESCVRDFSAAVRLNEANYYAMANLGKAYEVQGHLEKAIECYGKALESSEDYAY
                     ARFRRGCTALRMAERSILSREESEGSSDSDAPEASADSAKAVHGSSTQHMTEAASSTN
                     RRVPGSATTLKEVKAEVRQRIEEEEEAQKAAKLLKLAEGDFTVLLDRSPEAKILTADA
                     TVVLNIGICALLRKNINRAEKHLKLAQEIVAKRPGLIEEGEAPPLENMDTFNSVLAIR
                     LNELQKLKDMARSAA"
     gene            <171150..>171548
                     /locus_tag="LMJF_11_0500"
                     /db_xref="GeneID:5649799"
     mRNA            <171150..>171548
                     /locus_tag="LMJF_11_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681466.1"
                     /db_xref="GeneID:5649799"
     CDS             171150..171548
                     /locus_tag="LMJF_11_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649799"
                     /db_xref="UniProtKB/TrEMBL:Q4QH30"
                     /translation="MLRSTLTRRSGFSVRELYPYGVPRRTFPYREHQKQISLAPTAGG
                     FYVTKHALGWPFQIPFEWLFYRSSVAFFVFCVAYDMLFGLPHPFMKEVPPGTPHHFFF
                     GNAGGTPHHLWQYQDGWTVPNMSGGRRWFD"
     gene            <174488..>176224
                     /locus_tag="LMJF_11_0510"
                     /db_xref="GeneID:5649800"
     mRNA            <174488..>176224
                     /locus_tag="LMJF_11_0510"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681467.1"
                     /db_xref="GeneID:5649800"
     CDS             174488..176224
                     /locus_tag="LMJF_11_0510"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649800"
                     /db_xref="GOA:Q4QH29"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QH29"
                     /translation="MPTAFVGVSAVPPLERQKQRLANMDPSVYTVFEECRYKSLLAIC
                     HLARLIDAAIRGPDESTQVPASQPCDDTSHHDCALGSAANAEREEPVGRPIADATISR
                     GSSEDLPLFIPLMDDNSDVSFCSMLHVEAESSSNTSGLGYLSENAAKERSKQSTDMQA
                     NSHAALTNRERDVSLFPHLNGHWECGIFAGKRVYIDTGGLYLGRGATALVYEGWMVVT
                     DMMDGSEVCLAKVPVAIKEVTYNAKNRRLRNLYELAVNLRLNMVHPGIVHSYYAGTYM
                     PRLAGFRGAEKAMVYAHIVLARSVTGSVADVLRRSGPFPEPEIKRCMAEILSALQCVH
                     EDHNCVHNDVKPHNILIFDDSSAYYAEFKYQIIDLTDIAPATPIEDVLRDLATERKQQ
                     QNIFSERGTVMYMSPESCLGLGTLTSNDVWSLGITAFHMATGTLPWRPLERQYPSMIL
                     NGYRRKFTLRSLVDVHVNDAYGASGSCYPTGTDNPLHADSDGKPRARFHASSAPGSRA
                     TGGASCTSQVFRDQYKGFGPILDIPDEVSVSSEFRSFLEQCLTENPVKRPTCRQLRSH
                     PFVKDVTVASQH"
     gene            <180196..>181596
                     /gene="AAT15"
                     /locus_tag="LMJF_11_0520"
                     /db_xref="GeneID:5649801"
     mRNA            <180196..>181596
                     /gene="AAT15"
                     /locus_tag="LMJF_11_0520"
                     /product="putative amino acid permease/transporter"
                     /transcript_id="XM_001681468.1"
                     /db_xref="GeneID:5649801"
     CDS             180196..181596
                     /gene="AAT15"
                     /locus_tag="LMJF_11_0520"
                     /codon_start=1
                     /product="putative amino acid permease/transporter"
                     /protein_id="XP_001681520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649801"
                     /db_xref="GOA:Q4QH28"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q4QH28"
                     /translation="MYTFTISGAYGIEEAVMGGGVLLTIVSIVVIPVIMGAPIVLVVA
                     ELAAAVPSNAGFLMWIKLSFHRCVYLSMAIMSLIYIAVDNALYPTMFSEYLCTSIHCS
                     DTGEKFLRLGMLLFTYSLNMLGVEAVGVASVVLTVLTVSPFVLMYLLQQLRTGFYVNW
                     PAVAYIPASVDWTRFISTASWCLSGLEQAGTVVEEVEDPQRTIIGSLIPLIGLAVITY
                     VPPIIAGASVSREPLDMSKWKTGYWAEVSYQVGGNALKLFTVVGGVLSAFGLTLSALC
                     TTTCIISGMALTEAFPGKVGVWLSRRNKRFGTYHWTLTFNTVLTGLFSTVLGFGSLVL
                     VDQCLYGIRVVVILISFYRFRQLYPYLPRPFRIPFDGWRLHLMMGVALASSVALTIVS
                     LLQEKLTVILCAAVVGASFLVSFLYCRFVHRHDFAGRIVTFVTIPSSRHSNGGGDTDA
                     AATRRALSEAPASTGE"
     gene            <183172..>185334
                     /locus_tag="LMJF_11_0530"
                     /db_xref="GeneID:5649802"
     mRNA            <183172..>185334
                     /locus_tag="LMJF_11_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681469.1"
                     /db_xref="GeneID:5649802"
     CDS             183172..185334
                     /locus_tag="LMJF_11_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649802"
                     /db_xref="GOA:Q4QH27"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4QH27"
                     /translation="MSAAAATAASGRTAWPKDALCYQCALRMSMLFDYPPPRAMGQLP
                     SSLASGAVSALSDDTLPTLDDDHHPLFTLVHETPRSARRYFRGALQPTVTTADGLQAP
                     RSVDAPEVVGPTAAASTAHGMLGGDTAPKYAVSWLCVACMGLYQFIDLIHAPLAAAAV
                     RASPFYDSEAITINVNINRSFTFTWLAVATRYFDLKGTGTERPSPSSVVKEELSNFKD
                     FYMSDLRARILPYLLYSHDDVAASSVSPAAISRTTQLPGLAVYVDAVGATLPDHAREV
                     GKEATAGEPVVKCARTEVTAVVSGSASSSRAAAPDRGGTRPALVALQAFRYSGASESL
                     VGEVFCRHHATEGLITDGHMPAAYCGNRSTEVLPYSVIYDYAVPYLTKAGWMPATATA
                     AREEGQEGCRTTARQAATVSCRLHHTNIYLMGSYRKMMRNMSQSPWFLNGQRIGSFSL
                     QEVIANPVLPFFFPDMPGLPPEAAESPALPASDEGESTSAAPLAVERGAHATRWQAVT
                     PSVASSTLVFGYNRYKFHSAGREDVDVRMLGEGRPFVLEFVSPIRERFTEDDLRRLEA
                     SICSSYEGSVEVRQLRRTDADITVRLARHSESKVKRYRCVIWSSRAIDDVATDPRVRT
                     IHAMRDLPIQQKTPLRVLHRRSLHRRPRLIHSMRLTPLNTHWFLLDLETQAGTYVKEF
                     VHGDMGRTTPHLGMLLNARTDIIQLDVVGMAMHDLDQE"
     gene            <186129..>188072
                     /locus_tag="LMJF_11_0540"
                     /db_xref="GeneID:5649803"
     mRNA            <186129..>188072
                     /locus_tag="LMJF_11_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681470.1"
                     /db_xref="GeneID:5649803"
     CDS             186129..188072
                     /locus_tag="LMJF_11_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649803"
                     /db_xref="GOA:Q4QH26"
                     /db_xref="InterPro:IPR007657"
                     /db_xref="UniProtKB/TrEMBL:Q4QH26"
                     /translation="MTLEAIRKRGAEELSPVHHQPPSSAAVLGALSCGSLRHRLWRAR
                     RGLRGPRSLSCVLVASTICFFISCVILLQTQVWGWGWYSDEVAVFRQQQEHDDARRRF
                     RCPLTEALVFSAKRSAEDPLEVAYALMSRMPSTAARSQPYAFGPEGVMLDGGASEGRQ
                     NSVEALLAYCAARVAENPSWRTASWQQAGASNASAFRVPVSPRYLANASYAATGSPLC
                     LRAGRIYLTDARIRAGIAEFQAAGLTVLPLTDDVLSRPSSRASKATVRVVPAMAVLLN
                     GAWIATHFFHLVTDALEALRSAYQTWQDGVLLRIPTQTVLLHQPESNWMDRRGDTHGK
                     MELSAALANAFSSPELARGSPYNSSFLFRSQSRHCAELEANATATMASPPPPRRQSPA
                     TVSTLCFCDGLLVTTHRLPVLERDILYGIQDWAARQFRASPYGVNRSVQEMERLRLQH
                     ALLSSTSTLWSIGTLTAPALSLSYKPRALFVHRTSRVIANASRYAGWMRAAGFRVEEV
                     YLEKHTAAQQYHLGRYADIVVGMHGLGIGHAMWMERSPPRCRTVIEFRPWVIASMPTQ
                     PILILEGAMHYHFVTIPPIDVRFGPSVAHPAEERELLLSSARMVNAFRYPSFTDQIAI
                     YDDERVKGVIADVRQHLERCLPP"
     gene            <189570..>191222
                     /gene="NT4"
                     /locus_tag="LMJF_11_0550"
                     /db_xref="GeneID:5649804"
     mRNA            <189570..>191222
                     /gene="NT4"
                     /locus_tag="LMJF_11_0550"
                     /product="nucleobase transporter"
                     /transcript_id="XM_001681471.1"
                     /db_xref="GeneID:5649804"
     CDS             189570..191222
                     /gene="NT4"
                     /locus_tag="LMJF_11_0550"
                     /codon_start=1
                     /product="nucleobase transporter"
                     /protein_id="XP_001681523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649804"
                     /db_xref="GOA:Q4QH25"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH25"
                     /translation="MSKLPQAAMLGTSLVVGVSMVMGPKAINSAPSFMLEYYKYLAGN
                     KAAEALSPVFWRNILNFYTVVTMVAQAIHEPTNMTSFMCRFSLLFRLEVSCVLMMIEL
                     LVILIMPHTHAPEYGAIAAMMIVAYVGGAARAYFENTGYALFGPCPPIMMTGMLVGSA
                     VSGSVVSVLQITLKASMSDTYSAVLTQSLIYFCLAIGVIFLSGLFLMILPYNSYARRY
                     VAEFRSSRGLWANIYCPRKVVKETSDDGACGKTGAAGLQDRAACRYLADSDSEKKAEM
                     LLETEHGKVAASGNRACHHLSLLYDDRFFTRERLEAEPTQEFALEPGSHDGAAVNATQ
                     TGACDCAHSQMTSGEVSKEVVTQKTAELERDNNDLPAAADRMPTTAELLQEVRLWPVI
                     KKIYPMMIACFLTFCITYLVYPGIIVAVDSADGWFTTLTIAAYNFSDLVGRLLTLWRR
                     LWPSRKVILIASITRIIFIPLLVLCAVHKIPSKAAAYVFTVIMGLSNGFVGSLSMIYS
                     PATPSLSTDGERAMAGQLTGACLLIGCAVGSLIQLAEVLPFA"
     gene            <197840..>201088
                     /locus_tag="LMJF_11_0560"
                     /db_xref="GeneID:5649805"
     mRNA            <197840..>201088
                     /locus_tag="LMJF_11_0560"
                     /product="putative transcription modulator/accessory
                     protein"
                     /transcript_id="XM_001681472.1"
                     /db_xref="GeneID:5649805"
     CDS             197840..201088
                     /locus_tag="LMJF_11_0560"
                     /codon_start=1
                     /product="putative transcription modulator/accessory
                     protein"
                     /protein_id="XP_001681524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649805"
                     /db_xref="GOA:Q4QH24"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR018974"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="InterPro:IPR023319"
                     /db_xref="InterPro:IPR023323"
                     /db_xref="UniProtKB/TrEMBL:Q4QH24"
                     /translation="MVASARNGVTPRQTRKASAALRAPTAIGKRKYTRRAPAAASKAA
                     ADAVGSATGGASASSSSASGTEAKHRPSTHRGGDSASDTDAHGTRDEEEEVYSGQYEL
                     SPEETYRQTSERLLLPLNAVRFVLTQAKEGATVPFLARYRQGETGRMDETQLRLVMDT
                     AKEVAEVHRRRQFMLRSLESRGLLTPALQTALESMVHVSQLEDAWEPYKERRTSLASR
                     GRAAGLGPYADALLHFNPDDPDCKARLDELSAFVRRTDEGERLLTAIVAEDVQRSEVL
                     RRRLGEYCRHTARLSSTLMAKPRKKAAKELHEESFEALRKHFAYYDNKSWSVQRVAAH
                     VVLALQRGEAKGALKVDTGSGPKSHGLFMHTVREQYPSLNRLLSLSSSSVPTADGAGA
                     YSHVFRDFGYGRKIVHAGLQAAYDHIIKQAHFAIRRDLKKSAEQEAIVVFAHNLQHML
                     LQRPLSRSRILAMDPGLANGVKCVALDENGAVETFFTCTLMDEQKMRRYVIQVVESRK
                     LNKIVIGNGTASGRVTDLIADLIKQQKWTDVEFAVVSEAGASVYSVSDIAKEEFPNLD
                     VMYRGAVSIGRRVLDPLSELVKIPVRSMGIGMYQHDVNEKELMRELSYVLESCVAKVG
                     VNAASANRYVMEKVPGIKKRIVDQIVLARHAKKLHSREDLRRVPAMTESVYEQIAGFF
                     RFPNSPEPLDNTSIHPESYPLVRRLVTFYTAGQLGDGEAMAEKPGNAADGAATTLGDA
                     HIRQQVAQQLERMSPAQLASLATEKLSCSVETLELLRQELLHPGLDPRASLPHAGLLR
                     RDVCDVQNLRSGELLSGVVQSVTMFGAFVDCGLHDSVLLRGEGVDALQVGVYLDQRIR
                     FDGLDHLKRPRVFLVRAAAPAASGHSAEGGKGCAPSAAPRRLRLEAEDVLGRNGRGFV
                     SQASPDARLYDLVESSADGGVIAAAPTLTARVMRERKRRAAEALGSANGTAATGAMGA
                     EESSQANRTSRLHLFHSPAGKRAREKPETDTPFRHAPRRAEDVVVASAAARPHSTLSL
                     QSPKCSTTNGASTEPPASASQTSKPAARRVDTGDASGQRGTGGDSGDAVFLF"
     gene            202367..203311
                     /locus_tag="LMJF_11_0570"
                     /pseudo
                     /db_xref="GeneID:12980841"
     misc_feature    202367..203311
                     /locus_tag="LMJF_11_0570"
                     /pseudo
                     /db_xref="GeneID:12980841"
     gene            <205438..>205866
                     /locus_tag="LMJF_11_0580"
                     /db_xref="GeneID:5649807"
     mRNA            <205438..>205866
                     /locus_tag="LMJF_11_0580"
                     /product="putative cytochrome b5"
                     /transcript_id="XM_001681474.1"
                     /db_xref="GeneID:5649807"
     CDS             205438..205866
                     /locus_tag="LMJF_11_0580"
                     /codon_start=1
                     /product="putative cytochrome b5"
                     /protein_id="XP_001681526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649807"
                     /db_xref="GOA:Q4QH22"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4QH22"
                     /translation="MSASELRVYSWEEIAKHTNDDDCWVVMYDKVLDVSKWLQEHPGG
                     LDPIKDMAGMDITNSFESIGHSSTALVKSKSFIIGCVDPEESKMRKEAAKKASTPAPK
                     WSETKREELRRYKGGEGIIPMPALIGAVVAILALLFYLLR"
     gene            <211877..>213481
                     /locus_tag="LMJF_11_0590"
                     /db_xref="GeneID:5649808"
     mRNA            <211877..>213481
                     /locus_tag="LMJF_11_0590"
                     /product="putative 3-methylcrotonoyl-CoA carboxylase beta
                     subunit"
                     /transcript_id="XM_001681475.1"
                     /db_xref="GeneID:5649808"
     CDS             211877..213481
                     /locus_tag="LMJF_11_0590"
                     /EC_number="6.4.1.4"
                     /codon_start=1
                     /product="putative 3-methylcrotonoyl-CoA carboxylase beta
                     subunit"
                     /protein_id="XP_001681527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649808"
                     /db_xref="GOA:Q4QH21"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4QH21"
                     /translation="MEGFVEQLRARVRYVQAGGVVSAEEAAKAGVSISSREVDDRVRK
                     LHLSRGKMLARERIERLIDPGTRFLELSQLAGWDLYWDDKKREYERCYSGGIVTGVGI
                     VNGVRCVLVANDATVKGGTYYPITVKKHLRAQKIAEQNHLPCIYLVDSGGANLSRQDD
                     VFPDEQHFGHIFFNEARMSAKSISQIAVVMGSCTAGGAYVPAMADESIIVARNGTIFL
                     GGPPLVFAATGEKVSSEDLGGADVHCRISGVADHYATDDLHALYLARRAVANLNLKEH
                     NEARNPTDVKPVPPLYDPRELGGFIPDMLSDVVKSFDVRAIIARIVDGSRFDEFKALY
                     GSTLVCGFARVEGMQVGIIANQGILYSESALKGAHFIGLCTQRKVPLLFLQNITGFMV
                     GKKYEEGGIARNGARLVMAVSTAPVPKITVLIGGSYGAGNYGMCGRAFEPRFLFMWPN
                     ARISVMGGTQAATVLTLTNRNLKNASEAEVAAFKDKVKRKYEREGSCYYSTARLWDDG
                     VIAPEDTRVVVAEALRATRLEPMEKQ"
     gene            <214447..>216246
                     /locus_tag="LMJF_11_0600"
                     /db_xref="GeneID:5649809"
     mRNA            <214447..>216246
                     /locus_tag="LMJF_11_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681476.1"
                     /db_xref="GeneID:5649809"
     CDS             214447..216246
                     /locus_tag="LMJF_11_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649809"
                     /db_xref="GOA:Q4QH20"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q4QH20"
                     /translation="MTDLRGVLPSKVISTPSGFVECSTHNVRRKAECCEMKAVLNADM
                     EVIDYICVCKHPFTCKSASERQSNGLAAASNARRNAPDGERSGTAPLVIDASSTSMTA
                     QSQHHHHGGQPSAAGAADKEAGVSTLFAVSFYDASRSTPGPSASATAAAVSPKPSAKD
                     GEDREDEKGKDTRANAMRISDSDSDTDDGDSLDNSPSFTAGATPATAATAASFPAAPR
                     ERSRYYDSLQNASTGGHAPPAKVCWGCGMTGHEKPACPNALCRTCHQKRGPYGSPHRC
                     TPVVTPSPLIVYPTPSEWRAATQKTAAAAGEPNGMAAVRCVACNEYGHFDCSTVVLPS
                     SYALVASSSPGPAAVPHTLVPTCCFCGVRGHTVFDCQQREHVNPDYFERRNQLFADSV
                     RRGSGITAAGAPFSNSGSSSGYGHPSQQQRQQRFYGSPTGGAPLSSSSFTRYGNGRGG
                     GGSGQRRERDWCDNREQRVGGSQYSNSRREGSAYNNDSYGGDRDHQRRRYESPSFSRA
                     GGGPAPSSSLLMHGRDRCQEGGQRHHEERSRDSYGGSHQRYSEGEHGGAGSRGHGQRS
                     HYSQQSQHSHRHGSSRRGGRLGDSGYYSDDNLF"
     gene            <225554..>228784
                     /locus_tag="LMJF_11_0610"
                     /db_xref="GeneID:5649810"
     mRNA            <225554..>228784
                     /locus_tag="LMJF_11_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681477.1"
                     /db_xref="GeneID:5649810"
     CDS             225554..228784
                     /locus_tag="LMJF_11_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649810"
                     /db_xref="UniProtKB/TrEMBL:Q4QH19"
                     /translation="MDNVLSSSDLTATFLPWTVLSSSDGPEVTKNEKPPQQQQAPSQA
                     FRRLPTPVQTRSIPFMPSMSAPFSFSDSAGGEDPQQFSALPLQPRYPLLLSQSFSNQS
                     HRANQYTASSFVHAHDTKASAATDPRLVGAHGGFPMPLNVSSANQAEEENLSCAISYN
                     SNRGEACGDELSRPLRQAHVHGSASFFSASLSSRPSSLLSPSTPAPEEHITGYTSVIL
                     LTVLPSFTGEDYYEHAMHGQVEFVKQLCDGTGDNDSNGSGELDELGRSCDTPRSSSLH
                     RLQQSASLHMKAGSFDGLSAARGSATAMGAATSSAPAQPAPPLLSTFQPLSTATTGLE
                     EYPAYLPASTAGAGTVQDAPTGGNQLKGSAHAQLQASSGDCQAPLLPLQRMALLQQLP
                     QQHRAPFTSSPLPAQTWTSTAGAANGEEVATPSSGQQQLQLNAHSQSNSRQYSAGATS
                     GAATLVSPALSGSGVYTTSPAQSFNASNGYHTGSGTPPSGGPAHLIMLLPASSENSST
                     GHSTRAQQHLYAMQVPTQTLSTSETAAAPRYASPHRSGAVPSPSMQLSSSPTVASGSG
                     ASAVPLLYVTAPTAFVGFPPTAAGRQVNALSPSSVSGHSCSISTTQASAPEMSSPSSH
                     YVYLHTHPPANNSPSRPLPLQQYSGNFPSQVPSAGMPKAAEQAASASLHARTSSALGT
                     AAAAHLPHAMSTEAFSPGSKTAGLKGPSIRPVAPATSTDMLRKQVNVHGAMMNVLHFY
                     PYSESAPPALTAQIVTGTRSASSSTPAQSLSGSGWWSRSVNSNVECSLDGSRRSLDGF
                     KSQDGAEASSCALRGDTSSLANAPVLPIFIQMFPCELRDRVGLLNRVIEATCGRDAGL
                     VQSFETRSETSFIAHVRTNNVWELIYKLRCRVLMDRFGFWYAADIEQYVHMKEYCESV
                     RRLPQQTRHFQTDGLPCMPLVVELSRSLDRGLVPENTGPRCFDELVPIAAVDRHRSRL
                     QGSSLVHNGRSNASMSGKAVAASGASAAGGSVFLTSAGDVQSLHGGSPVFLTNNSHVM
                     MLSPHMVPGLAGDSYRTGGSMSGSSAQVIHIDPQFLPPSFTMQRSL"
     gene            <233088..>233966
                     /locus_tag="LMJF_11_0620"
                     /db_xref="GeneID:5649811"
     mRNA            <233088..>233966
                     /locus_tag="LMJF_11_0620"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_001681478.1"
                     /db_xref="GeneID:5649811"
     CDS             233088..233966
                     /locus_tag="LMJF_11_0620"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_001681530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649811"
                     /db_xref="GOA:Q4QH18"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="UniProtKB/TrEMBL:Q4QH18"
                     /translation="MTVIKGDELREKGYGGIYAVGKCAQYPAHLVTLRYRNPNAAEGA
                     KNIAMVGKGIVYDCGGLALKPAAHMTNMKTDMGGSAGVFCAFIAVVRSMKMQRTHFSH
                     IANISVTLCLAENAIGPHSYRNDDVVVMKSGKSVEVMNTDAEGRIVLGDGVYYATGEQ
                     DFVPDVLIDMATLTGAQGVATGSKHAGVYASDAEAEKDMISAGLQSGDLCYPVLYCPE
                     YHEEVYKSPCADMRNIANSSSSAGSSCGGYFVEQHLSERFRGPFVHVDMAYPTSNTAG
                     ATGYGVTLVFEFLRQH"
     gene            <236568..>238184
                     /locus_tag="LMJF_11_0630"
                     /db_xref="GeneID:5649812"
     mRNA            <236568..>238184
                     /locus_tag="LMJF_11_0630"
                     /product="putative aminopeptidase"
                     /transcript_id="XM_001681479.1"
                     /db_xref="GeneID:5649812"
     CDS             236568..238184
                     /locus_tag="LMJF_11_0630"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /product="putative aminopeptidase"
                     /protein_id="XP_001681531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649812"
                     /db_xref="GOA:Q4QH17"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="UniProtKB/TrEMBL:Q4QH17"
                     /translation="MSAMKRPRSNSIVEETAVSAYVQTCTNFKSNVTFTDISKVSCVA
                     PHVLLVGALEQLRDNSLKSVLFYCPAVAEALQRVKAGSTVKTLAEVPGRKGYTEVMVT
                     ALPATTSRTNCPYRADSMSEAVAAACGSVEEGEVLDVYVCAPAGSETAVANAVARAAP
                     HSYTAKAGQATKAYMKQAMSLNVVMSSRAAFTQELVRGKSVCVAELEAICTSVQLCQR
                     LVDTPPCMLDTVVYAEIAAAYAAELGVDMTVIKGDELREKGYGGIYAVGKCAQYPAHL
                     VTLRYRNPNAAEGAKNIAMVGKGIVYDCGGLALKPAAHMTNMKTDMGGSAGVFCAFIA
                     VVRSMKMQRTHFSHIANISVTLCLAENAIGPHSYRNDDVVVMKSGKSVEVMNTDAEGR
                     IVLGDGVYYATGEQDFVPDVLIDMATLTGAQGVATGSKHAGVYASDAEAEKDMISAGL
                     QSGDLCYPVLYCPEYHEEVYKSPCADMRNIANSSSSAGSSCGGYFVEQHLSERFRGPF
                     VHVDMAYPTSNTAGATGYGVTLVFEFLRQH"
     gene            <240687..>246242
                     /locus_tag="LMJF_11_0640"
                     /db_xref="GeneID:5649813"
     mRNA            <240687..>246242
                     /locus_tag="LMJF_11_0640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681480.1"
                     /db_xref="GeneID:5649813"
     CDS             240687..246242
                     /locus_tag="LMJF_11_0640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649813"
                     /db_xref="UniProtKB/TrEMBL:Q4QH16"
                     /translation="MASSVTETSSAHVNDAASMPTHPRTRLVLQLLALEALRREQRRG
                     VFPLSSPPRSSVSTAASLQEAASGEATPAAAVAAPAACRSLRLGSSCHRDTRFEEGGL
                     PVVYHWLWQRAAALPSGLAVAESPYGDLSALMMEWATLALPAWLESSEEVRWRYERDE
                     VLRLVHESATTAAACGFANLDKGAREAEETAATVPGLVQQADTSATDTVAANSVRSLS
                     RYQAAFVPEVKDVNDEDVSEPSLAAVSGPLSTSAAHGAPSSSPRRVLQLVVAAAANLA
                     TPQQADLTIAKTTAVAPLPSPAAESEGALVKATGREPTSVSGTVPAFLMTPPLQSQVG
                     DTPAMSSANAAGSGDGDVGVEKRLAIQLLRTTCGTAVPREAATAATAVVAEPSCNTAV
                     DDVVARVATRPPMLLSDEGVTDDDGEARGSMAEANDSAQDGSAFVSPAPEGAENTAVC
                     MRSRLRRWRRIAPVVLDAPPGSEAAQDVCTVLEALGFAKAGEDDCADKTLTELAPSCG
                     SAQAPGELLKGPKVPASRRFSEGAARARMPLCPLGRLPPLLTAHAWLSSPSLRSSWLA
                     HIIAVWSPECLLAVGDDGSEACLKDGGTALGSSRDAQATPLPVPASSPSSSAHCSGAT
                     PPSPQLPSASPALSCIALADHRVFAMLDELLWCAHPSASTFLLSFEANLHAYLCYPLA
                     GVCAAAPAAATATKSGFCQSVSHLEQGARIAGSHGASAPRPLTVSAWKAYLELRYGKA
                     HLRQPKHLHPSPLRTVPSTKAAASRSGTGQNAEPGVTASAAAAPLTVGGPHRTKKREA
                     GGRTAEGEAALRPAMSSVAASAAAAARTPLLPFVAAAFAASSSATASTATYAAVMDVG
                     AMVFLAELRRVGAIAMVEKARGAVQVLQACHVGRGAGPLRHSTQQRGGESGDSAESGM
                     CVESTADAEGVRQFSSAAADASCFKAVQGGCDIPISSLQALLEGTVECDTSLHRYVCR
                     WFVPLSPPSAVTMANHVQESPRDIQDEKPSLVTVAAHLWLALVTVLSLGESATAQYVR
                     GVLMPPASLPVTPCSPSSTWAAALGAVAEGEAVGVPSWVVRTSLAPFTMPTLFRSTLE
                     DLYQEESAATAAAVAVAGKDHNPPCRPSSLPLCAPGFLRDEEDPASRATASCRVAPAS
                     LATTTLQGCAPVTPATQDTLVLSAAVALRHPRVILRQLHFLWQLSNCENRDGYATKAD
                     DSSHHSATLSSPSPAPPDTGRTAASTRRPAGAADHRATAKGTSDPTALSFKQEFATRV
                     ASLVECVQMASLAGLPPPLAASLTPSRPSPSAVPAEAAGGALSGGASASSMRQWSTGP
                     STSAVNVSTAVALSQQQCGAAAVPPHVPPLNADSARAVTAHATSTRLRLQLSSKTSLS
                     SAVTAGVGAFKTPTTDGVKRSREMDEVDVGVTEPAVLSSSENVAARSSRPAKRHRMDS
                     VATHALQLKLDSWARAPPPPPPLESLAELHVRWADEVHEKGGSVRLSLTPLAATSSGA
                     ASDVEATTSRSALLLTVVADTLWNVLQHIHAQVLGVAVGSAHVPRGDDPTPNDPSAAT
                     SASPSVLLRDAEATPGGVPVRRTLLRLRVSPAYRALQRLWQAINPPTVSERSVVVSSE
                     AGTLPPSGGAAAGHPRLDVILPATASRPATAVDLRVYTSLTASLRGVVCVVLGYAVHE
                     CLQAIWCNWCALCNEHEDSATTAGCATASSGSAQQPSRTPFPPSHGAYAWLTRQLRAL
                     LDEVLQPLNRILKASLSGVHDIEPVGDRSAPDVVRCDGHALAEPLSSSLRQPGATHVE
                     TLATAAWLTYKPLGLVLLPAHIRQLDAAMPCCLRGDCAAMSGGLHRLDAYEAWAQVKV
                     ALQQAGVQA"
     gene            <248247..>250172
                     /locus_tag="LMJF_11_0650"
                     /db_xref="GeneID:5649814"
     mRNA            <248247..>250172
                     /locus_tag="LMJF_11_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681481.1"
                     /db_xref="GeneID:5649814"
     CDS             248247..250172
                     /locus_tag="LMJF_11_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649814"
                     /db_xref="GOA:Q4QH15"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH15"
                     /translation="MADHSSKELHLQVLARGPQRRISDLHRFALLLVGSFGTICGSFG
                     YAFTLVLPQMQERYNLSQRDLASVTTVGLVFGFFMLPFGTLYDYLGPLPVAILSMISY
                     PLGATLTALCFEGVIEGNTLRLCVFNSFQCVGMSLTDIVCCMTVLSYFPSNRGPVIAL
                     LKTFPGLGSAIVGSFFAGFFNEQVSQYLYFLAVFAFLTNTTCALVMRLPLYHLTGYQE
                     SHLSEEEKGRRLATKTQYLKQTPPMWRFMFGFVILVIFIIYLPTTSALVAYLNWGRLH
                     KLGLAIGTTVLTVLYMLIAVPLPACLTRQLARRRSENVNNDNMTYDRRTNGHRSSDKE
                     PFRAGADVSAEKSTVAMAEEAVESDGQQAARVPVETDVDYVAPQYQGTFLQNLCTLEL
                     WALWWTLLCVFGAEFVIIYNATFILGALQGSMPAPSLTALLTVLNGVGSAVGRLLMSF
                     FEVWSQKRKAEDRVPITIALFFPTSTIITSIVLFLVLPAAALPLPYVIAALGNGFCAA
                     SQILVARTIFAKDPAKHYHFCFSATMAASVLLNRFLYGEWYTVQAEKQGSKRCFGRHC
                     VMMPLLVMLGLAASAFITDVIVHLRYRSFSRRVLMERAHLRGDVADTEKARPAEAEEV
                     VNDLDVIRDSKDCPRGV"
     gene            <253778..>255739
                     /locus_tag="LMJF_11_0660"
                     /db_xref="GeneID:5649815"
     mRNA            <253778..>255739
                     /locus_tag="LMJF_11_0660"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_001681482.1"
                     /db_xref="GeneID:5649815"
     CDS             253778..255739
                     /locus_tag="LMJF_11_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_001681534.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649815"
                     /db_xref="GOA:Q4QH14"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH14"
                     /translation="MQTNEEVVIYRLATGPQKPVSEPKRFAILVLGSFGCIVCSFSYA
                     WNLIAGTMQQRYDLSQRDLSMIVTVGLVVQFGVLPYAFLYDFLGPIPISVIGTVYFPL
                     GTLLLALCFMGKIEGSVVRLSVFNALMACGCAMFDLVCCITVLSHFPTNRGPVTALLK
                     TFTGLGSAIVACLYAGYFDSDAEKYFFFLFFAGIVVGVLCIVFMRLPPYHLTQYAERR
                     LSGEVKECRLVTKAQYLRQEAPLRRFMLGLLILVVLIVFVTTQSALVSYLKLDKAPKL
                     AFAIVSTILVFLYAFVMAPLPFLNSSYIPVFHPVRSRQPQAVGERSEALQEGRRAEGT
                     VTSSTDDPKEEDSSEGVQGSEAAECTPDQVIASEPTAAAAKGSLDMELDYVAPQYRGG
                     FIHNLTTLELWALWWTSFVTTGVTFVINFNSSFIFVALQSAPVSDSLRTMLTVLNGVG
                     SAVGRLLMSFFEVWSQKRKAEDRVPITMAVFFSSSCVITSTLLFLVLPAAALPLPHVI
                     AAIGSGFYNGVAILVTRTIFAKDPAKHYHFCLSAPMISAVVFNRFLYGEWYTAQAEKQ
                     ARADKMCYGKKCVLLPLLVMLGLGCSALITDVVLNRRYRSYCRRALEERARLRERDEL
                     AQKMEAIAGSGAKDGPDTHKAADWKRKQL"
     gene            <258024..>259664
                     /locus_tag="LMJF_11_0670"
                     /db_xref="GeneID:5649816"
     mRNA            <258024..>259664
                     /locus_tag="LMJF_11_0670"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_001681483.1"
                     /db_xref="GeneID:5649816"
     CDS             258024..259664
                     /locus_tag="LMJF_11_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_001681535.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649816"
                     /db_xref="GOA:Q4QH13"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH13"
                     /translation="MICASTSYAFNLFSGSLRDKYNFDSRQMSTINTVGMVFAYFLLP
                     YGTIYDYLGPLPVYILACVLASLGLLLMGLTFQGVIAGSVVRFCVFNALLSLGSQLFD
                     LATVVTMLSIFPTRRGWVVALLKTLMGLGSAIIGSMRTGFFLNTPANYFYFLMGVILV
                     TGLCCIAVMRLPSYHLTGYQQSRLSDEQKAVRGARVAAYLTQEPPMWRFYLSIAVVLV
                     LVVYLPTTSALAAFTEVAKTQHGLLAFAIVAVIITSCFLLMLVPCPWLDRLTTKGLRD
                     DESAESGEVLTDVDYIAPQYQTTFLQSCCTVSLWCILWTMFCGVGAEFVIIFNASPIF
                     SALTETPKLDTTVSALLTVLNGAGSALGRLTMSVFEHYTQKRKAEDRMPITVAFFVPT
                     TLIILSMVLFLVLPGRSLLAAFALASLGNGFCASVTILVLRTMYAKDPARHYNFGYNA
                     LWIAAILLNRLLYGEWIASRADRQGQKVCVGRECVMMPLLVMIGMNLTALLSDVYLHI
                     SYSRFSRRVLAERRRLREGAAAAGSSEPMCPEKGGSPW"
     gene            <265113..>266753
                     /locus_tag="LMJF_11_0673"
                     /db_xref="GeneID:5649817"
     mRNA            <265113..>266753
                     /locus_tag="LMJF_11_0673"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_001681484.1"
                     /db_xref="GeneID:5649817"
     CDS             265113..266753
                     /locus_tag="LMJF_11_0673"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_001681536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0673"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0673"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649817"
                     /db_xref="GOA:Q4QH12"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH12"
                     /translation="MICASTSYAFNLFSGSLRDKYNFDSRQMSTINTVGMVFAYFLLP
                     YGTIYDYLGPLPVYILACVLASLGLLLMGLTFQGVIAGSVVRFCVFNALLSLGSQLFD
                     LATVVTMLSIFLTRRGWVVALLKTLMGLGSAIIGSMRTGFFLNTPANYFYFLMGVILV
                     TGLCCIAVMRLPSYHLTGYQQSRLSDEQKAVRGARVAAYLTQEPPMWRFYLSIAVVLV
                     LVVYLPTTSALAAFTEVAKTQHGLLAFAIVAVIITSCFLLMLVPCPWLDRLTTKGLRD
                     DESAESGEVLTDVDYIAPQYQTTFLQSCCTVSLWCILWTMFCGVGAEFVIIFNASPIF
                     SALTETPKLDTTVSALLTVLNGAGSALGRLTMSVFEHYTQKRKAEDRMPITVAFFVPT
                     TLIILSMVLFLVLPGRSLLAAFALASLGNGFCASVTILVLRTMYAKDPARHYNFGYNA
                     LWIAAILLNRLLYGEWIASRADRQGQKVCVGRECVMMPLLVMIGMNLTALLSDVYLHI
                     SYSRFSRRVLAERRRLREGAAAAGSSEPMCPEKGGSPW"
     gene            <272195..>273835
                     /locus_tag="LMJF_11_0675"
                     /db_xref="GeneID:5649818"
     mRNA            <272195..>273835
                     /locus_tag="LMJF_11_0675"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_001681485.1"
                     /db_xref="GeneID:5649818"
     CDS             272195..273835
                     /locus_tag="LMJF_11_0675"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_001681537.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0675"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0675"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649818"
                     /db_xref="GOA:Q4QH11"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH11"
                     /translation="MICASTSYAFNLFSGSLRDKYNFDSRQMSTINTVGMVFAYFLLP
                     YGTIYDYLGPLPVYILACVLASLGLLLMGLTFQGVIAGSVVRFCVFNALLSLVSQLFD
                     LATVVTMLSIFXTRRGWVVALLKTLMGLGSAIIGSMRTGFFLNTPANYFYFLMGVILV
                     TGLCCIAVMRLPSYHLTGYQQSRLSDEQKAVRGARVAAYLTQEPPMWRFYLSIAVVLV
                     LVVYLPTTSALAAFTEVAKTQHGLLAFAIVAVIITSCFLLMLVPCPWLDRLTTKGLRD
                     DESAESGEVLTDVDYIAPQYQTTFLQSCCTVSLWCILWTMFCGVGAEFVIIFNASPIF
                     SALTETPKLDTTVSALLTVLNGAGSALGRLTMSVFEHYTQKRKAEDRMPITVAFFVPT
                     TLIILSMVLFLVLPGRSLLAAFALASLGNGFCASVTILVLRTMYAKDPARHYNFGYNA
                     LWIAAILLNRLLYGEWIASRADRQGQKVCVGRECVMMPLLVMIGMNLTALLSDVYLHI
                     SYSRFSRRVLAERRRLREGAAAAGSSEPMCPEKGGSPW"
     gene            <279357..>280970
                     /locus_tag="LMJF_11_0680"
                     /db_xref="GeneID:5649819"
     mRNA            <279357..>280970
                     /locus_tag="LMJF_11_0680"
                     /product="conserved hypothetical protein in leishmania"
                     /transcript_id="XM_001681486.1"
                     /db_xref="GeneID:5649819"
     CDS             279357..280970
                     /locus_tag="LMJF_11_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein in leishmania"
                     /protein_id="XP_001681538.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649819"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QH10"
                     /translation="MSTINTVGMVFAYFLLPYGTIYDYLGPLPVYILACVLASLGLLL
                     MGLTFQGVIAGSVVRFCVFNALLSLVSQLFDLATVVTMLSIFLTRRGWVVALLKTLMG
                     LGSAIIGSMRTGFFLNTPANYFYFLMGVILVTGLCCIAVMRLPSYHLTGYQQSRLSDE
                     QKAVRGARVAAYLTQEPPMWRFYLSIAVVLVLVVYLPTTSALAAFTEVAKTQHGLLAF
                     AIVAVIITSCFLLMLVPCPWLDRLTTKGLRDDESAESGEVLTDVDYIAPQYQTTFLQS
                     CCTVSLWCILWTMFCGVGAEFVIIFNASPIFSALTETPKLDTTVSALLTVLNGAGSAL
                     GRLTMSVFEHYTQKRKAEDRMPITVAFFVPTTLIILSMVLFLVLPGRSLLAAFALASL
                     GNGFCASVTILVLRTMYAKDPARHYNFGYNALWIAAILLNRLLYGEWIASRADRQGQK
                     VCVGRECVMMPLLVMIGMNLTALLSDVYLHISYSRFSRRVLAERRRLREGAAAAGSSE
                     PMCPEKGGAGSAGERIERGVSEQTGGHER"
     gene            <282145..>282825
                     /locus_tag="LMJF_11_0690"
                     /db_xref="GeneID:5649820"
     mRNA            <282145..>282825
                     /locus_tag="LMJF_11_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681487.1"
                     /db_xref="GeneID:5649820"
     CDS             282145..282825
                     /locus_tag="LMJF_11_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649820"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QH09"
                     /translation="MSNAKNGSETTYFTAIANRDVEALKALIAQNRNVNEVAQDPVLY
                     HRTPLHICVWENFVEGAKLLLDAGADVNALDDLHDSPYLLSGAEGRQEIMEHIYKNAE
                     RTMRYGSQTSLRMKTSVPDHSIVNRFGGSALIPACERGHVEMVRLLLQKGVDVNHYNY
                     YHWTGLLEAIELGGDDREHVDIVRLLIENGADVNQVDGAGKTPLYLARKRKYKRIAAL
                     LEAAGGHE"
     gene            <284651..>285880
                     /locus_tag="LMJF_11_0700"
                     /db_xref="GeneID:5649821"
     mRNA            <284651..>285880
                     /locus_tag="LMJF_11_0700"
                     /product="anion-transporting ATPase-like protein"
                     /transcript_id="XM_001681488.1"
                     /db_xref="GeneID:5649821"
     CDS             284651..285880
                     /locus_tag="LMJF_11_0700"
                     /codon_start=1
                     /product="anion-transporting ATPase-like protein"
                     /protein_id="XP_001681540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649821"
                     /db_xref="GOA:Q4QH08"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDPTLKELLHANLEWIFVGGKGGVGKTTTSCALATLFATTPISD
                     AASPGGTRPRRVLLISTDPAHNLSDAFNQRFGPHPTPVKGLEESLAAMEVDPKNFTHG
                     ALMSSLTGAKSDGSASSLSAEAEADAAQHTASFARIGAVLKEAARTMPGIDEISVFAE
                     ILHYVRTLFYDLLIFDTAPTGHTLRLLALPQTLSSTFDKLMSLEGLAPMIEAASHLIG
                     TNLGALGGACGDTAGSCEQATAAPSLSSAAPGEGSAAAASSQSRWCITADEVRSTALH
                     WRQTMEEVQARFNDPNRTSFVCVCIAEFLSVYETERLVQELMKYNIGCDSIVVNQLVL
                     KPSSEPPCRMCSARQKIQAKYLEQIDLLYEDFHVVKMPLLSDEVRGVPALKKFARFLQ
                     EPYSPDTHGYIDVQEPC"
     gene            <288045..>289457
                     /locus_tag="LMJF_11_0710"
                     /db_xref="GeneID:5649822"
     mRNA            <288045..>289457
                     /locus_tag="LMJF_11_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681489.1"
                     /db_xref="GeneID:5649822"
     CDS             288045..289457
                     /locus_tag="LMJF_11_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649822"
                     /db_xref="UniProtKB/TrEMBL:Q4QH07"
                     /translation="MTLIDQHETTVQQVIDKIDFLRGEREARYTEFKQETQQREAELQ
                     HLRNERSDLSLQVQEERERSTRLLHENTALYAHQAEQREQLGKLVELCRARGRRLRAL
                     SNQNSRAAGSTSHRRRSMETDAGASTGASCDDARAADFGDEASTLELSRTEVGTKGAG
                     AAAMAAACSPSPALASPPASMSIHKAVGATASARRPALSPSPAALGNVAEDAEMAALL
                     NVPYKLQVPSTPFGPSAHTITANTAATAHLLALNEEVNMLRQQLEEQRITYEQERGVR
                     TTENDELHRRHLEKEAKYLATIDQLEVLHEESLRDLVQYRHTTEKQLRDVRGQVDWLR
                     AALQEALDLAEKERRRQHNEVYATEQRMSRQYYPKVQSLHAELEECRRGALAQAQENA
                     KVIAQKDALVAELRHKLKAEVSHRRRIEERYQLEMKGVHSELDLMRQSLRQMERRVYY
                     RDVRDQASEEAQHELERYYD"
     gene            <292776..>294737
                     /locus_tag="LMJF_11_0720"
                     /db_xref="GeneID:5649823"
     mRNA            <292776..>294737
                     /locus_tag="LMJF_11_0720"
                     /product="PUF nine target 1"
                     /transcript_id="XM_001681490.1"
                     /db_xref="GeneID:5649823"
     CDS             292776..294737
                     /locus_tag="LMJF_11_0720"
                     /codon_start=1
                     /product="PUF nine target 1"
                     /protein_id="XP_001681542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649823"
                     /db_xref="UniProtKB/TrEMBL:Q4QH06"
                     /translation="MPPKRYPNRLLVLCASINDVTAWPFWKFLQMKKIRGVTDMALLA
                     FNSDGGSFEARIDGDKYQLKNYAKVRGYQHDMFESFVHRWHDPGRSYFVYGGHGMGDY
                     VELEQNRVSLQVHELADVFGTRVFEAVLFDACFMANIDCAYHLRHNTRYIGACEGYMW
                     EPDTALDYHVFNTHNASAMSRFKDPLHILRVIQTDYCSKAPRGDFTIIDTTHIAALRQ
                     YVQEHVMQRVYDRATFYSLPQRERLQQIAEASIQASISQFGHPGGDTNVINGVGSGTD
                     RPRTAPSSPEVLALSAAGRPTRRQRMLQAIQFEHSLYPSEVDDKQLLDLKSYLTDMLH
                     EEQQLKAWEAAALGPQRRIAAGRRRVRSDALQHGGSSGIAAPSTASSSFAVWKAPPSR
                     ALFADRHGRPPAASSAECSPSINGGPAAAHDTQKGATALSPPVLATTPTKAAPPPPSL
                     STSYKGSAQEGLDLFYQVVVSHIPPKAASIYATQLGGLSFTVHEYSAMSRPAEPWLVG
                     SKRLLKRRAKQFLKNGELSEVVMESPKASASVTSAALVAAVDKVTATAAAVTGASAGK
                     PEPATSAAALPLSPRAHMPSTDQRLRFTSSGNGTDSDSSLSLSLSVPLSTSSTDAYNN
                     SMKTVILDSPQRAASYTSLPNSKERTSAC"
     gene            <297683..>301504
                     /locus_tag="LMJF_11_0730"
                     /db_xref="GeneID:5649824"
     mRNA            <297683..>301504
                     /locus_tag="LMJF_11_0730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681491.1"
                     /db_xref="GeneID:5649824"
     CDS             297683..301504
                     /locus_tag="LMJF_11_0730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649824"
                     /db_xref="UniProtKB/TrEMBL:Q4QH05"
                     /translation="MPSAPPEEFKVEFISSSSSVQSSAVPSRTTSRGASSSSEAAATE
                     KIDAEHAPADASDAGDGKSTVSSDTAGAREGTTSEEQLVPLTFAHGTELTVSAALVAA
                     LDDELTRCALLLFDGRIPQQQPPPPPGPGPVEVPRQWWSEAVNYHRAVLLGYDDAGFA
                     YVDAQAFAQRVPQPQGWRLCPLPLLVCEVAKLVHFYRDAELDDTTSEQSTAAGASGAA
                     LRYPVLPRPSRCAAAEGNGGLVNAQPSRNGSTDAASPSPSYQAPASGEPSPSTSLATT
                     PPVPPSTSLAYLSPPLRWSLPMCGHAPSLNLQQVFRVQSNRVYQLTRPPEEVVFLGVA
                     FGIPWIRPVVLATATTPDAASSQVGTCRGVVLHATDPSTSSLASQPPAGYRWKDMRAW
                     AEPLIGCHDACDIRGRHGLVDPSPGATGVSPAASVADAEGSAPPSARSSAVTGAPPED
                     SGQEASLRPSEADEQNSGTSAPLSLSPPSPSQKPLTAAAPLFVKEGARVFVPGRFGVM
                     LECNTNSALMEAHFGVVHADQLVPRALSSHAAAAQLSGASKPDKTPTPSLPPGPFIVM
                     GLYGRNVLVLIADGEGQTAVQIHVTRGVAEVAETFRKVAGTPLPPPALPLEPLSVPAS
                     PPESTMVAEAAAASRLVANDEVSQERPQAPETERREDQAGPVPATVTCIVAEETDAFM
                     APAADIAAAAAAEAQLCKDKAAGMRGVEGVCKEVGTATPVADEERHGGPPPTKEVILT
                     DLHKAGETAAHACSSVVVEISQGVSISAASAPRTWRWSSTTSSSASSSSFDSHASQRL
                     RQQQQQSRLEQIGEEQAHRSGPSTGRASAPSTPTDKVVEEVAEAWPTYGAQLLESAEE
                     VTVVPAVTPATDDAPPLMTLPAAEHAMTSQNGEGVFQAEAAIGVVEAANTKTPGEKDV
                     HYHDDGVVSADASLHGQSLLQLPEKDLSAPEGESEKHLQLGSSLAVQFFADHTPSLLP
                     ASSSMPRPSQQQHTGDAQEASLGTEVSFDEDGVDAHRLPATLESDCEERVQHVSGADA
                     DDVAGPVIAFQASSLLASVEQRGWANQAPPVRHVAIPAGEEVAVTTAMARSATAFTPS
                     YSPPPASPADLRAAPRVWGAQGTSYPTSGPSPCAAAVGLQHHSAATPFTNFLKAYAVY
                     VLGTHGAASGGESKQLRNGTAPHMNECAAGAGEASRGVAELASILDFYREQPLARIME
                     ATAIQRRCRAAWNEVIASTPASAAAQVGSDVEVCKLKASASTTVFTELCVDELVSLLA
                     IVHYPSPRQDG"
     gene            <302396..>303730
                     /locus_tag="LMJF_11_0740"
                     /db_xref="GeneID:5649825"
     mRNA            <302396..>303730
                     /locus_tag="LMJF_11_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681492.1"
                     /db_xref="GeneID:5649825"
     CDS             302396..303730
                     /locus_tag="LMJF_11_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649825"
                     /db_xref="UniProtKB/TrEMBL:Q4QH04"
                     /translation="MSTSRDDAAGEACLLPPHGPANMMSTYMTRYDYDYNRDPSLTGS
                     DGGSGGGFEQEISGEVRNRPIFAYGVDTGDRDDRTIYQVDYTHKDRSVKNMAGLAATL
                     KGSAASAAAARMRGQDNGTAYQHNWYLPAASAHVVLVDGSHPHTVYQDDYQAPRHVAG
                     GAVHDPVCYAGAAAAAYNADLLKPHGVMEDDGADLAPKITSKESLLPRKHASPNATWT
                     PVFENTADHRHTWNDCVPGDGVVGTYVCTSWDYGDTSQAHPLQLPLSLARSLAAHNLD
                     ASANPDKAALLRHLAGKNYSSRTLRGSSSGAPLDTNDRTNPQFLSTVEQKRCAVSRRL
                     EKEHYVTMSIYKSDFIDQGLLPELPGNPGGPADVRDTHTSPLATAGEMMAGQLTTATR
                     ELGLLRNAHGTLKSGEAHAASRVSTGVLSAMRAMEKAASIDKADPHCHKLCE"
     gene            <305399..>306016
                     /locus_tag="LMJF_11_0750"
                     /db_xref="GeneID:5649826"
     mRNA            <305399..>306016
                     /locus_tag="LMJF_11_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681493.1"
                     /db_xref="GeneID:5649826"
     CDS             305399..306016
                     /locus_tag="LMJF_11_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649826"
                     /db_xref="UniProtKB/TrEMBL:Q4QH03"
                     /translation="MAAADQLRYAAQMIELARSEEREDGNPLTAARCYTTAMEVIASE
                     ASKRAAMIESNEARRFFLFQVRSKLEMYHERAELLLQVANGSGLLDKPSLSNGDASAL
                     QTNYPPALFASAVANEKSSSGNGGVASCSTGGGVSVLGIPLQPQQMAPSAPPTQTQSS
                     YGDFKEPPMSCYLKPDDDATAEPPPVTPELNLDELMKNLGAPPEL"
     gene            <307626..>308120
                     /locus_tag="LMJF_11_0760"
                     /db_xref="GeneID:5649827"
     mRNA            <307626..>308120
                     /locus_tag="LMJF_11_0760"
                     /product="putative 40S ribosomal protein S21"
                     /transcript_id="XM_001681494.1"
                     /db_xref="GeneID:5649827"
     CDS             307626..308120
                     /locus_tag="LMJF_11_0760"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S21"
                     /protein_id="XP_001681546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0760"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649827"
                     /db_xref="GOA:Q4QH01"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="UniProtKB/TrEMBL:Q4QH01"
                     /translation="MATIGMFNEEGENVDLYIPRKCHATTTLIEAHDHAAVQISIANV
                     GPNGVINGTTTTLCIAGYLRSQGESDHAINHITIDRGIMRIKTGKPKRASKSKSKKPA
                     AKGAAAGAAAQKGARPPAQKGARPPAQKGARPPAQKGARPPAQKGARPPAQKGAAPAR
                     KNRA"
     gene            <309350..>309844
                     /locus_tag="LMJF_11_0780"
                     /db_xref="GeneID:5649828"
     mRNA            <309350..>309844
                     /locus_tag="LMJF_11_0780"
                     /product="putative 40S ribosomal protein S21"
                     /transcript_id="XM_001681495.1"
                     /db_xref="GeneID:5649828"
     CDS             309350..309844
                     /locus_tag="LMJF_11_0780"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S21"
                     /protein_id="XP_001681547.1"
                     /db_xref="GeneID:5649828"
                     /db_xref="GOA:Q4QH01"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="UniProtKB/TrEMBL:Q4QH01"
                     /translation="MATIGMFNEEGENVDLYIPRKCHATTTLIEAHDHAAVQISIANV
                     GPNGVINGTTTTLCIAGYLRSQGESDHAINHITIDRGIMRIKTGKPKRASKSKSKKPA
                     AKGAAAGAAAQKGARPPAQKGARPPAQKGARPPAQKGARPPAQKGARPPAQKGAAPAR
                     KNRA"
     gene            <312379..>313149
                     /locus_tag="LMJF_11_0790"
                     /db_xref="GeneID:5649829"
     mRNA            <312379..>313149
                     /locus_tag="LMJF_11_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681496.1"
                     /db_xref="GeneID:5649829"
     CDS             312379..313149
                     /locus_tag="LMJF_11_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649829"
                     /db_xref="UniProtKB/TrEMBL:Q4QH00"
                     /translation="MSGVNAWGRMHTPAKQSQFTLDMFEEWKAKQNEDIAQRGADRDP
                     AVEEEHNRYMLRQNLNAYVCYKELDRYTTCLEDKRLIRRRDDEDGARGGGTGVSLASS
                     FEINTRNKVNEKLCRATHNTYVSCMSSQKNQEVVLQSASLEPHCTERRAKLFRCLREN
                     QVSEAQTNTPQCTDTYRSLLRCGLNHLWNHYWREITKFSDTDEFHLYELSRDDNKKQA
                     YLRALTTSEAQRQSHLREARDTMLGYYLDPKAAQKGDS"
     gene            <314633..>315076
                     /locus_tag="LMJF_11_0800"
                     /db_xref="GeneID:5649830"
     mRNA            <314633..>315076
                     /locus_tag="LMJF_11_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681497.1"
                     /db_xref="GeneID:5649830"
     CDS             314633..315076
                     /locus_tag="LMJF_11_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649830"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ9"
                     /translation="MSDAQTVQTLVLWNGEWPYVKRGVSEVRAVAAGVIASANALVDV
                     PAYLARARKYTAAADDFVTAQSARASSTLESHQWVVPAAGIALASVYVVVRSAPWGGM
                     KMMRNGLVTAGALTAFMYPREIVHQIDRAMPFQAPASISEQKNES"
     gene            <315768..>318695
                     /locus_tag="LMJF_11_0810"
                     /db_xref="GeneID:5649831"
     mRNA            <315768..>318695
                     /locus_tag="LMJF_11_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681498.1"
                     /db_xref="GeneID:5649831"
     CDS             315768..318695
                     /locus_tag="LMJF_11_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649831"
                     /db_xref="GOA:Q4QGZ8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ8"
                     /translation="MTSTVSSFDAAMRKARAQVGKRRIFLKSFFADFDHLHCGRITTA
                     QFARVLTNNDVHLSPDEMRVLSRNFAPAIAAGTAAATARAAADASGSDNSEVLYENFL
                     AALEAGPGSSASVRCSTPSTTLTPAEEARLRPFRTMLQQAIQAHGTSLTAPLRDLDPL
                     RTGRVTVAQFRRCLPFSASLTEEAMDLFAKQYSDGHGGVYYMAWCRAMDPSLNGQANG
                     ENTLRAAGSARLHAIDKDQSNQWKTGSVSSLVCPDSFTNPRLSAEELVVVFRRQCALY
                     RLRYEDAFVDYDKMKTGKVTVAQFESVLGRMPLVHFALRPENIDTLARAYISSDSSVS
                     VNGAPSGPVVEYRAFLRDIHPSQALETAADGSAVPTNFFATTHAADTYLTSSEDQRKA
                     EALLSQLRALVQSNRICLSPVLRDFDRVRKGIYEHRTCTRTRFARGLATQNIMLPPEQ
                     LQLLIRKYTVPNPDGSPSSEVNYYLFVQDVDPSQASGGKGTGRDGARSTTGLVVPSST
                     SAASTTATAVAPATSLTKESVLASIALQVVERRLHVSAFFADADPLHSGTVPRDRLGI
                     ALGQAGVQLLPEALAALQSAFASTHIRDGVDTQKLVTEVEAAVAALRASRAAEKTGSA
                     GDEGTAQDAERAAQVAAMLNRVRHNVRVHNALLMPFFADFDRHHRGVITPIQFAQACV
                     RHHLPLTQTEIETLASWYSAGDAVSPGKDGVRYLTFVRDVGCEEESVQYALAQKASAA
                     GSTVSTGLSASARQAVEAAADVDEVLTGICVFLQERRPCLSEFFPDGDELRHHHVTPS
                     RFRHCITMLGLTDMTEAQLSALEGAFASAKCPGDIDYPAFVCTVRAMLADGAGAAAVS
                     QRRLQGPASSVRGNGDVTGDSAATQTTAAQGFAAATLKHIQRTLKARRTATIAAFREY
                     DRARKGYVTEGQFFACLQALGVPLKPDEAAALLQLYAVGNGQVHYLAFAHEVDDESLI
                     AVS"
     gene            <321131..>322147
                     /locus_tag="LMJF_11_0820"
                     /db_xref="GeneID:5649832"
     mRNA            <321131..>322147
                     /locus_tag="LMJF_11_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681499.1"
                     /db_xref="GeneID:5649832"
     CDS             321131..322147
                     /locus_tag="LMJF_11_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649832"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ7"
                     /translation="MEEGAPTPAAPVGEDQEVAAAPATEEPASIMQVENTNFNWADDD
                     IQFQIRQPQYAAEYPVSVLENLARNVTFKVPEDQNTMTSAIEALARERQAFEQMKRNH
                     EDAMKSREVELNAQEATLQARERQLHANTETLAAERQQLILQQSQFRAQQAQAQAQSQ
                     AQAQTQSQPRTSSQTQSPAAQVSPSPAQAAQPAHAPQLQHQMPPPHQQPQPRSGNVYM
                     GGGYGAQEWQPDQRTWGNEGAMGAPGFDMYQGAYPGSYAQRNYHMAGGHRGQMRSGNL
                     PQQQFPGNRMQPMMPPPQQYSRSMAPLGAARQQQMDMNFGGRSQQSYNPAPNTGYPQR
                     SAQW"
     gene            <328779..>333008
                     /locus_tag="LMJF_11_0830"
                     /db_xref="GeneID:5649833"
     mRNA            <328779..>333008
                     /locus_tag="LMJF_11_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681500.1"
                     /db_xref="GeneID:5649833"
     CDS             328779..333008
                     /locus_tag="LMJF_11_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649833"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ6"
                     /translation="MPSKPQQQYKTLNGTSGGAGKSSAAAAAKSTATTSASPAPAPSP
                     PPPLPFNAIPHATSGDRLIGVEVSSSIPALMSELGELLQQTPGSGSGGVAGGLWRGQN
                     GGLLFEHLDGAAASPKEATAALSGGTDANRRIEQISPGALERLSQVFNVQQRQSGFAS
                     AAAGLVAAAGASAALKCSSSSRGGVAPSTVEVLDDDEDGDMDSASGSSTAADEVFPAV
                     YRDGGSDCDASSTTGRRHNFDDMFEMMQRSIGSYARGGGGGAGDKGAGGSGDVGFDPS
                     AYSDPLTQLELFRAMMVATSKGRSSGGGSAAAQEAKPDDAEARSRVISESGLPNHFRN
                     FLDILSPQLISQLMLQQRAAKAASAGAGGVAGACKAGEATSAAAAAVAREVDMAASGV
                     ANLSDLQQRVEQVRGLSSSTLEALAEGEVSDSTSGSLRDLLLGDSAGAAAPEAVSAEL
                     ELSSAKVGYCLTEAAAVAVSMLWSYLGSQQKEAPLLLGYTREEAQSQFNLLLFRLRQE
                     LFAQPAASLEEVSRCFGGTVQTDAEDIYRAINGVGVLLFFTCKPLPLLEKTCSELRIS
                     LSDSANTDCNIMPELIAEKLAAFLYPMKEGKLSFAHLSFIPRLQVHEHAPGNYTCTID
                     NASNMGRMMRERLLSNRFSCNKIKWRAALMNDKGKLKFQVWHRHATPLSVHFIVRTSE
                     PKKKKKSGCGNTGVNGAAGEEKDAAAASAVEDLRANSALFVEQQLTAAPGEMVGFTHD
                     FIELTVALSSPTTLQHGYRTYNKADDRLVFQFSLQLSNVDGAPLDGAAAANAGNKVPA
                     KQANEDQEPSLSGSTEGKTDGGESKDDPDAELHAAMRRVSDSETAARAVIEETAKWDY
                     RHLQNDECREAHCARQRTEDRERKALLAKVGPTPELIREVEKLSQSVQAAQQQIARLN
                     KERSKDEKEGEKTAEKLAQHQAELALLLSSLESGEAELSRLEAEMKAAEARIVEKRAR
                     RARKEAKKAEQSQWTALKRVLEPTSSTTHHDTLAINDFGSFLQSTPIMAAAMPLQQQQ
                     ESAVLPTAPSSSSLFGSSAGCGPGMPPLAGGTGGLGAFGTDRFSARTPMSASPGTGVT
                     NTTPVFSTQPKMGLGSSSSLVNTNGNTSPGANVGAVGGGHPHMNGIGGSTHGTTPSHP
                     GRVSPMLPPSPGVVSNASAAMGSRSSPASAAGVPIGSPGMPLSGGNGVSGNIGMGSSG
                     SGSGGNGGGGLSFGLAPSLFSTNPVSHVTHSAGATVANANNTPRNLYTSLDVNAQPFS
                     PSPPPAMPAPGTGGCTTPAASGSGAGNASGSHSNGSSGGIGFAFTVTAGAHPGLVGGS
                     SPIYQSGPSGFSSGSAHDLPGHSPSSFSTTPMPTPAANGVYGMGGGNHGSTHDMQHQH
                     AHQPQHSGLLPPRPHTPSEFLSFSTSLQWRN"
     gene            <335614..>336747
                     /locus_tag="LMJF_11_0840"
                     /db_xref="GeneID:5649834"
     mRNA            <335614..>336747
                     /locus_tag="LMJF_11_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681501.1"
                     /db_xref="GeneID:5649834"
     CDS             335614..336747
                     /locus_tag="LMJF_11_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649834"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ5"
                     /translation="MATCTLSVARFGRPSTFAHRRVRWLPPYDGNSTCLDWWLPTDAE
                     AADTAADGGAAAIRVRALAVILPGLTGSSKEFYVRRMARQLLRAHMATCVLTSRGVAD
                     THLERPQIFSALFAKDLRHIMQACMTREKVQECLLRRISPLQSSDHHKGAVPIIGVAF
                     SLGGRILTNYVSEQGEAEAPSGFDAVYTITSPHNVSDGAAALRMLLSKLLYGSTLYKR
                     LRAYYERHKNVLQNLPDIDKKLLMDGDSPLVKRLRTVQDFGEFITGPHVGFPGAEAYY
                     VAASSFRRLHHSRMPQVCVVVANDPIYGPPQPAPRWLHLIDMHCGGLVYVEMPVGGHL
                     GFLGCPWSEWTQAPNEMEHLVLRSLIHFIKSADTQAAEAKTNE"
     gene            <339350..>340798
                     /locus_tag="LMJF_11_0850"
                     /db_xref="GeneID:5649835"
     mRNA            <339350..>340798
                     /locus_tag="LMJF_11_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681502.1"
                     /db_xref="GeneID:5649835"
     CDS             339350..340798
                     /locus_tag="LMJF_11_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649835"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ4"
                     /translation="MLLCSSSIHRMRFTDRVSFAVKHVVVHVFFYWLPRLVFGALSRW
                     PRWLVSRLTRGKLVAEPPDEREVTLIANEKDPYRLRRRFGLPLTGQPPLRYHAPLYSG
                     HIHTILAAMRSGPRAPYERELVESYEGQHVNMDYLYPLPSSNPTSSTLATAATSPFAG
                     AAGSGKGRAPQAKGLMFIVPGLLNASTTNYVRRFAVKSVEAGFAVCVLNSRGMGTTPL
                     EVPRLFSATFTEDIRYCLHHYLQQKQVQERLGTPRPVPLIAVGFSLGGVTLIKYLGEQ
                     GMAATEKELRSNLPPNSAVPDTPVSALVTVTCPYDLIEADRMSATLLYRCLYEKPFAM
                     GLRKYAKHNREMLAKLPNVDSKMLFEGPCPVIDRLTSIRAFDKYINASHNGFSSPQEY
                     YAAAQPLLWLPRCRTPILCIGDRNDTVAGGFVPDASWRALVSENPYTVYVCYPVGGHL
                     GFLGTPAAEWRGDASEAEHLVLRAATKFCETT"
     gene            <342383..>347686
                     /locus_tag="LMJF_11_0860"
                     /db_xref="GeneID:5649836"
     mRNA            <342383..>347686
                     /locus_tag="LMJF_11_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681503.1"
                     /db_xref="GeneID:5649836"
     CDS             342383..347686
                     /locus_tag="LMJF_11_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649836"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ3"
                     /translation="MSVYDSVRGLSLAAPSTAPCPGSTPFSATYVEELLTPRLLSSPI
                     PDVSQLVSCLLCDSVRLHHEQLQLQQHQHRQRRHSGDSTLTYTSSGSGGSTDCTQPVD
                     ALETAGAGSLPFPRERCADVLRCICTCFARLSSSLSNASPSSAAHQRPSLQRVAYLIE
                     RAAAAHIFRHLLPHCSLASEETQQALLWVFKAVRCASSAAAGELGNGARGGSSGTPTS
                     TATCAEMAQVLRDIICCTSVVTPAQLVPLLEELVAASPTLRLMSVSASSSSSLSTCAP
                     SARQSRHLPAHCGSGGALITTRLLLEQMDMLQPAIATWAMGEFEEGLAEVLASNALQS
                     EDEDLEGEERRPGSDTDGDEPHQQRWQQPRMRTAKTPQEAQLTHKRRGLQIMAHVLEV
                     LVALMELHVDLAEQLLPALAPHLEHTCPEVRLLLLRGLSAAFAANEAAVRSYRTVFMG
                     PLLNRFLDVKPNIRMDAVRLSTMLLQRFGDHARIGAGRDDRHAIGLPADSSRAQSLQQ
                     DLWKAFQPHWERLLTDPHVLVRRQAVASVTEAALASPLLLQPTPHRKSIDNRDLRGGQ
                     QATPSPTRSPSDFLAQTLGLRALDKNRRVRCAAVDGLTRLYSEYRLVWIPNAALDAVR
                     IDAGSSLSSTAPAALTAETVVEGLLPAPFSCLSPTSATCAAAATQATLTRWLSPTSPA
                     ALPLTKTPTLLDFERNPLEEKQLCQQHPPGGDEFDEGDALLGFGASVSSTKAVAGGGV
                     LTTASIPSTASAAAAAVSAYVDALVHLCQHVDSVHFAQLLRLSEKKPQLRLAIRRLFE
                     FHAAVKESNGDVKSAEGQQRIHSIHRLLTFLQETTGASKGEWDALFRAKDETVRRALL
                     RACDATHTDWVEVREGLLRSLHGRVSADEFAFVKQTLMPQMVFAVKPAHLAGLMQRLH
                     RSIYTSARDEVVVDGAVAAGALRALLLLTAASPSLAVLSTEGLVEALQAAAKQSVGPP
                     PNWCGLLLQALQRWATAIATMAHRNATATAGATSAVHDSLIATLRAMALASLPMQQTI
                     PPSLASTALAPDNDSYRGGTALSAAKQLAKQATRTLAALLSVPDYNTRAAAALHSLAS
                     ELTKRLASGRALINDVKAVAWLASVQALARCGSGSGSDDRTSRAAGAALLLLLSKAAT
                     TTETDVGPLPALLLSLSSLLVAAVEDVCGRAGQSTLKALATASAAAATMPTCGAFSSS
                     PVSVNMSVTAAIVDGSAKAMVALALSCPKSSDAGGSSTGVASRANSVICAVDALLKGY
                     KASVAVAPGRRGLASIGSCQCRIALEKQLVKLLLTPTPDIGRELAVSVVLSVEESAHV
                     RHAVQAKLAGHLLHRTCDMRVAALLLLTAISEDSKSSYHRLRGLVETVGDHLRAKQVS
                     QGASLSSPSALYCYWEYTIPFLVLFLAHHPYYASEEAENQFVGFQRVWHLLIGELLRH
                     GTQCAGFVVELLSKIKQSDDALAPESDACRVMCDLASRVLLECLGQRQSRAEDLRRYP
                     GAVLLPSFFVRTSRANPQKLLETVFLDHGVRVAANAPFRVPTVSGGGVGAGSGSRGSS
                     RQATPRASSTALSGGADGVTDINYVSSSAAPYEVTTAVAAVPPSPLRKRARSPSTEVS
                     AAVSLSPSVRPQCEDEVAEGDEGSMPQRECTEPAVGESASNCDPLSDSAIASQEWNAK
                     RAALQRLTIEEALDDLFRGLTKTAIAQLRWRVVRSRIEEALRALDCSRFPQQPQPRIT
                     NDGTGADLMVKKGASLLECDMENLLQYAKDQLRVRYDRAPA"
     gene            <349650..>353903
                     /locus_tag="LMJF_11_0870"
                     /db_xref="GeneID:5649837"
     mRNA            <349650..>353903
                     /locus_tag="LMJF_11_0870"
                     /product="putative kinesin"
                     /transcript_id="XM_001681504.1"
                     /db_xref="GeneID:5649837"
     CDS             349650..353903
                     /locus_tag="LMJF_11_0870"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001681556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649837"
                     /db_xref="GOA:Q4QGZ2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ2"
                     /translation="MHASPAGPASQPTRATTRSYQFSVDQVFSTHASQIEVYEQSCKR
                     IVEGIFHGINGSILAYGATGSGKTHTMFGSTMSAAGIVYQAVQDIFAEKERLEEEEGK
                     RVRIKCSFLEVYNEDVFDLLARPVGEGSGGAKSLANSGAGASGREAKRVPLQVREASD
                     TTASASAGFHAGEGGSINNGGLHIRGLTHIFPETFEDFARSIEHGHTQRFVAATGANA
                     QSSRSHAIITVEVEVRHSDTSANVGDLGFASAVDDDADAAEATTEFSPTKKAAKRKKR
                     SVTSTVTIAKIQFADLAGSERAAATSNMGLRLREGGNINRSLLALGAVVQSLVQQKVR
                     RRQTGGKGGGKIFIPYRGSKLTRLLRDSIGGNCRTQMLFCLSPSTKHAEETVNTMKFA
                     MNAKEIQVEAHRNEFAVNSSQLAKTQEALIEELREELARAQSALAAYTSGLSGNDSNN
                     SSGAEGNQCQRADAVPATESGAVGSESPSLTLHIRQGASLSMSNSPLGALSTGNRSHS
                     SPAPTPSVPALPSWPAKSAPRGTVTPSAAAGGAAASSPSVNVSPSSISIGGADVLQGG
                     SVPRPSLSSRTARPSVFSETTPLFSELEAKLKNFSAQKESLYHEVREAQERQRDRETQ
                     LREQQWRLATFLVSDASGSRARGEVDGNGTTGIGVAGLRKMIAAMEAEQAQQAHQLTA
                     LTERLDDVDRQFAATRQELLRERQGTSLELLLDNARLRQGCTEAECLAAHYHQECRSL
                     LNRQAEYAEALSKCVEAIQRLRPHLAQLTPPTSSMNGSNSGNAIVAAVETANVALLYA
                     LLPTASTAQMTTVFESALHSTVKSPLQAPPLTSVSAVSFPAQPMPFAHPPLAPSPTNR
                     AGRSNSCSPLRGCGSAGTRGSNHLAEHFRDLMATAESMHLTSSSERDTNESTEGVRTR
                     HGHLVQATDRTSSPDRRPSTPQAGKSYEPHGRAPATGNKNAPKAFGRTFSLTGLTRNT
                     ATAPIGGRKRRLCPVADKTSSSGPVGGHAPRTINGAGAKKTSGGGALHAQALQRSVSA
                     PLPFTRSASRTQGPAAGPACKPKAASGSGPAAASSTRRRAGAQKATRRRASRKTPVGS
                     PSAGHTATASSFAFVRSNHASALRALAFAMDSADSSLRGRSNRRGEVNSSPPPAARAS
                     SEVTANSGSSRGMPNTNDAAKGRQSNSSTGNKLAATNTIPSCPDLDCGPSRAQAQQER
                     KRVSGSAALHLLGLAPSSSKLECTNKKTGKLARSQATFAPVSPPCVAGASGVPLQRRS
                     DHATATAATLTSAESSSRISSSSSDSSSFNVSCESAPSRYNGAPEGRTATPETGAHNA
                     KKAANGARKSHDRTPQLTVARLLECAAAAAAPALPQYNVTLSPNTHGSDCVNKENGQQ
                     PLQLRTRTSFTDDLMVSISTCFSDGLSPNSRGQVSSSHC"
     gene            <360445..>361434
                     /locus_tag="LMJF_11_0880"
                     /db_xref="GeneID:5649838"
     mRNA            <360445..>361434
                     /locus_tag="LMJF_11_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681505.1"
                     /db_xref="GeneID:5649838"
     CDS             360445..361434
                     /locus_tag="LMJF_11_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649838"
                     /db_xref="GOA:Q4QGZ1"
                     /db_xref="InterPro:IPR002913"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ1"
                     /translation="MCTNTMSKAKRTVAAPNKADSTANPTAPEVVEYMTPFSFSGETQ
                     EAAGRIYRLPSRADFYTFRTFADSLDGFALRYNRANEVMVWEKKLSNEPMHVIKVFGI
                     FVKTKDNPSGGATPGELYNLLQDPIFREQWDEYRQEAFRVMSLSANTDIGYYAAKSPM
                     PLVANRDFVNQRMWHEAGRDEYVIFNTSVPHSAVPPTYQKDAHRNKHGPYIRAISKLT
                     GYLIRPWKNPKSGEVEGASLTYITQTDPGGWIPVSLTNYIATKFAPNTMKNVAQALPK
                     FRLWFKEQLKAGTYTKDWDLTPEWWVEDGSDDAVKNETVEFAIKKWSEESAMK"
     gene            <365890..>368928
                     /locus_tag="LMJF_11_0890"
                     /db_xref="GeneID:5649839"
     mRNA            <365890..>368928
                     /locus_tag="LMJF_11_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681506.1"
                     /db_xref="GeneID:5649839"
     CDS             365890..368928
                     /locus_tag="LMJF_11_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649839"
                     /db_xref="UniProtKB/TrEMBL:Q4QGZ0"
                     /translation="MTPLPQQPPTPPAASPYITPESKEKGDAGIYAALDAMQLSRALH
                     GVTSSRLDQQQLQQVAAARGASPTPGGDGGATQSNAVRLGMEPASYRQGTLADVQAMY
                     NAAVVEAVQAVSGDAAAEAVERGVGGAAVTATAVGLPDDVATLRSALPLVHELKPRDP
                     LNFDALQRLFVLMEEAVGAAEVAEGVGSGGITALLLANGVVDPARQPSPSTEAWEAKY
                     REVYARYPLPVAHAAASSADSHNFDEDDDDTQPEVHAQNNEDLQEFCEKLGIAYETHA
                     KAVRDVAFYEMTVFPLLCAYLSRINERTAGGRDAATVAAVACSRVKVLDLSYNNIGAP
                     VVSTASGEDGGRGDVAPVRQLSPLRALAAMLDANESLRYLNLRANALGPRGVGIIAKA
                     LTKNIALCGIDLSANALNLATSTEEVEDPLYEPEDPVFGEPYEGLEALAEVLKKNKFL
                     RVLRLAENGLHAGEDLTAPPPEEDGEEADEEAAEETAAAEADSGAAATAGAQAPRPGL
                     SFADAQEQWQSIPLWTLLSPLYRYQRLRALDLSKNLLGNDGVHMLAVALSHNTSVEVL
                     DLTDNAIGYAGLGHLARYVLGRGVAVGAASTAAAPQSVLHTLILRQNPLACVGGAADA
                     ASGVNARRRRLTKRQQKSALAAVRRFASALEGPRGLRRLVMANTYLGPTFSSIVLRSL
                     TRAEALEELDFAYNHACGDYPSNFDGTAAQELAGLLYQLQRHGPPRLQRMCFDGNNLT
                     AAGVAALIPPEVHVAFPQTLHKLTLSRNTLRDDLGSLSQLLAAGAATITHLDISYNNI
                     LTVASLLPGLATATSLRELNMSHNNLGLQEGLLRGMTPAQQEMEVAQLFQVLAQLPNL
                     EVLDISHNDWRATHIEQLTAFFSNTALATALRKLDVRNTPRVPTAQLMTLLQYVASRP
                     TMEVFMATVVPDKSEGADAVAADVDSTVAPWTLDSVLQVIHGVVVNSGSLLEVDCGLL
                     QGDAGAASSGDDASVSSVALDEARERLLLNVLMKAATPSM"
     gene            <370331..>370903
                     /locus_tag="LMJF_11_0900"
                     /db_xref="GeneID:5649840"
     mRNA            <370331..>370903
                     /locus_tag="LMJF_11_0900"
                     /product="putative 60S ribosomal protein L24"
                     /transcript_id="XM_001681507.1"
                     /db_xref="GeneID:5649840"
     CDS             370331..370903
                     /locus_tag="LMJF_11_0900"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L24"
                     /protein_id="XP_001681559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649840"
                     /db_xref="GOA:Q4QGY9"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="InterPro:IPR024546"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY9"
                     /translation="MRIEECSFCSAPIYPGHGQVFVRNDCKIFRFCSGKCRKNFGMKR
                     NPMKLKWTKTFRKANGKELAVDSTMDFEQRRNIPVKYNRELLGDTLKVMKRVEKIKQR
                     RQEDLWARRMEKARLQEKQEASSALKHNIDWIEDVEIKHKARDDLVAIQQEREDKKAK
                     RREANKRRHQKQRLAEKAAGTSAFRSAKKK"
     gene            <372728..>377386
                     /locus_tag="LMJF_11_0910"
                     /db_xref="GeneID:5649841"
     mRNA            <372728..>377386
                     /locus_tag="LMJF_11_0910"
                     /product="putative ATPase"
                     /transcript_id="XM_001681508.1"
                     /db_xref="GeneID:5649841"
     CDS             372728..377386
                     /locus_tag="LMJF_11_0910"
                     /codon_start=1
                     /product="putative ATPase"
                     /protein_id="XP_001681560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649841"
                     /db_xref="GOA:Q4QGY8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY8"
                     /translation="MMLTRSQAKRGRSSDVGDEDDSSVVGPVSSDADTSDGDDVHRRS
                     TAKPRSSPAETTPIRNGSLVSGQRGASLLASPQGERLGRGCRVPHATVSLDEQYLAAS
                     LRRSKPLQRSPGHRGNDRDGVARTRGGDEENDALAIRSRYPQREAAKRAMENLRSTLA
                     HPNGAAGRGGSGAADDEDSDSNSMGAFNFRHHPELKEEIKKSRKMYRRRCRNRNSASD
                     DDEDESTASSSSEESADANARARRATRGRPRLSTDWRGSAAAPSSNSPAGATTRRARA
                     ADADAVSIDSSISDASMRDESVERMAQQDQRAHPSSSSSESGEGSLTRDFMTEAQRRH
                     AARQARESVTENININHYMADAVGVEDSKKVRRRQLDRRYRWLMHQEEDARTRADGYG
                     GCAGAADGGSGGATTAANGALGDISPLQIDDGITFDSVGGLPEHIVTLREMVLLPLLY
                     PDLFERLDLKAPRGVLFVGPPGTGKTLMARALANEGSGFARGSNTDGATPSQQQQQQR
                     ITFFVRKGADLLSKWVGESERQLKLLFEEAKRLQPSIIFFDEVDGLAPARHAKAEQTQ
                     AALVSTLLALLDGLEDRGQVVVIGATNRPDTLDPALRRPGRFDRELVFPLPDAAARRH
                     ILTIQLAKKAMPGNAAQRAALLKDLVEMTEGYTGADLAALCTEASLHRLRTALPQLYL
                     SSQRLLVPHDVEKAQLHVRTEDFYAAAQLMQPSLRRPRNRGASGMADCFLDPYIEVLL
                     RGTRDATLAALTPSWSLVDKALRAGSRDCQDMATAVRSLCTVPIPQPPRPCLLVLRET
                     SDDLPSSWCAAAAAPADRSAEQHQQQRALRLHHLAISLLKGLPRLPQLTVHLPQLCWD
                     DSESRGTWRASAVVSDECLGDGSGSRFAGISFTHMSHVVDSVRQCSPCVVYLSGVEEW
                     LRGTSAEQETAATDLSSDDEGVVRVGSAAASHTVPSRPDAFTTSADAKVVIDGAEGPS
                     PVHQQQLSRRRQHLLQVFRYYLNTMADTDVIFVLPCATAATCELLIGPESPAPAASKP
                     RTAATALSPQQLDSLSPSSPILQADPPSAVQLRRFSARQQLLHPQFSVVVAAVSATPL
                     PNDLCQFVAYVYRIVAMTLQLHHRTAVVNATSEPTKEHGETRAAAAVGSSGALVVDKA
                     PPSSPLSAVNLRARRRADRAQRCKLWRRVEYRRLQLRHVLVKWVSQYINSGKFKLLAS
                     ADLDLAADNPQFKSWQQHTRHHRIGLQDILEKIEDEAYVCLSQYHDDIDQLVRNVRSF
                     FRTRAAQDQRYRLKALDLKETCLLNMYKLNRDVIRFCEETRDIHEPSSDEDAADMGEA
                     QRVGAEVPGRDPTALISKDADPALIAEQSRRAMSFSQRPPAPVRRKPRRYYGERRRRR
                     KPRKDSKAETKKTSDEVVLTSDGSGDDDSGDGDEEDERASNEGSASEKQAAAAAAAEE
                     EEEVTANGSHTSASGVAKCKASVLSTASSAQDWACGLLASLSYTRLYQVFKSMMRGLE
                     MEVRGAEWQVASAVLPGEAGKPDDAAGVPLIVAGDSERAPDAYAATVFRQLLLAAVGE
                     "
     gene            <378029..>379891
                     /locus_tag="LMJF_11_0920"
                     /db_xref="GeneID:5649842"
     mRNA            <378029..>379891
                     /locus_tag="LMJF_11_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681509.1"
                     /db_xref="GeneID:5649842"
     CDS             378029..379891
                     /locus_tag="LMJF_11_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649842"
                     /db_xref="InterPro:IPR018649"
                     /db_xref="InterPro:IPR018997"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY7"
                     /translation="MYTSTHTHLHKVRPLTRERRETQLRPFLAMSSSLADEIAQLHEL
                     FKLGALTQEEFNEAKQATIRSFKTAAAAKAASAPVPGVSSASLSESPACSSLTSTKQQ
                     PNSSASPGYTETDARGQLAPPSPNASASPSVHTVAATRSRTFEEWKELWDTAKVSTPA
                     ATASTASAPPDAFHARMQALRCLSRLLCNVRMYPAEPKYRRIRESNRIIAHELMSVAE
                     ASGAVLSFAGFVRERDEEDASTSASAAGAATHCWVLHGEATAATVAGKAAVAVRLVDE
                     LLEYFGEQQSRRYRVQQLWRSVALEVRLERAARGADSRSPLQDVPDHPEEVNNEKEKG
                     NGKGGRGAVARSAESAAPSPPQALLSYLAECYTVDEAGDGLFSSMCHLQTLQRLYEEA
                     AAHIAAGAQPSSSHSLLRTAEVYGAVVQQRGAVELLVYGCGACFHPPPVATQRVLAAT
                     ASTLLTASSAPLSDTANDYTVQLVPTDTPDASEFVARCLQLLQRLRREVERVQQERAR
                     AARQAAEASMRQELKRERQRRQLEKNSGRDEMSADEQTQQWHQRRRTHRRGHGVHRRA
                     GSSSSTSSSASSASSRGAATKTEGQRIPLTEALAILMGKMSPPSSRPPPASSSS"
     gene            complement(381342..381414)
                     /locus_tag="LMJF_11_TRNAMET_01"
                     /db_xref="GeneID:12980842"
     tRNA            complement(381342..381414)
                     /locus_tag="LMJF_11_TRNAMET_01"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12980842"
     gene            381491..381562
                     /locus_tag="LMJF_11_TRNAARG_01"
                     /db_xref="GeneID:12980852"
     tRNA            381491..381562
                     /locus_tag="LMJF_11_TRNAARG_01"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12980852"
     gene            381622..381740
                     /locus_tag="LMJF_11_5SRRNA_03"
                     /db_xref="GeneID:12980848"
     rRNA            381622..381740
                     /locus_tag="LMJF_11_5SRRNA_03"
                     /product="5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460097.1"
                     /db_xref="GeneID:12980848"
     gene            <382922..>384055
                     /locus_tag="LMJF_11_0930"
                     /db_xref="GeneID:5649846"
     mRNA            <382922..>384055
                     /locus_tag="LMJF_11_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681510.1"
                     /db_xref="GeneID:5649846"
     CDS             382922..384055
                     /locus_tag="LMJF_11_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649846"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY6"
                     /translation="MVFDVNGDFVENEQQFIEAARKSINLTIKLQNTSGMSELIARVL
                     EDDDRRASGAISTSALDFDELLRTTPRFNFLSGDHPIFRRYNKRLAQQRQAAALIAQR
                     TAEAELQRQAEIKERLRKALEEEAAVQKKKEQEKAELQRMRAAQEPARFVPEEPFLKI
                     IKDESSFGQVERELKKPETAAEPKVESKAEGAASEAITNTATGTSTTLSNDVAATISA
                     EELLVLVGVPTETMETTTPALEDLAEAIALPSSENTATYVALPAEEYTLCSGERVVSV
                     IKKRSGPIPAPPPGTPPVINKAAASRLSEPVKRVKPVEKMVRNCTPSNEQPYKSRHRS
                     RSPRSRRRSERDHSSKECSRRHRRDEPSSHRHHKNSRDSKHRR"
     gene            <385180..>389610
                     /locus_tag="LMJF_11_0940"
                     /db_xref="GeneID:5649847"
     mRNA            <385180..>389610
                     /locus_tag="LMJF_11_0940"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681511.2"
                     /db_xref="GeneID:5649847"
     CDS             385180..389610
                     /locus_tag="LMJF_11_0940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681563.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649847"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY5"
                     /translation="MRNFFLLEVMLYFSSPLDFVDSLCTSTDEMAHHTDKSRQHYAKI
                     SALALDSSSHYEEQRARMQSVDLNYLQQKSNECIENRHAPSSLYTTYACCQAAMAVPQ
                     ESYFTRFVPNGSSPARRSELASRIVAQRNYFSYCRKPLECGGAISLQQLSQSPPAASS
                     QQGSRASVFFDDERFDETHVVFINGEPHRFSGGHQSERTLYGLDSPTAAIRDAVTAAA
                     AHQAEKSNTVSSSGGVQKRWHVSQEQSSTTSRIAEPKRRTAGFNGTCKRQHGKGSTSS
                     DRYRDFLSPSGQLYRVFRLHKRHLPPIGVSEKAKGFSFHAKGAKDASRTKKSRDREPA
                     ECDRDIDGRRELREDRVAADHRSGGRRPVKDDKVVSPVWKGHTAKPHKSHETSKNVRG
                     KRNGRRQLDAASHQNSCATKHTCRRCQRNLNSTSPRNASSESSSSWLLSPSASPSEDI
                     ADTRTGDRDCDGPSSCRERRQRSHDHHGASQNDKTHRRLPPIGGDQLHRPVPPPPSHP
                     SRRPRDAHRRRRQHNEGGRHVTKRRGSHSDVLSDSSDLSSLLSDSAVCVWSSLSSSID
                     SASDMSDCVVMDKPQRSPSEEHWQQRGTAQCRRAGSASPLISEGDGKDQELFECSNSC
                     LSDREPEWEDADCTSSSFSSTSLPSSELSSTSTWRAEVRRPRGRDGRRRHRRSAHSPP
                     SPSRKGGRPGARGSASNRHRRRDGNKTRNTRRPVCSPSSPSSSSDDSDSDRSPGKPRA
                     RSRAARATQSRSHSRTRPPIVHAVAPAHPPRALPPLMEEVLPSTRYATSAATPLAQRP
                     QMAQATEATHSCASPAVRPPRTEQGTIDKGVGQSHGTVEPTRRAYQKMPTSPLQVNLF
                     CDLVTPSVESSGPVCTSSQAEDSNKGGASPQQQSHKTGEPTPSPATEPLDLDYITEHV
                     LRVIQNRLAGKDNARDDDAATALRTHEAAGRERARQEEVREAAKRAAEQVRLRDLLRE
                     AQQEARQAREEQLSLSSLTDSLQFAFAQITRLMEHGDGTGDDTARLGLTHEATNKGGN
                     PSTAVGTLNSNTLVYCAAGSHAMTPPGAGASAVDGGSARDTAVAVEGGHTSSLPDSVP
                     DAATLQRLITVLRRRRHSRQVELRFQRQRAEKAEAKALEAAQQQQQKQELDELVANEH
                     QARASLRRAEEEALDELLVSAASVLEEAIGRMMAAQVSARMLLLEEEFNKRTEIVASE
                     EEEAADFWHFAADLYQAAEDAEAERLQAEAERMEAEGVAAKLRKGRDELGQRSSGSGT
                     QSTAGVEKIVVSNLIPGQLLGIEGGKSIENGGKIRLIGDPYVEAVEAHARERRRLDRL
                     RQQRLASALPSRPETNKANDAAGSRLSSRQPSTVRTGFTGGAVSALKLHSRASSRNFP
                     VLSPGRLSSDGNTRVGERSPSQNRLPSQSNFVFDGDVDLQVYGRQVGIPSKTRSPASL
                     LASARGTPVKGGADIAARPYNKRPGEGLLLMDMYASQIEH"
     gene            <392234..>393475
                     /locus_tag="LMJF_11_0950"
                     /db_xref="GeneID:5649848"
     mRNA            <392234..>393475
                     /locus_tag="LMJF_11_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681512.1"
                     /db_xref="GeneID:5649848"
     CDS             392234..393475
                     /locus_tag="LMJF_11_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649848"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY4"
                     /translation="MSAASSSVGHVRGSASSVASNSTEGGFGTGAGGGADAERRPPPR
                     LRYFFECFVPDEDATDAQSLSEVWRHMEPLNPFHYRELWCGVDGAVAASTTAAGPGWV
                     KPETPVEWNAFTDGDRATDGSASKVEDSAVKKEAQDGALPCSPARVTGGVLTTRAAQN
                     ALRTLRAVGIPDELSCMVMLSVRIPPGARLTRKQEKVLRLRVQRRPAPPRPIRRGAKV
                     FVPVPAVLGSAAENGVPVGSTRGGGGLLDVTALGPRVMRLAPAGFADAAAGVGSAGYS
                     KVPSAVSVMGEFAFDDDDEDEKYFHSGRRAGMKRSRHDVEDERLDDGDVPLINSGRWG
                     LDDSAGGGVGGSVGATAAAGAAGGAVTAQGDEVEEDHDEEDVFSTGMVDDDDDENMGS
                     EDNAQEDGDSFGGGDDGDDSL"
     gene            <395081..>395653
                     /locus_tag="LMJF_11_0960"
                     /db_xref="GeneID:5649849"
     mRNA            <395081..>395653
                     /locus_tag="LMJF_11_0960"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_001681513.1"
                     /db_xref="GeneID:5649849"
     CDS             395081..395653
                     /locus_tag="LMJF_11_0960"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_001681565.1"
                     /db_xref="GeneID:5649849"
                     /db_xref="GOA:Q868B1"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q868B1"
                     /translation="MSSKTPKLFNKWSFEGLETSELALRDHISTTAAYVPHTSGRWQK
                     RRFYKARMPIVERLANGLMFKGRGNGRKLQAARLLKHTLEIIHLLTDENPLQVVVDAV
                     SKGAPREDSTRVGSGGVVRRQAVDVSPMRRVNEAIYQMCKGAREAAFRNLKSMPECLA
                     DEIVNASKGSSNSYAIKKKDEVERVAKANR"
     gene            <396948..>397520
                     /locus_tag="LMJF_11_0970"
                     /db_xref="GeneID:5649850"
     mRNA            <396948..>397520
                     /locus_tag="LMJF_11_0970"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_001681514.1"
                     /db_xref="GeneID:5649850"
     CDS             396948..397520
                     /locus_tag="LMJF_11_0970"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_001681566.1"
                     /db_xref="GeneID:5649850"
                     /db_xref="GOA:Q868B1"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q868B1"
                     /translation="MSSKTPKLFNKWSFEGLETSELALRDHISTTAAYVPHTSGRWQK
                     RRFYKARMPIVERLANGLMFKGRGNGRKLQAARLLKHTLEIIHLLTDENPLQVVVDAV
                     SKGAPREDSTRVGSGGVVRRQAVDVSPMRRVNEAIYQMCKGAREAAFRNLKSMPECLA
                     DEIVNASKGSSNSYAIKKKDEVERVAKANR"
     gene            <398703..>400157
                     /locus_tag="LMJF_11_0980"
                     /db_xref="GeneID:5649851"
     mRNA            <398703..>400157
                     /locus_tag="LMJF_11_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681515.1"
                     /db_xref="GeneID:5649851"
     CDS             398703..400157
                     /locus_tag="LMJF_11_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649851"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY1"
                     /translation="MSRAYGGGRSAAELERLARLSEDNAFVDVGATLKRAGGEDAWES
                     TVGGDGTFDGPASSIIGLLSSSGGTSATSGATAAAAGAKRGQARKGTRASEDALLNGA
                     RIPLTASLQDQHKAYLESVRAAAKEWEEVSCSSSADDGSTADSADGDDKAVSRIGGVQ
                     TAERRGVGPPKRRGGPQAKVFSAETLPSTSLSSSGHPSEMVTVTSVRRGLADGAAVAR
                     KRPRGAQRAGRDTAAAETERKVNSAAQSARPDACSSLVAKLKAELRLVRQWERTMLEF
                     PPQIINGVLSPESRAPWAQASSTSRKTDAATVSSEAKYVDSDDDAEVLPNPLLQVYSL
                     CPSYEALTAGPVHRRDVVRCATTEEGWGHKEKPRRSLVASSSTATEAATRTVHVAGFT
                     FAVPEQVLGSRKRRSRQRENDSGHTSRLANGGQVDFIDPGCEDAVQGEREHHLCSVCM
                     LPASYRCLRCRTALFCSIDCHVLHDATRCLKFTV"
     gene            <401952..>404924
                     /locus_tag="LMJF_11_0990"
                     /db_xref="GeneID:5649852"
     mRNA            <401952..>404924
                     /locus_tag="LMJF_11_0990"
                     /product="adaptin-related protein-like protein"
                     /transcript_id="XM_001681516.1"
                     /db_xref="GeneID:5649852"
     CDS             401952..404924
                     /locus_tag="LMJF_11_0990"
                     /codon_start=1
                     /product="adaptin-related protein-like protein"
                     /protein_id="XP_001681568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649852"
                     /db_xref="GOA:Q4QGY0"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:Q4QGY0"
                     /translation="MPTVFVTGAAYFSRGFDAPMVKEDLASQNEPRQLSALYQVVAYM
                     TMGKDMSSLFNEVSALTSSAHSTMKRLAYLYLMENSRVQPERTVLQAGTFVRDTLHDS
                     PLVRGAGLRTMTSIQLSVMADFDTGPLSRCLEDSSAYVRRIAAMGVLKQYSKAPNVSS
                     ALDLLDKLKGLLKDTNAAVAGSAVRAMLELQYRNAPVSYISALLEARPHLMEMLLHGN
                     EWTTVYLLEGLAIAMMWECHEAVGRERRCCRGLQPSVASSTAVHSTAGPTLTALQCGS
                     HPAAHGEDDVELDTLRRQYIAEGEETLEAVLPLMQYASPIIVLSAIRVVGLFLHSVTA
                     PRLCVPEAEQSRILQRYTTSLLQPLVELLEAPRFEMQYVVLRNIAQFLTPVFMPYLAA
                     HLSKFLVKFEDPIYVKMEKLNLLVRFANRENGVRVLDELMVYTREADVALVRTAINAI
                     GVLATMIPELSEECVHQLGQLIATRVPHLVEDTVVVVQMVLRCYPGKFTDIIPPLCAS
                     LTILRATEAKAAVAWVLGEYPDSVSESVIEYLSVLVNEFMQQPRLVQCATMTALAKLY
                     LRSARHAPGKDSNSAIKNGTQAMLEKVLGACTDSLHPDLRDRAFFYWRLITLDPDVAK
                     RMLTTTEAVKLGTNSWDELVHHSSQQPGTSSGLQELGTLASVASKPLRLLIGDNVIGS
                     SNKCLVGVNDDEDANSGEEGDNDEANGYTGGSSNGSTAAKTPSAMAANTSSTTAHGAA
                     ATMLSSGETTTSFSTVLTPAQGNGVQVEMMWSQSGSKLVLCSRLRLVAGEDYMHHTRV
                     LTMQINWNMFGLGVAQVFPATSLECDDKPVEVSVLVACNNRKSPTAELQVAIELEYIG
                     VRYVLAPPIPTAYLLLPATGCEPHFFAEQWRALGRSVWNMPPQLRELKSDLTRLTTNL
                     LRVHCLNLVHRREVPEKGLLVLLYCETIGHERLLAQATLNMKKSTLTALNVRSADTPV
                     AAYVGEFIMRVLCPLSTD"
     gene            <407502..>410246
                     /locus_tag="LMJF_11_1000"
                     /db_xref="GeneID:5649853"
     mRNA            <407502..>410246
                     /locus_tag="LMJF_11_1000"
                     /product="putative pyruvate phosphate dikinase"
                     /transcript_id="XM_001681517.1"
                     /db_xref="GeneID:5649853"
     CDS             407502..410246
                     /locus_tag="LMJF_11_1000"
                     /EC_number="2.7.9.1"
                     /codon_start=1
                     /product="putative pyruvate phosphate dikinase"
                     /protein_id="XP_001681569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649853"
                     /db_xref="GOA:Q4QGX9"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR002192"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="InterPro:IPR010121"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018274"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX9"
                     /translation="MDTVKHVYYFGGSKADGNRDMKMLLGGKGANLAEMVNIGIPVPP
                     GFTITTKVCAAYQQSKTIPDDVITQVKENVRKVEKEMKKSFGDVNSPLLFSVRSGAAA
                     SMPGMMDTVLNLGLNRNTVEAWVKRKPAQSRFVYDSYRRFITMYADIVMQVGREDFEH
                     ALGEMKEKKDTKFDTDLTAEDLKELVGKYLRLFEKKTGTPFPQDPWVQLFAAIRAVFR
                     SWGNPRAEMYRRLNHITGLIGTAVNVQAMVFGNVNDRSATGVAFSRSPATGANYFYGE
                     YLVNAQGEDVVAGIRTPQQIGKELSLKWAKEHNVSEEERRRRYPSMEEFMPENYKLLC
                     SIRARLEDHYRDMQDIEFTVEDGRLWMLQCRNGKRTIQAALKVAIDMHQEGRITKEEA
                     VLRVDPEQVGHLLHPNIEPGAAKTAKPIGKGLAASPGAAVGQVVFDAESAKAWAAQGK
                     RVIMVRLETSPEDLAGMNAAQGILTARGGMTSHAAVVARGMGKCCVSGCGDLVLKGKS
                     FTLNGHQFVEGDVITLDGTRGLIYKGALKLRAASLEGDFKVFVRWCQDVKRLGVRANA
                     DTPADANKAREFGAEGVGLCRTEHMFFESDRIDSIREMILADTREGRETALKKLLPIQ
                     RGDFIGLFRAMAGNPVVIRLLDPPLHEFVPHDESAQQELAAKLGVSAEKVRQRVKALH
                     EMNPMLGLRGCRLGITYPEIYNMQVRAIMEAALTLAKEGTDVQPEIMIPLVGKKEELT
                     FSKKQAVVTAEKVLEEGGARVHYTIGTMIEVPRAALTADQIAEEADFFSFGTNDLTQM
                     GCGFSRDDAGQFLRLYDNLGIYTRDPFQSLDQEGVGLLVSTAVTKGRAVKPTMKMGIC
                     GEHGGDPRTIEFCHRVGLNYVSCSPFRVPVAIVAAAHAAVKEKQDYEKRNKALAGSKL
                     "
     gene            <412372..>414438
                     /locus_tag="LMJF_11_1010"
                     /db_xref="GeneID:5649854"
     mRNA            <412372..>414438
                     /locus_tag="LMJF_11_1010"
                     /product="putative inositol-1,4,5-trisphosphate (IP3)
                     5-phosphatase"
                     /transcript_id="XM_001681518.1"
                     /db_xref="GeneID:5649854"
     CDS             412372..414438
                     /locus_tag="LMJF_11_1010"
                     /EC_number="3.1.3.56"
                     /codon_start=1
                     /product="putative inositol-1,4,5-trisphosphate (IP3)
                     5-phosphatase"
                     /protein_id="XP_001681570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649854"
                     /db_xref="GOA:Q4QGX8"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX8"
                     /translation="MSSATPPLPADSVTASAALRFSVDFDPSRADSKPSVLLLTQNVG
                     GIEAALGTDAGLGETSPECPHSPLPENGGDTSAAFASVPKDFRGPSYIHVPDDIDSEL
                     GVSPVVRQQVAEFLADLRQWLHRLSYMSAAVRAAEASATASSAAPASVAGGAPSPPPS
                     PTPCGAAANTEAYMRSYTPSVRPPLIDMVVLHFQEIGGKYKNKHFNEYFKEQIRTSLL
                     PEAGWTSGLLMDERESGDTLSSSSYQRHRATSTVQALRRTSFEGSSTSNNNGNANGHV
                     GDAHRLSDANSNDTDLTAELDADADAYFTAIGSIVFLSPRFMGIASCLSVPHRTYIPI
                     VDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRLGTVQFNVCNVHLFNDDDNRVA
                     LKSSPSLYTGRRTRAITEAIAECSAVVDLSEPLFIFGDYNVRMDGKSFTEWVEEKMQM
                     TVRAERKRLRCPEQFWELFTNPATQQELRTRFDIEPQHLMDEVALLSSVELAEMPIQF
                     APTYSRVAYRTRTGATTTSAGADAAALRDVAATPDAQQQIPTLKDLAGRADAIRAEEQ
                     EQTEAIRARPSVSTLLAPLASPLASVPLTHVAASPYRDNFCHDRLPAWCDRVMFNVAG
                     LEWISGDRSRTAPPQPQAASSVSGSAASGAGGLKGRQRSGQGCWYAYAAIDFIHMDHD
                     GVFMLF"
     gene            <420555..>424133
                     /locus_tag="LMJF_11_1020"
                     /db_xref="GeneID:5649855"
     mRNA            <420555..>424133
                     /locus_tag="LMJF_11_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681519.1"
                     /db_xref="GeneID:5649855"
     CDS             420555..424133
                     /locus_tag="LMJF_11_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649855"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX7"
                     /translation="MPWAPPTCDDTLRNPYQAFRMHRYHTRTETQLSQHGVMREVSQQ
                     HQRQRLPVAGSKNAPEAASEQSGEDEESQDRQWQTRCCKEQQAYPGAPTRQRDGATVV
                     SSLRRFLSMMPVASPPDEPPPPPPQQQQQQYQHQHQQQQQQQHQHQPQRGSVGNRDRA
                     LAFQHLQSTSLPSSSAMAAAATTPSPLPAAATPPSPTSRVPPTFALFGALERLSRFSE
                     MVQLCQEHADVLDDFLARLTLQLHRNSCALPLLASGANPARSQSSPPSLAASAACDDC
                     EFLRWHRIIMFLLRQPSELVKVGAEFFTDAVNSWPLHMLYLTCCFYVTACERGFDALA
                     AALCKGGIFCSGKGLFAALAVSMAQSEEDLIRSTACMYRAAFYTGVLMRKRHQHFETE
                     TRLTANGGFTLLVVNIPIITLRRLVARVNEGYDVFASMRDIYKGSETERGNTWLNVNS
                     NNTVVSAGTAPTPRGRCGGRLHSPNSSSAHASASLPFARSMPHYPHSVIEVSRVISNR
                     SAVLCGHPLDMLRLDMILSRFADFNDVKIHKEYLPAGGPENSYFFNKHMAHELMGLWR
                     ARGVSFSLASVQLPVHSPVNGDLWAASLRVPLGPPVPPNVSAATMASAYASNAILCSA
                     APPPTAGYRDEWWMFNVAEAATCSNQDLTYSLRYMQDGSVLLDFSTHAMRIGRLIAWT
                     NKSVTVLAAPENRHESSAMPPPRRSPKDEAVRNTMKKLAIINNVLREVGDRTEQPPGA
                     LANPSVELSTTFTELGLLEVLQGPRERGGTCRFGAPTRAASVVLSERQSSYHGYGSTR
                     FGNVPSGAGVASEAPSACRLDAANALGGPRGVASSNGTAAGRCLKPSIGALVSLKRAF
                     ANSANESVPATASNLNNPSAIGYRHTDSLSLSSVGAVAGCLAGELWHTISPVGQSDAS
                     SDERTPTVTSMSIGAPASLQPKTEEASVAGGVSLSAPPAPFFSVPQEAYLRPSSVSAG
                     RGRNGAVVVSDSLHEGPASTFALPSDVVARLVSEPERIPAYRVRSAPSGQRGLHLQAS
                     GTTALRRARGIQCEAPVEGYHSNTERGSAVAFDDDSADVHRVSGDPRTHAAECFPGTM
                     YEDGFVIRRNDDHAGIVNVYQVSALITYYEMQFNSVLCDGAVLFARLLKRASGIAFPS
                     YTLLLCPTVFSLLELWDGYEFEELWRRSLSAPVCSRVTSPIPAGLM"
     gene            <425050..>425856
                     /locus_tag="LMJF_11_1030"
                     /db_xref="GeneID:5649856"
     mRNA            <425050..>425856
                     /locus_tag="LMJF_11_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681520.1"
                     /db_xref="GeneID:5649856"
     CDS             425050..425856
                     /locus_tag="LMJF_11_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649856"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX6"
                     /translation="MSKSIAVIAAGAPAALVQAASAMVSKATGGAVKAMQATSAASNA
                     IVVGMQAPRGVYACVAEPPSTASGPYAGVKTVVVRAILPRRAPDTMQVRDILDVYPAS
                     GITCEQETAEAVESFSKAAKVAVEKAKAMKATRVTLVMKPATKYERLNSLFRETCTKT
                     IEAAGLSVETATTAAATNTLIMFPEKMSVVMVSDDPVCENVQYAFAGVVGGAHTTYYT
                     DAGSTIHGGHSYKSVAMALAEELKSLGMKAEAAKVEAAAQKSPRNAAAAM"
     gene            <436168..>438609
                     /locus_tag="LMJF_11_1040"
                     /db_xref="GeneID:5649857"
     mRNA            <436168..>438609
                     /locus_tag="LMJF_11_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681521.1"
                     /db_xref="GeneID:5649857"
     CDS             436168..438609
                     /locus_tag="LMJF_11_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649857"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX5"
                     /translation="MAMGGPAALATSTTATTPAHDFAACREHPTLLSSPFDGVNSQHQ
                     SLSSPLHGPPLPRSRHSADAGGDDLSPTGNTVGSLPSASTPTQCSAAPLRSRQALLNA
                     QSLSFTIALERPSFTDWYATAAWDDPSTGSCPSSSSWSLLNQPQPRNAARAMASSPIS
                     PVDTVATTLFIDGLPALIENKWQLQPYVPPQGLVALRVKSSRGRNVGFAVYDSIAAAR
                     EALTWFKQMLIIKEVVQTSTLGAPPAAESARGTEAPPVLACGGRSAPPVGGRSDCFPG
                     SPVELEPMPLEYEEYLCTQPVPGQFASLLRRCALLRAEWARSLETQHPPASVGAAAAA
                     AASSVASSPLSYPPSPWGTAAAVVRPPQQPPTATAVPHVGRKLSHDGGDGYSQMSEPA
                     RQAPTLQAPLHPLPSPIAWSPGSQSPQQPLNPCAAVSCADAQAAHPPARNPLFLSAPH
                     HAPSPVTRRVWASSAPSVPLHRSEMRCYHGCGAAQKVCHQHAHSTTCQPPFPVHRGLY
                     MAERSDARERVDAWRGAPPEPPASLHRQGRPHPRQHHASYHYHQHSSEPPLPSRTLFV
                     RLIHNFDAPGYLQQDQVRSSTGSSTGSASAMHVKPFTTARLPPTIAGSVTAPGTTTAY
                     AEEAALPTPTRLVAQTTPSLQVSPTSGAAGTCPLISVVPHHYHHMCYQSPSSPTLTTT
                     PQLRSPLDNGGTQMYSSWQPPPSSQLTGPCADRHGGGAGAANEALSRWTPNAEDREFF
                     RFAQSVLREEYFSEKFAGFLRYREFLRPPYYGGCFVLFERGEDMQRCLQWMRKDERLM
                     KLFAVAPARNDSFGP"
     gene            <442810..>444270
                     /locus_tag="LMJF_11_1050"
                     /db_xref="GeneID:5649858"
     mRNA            <442810..>444270
                     /locus_tag="LMJF_11_1050"
                     /product="putative pretranslocation protein,alpha subunit"
                     /transcript_id="XM_001681522.1"
                     /db_xref="GeneID:5649858"
     CDS             442810..444270
                     /locus_tag="LMJF_11_1050"
                     /codon_start=1
                     /product="putative pretranslocation protein,alpha subunit"
                     /protein_id="XP_001681574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649858"
                     /db_xref="GOA:Q4QGX4"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX4"
                     /translation="MTKQANWLMSLKPMLAVLPEIEKPRRVPGIKERIMWTAVALFVF
                     LICCQVPVYGARPGNASDPFYWMRIVLASNKGTLMELGISPIVSASLILELLAGVRIL
                     TYDQNNREERAVFEGFQKMMGLVITAVEAVAYVSSGMYGDPSRIGVVMCGLIVLQLMV
                     ATMICILLDELLQKGWGIGSGTSLFIATNVCDTIIWKAFSPSTINTGRGAEFEGAIIA
                     FFHLLVSRTDKVRALREAFYRPQLPNLTNIFSTAVVFAVVVFFQGFRVPLMTKSKFNG
                     NDRQPYMIKLFYTSNMPIILQTSVVSNISFFSQILSRRFGNRNFLINLLGRWEERGYN
                     GGGSGQLFPVGGLAYYLVPPATFYDLLADPIHAIFYVVFVLTSCAVFSRLWITISHTA
                     PRDVAKQLASQGRWLVQARESEDDMTRLLEKYIPVAASFGGLCVGALTIFADFLGAIG
                     SGTGILLSVTMINQYYEILQQEGQDLGYGFLKQKVA"
     gene            448984..452289
                     /locus_tag="LMJF_11_1060"
                     /pseudo
                     /db_xref="GeneID:12980844"
     misc_feature    448984..452289
                     /locus_tag="LMJF_11_1060"
                     /pseudo
                     /db_xref="GeneID:12980844"
     gene            <453491..>454210
                     /locus_tag="LMJF_11_1070"
                     /db_xref="GeneID:5649860"
     mRNA            <453491..>454210
                     /locus_tag="LMJF_11_1070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681523.1"
                     /db_xref="GeneID:5649860"
     CDS             453491..454210
                     /locus_tag="LMJF_11_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649860"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX3"
                     /translation="MSVSVTEHRHGDMHHGTMRRRCLTRVLLAGPQGDLEALVSRMPR
                     TWSLQQPLEMLQPEAVEEERANTASAAAATRTENAGLAGGKVPDKSAASVMISYSPVR
                     ATLPLAAAASEEERAEEDVVDVVAAVEEKAAMKADLHNSSGSAVEPPSLEGTPNVRLH
                     AAQAPHEEQQEEGDCGVVVAHEAPALTEDGIPGADSAVVRAAEVAATLDIGSQLAEAA
                     PCADRASLDSSAALPVSQVPE"
     gene            <456577..>458139
                     /locus_tag="LMJF_11_1080"
                     /db_xref="GeneID:5649861"
     mRNA            <456577..>458139
                     /locus_tag="LMJF_11_1080"
                     /product="putative zinc finger domain protein"
                     /transcript_id="XM_001681524.1"
                     /db_xref="GeneID:5649861"
     CDS             456577..458139
                     /locus_tag="LMJF_11_1080"
                     /codon_start=1
                     /product="putative zinc finger domain protein"
                     /protein_id="XP_001681576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649861"
                     /db_xref="GOA:Q4QGX2"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX2"
                     /translation="MTDHDDETERQRLASAAVAPNQPVSNGGSRKPSVKQPSPPQCDS
                     LALAPSTATATVACTSVAEGTLSHFPHGVGVPAPCARPSDASVAQNRGTALSFTPVSG
                     LKKSILTLGEYVKGPVWPRIAATTLPESPQELSSVFSPASLREAEVEMTAQRQQGGVG
                     NHLPSATAVTAPIGVSVGEGGTSRLPCAHPHPADVDLPIAAEMEVAAKQRYGDEGDGA
                     FLAGGCAWDAEERVRGASLHEAEEDTGDGWESEDWAEDDRKIPRSAEPCCSLCVNVSK
                     DPDSWRHSQPRRHAFERPLHSMQVMAFVFEVVLLGLFWSSVFMGYVMLYTQDKQNCLA
                     EMVIFAILVLAGMVWLYTSLIIISFKDCTDRSNSGEMCMFCRRRTHVDSKHCKACNKC
                     VEGFDHHCKWLNVCVGTKNYQLFFSFVSAAVCVTLVGFLGGVTYLARWWHVLAERHSA
                     YFRAGPVVMCTLMVVGIGPMAHLLLFHSYLCIVGKTTYQHILEKRKRTVQFPSGETEE
                     RFLKKRRLPCCC"
     gene            <460975..>461904
                     /locus_tag="LMJF_11_1090"
                     /db_xref="GeneID:5649862"
     mRNA            <460975..>461904
                     /locus_tag="LMJF_11_1090"
                     /product="putative zinc finger domain protein"
                     /transcript_id="XM_001681525.1"
                     /db_xref="GeneID:5649862"
     CDS             460975..461904
                     /locus_tag="LMJF_11_1090"
                     /codon_start=1
                     /product="putative zinc finger domain protein"
                     /protein_id="XP_001681577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649862"
                     /db_xref="GOA:Q4QGX1"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX1"
                     /translation="MDLASRSNLEASGRDDACVVANVLAPPPKVDAAGGNVMEADHGA
                     ADDDHGFESRSEQPLASCCVDTRRYPDSWRHTRPRRYAFERPLHSYQIAGQMYCLVVI
                     ILFWSSVFAAYVLLYTQDKQDCLAELVAFATLFGAGVVCVYIFFFWLSFKDCTDRSNS
                     GELCMFCRRRTHVDSKHCKACNKCVEGFDHHCKWLNVCVGRENYIAFFCFVSGSVFTS
                     FTALGSVICLLARWWHVLAERHSAYFRAGPVVLCFVLLVGIVPILHLFGFHIYLHFIL
                     RTTTYQHIVGKREETFQIPAEGAASTKTSCCCC"
     gene            <464294..>465733
                     /locus_tag="LMJF_11_1100"
                     /db_xref="GeneID:5649863"
     mRNA            <464294..>465733
                     /locus_tag="LMJF_11_1100"
                     /product="putative lanosterol 14-alpha-demethylase"
                     /transcript_id="XM_001681526.1"
                     /db_xref="GeneID:5649863"
     CDS             464294..465733
                     /locus_tag="LMJF_11_1100"
                     /EC_number="1.14.13.70"
                     /codon_start=1
                     /product="putative lanosterol 14-alpha-demethylase"
                     /protein_id="XP_001681578.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649863"
                     /db_xref="GOA:Q4QGX0"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q4QGX0"
                     /translation="MIGEFFLLLTAGLALYGWYFCKSFNTTRPTDPPVVHGAMPFVGH
                     IIQFGKDPLDFMLNAKKKYGGVFTMNICGNRVTVVGDVHQHNKFFTPRNEILSPREVY
                     SFMVPVFGEGVAYAAPYPRMREQLNFLAEELTVAKFQNFAPSIQHEVRKFMKANWNKD
                     EGEINILDDCSAMIINTACQCLFGEDLRKRLDARQFAQLLAKMESCLIPAAVFLPWIL
                     KLPLPQSYRCRDARAELQDILSEIIIAREKEEAQKDSNTSDLLASLLGAVYRDGTRMS
                     QHEVCGMIVAAMFAGQHTSTITTTWSLLHLMDPRNKRHLAKLHQEIDEFPAQLNYDNV
                     MEEMPFAEQCARESIRRDPPLIMLMRKVLKPVQVGKCVVPEGDIIACSPLLSHQDEEA
                     FPNPREWNPERNMKLVDGAFCGFGAGVHKCIGEKFGLLQVKTVLATVLRDYDFELLGP
                     LPEPNYHTMVVGPTASQCRVKYIRKKAAA"
     gene            <468817..>469260
                     /locus_tag="LMJF_11_1110"
                     /db_xref="GeneID:5649864"
     mRNA            <468817..>469260
                     /locus_tag="LMJF_11_1110"
                     /product="putative 60S ribosomal protein L28"
                     /transcript_id="XM_001681527.1"
                     /db_xref="GeneID:5649864"
     CDS             468817..469260
                     /locus_tag="LMJF_11_1110"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L28"
                     /protein_id="XP_001681579.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1110"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649864"
                     /db_xref="GOA:Q4QGW7"
                     /db_xref="InterPro:IPR002672"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW7"
                     /translation="MSHSVDLQWVLVRQNSRFLQKRGGIRMSNDPFNNNGNWTKRHCG
                     FLNEKAAVVKPAKGGAICVTVKDGSSNNKPRQTYKKTVHAAGVRASDVSRAVAAVRPD
                     LADVSFRRARRMACIASRTAKVAAARKARSEKIKFSRKSARAKRN"
     gene            <470536..>471549
                     /locus_tag="LMJF_11_1120"
                     /db_xref="GeneID:5649865"
     mRNA            <470536..>471549
                     /locus_tag="LMJF_11_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681528.1"
                     /db_xref="GeneID:5649865"
     CDS             470536..471549
                     /locus_tag="LMJF_11_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681580.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649865"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW8"
                     /translation="MMPLTLVDAYALALRTLDPAAWELFCALEDRILHSAAFLLGRVE
                     LTALRPAVKDSAAALSPTAASCVQPTVTSGVHDAEAMGIASVAAEMHRHLRETLRAGA
                     LHTFQSRPDSPTTSASARLVKDLSRVRQQVASALSPSSSPRCPGLVLAELSIVCQTVL
                     ALSALWMSTKFWATLCESTTLSALIACFLRLSSPPSKDETVAASCLERGTVGSVASAE
                     RGPCTDDAPDVVPMELANADQLCLASTPPSSFLAPVPLGHRSCAETCSAQVGAAGGLE
                     GGAACVSSEIIINGYEDISCSPLAPMMWLDGSAADAAESLARDIEDVEIILLRCSEYA
                     VPV"
     gene            <472580..>473023
                     /locus_tag="LMJF_11_1130"
                     /db_xref="GeneID:5649866"
     mRNA            <472580..>473023
                     /locus_tag="LMJF_11_1130"
                     /product="putative 60S ribosomal protein L28"
                     /transcript_id="XM_001681529.1"
                     /db_xref="GeneID:5649866"
     CDS             472580..473023
                     /locus_tag="LMJF_11_1130"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L28"
                     /protein_id="XP_001681581.1"
                     /db_xref="GeneID:5649866"
                     /db_xref="GOA:Q4QGW7"
                     /db_xref="InterPro:IPR002672"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW7"
                     /translation="MSHSVDLQWVLVRQNSRFLQKRGGIRMSNDPFNNNGNWTKRHCG
                     FLNEKAAVVKPAKGGAICVTVKDGSSNNKPRQTYKKTVHAAGVRASDVSRAVAAVRPD
                     LADVSFRRARRMACIASRTAKVAAARKARSEKIKFSRKSARAKRN"
     gene            <474571..>478047
                     /locus_tag="LMJF_11_1160"
                     /db_xref="GeneID:5649867"
     mRNA            <474571..>478047
                     /locus_tag="LMJF_11_1160"
                     /product="putative protein transport protein Sec31"
                     /transcript_id="XM_001681530.1"
                     /db_xref="GeneID:5649867"
     CDS             474571..478047
                     /locus_tag="LMJF_11_1160"
                     /codon_start=1
                     /product="putative protein transport protein Sec31"
                     /protein_id="XP_001681582.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649867"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW6"
                     /translation="MRLKNTALCCAFAWSPAVLGNPPLLATASYSGAMDENFSSDAFL
                     EIRLVDVKVTDETELPVVGRVRLPDRAHRVDWSPYAGPQGIIGVSCGNGCVYIFSAAE
                     VLAAGPNGGGEEVSDNPRGLLWMVREHAGSAVRGFHFNPSKPHFFATGADDGVWHVWT
                     LQDGATGGVCAPAKVSVISNVPNSGAIVHLQWHPKYAHIFATATVNGVVNVWNLKMAT
                     RVTALNVSKASHGAQITAIAWNPTAATQLVVGLDEGHPVLQVWDLRTGVVPLREMSGH
                     TGGVTGLAWSEQESSMVASCGGDGRTMWWDPNTGKKLGELQPVGQYLVDVQWCPVLPA
                     VIATSSFAPLLCVSTAQDVSSTGGDKLGAVPKWLNKPCGASVNMSLAVASLAPGTEHD
                     IVLSRLNCVPMSPHTTEDQRMFEQLAEFPCGSPERTQWLRDTHHELLAAFSSAQHSRQ
                     PILDFLNEGVASKKGGAGAGSGRLGEDDDDPFTAISHENQKRYEDRTSELIVSGKIEE
                     AVDLCMDEHCFDDAFAIAFLSGGEMVRKVHQRYIAHVAAVNPQKRHVLYAGAIASGDF
                     RPLIQANVPWKEVLSAIVAFVVGDGFADACNLLGDALRDQQNYEGSYHCYVCARNVDA
                     VVDLWRLENRPSREVVQDTILLEETTQRAASGEYLAHCMCDYGVKLLTDGHPKEAVQY
                     LQRAARLGDHTATVLVDRMKYLFNLAQPENGAPYVPAPVSDAQSPACQAFLAAAEERR
                     VRELQEQAQAQAQAQPIAPPPPQHQQERPPTMPPQTQYHVNPMAIPGQPQLPKSGYLP
                     AVGYMPPMGAPAAASQPPQQLQHPPSLLPHKSAAGGLPPPPGGSAPLRPQLMPGSGAA
                     PPPPSHGPSVYGNATPVSNSVNGAPVAPSPIGPHPPSAGGASMGMSASDTSSFSSSAL
                     PPSRTNPLSAAPNGVVGQPKPRLMPHPVSSYSSMRAPTTGAAPAAAAPPPSGPPSSSG
                     AMASQASSQPVSLYSVTAPPTQPPATQSVPYQAAPPPPQQRSDAVYGGGAPSMMKPQP
                     PPPGLPRLTMGSAPPPPPQSSAAGAEYPASLLASVSPAQFASPLHGQLVQRLQQVIPA
                     IADPRRRAAVEQAAVEVIRQLQQGMLPEGLVQMLVHFCANVGTPSATQAWAQLAQRYA
                     GAVQAFGNLCYL"
     gene            <480527..>482818
                     /locus_tag="LMJF_11_1170"
                     /db_xref="GeneID:5649868"
     mRNA            <480527..>482818
                     /locus_tag="LMJF_11_1170"
                     /product="putative eukaryotic release factor 3"
                     /transcript_id="XM_001681531.1"
                     /db_xref="GeneID:5649868"
     CDS             480527..482818
                     /locus_tag="LMJF_11_1170"
                     /codon_start=1
                     /product="putative eukaryotic release factor 3"
                     /protein_id="XP_001681583.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649868"
                     /db_xref="GOA:Q4QGW5"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW5"
                     /translation="MSWQQPTGNVNPNASSYTPDGGAYINSYNNQEARGYYSPPQQYG
                     GGGYYPPQGGLGGNHQGGYANRSNYQGSMYNPQQHRQSVYQDPRNDQGGYYPRGGYGG
                     PQQQQGGYSANASYYQGGGYGGQQQQQQQQQCYQQNEAYQQQMQQQLTLQQQQQQQQQ
                     QQQKQQKPAASMPAPKTSGSDAAKLSLGGGSAKSAVVPKKKGGGTLSLGKKKQVAVEA
                     TAPEETASQASPSTTAEAKPEGDAKPSTPPAAGPAAESPVQEKESAAVTQAESTSKPA
                     SAAPTKEAPGATEKDRAKATPEERRETVKKEIARQRQQSKKQYKRDPRPHFNIVFCGH
                     VDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSEEERSKGITR
                     ETGAAYFETEKRRVTVLDAPGHKAFVPSMIGGATQADICVLVISSRTGEFETGFEKGG
                     QTREHAMLVRTCGVKQMICVINKMDEMKWSKERYSEIVGRLKPFLRQNGYDEERAKNL
                     IFMPVAGLTGENLIKHVEPSHCDWYKGKTMMEVIDDLKLPESKTEDDVFCIPLVGAYK
                     DDGKTHIYGKVESGSIAVGERIQVLPTKAEALVEGISIESTEFEKCYPGDNVHLHVRG
                     IDENDIHGGYVATSIPTSLRAVEFFQARVVILEVKNIISAGSRVMLHIHSAQEEASFH
                     KLLAKIDRKTNEVVEKNPACVKAGDVVIARIELDRPVVLEPHKDFDKLGRFMLRDDGR
                     TIAIGVVMRLYESTHESLARAGQ"
     gene            <484853..>486076
                     /locus_tag="LMJF_11_1180"
                     /db_xref="GeneID:5649869"
     mRNA            <484853..>486076
                     /locus_tag="LMJF_11_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681532.1"
                     /db_xref="GeneID:5649869"
     CDS             484853..486076
                     /locus_tag="LMJF_11_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681584.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649869"
                     /db_xref="GOA:Q4QGW4"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW4"
                     /translation="MRRNGAPTFSSIACGHGVRSGRCSSGMLVALHVQQRRISWNPLK
                     WGRTDVGRSMNPNLEEELPEIFASQPTEVDDYICPDKSLFERLEDFWDWAVSFLQPVE
                     KQVEIMRSLRHDGFMSFDLGGWGHVFFFYGLCMRVLTLIPSLYSHRNSLRMAHIGPQI
                     SEITNNQNKAKNDRTLSSAEKRVIKDGYNRMKYVLCKKHNCSQWKSFLTTLTMPITMS
                     AFLSIRRLAMYETDLEMAPFLWVKDLTMPDPTYALPAICAGMFLLNFEMNQRMQRGGR
                     SASGLYVRWAVRASSVVGIYFFAGQPSAMFAYWIGLSTAGLLQPILLRWQPFRDFFQF
                     PDPPQAAKSNIICEIKGPSLYERLFATQEEKTRLEAQRKADRIKNSAARIETVYDYEV
                     VFDDDVKERPSGNRR"
     gene            <488611..>489003
                     /locus_tag="LMJF_11_1190"
                     /db_xref="GeneID:5649870"
     mRNA            <488611..>489003
                     /locus_tag="LMJF_11_1190"
                     /product="putative 40S ribosomal protein S15A"
                     /transcript_id="XM_001681533.1"
                     /db_xref="GeneID:5649870"
     CDS             488611..489003
                     /locus_tag="LMJF_11_1190"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S15A"
                     /protein_id="XP_001681585.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649870"
                     /db_xref="GOA:Q4QGW3"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW3"
                     /translation="MTMMSVLANALRTIASAERRGKRQVLIRPSSKVVVKFLQVMQKH
                     GYIGEFEIIDDHRAGKIVVNLNGRLNKCGAICPRFDCATTDYEKWMKNILPSRQFGFV
                     VLTTSLGIMDHEEARSRNTGGKVLGFFY"
     gene            <490655..>492733
                     /locus_tag="LMJF_11_1200"
                     /db_xref="GeneID:5649871"
     mRNA            <490655..>492733
                     /locus_tag="LMJF_11_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681534.1"
                     /db_xref="GeneID:5649871"
     CDS             490655..492733
                     /locus_tag="LMJF_11_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681586.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649871"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW2"
                     /translation="MAKVQVEVLAQRLMFTLAEENKTSERTFSRGVDLTWVHHKALIY
                     AAVIFAVICCFVSFSDLREHLSRFDYPKLQVLEMRIIMMIPIYALFSALSLLFHKWRF
                     FFETVRDTYESFVLYIFFMLMVSYCGGEGQLLRSLKRKRYKGMHPFPMCYLPSFPLDT
                     DFYLRCKRWVLQCALMKPLVSFIAMICHPLGIYKEGSFRLNNVYTYTSIIINISLTMA
                     LYYLVLFEIECKKEMYYAKTFLKFLCIKSIIFFSYWQTVFVNLASSAGVIYLGAHEEE
                     IEATGAVIQDLLMCFELLPVAFLHRAAFGRRKLDDEMACVPVYMKDNNTGDLRSNVDT
                     ALNVNDIIDDTFGTIFFRKGKLIDQENGGESDDDEITYGEGAGKADGSGEGASRGPSA
                     GARFNSAEGRLAFMGNADALARDPTLEELVHHAIVTDYGIRVDGVLHYDADSDREERN
                     QDMNFADTDVILRRSKHEVATQDVRVDTDLLRSHQVPQGGATPQIYCVVCGRFDRDMV
                     RRRNGYKCKECVGSKSQSLLRRRQQEVMEDDEVGPGHTDVVVAAMDATANVSSDVVDN
                     QWQFPPAVASTVSHHGAAVVSDDDEDASYVQPMPTEANADLVGVARLPQDTTVSALPG
                     ATALAEGFASLQQVLRVAFQGDDTKPTAFRTSTAPPSQAGVPPAAASRGPPAAVTAPF
                     PARRGNFNGD"
     gene            <494082..>494633
                     /locus_tag="LMJF_11_1210"
                     /db_xref="GeneID:5649872"
     mRNA            <494082..>494633
                     /locus_tag="LMJF_11_1210"
                     /product="putative S-phase kinase-associated protein"
                     /transcript_id="XM_001681535.1"
                     /db_xref="GeneID:5649872"
     CDS             494082..494633
                     /locus_tag="LMJF_11_1210"
                     /codon_start=1
                     /product="putative S-phase kinase-associated protein"
                     /protein_id="XP_001681587.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649872"
                     /db_xref="GOA:Q4QGW1"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="InterPro:IPR016897"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW1"
                     /translation="MPVEIANSDDVDFSQYCVLQSNDHPPVEFKVSRESAKMSGLLRD
                     MLEDQEGNEAIIPIPNVSGQTLRLVLEYMEYHCGNPAQPIEKPLKTTIESLVCEWDSN
                     FLFNQLLKNHDEKQHEVLIDVIMAANFLNVRDLLDLTCACVASMIRGKTAEQIRELFN
                     IENDFTPEEEEKIREENRWCEES"
     gene            <500104..>505434
                     /gene="ABCA2"
                     /locus_tag="LMJF_11_1220"
                     /db_xref="GeneID:5649873"
     mRNA            <500104..>505434
                     /gene="ABCA2"
                     /locus_tag="LMJF_11_1220"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 2"
                     /transcript_id="XM_001681536.1"
                     /db_xref="GeneID:5649873"
     CDS             500104..505434
                     /gene="ABCA2"
                     /locus_tag="LMJF_11_1220"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 2"
                     /protein_id="XP_001681588.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649873"
                     /db_xref="GOA:Q4QGW0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGW0"
                     /translation="MRATEAQRRSETSTELSSDYSSFCFQLVVTVKRMLILQSRDPLS
                     LACELITPIIFLVSSIALWGVIKKGFVPASDYFSVAGESMTNTVMTQAKDMMCYNATL
                     SGGVPIEGLLECREFLRKPLTHPRLLCAENNLTGAPVGLCVLQTYALKSYFTMSRYVT
                     QNTTRVPTVDEMILLQWAWRLLYQQSGASLDRFQMLDSAMLSTGTLYFAPQSTETEAL
                     VAYFRNTSTYFQYVYGGTFATVAEAEARVQNRTCRDPPIWGIIQVGSLTAENFEVAIR
                     LNATALPQTKWMSALYYIGGVVVKGPAMYILSGFTTLQQTVYHYFLRGVLGTTSTPEK
                     ELLLLPAPTRGYRDDQFLAYGGQFVPLILVLGFLYPVSQITKRVVLEKELRLREAMLI
                     MGLSEVVMYTAWFLIYVVQYAAVSLIMAILLRATYLAKSNFGIVFFLFFFYSLSVITL
                     SGLMAVFFNKARLSAILAPLIYLALSIPLFTVQNLQGPAQTGFSFLSPSGLAVGIGIL
                     FSHELGSGMSASDLTYFRDSPKMLAVIIILFMDFIIYLVLMLYLDAVLPKQWGTRKHP
                     LFFITEPVRWCCGSSARVLEGGADGRAEDGVFEDVEERDADYAVRISGLRKEYLRGGK
                     RFVAVNNLYWGMREGEISVLLGHNGAGKTTVLNMMTGMVEPDAGDCYVYGNSVRNELE
                     KVRQQIGYCPQHNILWPNMTCYEHLWYYAALKGLRGAAQEEAISRMLAGVDLQDKRDC
                     SSTMLSGGQKRKLSAAIAFVGGSRLVFLDEPTAGMDVGARRYTWGLLRAMAKCHTILL
                     STHFMDEADLLGDSVAILNKGCLQCAGSNMFLKAKLGVGYVLTLSVVAHANWMAVAGV
                     VREHVPSATRLGSGAGEMAFRLPMRTKAAFPALLAEIEGRGSQLGVNAYSVSATTLEE
                     IFIQIAQQGAAKEEMERKREQLTAPFTATTRVAAAASAGSSENYMNAVTDIATVDGVY
                     QEPPQPSDVWNVGFIGNDLGVLRSQFKAMLWKRLWNVLRDRRTQFFQIVCPMLCVLLA
                     MLLMLIKLFLSPAITLSSDLYGTAVEIDVVGCERAMNLSIPFSSRAVTVQPPSAISIA
                     TLSSYMLKTYDTHVAERYTGLVCLDTVSFPAPFAPASRPVSAVIYNTSGLHSSAIGLY
                     NLYNGYYMRLRGNNARVLTTVVEAMPRTKTEVEAQDSIYALIAAIVIMVPFTFIPSTF
                     VSWIVKERECKARHLQNVSGLYFSVYWLANFLFDICCYVITMFLILIVFAIFSHSEYI
                     GARAVGATIVLLFLYGLSGVAMAYAVSFLFKEHSAAQNVVMLANFITGFLLVLCVLML
                     SVFDSTHELAKVLPWIFRIVPSFCVGEGINNLAKLKLEGAVGTTNTPWSMSVVGWPCV
                     YMAAGLPFYVVVTLFLDHPGRQQRMQRLFHNPDAEPDFVKNEDEDVVAERRSVLESEA
                     RQSDLVRVENLSKVYSNGKVAVRSITFGVRPGEVFGFLGTNGAGKTTTISILCQEIHP
                     TSGRASICGNDIVTESREALRCIGYCPQFDACLDLLTVEEHLELYAGVRAISYDCRKR
                     VVEGLLALCELTNYKHTLAHELSGGNRRKLSVAMSLIGGPRVVFLDEPSAGMDPVARR
                     GLWTAIEAVADNSSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKNKFGTGFE
                     VNVRIRSEEEELKEAMRNFFSENFPGSLLREYRARRFTFGLPGGTKLSRTFKLMEEHA
                     SALGATDYSVSQTSIEQVFMQISEEAERQHEAEEAEQLAQTPKSYCRCCC"
     gene            507789..508810
                     /locus_tag="LMJF_11_1230"
                     /pseudo
                     /db_xref="GeneID:12980853"
     misc_feature    507789..508810
                     /locus_tag="LMJF_11_1230"
                     /pseudo
                     /db_xref="GeneID:12980853"
     gene            <510667..>516078
                     /gene="ABCA3"
                     /locus_tag="LMJF_11_1240"
                     /db_xref="GeneID:5649875"
     mRNA            <510667..>516078
                     /gene="ABCA3"
                     /locus_tag="LMJF_11_1240"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 3"
                     /transcript_id="XM_001681538.1"
                     /db_xref="GeneID:5649875"
     CDS             510667..516078
                     /gene="ABCA3"
                     /locus_tag="LMJF_11_1240"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 3"
                     /protein_id="XP_001681590.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649875"
                     /db_xref="GOA:Q4QGV8"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV8"
                     /translation="MEPVTTAVHPLGSSEASNRSWYSPSKRRAGLGAMRRNELMSRTV
                     NFTGFDMHTSSGLSLGPNRTSTVSEKDTSTSSGSKGSPEDSDSFSDAYEMPTRASFVD
                     QLLAVVARSTRELWRRKLDLLLDIAVPLIFIAVSIALWAIWGTQYNEEMTYVSTNLES
                     GNIGAAGLRAPATYDFTCMRQPEGTPTLAEFTRCKPMDYTTCDSVTGECKTQSIITFI
                     CDGDPSMLPLPAEYEICRVSYDWEELITAGLSYYWRWLSAVPTLDTLIGLQWTALSAY
                     RYLLPFIAKTMAGFAANTRYSSILCSGHLYFVGERGVTSELIAYMNRTSGLFQYVTDF
                     QVYSSVAEARRAGKRRGRVWAIVELRQIGEAGLDLVLHMNNSALPSFATTYDDAYSGG
                     VLFDTAELYMLSGFNTLQQLVSEFYLNTFHDARMNMTQMMAATATPEYNRVPLMAQAR
                     QVLPLIFSLAFLYSVSQQTKRIVLEKELRIREAMLIMGLKQWTLYVSAFIVQLAIFVP
                     TCALCVVMLKLTYVTKSDPLILFFIFCLFALTTIPLSGMIAAFFSKSRLASLVAPVVY
                     FILVIPMFAMTNAHGLIVTWFSVFSPTGFAAALNVFLLHESGSGCGAAEMMSNRDNPT
                     LAVVLVMLAVDLCMYYALMLYLDAAVPQEWGTPKHPLFFITEPVRWCCGSSARVLEGG
                     ADGRAENGVFEETDYSHDCVSFQGIRKEYLRGGKRFVAVNNLYWGMREGEISVLLGHN
                     GAGKTTVLNMMTGMVEPDAGDCYVYGSSVRTAKADVRQQIGYCPQHNILWGELTCREH
                     LEFFGRIKGLRGWELEDAMCRMLHETDLLEKMDQPAKSLSGGQKRKLSIAVAFVGGSR
                     VVFLDEPTAGLDVGARRQTWELLKRMSHSRTLLLTTHYMDEADLLGQRIGIMSHGRLK
                     CSGSSFFLKSRLGVGYNIVISVDPELDLDAVDDVVLGTVDGAELLRRNGCEVSYQLPV
                     QSVSQFPSLLNEIDSVEADGIRGYSLAATTLEEVFLKVSEEDILGRSEAAAQEGVELI
                     WNCEVAPSALWLQFRAMIVKRFWSALRDRKMQCFQIVCPVVCILIAMLLNLVQYRDPQ
                     SLTYNYSMFANRPTSVLDTSFCDVMWGGAPTGAVDYEVNETHLTGAQALSDYLLDTWY
                     VHDMPRYGAVSCIDRNVTALLRFADEWRGTNVNVFLYNSSSHHQAGLSLATYYDLFIK
                     SFLGRDSAFMRYEAELFNEPASQSQLGFIFIGALVMIPLTFLPSNPVAWVVKERQCGS
                     RHLQDLCGLSFLVYWAANYTFDMAAYSVTTLLCILIFCIFNRQDFVGPDRVGGTFVLL
                     MVYGLTSTAGAYALSFLFKEHSSAQTIVMGVGFVAGFLLLMLVYVLTLDPSNVDTSDK
                     MRWGFRLIPSYCIGEGLIGLLMLDSKLAMGTATSVWDMDQLGWPLLYMAVEFPAFWLI
                     VLFVDYPAVSRCVQRLHYNRDAEPIIPSDEDSDVEDEREAVYEAAQMGDTTSDVVRVV
                     NLQKRYGNGNIAVKGITFSIFPGEVFGFLGTNGAGKTTTISMLCQQFLPTGGSAYVCG
                     YDIVEQSKEALQCIGYCPQFDATLDLLTVEEQLELYAGIRGIVRAEWPALVDALCTLC
                     ELTMYRKTVTSALSGGNRRKLSVAMALVGGPQVVFLDEPSAGMDPVARRGMWTAIQRA
                     AGYCSVVLTTHHLEEVEALADIVAIMVRGYVRCVGDKVHLKNKFGSAFEVSVRLASAQ
                     HAERFASFMQAAFPDAVRNEGEGRRFVYQLPRDRGFGDVFQTFQANKEQLHITDYSVS
                     QTSIEQIFMKVRGLAVNLR"
     gene            <520967..>526297
                     /gene="ABCA4"
                     /locus_tag="LMJF_11_1250"
                     /db_xref="GeneID:5649876"
     mRNA            <520967..>526297
                     /gene="ABCA4"
                     /locus_tag="LMJF_11_1250"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member4"
                     /transcript_id="XM_001681539.1"
                     /db_xref="GeneID:5649876"
     CDS             520967..526297
                     /gene="ABCA4"
                     /locus_tag="LMJF_11_1250"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member4"
                     /protein_id="XP_001681591.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649876"
                     /db_xref="GOA:Q4QGV7"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV7"
                     /translation="MRATEAQRRSETSTELSSDYSSFCFQLVVTVKRMLILQSRDPLS
                     LACELITPIIFLVSSIALWGVIKKGFVPASDYFSVAGESMTNTVMTQAKDMMCYNATL
                     SGGVPIEGLLECREFLRKPLTHPRLLCAENNLTGAPVGLCVLQTYALKSYFTMSRYVT
                     QNTTRVPTVDEMILLQWAWRLLYQQSGASLDRFQMLDSAMLSTGTLYFAPQSTETEAL
                     VAYFRNTSTYFQYVYGGTFATVAEAEARVQNRTCRDPPIWGIIQVGSLTAENFEVAIR
                     LNATALPQTKWMSALYYIGGVVVKGPAMYILSGFTTLQQTVYHYFLRGVLGTTSTPEK
                     ELLLLPAPTRGYRDDQFLAYGGQFVPLILVLGFLYPVSQITKRVVLEKELRLREAMLI
                     MGLSEVVMYTAWFLIYVVQYAAVSLIMAILLRATYLAKSNFGIVFFLFFFYSLSIITL
                     SGLMAVFFNKARLSAILAPLIYLALSIPLFTVQNLQGPAQTGFSFLSPSGLAVGIGIL
                     FSHELGSGMSASDLTYFRDSPKMLAVIIILFMDFIIYLVLMLYLDAVLPKQWGTRKHP
                     LFFITEPVRWCCGSSARVLEGGADGRAEDGVFEDVEERDADYAVRISGLRKEYLRGGK
                     RFVAVNNLYWGMREGEISVLLGHNGAGKTTVLNMMTGMVEPDAGDCYVYGNSVRNELE
                     KVRQQIGYCPQHNILWPNMTCYEHLWYYAALKGLRGAAQEEAISRMLAGVDLQDKRDC
                     SSTMLSGGQKRKLSAAIAFVGGSRLVFLDEPTAGMDVGARRYTWGLLRAMAKCHTILL
                     STHFMDEADLLGDSVAILNKGCLQCAGSNMFLKAKLGVGYVLTLSVVAHANWMAVAGV
                     VREHVPSATRLGSGAGEMAFRLPMRTKAAFPALLAEIEGRGSQLGVNAYSVSATTLEE
                     IFIQIAQQGAAKEEMERKREQLTAPFTATTRVAAAASAGSSENYMNAVTDIATVDGVY
                     QEPPQPSDVWNVGFIGNDLGVLRSQFKAMLWKRLWNVLRDRRTQFFQIVCPMLCVLLA
                     MLLMLIKLFLSPAITLSSDLYGTAVEIDVVGCERAMNLSIPFSSRAVTVQPPSAISIA
                     TLSSYMLKTYDTHVAERYTGLVCLDTVSFPAPFAPASRPVSAVIYNTSGLHSSAIGLY
                     NLYNGYYMRLRGNNARVLTTVVEAMPRTKTEVEAQDSIYALIAAIVIMVPFTFIPSTF
                     VSWIVKERECKARHLQNVSGLYFSVYWLANFLFDICCYVITMFLILIVFAIFSHSEYI
                     GARAVGATIVLLFLYGLSGVAMAYAVSFLFKEHSAAQNVVMLANFITGFLLVLCVLML
                     SVFDSTHELAKVLPWIFRIVPSFCVGEGINNLAKLKLEGAVGTTNTPWSMSVVGWPCV
                     YMAAGLPFYVVVTLFLDHPGRQQRMQRLFHNPDAEPDFVKNEDEDVVAERRSVLESEA
                     RQSDLVRVENLSKVYSNGKVAVRSITFGVRPGEVFGFLGTNGAGKTTTISILCQEIHP
                     TSGRASICGNDIVTESREALRCIGYCPQFDACLDLLTVEEHLELYAGVRAISYDCRKR
                     VVEGLLALCELTNYKHTLAHELSGGNRRKLSVAMSLIGGPRVVFLDEPSAGMDPVARR
                     GLWTAIEAVADNSSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKNKFGTGFE
                     VNVRIRSEEEELKEAMRNFFSENFPGSLLREYRARRFTFGLPGGTKLSRTFKLMEEHA
                     SALGATDYSVSQTSIEQVFMQISEEAERQHEAEEAEQLAQTPKSYCRCCC"
     gene            528430..529703
                     /locus_tag="LMJF_11_1260"
                     /pseudo
                     /db_xref="GeneID:12980854"
     misc_feature    528430..529703
                     /locus_tag="LMJF_11_1260"
                     /pseudo
                     /db_xref="GeneID:12980854"
     gene            <531133..>536517
                     /gene="ABCA5"
                     /locus_tag="LMJF_11_1270"
                     /db_xref="GeneID:5649878"
     mRNA            <531133..>536517
                     /gene="ABCA5"
                     /locus_tag="LMJF_11_1270"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 5"
                     /transcript_id="XM_001681541.1"
                     /db_xref="GeneID:5649878"
     CDS             531133..536517
                     /gene="ABCA5"
                     /locus_tag="LMJF_11_1270"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 5"
                     /protein_id="XP_001681593.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649878"
                     /db_xref="GOA:Q4QGV5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV5"
                     /translation="MARTSWSSSPTGSASAGSAESYCRSKPAKRGSFMDQLLAILYRT
                     LRQTLRTKAILFMEIVLPLMFVVITLILWLVWLPFQGRSRQFIDYTPYASSAATLHKQ
                     LTCFNSSEGEPIPGLCDCAWISMLSNYTVLCAGDYDTIPYKNLCYVDLPIDFSNFKVN
                     GYAVGNITGANKLVQLWINSYNTSLFVIPTLDEVIIFHWLARISRPKAKSDGNLLSAG
                     IAAGLMPNSKQSSVLCSGALYFVGSAAQVDPLLDYFRKESVLFDKVYGGTYATVVEAE
                     ARVRATEWNWAIIELNGFDASEFDVTIRMNSTALPTFALPYDKSYGGGFYNSRADLYA
                     VAGFLSIQQIISEYYLKLVVGSAATGTDLPLDHYMAVAGYASFITQPLLTTADILLPL
                     IFVMAYLYPVSQFTKRIVLEKELRIREAMQIMGLGNAPIYISWYLTFFLPNFFVTIVT
                     LVVIRMTYITITNILMLFLVYYIYLITCVPLAGFYSAFFSKARLASLLTPLIYFVFAM
                     PAFAIQSANTAIITAFCIFPPTAYAVTMLGIIDHEIAGGFAAASWHDVLDTPPVYLPI
                     VMMAVDFVFFNLLMLYLDNVMPKQWGTRKHPLFFITDPVMWCFNSKHKRLEGGADGRA
                     ENGVFEDVDGDDDAVILDGLRKEYSRGGKRFVAVNNLYWGMREGEISVLLGHNGAGKT
                     TVLNMMTGMVEPDAGDCYVYGSSVRTAKADVRQQIGYCPQHNILWGELTCREHLEFFG
                     RIKGLRGWELENAVCRMLHETDLLEKMDQPAKSLSGGQKRKLSVSIAFVTCSRLIFLD
                     EPTAGMDVGARRYTWELLRRMSAHHTIFLTTHYMDEADLLGHKIGIMSHGRLKCSGSS
                     MFLKSHLGFGYSITMSLCEAASVNVISKVVHSSVDGAHEVGVSGCEVMYRLPNECVEQ
                     FPEFLDRLDAVKDELGIRGYSLSATTLEEIFLRVSNEDIEREREEDPLMQLHPDIAAA
                     QESCIWNCEIVEGRKAMLWSQFKAMMTKRMWNGMRDRKMQFFQVVCPVICILIAMLLS
                     LISLNGPDTITLNKDIYPGEVLVEMNGCDELLGPNASFDKFTVRHQKYMNALNLSTYM
                     VDTFLSQPTLRVEGLVCHDPDWANAVKAPNNVIHILNSSTYHQGPISVNSIYQALYRK
                     YTGKNAHFTLVAGTMPRTKQEKLTQDALKTILMGAIIMIPFTFLPSNVVAWVVKEREC
                     KARHLQNVSGLSFYIYWLTNFLFDMVAYIISMCLVIVIFLMFSREEYVAKDRIGAVFV
                     LFFIYGLSSTTTGYMCSFLFDEHSNAQTIVMAVSFVSGFLLVMVVYIMSLLSQTMMAA
                     DVLKWITRIVPSFAIGEGIINLAMLTQRQAIVGGVTAWSMETIGWACVYMSVEFPLFF
                     AITLFIDHPRRRMWGQRNQYDVDAAPQTVSEEDSDVEKTREDVYKEEAEGVNDDMVRV
                     VDLRKVYPNGKEAVRNVTFSVTPGEVFGFLGTNGAGKTTTISMLCQEFIPTSGKAYVC
                     GYDIVTESEQALRCIGYCPQFDACLDLLTVEEHLELYVGVRGIRYEERDVIIDALLRM
                     CELSMYRYTLSSELSGGNRRKLSVAMSLIGGPSVVFLDEPSAGMDPVARRGLWTAIEK
                     VADNSSVVLTTHHLEEVEALAHRVAIMVDGTLRCIGDKTHLKNKFGTGFEMGIRVRAD
                     DDMVNVHTWVKTQFPDATMNEFKGQRSVYTLPANVALSDVFRLLQQKKETLNITDYSV
                     SQTSIEQVFLRISGELEEATAFRHTLEDTLALSSRKSALADAANFHPVTRNLSLDRSK
                     WGYSVLRDGG"
     gene            <542425..>543516
                     /locus_tag="LMJF_11_1280"
                     /db_xref="GeneID:5649879"
     mRNA            <542425..>543516
                     /locus_tag="LMJF_11_1280"
                     /product="putative tatD related deoxyribonuclease"
                     /transcript_id="XM_001681542.1"
                     /db_xref="GeneID:5649879"
     CDS             542425..543516
                     /locus_tag="LMJF_11_1280"
                     /codon_start=1
                     /product="putative tatD related deoxyribonuclease"
                     /protein_id="XP_001681594.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649879"
                     /db_xref="GOA:Q4QGV4"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV4"
                     /translation="MFCIAPPYTSPHTTASAHLSLLLLLFSTRMMTKLPQSCASWRLI
                     DIGLNLTDHMYKGVYNGRQQHTSDIESILQRAVEVGVHGLLLTGGNLMESKAVIDMCA
                     RYNSDTLQFFCTVGCHPTRCQEFVDDPDGYLKALDDLIRKHSVHVGGCVAAVGEIGLD
                     YDRLPFCPKEIQKEYFEKQLVMAKRHRLPLFLHERNTVGDFKTLLKPHLPELVGGVVH
                     SFTGSRAELQEYLDANLYIGVNGCSLKTAENLETVRAIPLDRLMLETDAPWCELKGTH
                     ASKALLTAAAKRASSQQSVSDTILATFPTCRKDKFKEGCVVKGRNEPCAIVRVLEVVY
                     ELRREEVSSMEQLAEVVLTTTRKLFPFAA"
     gene            <545656..>551310
                     /gene="ABCA6"
                     /locus_tag="LMJF_11_1290"
                     /db_xref="GeneID:5649880"
     mRNA            <545656..>551310
                     /gene="ABCA6"
                     /locus_tag="LMJF_11_1290"
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 6"
                     /transcript_id="XM_001681543.1"
                     /db_xref="GeneID:5649880"
     CDS             545656..551310
                     /gene="ABCA6"
                     /locus_tag="LMJF_11_1290"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     A,member 6"
                     /protein_id="XP_001681595.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649880"
                     /db_xref="GOA:Q4QGV3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR026082"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV3"
                     /translation="MERTIQQKQRAWIGTVVEFVIPFLFLIGAIILWFVFGEEVHPEK
                     QVLNYTAVSSLTIPGFYREVTCNNVSMGVIPGIEDCTKVPYSYDCSGDESSLPVKGLC
                     FSETLSGARLIALYLNAILGNAVRVPPLDTMIMMQWIARKFGRDITQGVRSAALTAAG
                     MMDNTRYSAIMNSGMLYIAPRASVPASLIDYLNDTTFYFRYVYGGTFDTVEEAENHVK
                     TTPGFHWAIVEVNAFNSTDFDVVLHMNPTSLPPLTKVVDAQYPGGYHFDRSEMYTASG
                     FNSLQEALYQCYLRDLGYTDGGRIHPYSTSLGYQSYKKKKLLKTASVLVVFLLVLSFL
                     HPVSQLTKKIVLEKELRIREAMLIMGLSSTSLHLSWLVTYALQYFAVCIVMTVLMKLT
                     LVPSSDAFVLLMTLYLFAMSTIPLSGLIAAFFSKARLASMLAPLIYFVLSVPIFASSS
                     VSANVIIGMSLLSPTAFAAALTNILKLEVASGFGPNHFNSAALTPESFILYVVLAADF
                     VLYYILMLYLDAVLPKQWGTRKHPLFFITDPVMWCFNSKHKRLEGGADGRAENGVFED
                     VDGDDDAVILDGLRKEYSRGGKRFVAVNNLYWGMREGEISVLLGHNGAGKTTVLNMMT
                     GMVEPDAGDCYVYGSSVRNELEKARRQIGYCPQHNILWGELTCREHLEYYGKIKGLFG
                     GVLEDVVRMILKEVDLLDKMEYPSRALSGGQKRKLSIAVAFVGRSPLVLLDEPTAGMD
                     VGARRYTWELLRRMSAHHTIFLTTHYMDEADLLGHKIGIMSRGRMQCSGSSMFLKSRL
                     GVGYNIVISVDPEVETETIDRLVVSLIPGAEASCFNGCEIVYKLPMRDLELFPSLLES
                     LEENGEDVGVRGYSLSATTLEEVFLQIVMDEMTNHKASSGVEENEEVVQEENNAVWNC
                     EMMAGTRQRLVSQFKAMMVKRLRNARRDRKMQCFQVICPVVCVLVAMLLTLFSFTETG
                     SLRLSSEMFGETVQMQVSGCEKYFGATNNVTRQGSYITDLNFANGQDLSFYATDTAKQ
                     LTMPRYTSLFCGDPGLQYVVPFEFDATFLFYNTSAYHAGGLVLQQLYTYILQFFTNNV
                     HRTFKTGAKPMPTTMRDASVKDGVQTILMGAIIMIPFTFLPSNVVAWVVKERECKARH
                     LQNVSGLSFYIYWLTNFLFDMVVYIISMCLIIVIFLMFSRKEYVGKNTAGPAILVFLI
                     YGLCSTVSAYVVSFGFHEHSAAQSATMAVNFVAGFVLVMMVFIFSLLNSTAKISGSLR
                     WPFRLVPSYCVGESIINLAMDRQQAALNLPSNPWAMEVVGWPCVFMAIEFPIFLLATL
                     FIDHPRRRMWGQTGSYDRCAPAEVIDDEDSDVEDEREEVYQQEKRNVNMDVVRVVDLR
                     KVYPNGKVAVRNLAFSILPDEVFGFLGTNGAGKTTTISMLCQEFIPTSGNAYVCGYDI
                     VTESEQALQCIGYCPQFDATLDLLTVEEHLELYAGIRGILYEQRSKVVAGLMRLCDIT
                     EFRDTMSAQLSGGNRRKLSVALSLIGSPQVVFLDEPSAGMDPVARRGLWTAIQKVSQN
                     CSVVLTTHHLEEVEALADTVGIMADGALRCIGDKIHLKQKYGSGFELSVRVARKDVRE
                     AVQRFVGENFPAAVLNEFKGQRLVFALPQDTKLSEAFWQLQQNKSRLHITDYTVSQTS
                     IEQVFLRISEQQEERDELGKNKVVHFVKSHATPHIYNGVATKKKRLQEPIEKTVTVSS
                     AAVEAYQRRKLMAGIVDEVAGSERSDRIGRPGEEENDEADNAVRNFSTAGSQCALAHR
                     RSVNNVHGASSGRKRSAVNLVAASGGDPNAGHAKPYSNTYGPSSEGQAYTHGYDYDSS
                     SGYVDPKQYNGNGESFGYDYGYNVHTDGAAGYGQPQNPYNSY"
     gene            <554242..>554802
                     /locus_tag="LMJF_11_1300"
                     /db_xref="GeneID:5649881"
     mRNA            <554242..>554802
                     /locus_tag="LMJF_11_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681544.1"
                     /db_xref="GeneID:5649881"
     CDS             554242..554802
                     /locus_tag="LMJF_11_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681596.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649881"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV2"
                     /translation="MSSVSSPPLTDAEVRELSTAEIRLNLERCSRLLSQASLLRRLRD
                     GGEGIRHRSELFAKELERRHTVEAANGDASTRLASSTLTEALKRENEAAILSESTHNA
                     TDAAREIAQKYRDQRIDVEATVRRIYEGILSESEIQRILHSVPPRFFLTYAETCEMER
                     QLARDARKVELQKLAAQAARLSATPQ"
     gene            <555737..>556945
                     /locus_tag="LMJF_11_1310"
                     /db_xref="GeneID:5649882"
     mRNA            <555737..>556945
                     /locus_tag="LMJF_11_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681545.1"
                     /db_xref="GeneID:5649882"
     CDS             555737..556945
                     /locus_tag="LMJF_11_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681597.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649882"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV1"
                     /translation="MWSVIRRRQGLKPNEAPSRHDAPCIAHQRCILLHAVRPYVPYIS
                     PTAFSKAYGDFLYAKIRRWLLDERVHVRLHAADHLVELYKEKREHCVQSLAYDMLPIL
                     LSTLEKDESATLRERAGMALELLVREAQTQRLLLGGGSSEDAPLSTLAGKQTAPTPHL
                     AAILASLRDESDEVVVAALRVVLACHMAHNAFSVTAALVQGGLIPVLIDLIQSTNTMT
                     QMVACCATRQLFQVKEAHVELLKLGIVATLTKAIIKAEAVALVAEAAEVASLIAEYAQ
                     GRRDAVACGTLASLLPHLHNANLTLRVAVYSAAAQITVLEAAKVQAMEVGYPEQLVGE
                     LAREDERDVLMHMLRLIYNLAEWPTARVTLRECLPRIAELLQIAEGDEGVMFALSQAD
                     RILKKKVFPV"
     gene            <557780..>559114
                     /locus_tag="LMJF_11_1320"
                     /db_xref="GeneID:5649883"
     mRNA            <557780..>559114
                     /locus_tag="LMJF_11_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681546.1"
                     /db_xref="GeneID:5649883"
     CDS             557780..559114
                     /locus_tag="LMJF_11_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681598.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649883"
                     /db_xref="UniProtKB/TrEMBL:Q4QGV0"
                     /translation="MASKAGGVAPKAQAGASSLAAHEPLIIAAAFLDGVVAVSGVPVM
                     MAQAAYVSFPSGAYLVAYQLCFLVPQLIATLVAEQLTLHVSASALLLFTLMCSTGSAA
                     IVALSLSQRALSLFFASHILNGVFRHTKILFGVTAEALHMSTTDVSAAARYGMMAGML
                     LSGIAGDIMRDAVQVAQLFIGVEAVAATLVFAHLLLRSRTVVVTARASQEYAQWLPSL
                     TRAPAAVYRTVSALIAVMLAASVNQMVYPIAAPAYGLPYTFAGAHLCFSLVLQMVLMP
                     SVVEVVKRMARQWRSNVLLTGSAEDKLSVIAGLLLLAGCTVVPCASDFGPLAFYPTSL
                     LLVDLPAGVLTTLAASAVQETFGHGSGDAPKVARLLTHITQLVKMFAAPLRICTAESL
                     RGYKYPVHCISIPLMTYVLVNARTQNVAYAAAGLATTLLLLTSTVSSFEGEL"
     gene            <560461..>565776
                     /locus_tag="LMJF_11_1330"
                     /db_xref="GeneID:5649884"
     mRNA            <560461..>565776
                     /locus_tag="LMJF_11_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681547.1"
                     /db_xref="GeneID:5649884"
     CDS             560461..565776
                     /locus_tag="LMJF_11_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681599.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649884"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU9"
                     /translation="MATDTPVPSHYEGVLEKHFCPIVFLLNSHTPDNLDAATVAHLLR
                     PFFRKDDYYVVNVSSVGNPIGILREAKKSLSSEASLQAAAASLQDRLSAAVQSALTNI
                     ATTRREAQQAALQAMEAQLSALQADYMEDGLSAEEALAAAHAELQERSESEDEDSYSS
                     AGERLPPAVCVVNAPLLPAAVARLACDVASLAAVVLLDSPCSVRELVSVAGTGGRKSS
                     ASVPASNTANDRAKGRGSGAGAAASSSSSASKQHHFSATAGGSAEDLLAALGRAALAQ
                     PDDSAFQEVLLQHVPYPTESSNITGASPESPAALRPAVPAAQFLSTLHALLLRIFSCW
                     VRYDAWRARRCLVQVPAYTPLIDAEAALSAAAGEDALAAAAAAEQRPNRHKSGGPGGH
                     EDSVSLPTSAKPPTTTLHPCTMAQVAAEQFEYTACMQRWMRCPSHESTDNVLAAGEAV
                     QACLKGCLCQVASLKGSSTLRTSADTSAAQLGEDIADACARCRVAVAVSSGASLRPAK
                     DSVAAACPDKGATTCGATPVSAAASAGLTADSVEEALAHIVTEEVGSTALPSITTALI
                     TTAGDGDALHWMRDALLARDQHGWHTAVQRWGRTAVYCLHQQTDAIGAPRTQHTAHLL
                     DSPTTFPRFFREEEFLEAEGRYYAPSSLSDDTEEESDSSSEETASDSSGDDTASAAEG
                     AATKMVPAVARETPPACPTVDHVDVVSQHLRRRRVLEQVRLSHARPPVQELLGCGTPC
                     RTVVTETQWMRAADGTLVEVARTAANSAQMRCTIVDAGLHLEAGFMLDCPPSTVDDFA
                     KATAADARASGSLPEPLLASAVRGFVSLGRELRVITEVVADNAQAVAQGAYAAAVAAA
                     KEAAVTQYEAQFRRVGKTSKSRDEAKAATQLTLEQITQTLLDALPSPPPPPPPESGDG
                     KAAAARIVMRVHACFLMHDCVMTAATSKAGVPGVQLRCLTPSQHTTHLPRRRLLTVQL
                     WNEGVVSAVTVTHLQAVDVYLDGVVEVHSPDLPTGVRLLLYKNGSYVTVAGRCQLVVS
                     PDGRVTRYENGEGGRLVHKLQHGRATAVSAPAVHRVEREDGVQLEVIEPSGADDHGQA
                     SLVPCSLGHVRRIRLGTGVVVEQGDTDGMWSWRFVGLPAVYCDVTAYEIAVAIDKGEC
                     DRFAYQPRTDSFSLFVNDSKTAGARVAADVAMSSCRISVFTQGCDLSTARADQGGCTG
                     VFAVDCAYGGVYGRVGADHVYRVSPFGRCSEEVEHGGDLRYRQLVLPECYKRPKKTAE
                     VLLLPEYASPSFRRAVAGDGGDLTTVPSGDHVDALHLQALPLLLPKEPARISASTAAS
                     PYRALAVQHPATCVPLQVRCIALQEDGSQVTVLDAASWLEWVMWWQRHSTWAPQYSSP
                     TPTEALREGAPPARPFRLIRAFRARQAFVPLTEPGAENVLAEASVVQECVLLLLPSRE
                     AASAPSWCAAGGLALTSAVSGVTGAAGEEDTAAAAAVTEAAVPLDAAPVSPIVAREEE
                     QAPNAVLTDAHCVTGLPAAAGRRGGSLNYWTSALCPQALQPSRDSPSTENRVAMPTAR
                     AHAATPSADAATSEAPAPPSPAVPAAVPKKMSSSQSSQVPLMHSYHPAADELTGTNAS
                     SRFHTPLLEVHPRRVEFGNVLPLRRYVTTVRLTNASTVPCRYRVRVGAVVRPFLSVSY
                     SRQFVAPGITTEMHVELSGGQPYGVMDSEICIVHEGGTVEVSVWWCTTDEADTARLGD
                     GVTCAGWTVHKPAIQHPRVPEQETEPTDDRSTLSDTNVALDVRTA"
     gene            <566725..>568608
                     /locus_tag="LMJF_11_1340"
                     /db_xref="GeneID:5649885"
     mRNA            <566725..>568608
                     /locus_tag="LMJF_11_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681548.1"
                     /db_xref="GeneID:5649885"
     CDS             566725..568608
                     /locus_tag="LMJF_11_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681600.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649885"
                     /db_xref="GOA:Q4QGU8"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU8"
                     /translation="MAPDATGLQPGCTYRVGLLEYTLEKAWFCQFCVGILICVSNGAC
                     FCFSIFSPFMKGEGFRYSQFEIDAISTVGVLLSYFSMPTGFLYDRKGPAATLLVGTLL
                     NITGWAGMSLIFSGVLSHSPAVMAIFYGLSQLSASFYETGSILTNLRSFSCYQGRVIL
                     IQKTFMGLGSSLVAQVYIAFFEKTLSGIAPFFLFLVLYSGFAGTLGVLYLRLPTPATR
                     CVGINIEDADTRARGGGEPRMFALPFNVGTSILCFSVAFILLASLIENYVHPLSNEWR
                     VAIGLATVGLCVSFTAMIFTTPNYEVNRRRDAGDADTGGIDDKASALDASTALLPPTA
                     AKARSVAAMATEDGRCSALKDDLDACGGPMVNAAPPAGVTDLSTTTATLDPALPAQPP
                     LGPSVAGEDSQEGLGMLNDKTLWENLRHCELWLLWFVCFGAWSAMTVVSSNSTHIYQS
                     IARGSFSLTVNTVFVSIYGVASALGRILVGALYPRMAQLRIHVAALLLVAPLLNAIGL
                     LLFLVSSDRVLFVPFFVVGLAVGFSWGSTVLTVTSVFTPSNCGKHYSFLYTAGMLSPI
                     IFNMALFGPVYDHYQAKQGHEKDGFCEGVVCIAVPLVVCMVVNMFAVMSAYVFYKCIT
                     ARR"
     gene            <570975..>571577
                     /locus_tag="LMJF_11_1350"
                     /db_xref="GeneID:5649886"
     mRNA            <570975..>571577
                     /locus_tag="LMJF_11_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681549.1"
                     /db_xref="GeneID:5649886"
     CDS             570975..571577
                     /locus_tag="LMJF_11_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681601.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649886"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU7"
                     /translation="MRRSEDGKVDVAVRRCRAWSAPAAPLSHICGSRNASSVRAAAGA
                     IAGDHTHLPLPPTIYRLFPTKTVFVPVDIPFTPSLEAPCNGGRQAPCSPPAETETLEA
                     LKAELLAAKHQVRLLNTASARSFHSYAALEAENAELRDASRRLREANDELKARLAQRN
                     DEVNEQLHLICDLEKKLEEFRCFNTAARLSACKSLNGGLK"
     gene            <572423..>573733
                     /locus_tag="LMJF_11_1360"
                     /db_xref="GeneID:5649887"
     mRNA            <572423..>573733
                     /locus_tag="LMJF_11_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681550.1"
                     /db_xref="GeneID:5649887"
     CDS             572423..573733
                     /locus_tag="LMJF_11_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681602.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649887"
                     /db_xref="GOA:Q4QGU6"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU6"
                     /translation="MYDSRSSGVHDVAPRDGVDFMYEGPQQVLPGAHPLPLFHPDNSV
                     TRPPVSPYLPSPQRPHPYFTTELPELPHFQTTRPIVYTVGTMKQRIVAPVFDLANNVT
                     HTRELDPFIFGFYPETEEMAKNLSYWLVRCQNFSSKWDYENREIWRKAKKNWPNTGMG
                     MARVGDRKNHAHPWGAHSKPVKPWNLLMPTMDVKTWSKSNRMLVTLKMLQGKLQIVER
                     LTLPEPTQEAYLQLCRTMGWDVRHKGGGALFMDGGSRLTPSSEYDRAFFFGSFFNGRN
                     KLVRPTLLCDEPYDYNRTSSKARTKGPKGQKNPIPINRFNAYDALTHDTLIITEGALL
                     QLEDEMYTHKLAMLPPHIRAQLPERGFLDSEVLGDVPPALQTVQMEAAARTEEAEQAM
                     YAPYYDNPYHPWQDEGEASYAVDAVEGTVQRYIKSRKTSWAMLS"
     gene            <575850..>577706
                     /locus_tag="LMJF_11_1370"
                     /db_xref="GeneID:5649888"
     mRNA            <575850..>577706
                     /locus_tag="LMJF_11_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681551.1"
                     /db_xref="GeneID:5649888"
     CDS             575850..577706
                     /locus_tag="LMJF_11_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681603.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649888"
                     /db_xref="GOA:Q4QGU5"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU5"
                     /translation="MKALGRGPITRLANTAAPGGFAAPGAVYNRDDWNAGRDVSAEER
                     QCGILTRLCTLAATAPREAASPACGLAPLEAVIRVQSTDAHVTEVDANGGGAFLEKAP
                     KGRWRKISRSKTLLVEDTATPFSNSDKSFSPRVQSYGEYVRRIGKLPEGRPLLRFAMF
                     RDGYSLDSVCHRLRYEIGVPHDGVYLHEPPGGSFAAVTQFGVAVGVTREQLPHASRHY
                     NVHALIFDDRGYHALDELPRLSVAPQAYLHRILLRCVSGDEAAVAQRLRHLSSNGFIN
                     YFGLESFGIGSNTLFDMAAFAFRREPHRSVGAYLQTLAECSPLHHQPYLSYANAEEST
                     VAGAVAEWLRVCERAKLPRETRELLRKLHCYHLSQCHPSDATTISMEDVWKACPIMHR
                     AEQSAAAFVWNAMASQRLLSFGSRPVKGDLVCRIGNRGAIEIAEVASDTDASHYTIDD
                     VVLPIPCGGTPAAELRYPTHSVNEAFFTQFAKKHSLSFLFNSGVDPTPRAAATLGPYR
                     RLVSRPRNLQAAVLQDPSSCAALKSDLFLLQEHQPTEGWSLDYRQRVREPSNFNVSER
                     FRERMSCIRKRRAGEHSVALAFVLPAGSSPWVALREAFHMHYGTFHDFYGVS"
     gene            <578961..>580121
                     /locus_tag="LMJF_11_1380"
                     /db_xref="GeneID:5649889"
     mRNA            <578961..>580121
                     /locus_tag="LMJF_11_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681552.1"
                     /db_xref="GeneID:5649889"
     CDS             578961..580121
                     /locus_tag="LMJF_11_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681604.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.11.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.11.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649889"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU4"
                     /translation="MVQPEQHIVYAIHEYAIPGSGFLRLKAGDIIHVDEADASGWWLG
                     TNLRGQKGVFPSTYTLPYVFPPPAEDILRDMRLIVLGHRFGVDVASGAPLPLLEHCEA
                     HVCDADTPPPPLALLRKTMDERLLDREAARACVMGLLSQLMEIRAREHEERARAAQGF
                     AAEQQQVAERQAALRERRAALEASLRTLAARKAALLEACIVPTSSWYERFHSLSVEAA
                     PSSESLSCEGAWRSVLQDVKQVVKRQEEELTRLSTSCTQQEDVFARAASSLRARIEWR
                     DGNVARMLAYWADKAHAVKTAYTAAKVERDAAESRLQMQAAQLRHRLEEGRERFLKTR
                     EQYRQLKRRAEEIAVALQRKDSLEHLSRQIARADVAIATHQERQRRYRAALA"
CONTIG      join(FR796407.1:1..582573)
//
DBGET integrated database retrieval system