GenomeNet

Database: RefSeq
Entry: NC_007253
LinkDB: NC_007253
Original site: NC_007253 
LOCUS       NC_007253             675346 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 12.
ACCESSION   NC_007253 CT005251
VERSION     NC_007253.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 675346)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 675346)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796408.
            On Jun 1, 2012 this sequence version replaced NC_007253.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..675346
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="12"
     gene            <2725..>3735
                     /locus_tag="LMJF_12_0010"
                     /db_xref="GeneID:5650030"
     mRNA            <2725..>3735
                     /locus_tag="LMJF_12_0010"
                     /product="putative translation initiation factor EIF-2b
                     alpha subunit"
                     /transcript_id="XM_001681553.1"
                     /db_xref="GeneID:5650030"
     CDS             2725..3735
                     /locus_tag="LMJF_12_0010"
                     /codon_start=1
                     /product="putative translation initiation factor EIF-2b
                     alpha subunit"
                     /protein_id="XP_001681605.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650030"
                     /db_xref="GOA:Q4QGU3"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU3"
                     /translation="MCCSLLFFVYIAFSLIHTLHHLFLFSECNISADERMDVPSEDYD
                     VSIMIKAIHEVQDVLTSRQFATFSEVDTEIGKTLKRYEAFGDGFERFHVNLTKDALQS
                     NDLQKSLKDMDKRCQDRLRDCASSQKDQINDILPFIRNTSSILVHGSGNLLALTIACS
                     IQEHEGVRFYICEGRPARKGYPHGSGEQLLEKVLATPEGMRLKDKLHKYCTIVPDSGV
                     SSVMNSVDFVIMGAYCVTEHGGLVHSTGSLQIAIVAAFRNVPCYVLCETFKFAHIFPL
                     STDDLKQPENGAGEVVPLVEFVPPSMITLIFSEQGIMPPSAVADEMFRFHTAPSAPGK
                     RR"
     gene            <4151..>4798
                     /locus_tag="LMJF_12_0020"
                     /db_xref="GeneID:5649899"
     mRNA            <4151..>4798
                     /locus_tag="LMJF_12_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681554.1"
                     /db_xref="GeneID:5649899"
     CDS             4151..4798
                     /locus_tag="LMJF_12_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681606.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649899"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU2"
                     /translation="MPCNCRQGTAFHSHVGDQLASEGVFGLGVPINDAVDLSAIQLWN
                     SRNTPAEAGRLFDVSKSANQDPISSDDDQELLISAPLLSVCRIKGVSFVAPANETAPS
                     RVKIFVNLVNVAGFGSVQRLVPQEQLQLADAGGEERIVYRVNAAKFSSVSSLTFFFDE
                     SFNGAETNVLRIELFGENTGKSTQQQVATNIVYEGRGNPADHRGSEEQKSLFEVR"
     gene            <5193..>6044
                     /locus_tag="LMJF_12_0030"
                     /db_xref="GeneID:5649900"
     mRNA            <5193..>6044
                     /locus_tag="LMJF_12_0030"
                     /product="putative proteasome beta-1 subunit"
                     /transcript_id="XM_001681555.1"
                     /db_xref="GeneID:5649900"
     CDS             5193..6044
                     /locus_tag="LMJF_12_0030"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome beta-1 subunit"
                     /protein_id="XP_001681607.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649900"
                     /db_xref="GOA:Q4QGU1"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU1"
                     /translation="MLQRPDHTLLQEPSYPKDIEQKLTENGPAQAGKQLFQPEPAVID
                     PQLSEAVSLGTTILAVSYKGGVVLAADSRTSSGTYVVNRASNKLTKLTEKIYCCRSGS
                     AADTQALAERVSNYLGSYQTDIGADVNVATAANLFHKMCYVNRWNISAGIIVAGYDPI
                     NGGSVYSIPSGGSCVKLDYALGGSGSIFLYSFFDANYKPGMSKSECVAFCQRAVAHAY
                     SRDGSSGGLIRTITLDADEAEDLTVPWKRSPYCMEKDPKYQVQAVQNPPFSSSAKVTG
                     NRMSSTG"
     gene            <6678..>8081
                     /locus_tag="LMJF_12_0040"
                     /db_xref="GeneID:5649896"
     mRNA            <6678..>8081
                     /locus_tag="LMJF_12_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681556.1"
                     /db_xref="GeneID:5649896"
     CDS             6678..8081
                     /locus_tag="LMJF_12_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681608.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649896"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGU0"
                     /translation="MWEGAIPLKHERVLNGGVATRVVKKTYSHPPEIHPTNLSFNDID
                     SMYCLGNDELIKYFPEGVGGKMMQLMPPGHPRGFLYRKQSHLLNCFIDKLPFWQSKEK
                     ALRSLTNGRPGFIMDGPTGCGKSALLCQAVHYARSRDIITLYIANAKAWTHGEWCWPS
                     TILPGFFDAPDAAREFLRTVAEANGSLLQAWELRVTPQDLPLEQGEKQPRSLYDLCEW
                     GHRAVAPASIDRQSVCIKFFFDEIRAEKTKPIIIAVDGWNLFSHETHFRYPHPDFLRT
                     LTTLNDGLTDVDLYPQELPRIPASRLSFVRGLNKLILSKQDPNKFFITCTTRDFKPFD
                     GVSGFADVENDRFKNSLDEYAPYDPEKDSFFHPMQVENFTEYEYRAFLRFAINSGELA
                     GLGWGPMWHYSSDFERKLYKIDFMSDRNPQRVVDHYHQELVWRYEYKRTRQKQYLLAR
                     RKMWQGAEVSNPLRNGK"
     gene            <8682..>9005
                     /locus_tag="LMJF_12_0045"
                     /db_xref="GeneID:5649897"
     mRNA            <8682..>9005
                     /locus_tag="LMJF_12_0045"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681557.1"
                     /db_xref="GeneID:5649897"
     CDS             8682..9005
                     /locus_tag="LMJF_12_0045"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681609.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0045"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0045"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649897"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT9"
                     /translation="MAKRDKRRTSLVQQNFDSLKRFYAISPFAAAERATLPPVYSGVY
                     SRRAAMNSYHVVGSSRDQIVLEAMRTFTPSVCTKEVMDLYLEVAALVSLYFDTKEQLL
                     ALPDV"
     gene            <9360..>10631
                     /locus_tag="LMJF_12_0050"
                     /db_xref="GeneID:5649898"
     mRNA            <9360..>10631
                     /locus_tag="LMJF_12_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681558.1"
                     /db_xref="GeneID:5649898"
     CDS             9360..10631
                     /locus_tag="LMJF_12_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681610.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649898"
                     /db_xref="GOA:Q4QGT8"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT8"
                     /translation="MAQPKERASISSEELVVWKAAERVRKGASLPLSRVARCIASATK
                     LLKVETKVVERVCGDTIVFGPIRGHAADFANILLTKVLPNRCVRNIVFLGNYIDGAHQ
                     SLGVLFLIAALIVCSRFHIVPLIGKHEMMYPILSETFGSLRNEMLLCCTRRRQPLEQY
                     ESIMKEFFSVLPIACVVENKFFCVAGGPSSKFRTLKEIELITMTQEASNEFVLNEPMD
                     EDEERIADRSAFVASQGTELAFRYTFNAACNFLSRNKLAMLIVGMEYHMSLPDYDSFA
                     RPNHYKESIYFPGYMLGRIHPESQLPAVLSIFSAPSFCGVNRNNACIAEIAGNRLVVQ
                     ELGVYAKRPLVTPGTQDHAFSWAQPMLERAVVAIARDIIRGVIKEDAATDDDAHRKRL
                     EEVAVSKMRRMCMLLRTHNIPFPDVPKLTFR"
     gene            <11448..>12026
                     /gene="MAR1"
                     /locus_tag="LMJF_12_0060"
                     /db_xref="GeneID:5649891"
     mRNA            <11448..>12026
                     /gene="MAR1"
                     /locus_tag="LMJF_12_0060"
                     /product="ribonuclease mar1"
                     /transcript_id="XM_001681559.1"
                     /db_xref="GeneID:5649891"
     CDS             11448..12026
                     /gene="MAR1"
                     /locus_tag="LMJF_12_0060"
                     /codon_start=1
                     /product="ribonuclease mar1"
                     /protein_id="XP_001681611.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649891"
                     /db_xref="GOA:Q4QGT7"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="PDB:1XN4"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT7"
                     /translation="MSRLMPHYSKGKTAFLCVDLQEAFSKRIENFANCVFVANRLARL
                     HELVPENTKYIVTEHYPKGLGRIVPGITLPQTAHLIEKTRFSCIVPQVEELLEDVDNA
                     VVFGIEGHACILQTVADLLDMNKRVFLPKDGLGSQKKTDFKAAMKLMGSWSPNCEITT
                     SESILLQMTKDAMDPNFKKISKLLKEEPPIPL"
     gene            <12784..>14646
                     /locus_tag="LMJF_12_0070"
                     /db_xref="GeneID:5649892"
     mRNA            <12784..>14646
                     /locus_tag="LMJF_12_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681560.1"
                     /db_xref="GeneID:5649892"
     CDS             12784..14646
                     /locus_tag="LMJF_12_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681612.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649892"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT6"
                     /translation="MHTHTPFTSFSSFSPPFVSAPLSSPIAHDLAHHGAGLLRQPQVL
                     RMSGEFSLLQHLGVTVDKCDSSADLTPPTHSAKAAFRVWAPTQHPPSKCGTAEETCGV
                     LEKKRKGAHPSYADPTGEVLLRRKNGVEVQYIVYNSKIPSVYGVNKQLAKKMEREREE
                     NSPLFKYPLAVGEGEAGQEEARRVLLQELRRCNQEQARMRKEEGLRERARRLAHERAV
                     VQYKAGETAREAEDARRHKIMDGEAVSETAAKALTLREERRADANVDARVVASGWNGK
                     EEDDRRRLAAAERTRQLAEENFRAAEQRRAERKAQEQEARERARVERMELQRQLAQER
                     VKDLEGHRRNAEALRGAQDSARERRWRANSADVHLQAMPSWSLFDAVERRQRDEAMRA
                     QQKRMEDTAVNVRLAAQKRADAQAERDRDRQYAAEYAKAELENFQREVEHARQRRQQE
                     RQELQDAAEATAKVRQAHADAARRREQSVVPLLFWPAAQSPGAEKAKIDANRRFREDL
                     RRQAEQKRDERAQEEEAERARDRALVEYDTRLAREAVERERKEMREKAEHLRRTLEAQ
                     IAEKRKGAVGDRHACAAADVTHVPATEAMRLYRCPVTGELLPASAYDFGVQRRR"
     gene            <15393..>15665
                     /locus_tag="LMJF_12_0075"
                     /db_xref="GeneID:12980856"
     mRNA            <15393..>15665
                     /locus_tag="LMJF_12_0075"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721738.1"
                     /db_xref="GeneID:12980856"
     CDS             15393..15665
                     /locus_tag="LMJF_12_0075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0075"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0075"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12980856"
                     /db_xref="UniProtKB/TrEMBL:E9ACR2"
                     /translation="MDLCGTDVVPFQGVRLGTTPTEDLYLTTLEKKLLRMSAMEQLRA
                     CCFADPQLPTARNGGEQLFLWSVLRESARVFASLMLLLCLVVHLLN"
     gene            <16159..>16776
                     /locus_tag="LMJF_12_0080"
                     /db_xref="GeneID:5649893"
     mRNA            <16159..>16776
                     /locus_tag="LMJF_12_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681561.1"
                     /db_xref="GeneID:5649893"
     CDS             16159..16776
                     /locus_tag="LMJF_12_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681613.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649893"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT5"
                     /translation="MQSVLPYTTNPAQIGSIEKLKLINPSSAAATGPYVNVRDPKLVV
                     GGLLHNWDAEAAHALLNAPKSVQTWDLSWTEDETNWEERVHRCTYPEEVEDLLPAKWI
                     GYRVQSDVDETLARVCKLCTALVDRLVSLSQGNNANVSTAKWRQRQALYDRLGAVMEL
                     LEASVGEAIPILKLKDPEFIQNCWRQMQDDERVEIISVLGTKEYD"
     gene            <17080..>18786
                     /locus_tag="LMJF_12_0090"
                     /db_xref="GeneID:5649894"
     mRNA            <17080..>18786
                     /locus_tag="LMJF_12_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681562.1"
                     /db_xref="GeneID:5649894"
     CDS             17080..18786
                     /locus_tag="LMJF_12_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681614.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649894"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT4"
                     /translation="MMYSRLFHESLGIVIISPSRSSASPALVIADAFYSAMRLQVMLA
                     MPFVQPRFASIFRLLLRAVPLLPPFMATFTFRRCTSDLSRRSAMRCFTARLQLLTFET
                     LLCGSHGVLPPPARLAAACARAKEEFALQCSTSAPPPTKLTTAVVATHLLHNNLRDAA
                     AVLASHPCQQQVLEEVRDYVRQHPGVFSVSTLTGMLEEARCVSPAAVATFLRAAVDEF
                     LRGSSAASTVGDEATAWDAQRENLRSLVLRHIRFYPACVSFLLGSLCAVSRGCAGDRE
                     DVIEVMQIAMRERSMNPRDFGGVLDVVWKSREPRRVAMMWAWMQHTSACWDVRAASIA
                     IMAFSELHQMDEAVACIQRLAEADGDPTIDAQVAFVRFLGVRTPSLLRYAAQLVLHWH
                     PSGERLWRGEPQAVGMELVKICCACGERKWAVEMLEQMVATNASVPAELEAFMLRPGA
                     AALGEHYSASVAASKTLQELFIDVPLRLPNLGEQPALVGLLLSLGMVTNRLPEVYDAL
                     EKASLTPANFQDALDCFVTGSVVKAASPVAVLACVREAGVRTGHKVPKEMESWLQLAT
                     EM"
     gene            <22922..>23749
                     /locus_tag="LMJF_12_0100"
                     /db_xref="GeneID:5649895"
     mRNA            <22922..>23749
                     /locus_tag="LMJF_12_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681563.1"
                     /db_xref="GeneID:5649895"
     CDS             22922..23749
                     /locus_tag="LMJF_12_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681615.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649895"
                     /db_xref="GOA:Q4QGT3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="InterPro:IPR018144"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT3"
                     /translation="MLQRLQLFRSTLVNFLEWRNFSDVVHGCYVRVLLEMRSTEENRR
                     ESPDNYYIALVKGAQRGPVYSGFSADAVTTEWHIVIELPPCFRSTQNGNVVQLNSISN
                     SPFRQAEYQNWVDMTNETRELSFPSLPQLQFRLGMLEEHKQQALTPEPRRHRNGEDAE
                     AAALREWALEEKRKRITEEIMVTHVKLRRIDQLKALSLEDLQEVEREILDLITGVRIS
                     INERSKCMLCHNRICTEICYPCKHQVLCKDCAKSIRGRCPAPKCKTPVQYTFEAFTS"
     gene            <25800..>28232
                     /locus_tag="LMJF_12_0110"
                     /db_xref="GeneID:5649901"
     mRNA            <25800..>28232
                     /locus_tag="LMJF_12_0110"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681564.1"
                     /db_xref="GeneID:5649901"
     CDS             25800..28232
                     /locus_tag="LMJF_12_0110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681616.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649901"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT2"
                     /translation="MAVHRCHLLEEMLNEQAKQAEKLRNELREQQEENKLLTHEKESL
                     KATIARMEIEAEVAAAAAAAAATTASAVTPVHSRAATSLKADAEMHVNASTSAESVAV
                     MEELMTKKKRQLDMREATLKDALKKVSADAAKIADQRAALQEQEKVMTAQLTAQFTSL
                     FEEERQRLEDFCADAVTDVQNKYMEWVAQQQVGALERRRRYEQVMEERQQRAAVELAE
                     ARAERDALQRALENQRAQLAKLQESGSKERMGRRSDEKRDALSSQCAREVKASLEEAV
                     AGGAALAAAAAKGQFHALQTEPVSTQHLGEEERQTSTDAAAAHAALGPKAQDSMETLV
                     RDMRAKEEEWAKATAAAVATAESAARLAERERLMQEVEKARQQSRCEAEEAVRVATQQ
                     RDSAMDALRKQHEHDKEEWLSNMRRLEASQRRKEECRQSQEKSWREEKVALQQKCSAL
                     EERLETRKAAAWQLQQQLRDATQELYNLKANTGGKEDAAAEERRTRANAAAMAAQRWA
                     SAFLEEAQQGQQLMLEEQARALALLKDEMQKWALANSAAANARDERQREATQRLHTEL
                     ESARQERDTALEQLGRMRETAADMTTRMSEESAELGTLRGAIQRQQRALAELQEQHQR
                     TVDELYATRAAVVAANTAADVAAPLAESPARAMPAVDGTCYHVLLRLEQCWVLQQANL
                     QSFYSVALYAVVQQEWTQVFESMTSSLAAEAERQRRLSIRNAEALENTTSTIKEVQDD
                     LRLRTQELLQRQVDVEEHERRVQDKKKRVDVLCRSLYTVAQELRKMHLDAAESSTLDE
                     VINSARVMSDSP"
     gene            <29642..>33538
                     /locus_tag="LMJF_12_0120"
                     /db_xref="GeneID:5649902"
     mRNA            <29642..>33538
                     /locus_tag="LMJF_12_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681565.1"
                     /db_xref="GeneID:5649902"
     CDS             29642..33538
                     /locus_tag="LMJF_12_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681617.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649902"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT1"
                     /translation="MRELIELRAELASERDRRHETLIAMGRQWKEDVLVEVHRRGAAL
                     QSDVSAVEEKMTVQWKESNEGRLVMRRQLEEAMRADKIRDTNQFQLREEVQETARQLE
                     ERVDMALAQSSAARADCSRQLEQERATLSQRLDAELLRLVEMRRDDQRALQQARELMR
                     DEGLRVRDDIRRVVQEVWETSASALVKTATEPIEQLRAELRQTKAAAQAMEERVAGCV
                     QTCQAECRTVMTTTTERLRALESKEAVAISSIDRAERKADSAYETARHMEAMIAAAKD
                     ATERALVQVAGAAERTLKVEHALTDRDSRLVAVEAQLHAIATAEGLRAEVEACKRQAG
                     RLESRVEAAGALCTRVEQLADRAAQQVASFADRIESCERSTQRSADAVQRVQDGLEAC
                     ESEGHQMRTRFETSEAVLQRHTHLLAQLEQQISGQENRLGLWRQQQEQHVKDQMTVQR
                     ELTERAEVTHTVASRAQQVSSDARAEVHRLERRIDDVDRRLTSTSAEMSTLRGCIDSQ
                     HTQALEAQRQQQQVVDELRSVASEMDERMAPVKDLVRNSAERMERAEAQAHGLGKKLA
                     QCEERLHEMGARVQDYLKDAVRHHVGEAQKRLFAAVNEGVSRVTEQVAAVEEAADLSQ
                     QRVADMSQKLAAMQQASAKLQHHVQSLEASLQSLSGQTEKLAVHADTQAGDRQRLGTV
                     QKELMCLTAMQQRTQQDVRLLQEAIRVLQAMATGGSMRDFSLSELGTSQARTASTEMA
                     PAADAISSSPSAHHPSGSGVRTSSHALAAGEHSQPPAQRAAAAAAPPLANTSGASLQE
                     LQDRQRASSGSRSSSSKEGSEERPALHLSGVSSVRPSNGQEERLHSLVEAGDASTASA
                     DGDNTVEAFTARPEAVARLPRTSDGTNGSASVPLFATTRTETVEQLSAPAHDSTQASA
                     VGNVSHCTAIREFTTITSSSSLSDSDSSEDDRRRVQEREAPTRRGAPSQERTDDVSSD
                     LTTAIMLTSEASAKQSSQRGSRPPPSSGQQLAAKMSTAWRQCSSGSSEEGTPAARRAA
                     LGSAPPPQSQYPTGVSESESESVSQGAGALEDSDDRVQAMSRHDSDTEEVERAVTAEE
                     AVAGVAHLQPTCASQTAATTYLARSPGNPNWNDWDEDGEEDDDAKKCRGNSAEDDEAL
                     EPPPARPHAGRHAASAASEDDTDDAVVRFQDAESSSDTPGPRETGVTTSAAGLAATVM
                     HRRQDAADDLRATPRRMFVSTSDDGRGVGTQRQAAQLPDSVPRHGRGTTSSSSSSAER
                     AEALGLRGARQSQPQRAATQMRQYTNFDDSTSSDDD"
     gene            <37431..>39182
                     /locus_tag="LMJF_12_0130"
                     /db_xref="GeneID:5649903"
     mRNA            <37431..>39182
                     /locus_tag="LMJF_12_0130"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681566.1"
                     /db_xref="GeneID:5649903"
     CDS             37431..39182
                     /locus_tag="LMJF_12_0130"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681618.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649903"
                     /db_xref="GOA:Q4QGT0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QGT0"
                     /translation="MGDHLGSRFTVIEQIGSGNYGSLYRVIDGEAATLADRIIATKKL
                     QDTINHPHVLREVSAQRHAQKCSPHIVKLLHVVPRDRVRAALVLEYVPLDLRTFLNAF
                     YCNQAKSSAPTWCATAGADELKSAAAPPCHIPLIYVRRMLRGLIEALHCLHARGIAHR
                     DVKPENILVEPLGLGHPLRCVCPPMGSFGPAGEAAGCWVHAPHCPDPRQEERGVTRPM
                     QPQGTLEPCQFFRRYSVALHHELTGDELASAIHRLHCETCRPCPCARAGAGKHAPQQH
                     RDSSEMKTGNSCAQERQADAVDEESPANVDDGEADKLTAPMSPPLMPDVKLCDFGSAR
                     HIGTLRLRSAEEQREELTPGPTTPVYCAPEMMLLQRYGTSVDMWAVGAILFEMLTGEF
                     FLGVGTLRSFSGDVVVRDDYCVMHRLNRMFRHLGTPSVEEWRCIAHPHYYPDEMLAHL
                     PQVRDAALFRCLAQPIDTDGSFRRDSGDIKSNGDAKTADVQTDLNVRPSAGTCSCAQA
                     PVNGTTDSHAARASAPPRDATAARHPLNVSDFLYQHIGESGVDFLRSLLRYDPAKRMT
                     SAEALRHPFLSPEVANM"
     gene            <42149..>43531
                     /locus_tag="LMJF_12_0140"
                     /db_xref="GeneID:5649904"
     mRNA            <42149..>43531
                     /locus_tag="LMJF_12_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681567.1"
                     /db_xref="GeneID:5649904"
     CDS             42149..43531
                     /locus_tag="LMJF_12_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681619.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649904"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS9"
                     /translation="MSYSTLALCTCVLYAPHAVLCGLGLLWQPMLVVMSILAAFIAFL
                     PLVMTGLVFQALRWAGVADVATAAWVVVIHFIGQNASRVGTLHVCLRLQRLGWQHGWL
                     LVRSRFPLVPLSIAVGAGFAAASLLVGSGALLAEALEVGRALTGSGRASSTSTVAAQG
                     IDFHASSGNCARLSRLLQSCFQQTFFSCGQVAWTVMMGQAYAALWPQDVAENLRKHTA
                     RANGADETATLGAVTTTWAEEGDSAPMPHAPRAEESVREDTCELLLVDEVVVPVAGDD
                     EPETAVHSVRREHASTAARPIPREEAEASQRVAYSAICFERSGAGAVAGVAPSAGSSI
                     SEATRSSTSAKRQDMSSSPSSSAEVAGWLVADSVFAQRLPAAVLTGVAALVLHMVFAL
                     LPVAAMAADSASAQSKETSSSVRRSEGCLVNTSLQCVVTMVSVLWGLCIVELERHPFT
                     YALLSSYPGS"
     gene            <45919..>48996
                     /locus_tag="LMJF_12_0150"
                     /db_xref="GeneID:5649905"
     mRNA            <45919..>48996
                     /locus_tag="LMJF_12_0150"
                     /product="putative leucine-rich repeat protein"
                     /transcript_id="XM_001681568.1"
                     /db_xref="GeneID:5649905"
     CDS             45919..48996
                     /locus_tag="LMJF_12_0150"
                     /codon_start=1
                     /product="putative leucine-rich repeat protein"
                     /protein_id="XP_001681620.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649905"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS8"
                     /translation="MSTSQASLVAPRSSPLQCYAHVSFLDLTHNALTSIAGIDALRCL
                     RSLRLAFNRLTSLAPLWASPSVAQLDVLDVSSNALTELLSAEDVHALKGHQIRIVTHP
                     TQAHSTAHGCPNAKRGVYKTMRLRVLYASDNQFCEVPSAIYTFTQLTDLRLSKNVIES
                     VPDGFPVRACLPKLTRLDLSMNKLPAAIVEAVTTRAEEAAESPLHRRRASAHRSRGDT
                     DPSAGAKTAALSSSVSSAFKAGDGASSEEAGRDAVHGAECSHDIQSRVAGGVNENGRA
                     AAEEGDGVSAVNGSGQRRSSSSAAKVADDAESNGSRGTLLQVKEDAAVSPRPPTKTRH
                     ESASATASSPSKRKATASLPPTTPAIATVSAQKSQQQDAVQCVAENVYSIDLSLWAAV
                     VRRRLEEVLQRLSDSDASGATGAASTCSMHELLVSLSDTLGGNNGGGGATALPRYRRR
                     PAATARTMAAFLQCLPSCSLSYSEEAQGRCPPLLLLTGISAAVAADESELLLYEVLAL
                     HIVHNCLCTAKSAPGGVSPPYAASTASTVALNAAELILQQACKYENSSEPLHRTEAPA
                     ADRASGGELPPLRPGSPGGGRGGGTSRQLNFAVPLQAVHVIACTGAAATPHSSTSALW
                     AYLTWRQRWEAAVSRRRFPNKSDYVCELGKQAADEPAPHSLSSNTPSPTAEANGSDTH
                     AAPHCAAAVPLYPFAANSPVPRTREGGVLHEYRPASYCAVPPAWELLYDLLLRPSAPE
                     KTALKRPHVPAVPPLLAGVGSRVQHLRGTPVSLACALLCAVDYSGCAGASTMCASPTL
                     PVLRWPTPGTGGPTASGASNGTSAITAFHAPCEGVIRRALQWRQHSQQLWSNVEREAD
                     IVAAEQVTSCSMPLYSAEEVLQSQQAAVAALISPDAHDSCLRCEVSGEEGVSEEAPQT
                     QLGSLASAKPLSQLRRSDSSAAASCSAETCESETATATDRIMWCCESEGSSRPAVAAG
                     ANGGCTPAAAADAVGSEADGLGGVEEQDAADAVARLDAAPNGNAATATAAQSL"
     gene            <49885..>52353
                     /gene="ALG9"
                     /locus_tag="LMJF_12_0160"
                     /db_xref="GeneID:5649906"
     mRNA            <49885..>52353
                     /gene="ALG9"
                     /locus_tag="LMJF_12_0160"
                     /product="Asparagine-linked glycosylation protein 9"
                     /transcript_id="XM_001681569.1"
                     /db_xref="GeneID:5649906"
     CDS             49885..52353
                     /gene="ALG9"
                     /locus_tag="LMJF_12_0160"
                     /EC_number="2.4.1.131"
                     /codon_start=1
                     /product="Asparagine-linked glycosylation protein 9"
                     /protein_id="XP_001681621.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649906"
                     /db_xref="GOA:Q4QGS7"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS7"
                     /translation="MHQRITCYLKMAAAFLLLSLTHYFASSFLPISDCDETFNFIEPI
                     HYLLYGSGKQTWEVCSRFALRSWLFLWIHAWPVVLIRGAASLSSVRVYFYLRMLNGCA
                     AALAELFFVCSVWFTLSGKAAAVALLLLLANYPIQHAAVSVLPTSFAMMCNFVVLGSW
                     LRTQSWTSSSALLSRVGDRPTQNTMPAAAAGTAQLSMMVPPSPSSAPTLHSSSASPPS
                     APPRHLCWFIGAALCFSVLAVVTGWPFAALISALVGLDLLLRFPVRTLACTLGSLLVA
                     CAAVFVADVRYYCRWTLSSWNVVMYNGFGGSGRGPELFGVEPIFFFWKNLMLNFHLMF
                     VVVLLAPVVLLCAPRRELAATSALSDAVGGGRPPGDGSAEGPSDSAVSPTYSLVRSRR
                     RTSGTHRDAAGLHSSPLANRHPRGPLPAATTAAVGSRLSRERELLHIMPFFVWFLFWM
                     SIAHKEERFMSPAYPFMLLAATRTLCLMFFPDAADDQPNSAAATPKREKITPDVVAVP
                     TADAQGTALTCQPPRRPSVPLQGCPSPAFLGWRHLAGLAFFLAFFLLSCSRAMAVYFF
                     YSGPERMFYDWYPLLQAEAQRAWEAKRQAVRGGASPSSLPPGTTAQQTQELRAYYTVC
                     LGREWYRFPSSFFIDHRYARYQFLDTPYFHGMLPMSFVTPPPGQESGFLRAPSSEAAT
                     ATGPSPSKSSSTVDRSSCSCGAPSVNDWNEEIPEQYVRYPSEQCDVIFDSLPPPTRVG
                     AAHHSNERKRLQLDTVFTRSLLNISSLQAVRRADGKTCCAVKDAYAVLDVDLTPLWCR
                     VLYYPFGVTRRCAVWRPLVMNAKP"
     gene            <54029..>55231
                     /locus_tag="LMJF_12_0170"
                     /db_xref="GeneID:5649907"
     mRNA            <54029..>55231
                     /locus_tag="LMJF_12_0170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681570.1"
                     /db_xref="GeneID:5649907"
     CDS             54029..55231
                     /locus_tag="LMJF_12_0170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681622.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649907"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS6"
                     /translation="MYLHVMKVACTPDERHCENSVNPSSSSTLPSATTSSSCPVEHGV
                     PDEESRFTRLYEAAVENESALRVGNYTRRLLFDEFCATSDATRQASQPTCRMLRQRHP
                     ALRSLSLSVEGMHSAGADRTSATQLPADSTMSAAESLQAYLSPALSAWRCASQEPFAS
                     SAQVAAAAPLPTSAVASDVRPRSPLPLHIDESDAPVDEGAHGEGLEALYMDVFDQEGP
                     ANNHEVAVNAAYTREREAADRAALLSAQQATMAGCPCGFTARGSTPSADVSLSNASSL
                     LPEEDDISLVLQPVLGGVAQRRGRGIRVHLESEPSVTTSSSMVDASFLQAGRETTTLT
                     CAVCELSGVVGDPHRTCIDAVELQEEDELHPCGTCGALVHSYCACPGTTADTHYCCNP
                     CCPGGGTV"
     gene            <55914..>58643
                     /locus_tag="LMJF_12_0180"
                     /db_xref="GeneID:5649908"
     mRNA            <55914..>58643
                     /locus_tag="LMJF_12_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681571.1"
                     /db_xref="GeneID:5649908"
     CDS             55914..58643
                     /locus_tag="LMJF_12_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681623.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649908"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS5"
                     /translation="MSDVLGYLNGVLHRVSATFMPTEMDDVASFLRGDAWVVATAASA
                     SAQQTAQTFSTAATDLSCGVARPTTVSYPLGATRWGRFIPLGIAGTTLVSAATSGSRA
                     VLLDFFESNGFEQVFTVSLVPTEQQQQQQSHVRLAAPGTMEGAGSSGDTALSRDGHCH
                     ADLWRTQRRFSFSPSDTGDTTASRKRARSNAASSVAIDMSLDSRYSTAAEAARHACMA
                     AARRWFEGVEERALLDADEPREGGDGGARRNHKTRLRRLLLIVRCCTDNRVAFSTRGG
                     ATGAAQVSSSGTGRRHRRGKDPLYLLLHDLAALTTLYEVRLAPTCCAARPAVLLLPED
                     DSYGGSMLRQQLREEVGHRYWVELFLQSDGASSGVPARHGEAGAADAGRGARKGDGWR
                     TTLIGCSSGASGAPGGLGSVLRQRQHEQAETPLERGCRLAAQWGVLDLSAAMRSAQQS
                     TGGEALRCSAASAFASVGVPAGGSASGHAPSSSASGPRPTGPMSAQQREEGLRRHASC
                     FFLRPSNAPLCVFLMEALRRFPVLVRPPVLQHWQSTWTARHSLMDVLLVFHTALCPFV
                     LSSSSVGVTAACQAPPPPSWMRGGTPFPASTMLQDTTDLLDALLCAAFALAEERDAAQ
                     PLSVNDFVIEQATLFLLLYEALVHQREGRLRRIPGVVRVLLGLSDRCASAAAKSCAVD
                     EAAACLPRGGATTDEKVHHAVRHLLPFAPLNLFYERVAQLGAASRKGHDSRREVQPYP
                     MNSIALPIRRMSLAPQLQHSTLLALLPLGESVWELQGVAARVWREELPARWQRVVEAV
                     GTRDDHPRAHPSSAALRGTNDDAGASAPTQLSAGNFYHPLVPHAVRVLYLLTAHALRA
                     PTEAAKQVPLVQLQMICQLSDEQLLLVLKELQVAGLASTNLKTKSARTLLDTV"
     gene            <59661..>64532
                     /locus_tag="LMJF_12_0190"
                     /db_xref="GeneID:5649909"
     mRNA            <59661..>64532
                     /locus_tag="LMJF_12_0190"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001681572.1"
                     /db_xref="GeneID:5649909"
     CDS             59661..64532
                     /locus_tag="LMJF_12_0190"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001681624.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649909"
                     /db_xref="GOA:Q4QGS4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS4"
                     /translation="MAKLQQKHASAVAAEAQAQSETTVVQQGPVPPLDDPVEFILDRV
                     DSIERWRSTVARLNLAQLGVSLVRGVLRRGRWSTPPMHVFDAAEKAAPATDAAEAEES
                     VQPFYPSQPVPPWLYPRTSFETGQAATQVAEQDEAAQTLARDVASPVPGQAAHHPPDH
                     HPRAHPSMQPSVARRALVQTASRASVPLYMGMLMAFIGHGVASMYSADTDTGPLGASG
                     AAAGQSVQTPAPASSAVAGGLPTSSRHLHFTTEMNSALHEVHRAAAEVMCMVDHGSKE
                     MHALATAALWSAGKARAYRTDEYERVQDMRHAQLGRSCRHLSRIVANLYSLVSLLDFF
                     AVESASLPTPTPRTSAASGAGHSNMNSANAGFLSTSSASEVAAVAMEEQGAQTTTVAP
                     YADSSTPSATLTSSAMKKPVANAAAPAHPYTTERFHKLFDASGHLPQSVWRVFSAVAT
                     TLSQFAVSWSLTTGDAQSRQAFNSAACVILGEDQRCLLLQLHRLCARFIVLRHRVYTL
                     HPVNSLHFKVKQMLEWGGFLNADVPDAWSYNNGDIDRCDLHSDRLHSTYARGLQWSVN
                     SSNKTALQAVVASPYAIAARDSALRRMKESSAFSPGGSAVGGGGAVSTAIDRGASAPL
                     SLIASLASAGVNGGANAAFAGLLAAPLSSASAAPTQSSSVAALSQLSGVPGYVGLRNN
                     GNMCFLNSVVQLLGSATLFRDDLMARLQDAVFCDSAHADHRAPAADATAMAALFAKYG
                     CRLVMALLLGEMQWRGSHQHSRLPVLPDYLTPHLPPPFDDHRQHDASEFWHALMDKLD
                     APNQPGGAVVARWFSGRTATTMKCVTCRHTRLHTDTFWDLSIPLRATSAPSVAASVGG
                     GAPTPPGAPVAAADRLVSQVEVQHFARATAVTTTYASSPASGFPANTSTTADATAELE
                     AAERAEEEAAESVSNKTALTLRPIVPSSVAEPYSTTPLPSSTVAADEAPKTLQHLLLH
                     VLHPTLNKELLHGSNALDCEHCGRRTDTELTTRLVAKVEGEAEVGVDTAAAGAPVECF
                     GAVQEARVSSGGGAASAAWESLLEGEPPTPCAADKRASPHGESMCVEQGLALSHSLTD
                     TAAGGGLPYYLAVQLNRFAYRRVTQSYEKVTDGVPLNEVIVVPVYPEITEPKDGAASP
                     VDSQEFNAQTAMSNEEDGAANTRREDDGRHGAPSTRTPTAPRSAAAALPVWVAYRLQS
                     IIIHSGSTPSSGHYFALTRRLAAVPAHVNVNESSHDEDGEHNVSAAADMPSMRAYVKG
                     QGAALTACLGTERHFSYAEIVQPTACADVEGAGPQSQGRPAVASLSRSTAGTVQSPAP
                     SPPPVLPAAAVSVSGDRLYKNWVMLNDTNVQTVEPDTMRHLLHGRGGGVYSVSETPYI
                     ILYEKLPVASEGATERDFLLEDEEAKGRRVADAALSAAAKLQRVWETNDASVGASGVT
                     SVGGTSTKPVHFAREVLQIFSARLKDEVAHDAALSEAPRTTDGHGVTSITSSAARSRP
                     TPVGTVPHQGPSATAWRATVNRSSWSRATGVGDAARAAAVKASLTDASKDTPACFTGS
                     GSLGRPSVSHRPRRLMSTAKYAKVPRSKCYSGNLNRHSAQEHRHRGGTAARSSSGSDA
                     GSDADDEQDEPPS"
     gene            <67484..>70717
                     /locus_tag="LMJF_12_0200"
                     /db_xref="GeneID:5649910"
     mRNA            <67484..>70717
                     /locus_tag="LMJF_12_0200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681573.1"
                     /db_xref="GeneID:5649910"
     CDS             67484..70717
                     /locus_tag="LMJF_12_0200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681625.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649910"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS3"
                     /translation="MPLTQSPSHTPPASGSDGDRKDEVAKTCMAPERTSRVRTCSSLR
                     SGSGATVDLGTSAATSEVVSRDGEAECGDVESHIVSGTHDHALLLPRLSSSINIIGLT
                     SSLLRRHLSSFFSGDGSTRTAARCDASSSMAAPDLTSSFSQAATMAKPEVNGKPLKRP
                     LGYSIYSTAAGASALTPSCSSAQGRSGSSVSHRFYRAYSLFWADAAASLAVSSTLLRD
                     PTRRVSAPLPLRSSTRVGHEDAPDASIEAVVAPAEEEDRSVLTRATAAASSVPRARKA
                     ARDGGTDAIPHRRIASAEPNRCSTFTEVTAKQAPTLSVSGFAGSSSALAFGCTPPDDV
                     SRREASAQHVGEGASSSSNVRFFSSTAIPGMLHALHAVPGAEQHRCLPESTDDAGDSH
                     HSRGCSSDSKPRDASHEYVAKERRPSCYQSNDFHGAARSRGGDIECITMSSLVAHVAV
                     PPTVQAVLRNSDATKEELWMALRTACQQCEVLQRRLARAEGALGNEEEGEWAEGEVGV
                     TAEGGALAHVTAHRRSRGDAGRTSTRPSRRHADDEERTAPNAGGAVEGTGEAEKSTAC
                     EQADSAQTRCSTAPPTPTRTNRQVHPGHRAWRRIAELAAAAAVASWTPPLLLSAQSDG
                     STNAADLDPHSGRGGDTGDASSVLRHRVSEAIRRIETKETAPLRSPHTRPDSSGWDGL
                     TSSRDADDTTQNSSDHLRISLSPPPQPEAHGSWHSTSSSDLQASGARHVRAQHDAPPT
                     PAPTLRLATHDPPGPTRMESGSLSSGSDAGAAPLHASSNEAVDSGGETASPGGSGILV
                     PPTLPAIAGVEAQASVAQESYNSAERMRLAQPPQQQLHRRHRGASLVSLYSAPAVLDE
                     SVHFNGPAAAAESLATLQAAAAFKSASWPSNGLQSSYNASRSAGFHSRSPLAFGSPTL
                     PNATQHRSGWTASTGANGASTAVIASLVTPLSGTLPSLHSSALFGSSAPPRSPLRRET
                     SMSSAESAWSRQQQQHAAAKATPSRAAAARISAEASQQRSLSSTRSCSPDKAALSVAS
                     ATLKMIRQLQQEDAPVPPVTDDDQKAALRQWRREAAVKKGSGSAPMC"
     gene            <72525..>73760
                     /locus_tag="LMJF_12_0210"
                     /db_xref="GeneID:5649911"
     mRNA            <72525..>73760
                     /locus_tag="LMJF_12_0210"
                     /product="putative proteasome regulatory ATPase
                     subunittcc1l8.3"
                     /transcript_id="XM_001681574.1"
                     /db_xref="GeneID:5649911"
     CDS             72525..73760
                     /locus_tag="LMJF_12_0210"
                     /codon_start=1
                     /product="putative proteasome regulatory ATPase
                     subunittcc1l8.3"
                     /protein_id="XP_001681626.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649911"
                     /db_xref="GOA:Q4QGS2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS2"
                     /translation="MAASSVASVSATKASALAAKKAEKDAHDSRSLFEEYEQLSKDIK
                     NIQLKTMICRTETHQLMKEESAAKQEVKRIQAVPLVLGNFVEVVDSVRGIVSGTSGSQ
                     YFVRILSTLNKEHLKPNVSVGLHKSSNACVQLLPSETDATITLLNSSDRPDVTYSDVG
                     GLDMQKQEIREAVELPLTHAGLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVARHTKAS
                     FIRVVGSEFVQKFLGEGPRKVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADRE
                     VQRVLVELLTQMDGFDQTTNVKVIMATNRWDTLDPALLRPGRLDRKIEFPYPDRRQKR
                     LVFQVCTSKMNLSPEVDLEDYVTRPEKLSGADIQSICQEAGMLAVRKNRYVILPRDIE
                     NAYRTVIKKTGDETYDFYS"
     gene            <74559..>75446
                     /locus_tag="LMJF_12_0220"
                     /db_xref="GeneID:5649912"
     mRNA            <74559..>75446
                     /locus_tag="LMJF_12_0220"
                     /product="putative hydroxyacylglutathione hydrolase"
                     /transcript_id="XM_001681575.1"
                     /db_xref="GeneID:5649912"
     CDS             74559..75446
                     /locus_tag="LMJF_12_0220"
                     /EC_number="3.1.2.6"
                     /codon_start=1
                     /product="putative hydroxyacylglutathione hydrolase"
                     /protein_id="XP_001681627.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649912"
                     /db_xref="GOA:Q4QGS1"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR017782"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS1"
                     /translation="MRNYCTKTFGSTFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNA
                     DYKPILTYIEEHLKQQGNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSMVPVM
                     VVGGANDGIPAVTKPVREGDRVQVGNLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVAL
                     FTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTAGFMT
                     FSEKTFPDRASNELAFIQAQRAKYAAAVKTGDPSVPSSLAEEKLQNLFLRVADPAFVA
                     KMNQGSAHALMMYLYNACD"
     gene            <77916..>81497
                     /locus_tag="LMJF_12_0230"
                     /db_xref="GeneID:5649913"
     mRNA            <77916..>81497
                     /locus_tag="LMJF_12_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681576.1"
                     /db_xref="GeneID:5649913"
     CDS             77916..81497
                     /locus_tag="LMJF_12_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681628.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649913"
                     /db_xref="UniProtKB/TrEMBL:Q4QGS0"
                     /translation="MQWATSSSLLPKLSNKESGDGGVKHLGSTLAAVLPVLQQQEQHR
                     VSARRRDGSVDNGAEGRDEEMRYGNSKDLGTTGCSTHDSGNGALSAAYATAAQKHALL
                     LRATITLVSEEEPLVQKVATALVNEWLDLVSVQVPTPQSRGTAADVPTTVKDEKTAFS
                     DNSAILATVGGARSAPRRRTALSGLRPSSCTDTPEQALRHRRICDARHYWLSCLLKMV
                     AYLDGVHSALREENTHIGAVLARQGIAPQDAEDTFTKSLPAIVNCALVEEVLHSAAAG
                     LPVSQARAFSAWAAPSLLASARAASTARLWMPPPALLLPFHLIGRGSVFGVWLPPSAP
                     SDGGSTGHPPAARTPTRAQGSFVPCVVDSHGLHLGMEPLCECDTHEPASKPGGEEHGA
                     GVAVLHAWKRKPVGVSAQEAASRPFHPERSPGHRRLGFAVRCAESESLLEKRYLASLE
                     HLLPILRVPDVASQLATDGSLRSDQPERQPSLRWWPCMLSETAGSPRMDVYVARTLLM
                     LPIPAQSTLDNSTDHAASATRVDSGARAGAGTVEGAHHAETRTKTLPGVLASSSAAVG
                     AGKRPRGSFNRGLTRSAEEQAVRHQHPLLYHAMRAHLRADKVLYKACRDVSENGVAEL
                     VLLYGDPRGEEAAALRRMGFTVRTGSHQRLGCSGAAFARRTASSAVSSLTGLSSGAGG
                     GSGRLTLARDALGTTLEGMYLIARRVLGLQGLFVSSASAFTTPAAVAPAEARVGGKGC
                     PSTTGAAAFEDGGGRCDLAKGTAATSAAAFPVCAQTEREALGTVAATLALTCLVLSHS
                     LLDDLLEQPSVVLLTTELASFVLDVSLLMPRPLPRLLKADGFALALLLQPAQSLLLMV
                     GLAATLVTREVRMAAASHRGGEAGSGSGGGRGRGAGGTSSASKSVAPQWHPWWSAFRA
                     AVLRDTELPRCLYSGIWSIVESAEGSLATFAAEVRRDTSGNRQADDGKRSHPSLVAGS
                     DGRGDDAVSGAPALVSGRGGARGGRRTLSLFVPSPPAAADRHLFADAQDTPSSKSRDV
                     TPHQCSVDGATPCRHRLLLKVPPAGGVAGQLSATTAVNRKDHATACGAGDVVSASQSY
                     TPRRLCGHAVLCQDDGICRAGAETSDAHAIASSSPFAEGVCVVSGNETALLGARSVHA
                     KVASPISRTPSLSLTRATLLPRLTSAVASALWASLEAEEMHWPAGAA"
     gene            <81928..>84042
                     /locus_tag="LMJF_12_0240"
                     /db_xref="GeneID:5649914"
     mRNA            <81928..>84042
                     /locus_tag="LMJF_12_0240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681577.1"
                     /db_xref="GeneID:5649914"
     CDS             81928..84042
                     /locus_tag="LMJF_12_0240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681629.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649914"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR9"
                     /translation="MVYRTLVASMAPTRHCAASVAPMCLADRMKQRCRCRLSPLLMCA
                     VLFAQLLLCSTSLPVAADPTIMPLLNITSTDKADPDEYYKILLSQDATILAGSTTALS
                     SDGVAYPNLNTVKGLRSVFQVPGAPTVQRAPKRTSTALKAFRADVLSELLVAMALLYL
                     DSTDALPFTRTAPIPSTYLPASYTGGASFVNPSFPTVPITLNMLLQHVSSLTKKGLDL
                     RAETAPSGTVPTLSDFVSSLFSTAATTVFSASQPGLSTSYTYSHANVAIVAYVVEQVL
                     ATSTNYSALSGIGEFVFTVVMPPLQLSNTFLLNRNGHVIDATYPLRSGSSHYTVNYAA
                     RQVLDNRSTDILDSAPMDALYFSDYMLFTTGADVAKLVAEVLVPGGLYHTRLGASMLQ
                     NMVPIAVPTMRYTEARTTGLFLFSANKLCSTMYAAISYSGHAPYCRYSSATVSESAPP
                     FGLVATSGTDELAIVCIPVVSNTKTFCSIAGLSFSGTGCSRCNAAAAGDRAVGLAMVS
                     LAHLTSEPMPAPTSQSTAHTFNGWFVVLGVAVTLVVVVVASYITDYLIQPPPPAKIIA
                     PVVASQMGLRSGTALNLPVGGDGAVGSSEVPVDSESPETFRKNGRDHDAEDRYSGADN
                     EEQTPHLTRSGGPARGSSSLRRRRPRRRRHRDNGEQNPASDGSYSSADDGWGENLDSV
                     DRASTGSQRPNPKGALRFDAYI"
     gene            <86495..>88849
                     /locus_tag="LMJF_12_0250"
                     /db_xref="GeneID:5649915"
     mRNA            <86495..>88849
                     /locus_tag="LMJF_12_0250"
                     /product="putative cysteinyl-tRNA synthetase"
                     /transcript_id="XM_001681578.1"
                     /db_xref="GeneID:5649915"
     CDS             86495..88849
                     /locus_tag="LMJF_12_0250"
                     /EC_number="6.1.1.16"
                     /codon_start=1
                     /product="putative cysteinyl-tRNA synthetase"
                     /protein_id="XP_001681630.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649915"
                     /db_xref="GOA:Q4QGR8"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR8"
                     /translation="MSTNRVATVVAGLDGANPVKRERHPAWYPPLKLDGNGLKVMNSL
                     TETLEDFAPRDGRVVRWYTCGPTVYDLSHMGHARAYLTFDIIRRIMEDYFGYSVIYQM
                     NITDIDDKIIKRARVNKLLVDFKEEELRHSDVAKLMAFTAEAVAAAESGLAKRKAALV
                     EPIAKGTNSRAKADREEKLLEVQLKESQLVETKVKIAAAKDDFAALFAAASGVNGDLL
                     DERSGHSVSDQQIFEDHARKYERAFFEDMQRLGIREPDIVTRVTEYVPQVVEFVQKII
                     DNGFAYAGETSVFFDTEAYIRAGHDYPKLKPGGDRNTTEDEMAEGEGVLSKGIEGEKR
                     SPNDFALWKFSKPGEPRWPSPWGEGRPGWHIECSVMASDILGENMDIHSGGWDLKFPH
                     HDNECAQSEACNLHSQWVNYFLHCGHLHIKGLKMSKSLKNFITIRQALDELGVTARTM
                     RLLFLANPWNKPMNFSDQSLDEAKEKERVLRAFFGSVDIVLRADNWKATQGVNKHDRE
                     LLSKWVEAEAAVHAALQDNFDTVVALQQLMSLVAATNQYLLSGERPSATLVRKVGCYV
                     TKMFRIFGVVEGSDDVGLQKQGSDDGEARFIEVVNTLVRFRDEVRNAAKDHKVVAGFL
                     PLCDKVRDEWLVDAGVRLEDNPAGPTTWKSDEPALLQKELAERRAQQEGDRQRRLANQ
                     AETKRKLVEKWRQFTYPPSEYFRRQDEQRVEKKYTAYDDVTGLPTMTAAGEEVSEKEA
                     KKLSKEQAKYAKSYDEFIGKGGVSWIQEQEAELASMVAELEGSK"
     gene            <93066..>100871
                     /locus_tag="LMJF_12_0260"
                     /db_xref="GeneID:5649916"
     mRNA            <93066..>100871
                     /locus_tag="LMJF_12_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681579.1"
                     /db_xref="GeneID:5649916"
     CDS             93066..100871
                     /locus_tag="LMJF_12_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681631.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649916"
                     /db_xref="GOA:Q4QGR7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR7"
                     /translation="MPLYACRHEWCEGYCARGSATPIFSLSKADSATAPPLPASFLTT
                     TATPCGDRSGHRRRLPPLLLCAAPTGTGKSVLIPLYALDAHWAVLERRLLRTIDAYDK
                     AAAAEATAKVRGGVHSAHDTLLSATTAQQTAAAATEAEAAHVALRSFPLDSQESFIRE
                     FMACSRLRIVVSQPTRVACAELAAYASALLDVGRTCVGASDSSEVAPAGAGLSGGRRL
                     DKKQCALSRRLVGKRVGFAVGGESQFCSETEIVFATPGYVLNALQVSHPQSSLSPTTL
                     VVDEAHCRDIETDALLAWMKLSRECSQGGDASALAASAPLPVLRQYYVVSATMNLQAM
                     DAYLCRGLQNGGNGERDAHPGPREGLARGPKRTIAESDALPEDAGGTDLVSADAPLLL
                     LSPMQRHHVRRWWQGEQLLSAGGRIDGADVDSAVGRAVTTDPRVRAAVLQLVEATEGY
                     GECDDGYCDDPLLIGGAASAASGSPAASSTGRAVAGSFASSAKSPTETTARVAPLRLS
                     PPLNPSEPRGADGAVIVIATQPYRVERYFVDDLDPVKGCFARSQVLFDETARLSAAAA
                     ASAAAARTPSNALQGRASGGRKGGSQPKQGDKAASSASAAEATQRSSRGFPMCLTDDG
                     AALRARLIDLHGTRAASYVMLNTHARALVELILQLLQAARLRWIDGAAAPPATPRPPR
                     SEQSYHADDITSEPVSMTLTAAAPPAAEAPITVLVFVAGISELHQIMLALERLCDTVQ
                     PSPSTASFPSTNVADSSAPSTLVLRHGSEVFSVGLLHSTAVGSPQEQLTATDHSGAPL
                     RLLLSTNVAESSLTIANTRIVVDTCLERRISTDDVTGATQVLTSFVSPSGLRQRCGRV
                     GRTGDGVVIHLAPRRFVLPETPLRPPTTTTPTTRRAVLPTSSTADMSDSSASTLTFEA
                     LPDGVATVLLRLTFLFAKVSDALAALPSPPSAAAVRLALQQLADMDLLLLPEAAETTP
                     PPEATRNVPDLAAARGSFGPANAAALYSGDGALLSLLDRSTLTPKGYFVASLPLPYEH
                     ASLVYYGLQFCCVEDALLVACAMAVPSLFLTPRVSSSSAIQAGARRSTNSDYASQRWG
                     VDRMPALSPLEQFYRHLWVQRHFAGFAVQRMVRPAACPSDGGGAAISRQSIDNSNSVS
                     DTDEPAPTTAAATTSVEGQAGQLSEPLMLRALLRQWYAFSNVGACIGFQNTHGLNRSA
                     MRQVDSMVAQTCGRLIRLLLQLSTASEDGAAKRFVVEDAEAEVDFGAYVCQACAAGSG
                     TTVLPSTNSMPGRGSRGGGSTTGCIPFLPDWPAEAREQLLRSLRRLQRVAVGRVHLRH
                     TEVRQRYGLPQWYGNEERWIRLWGRPYLRHGPTDHLASRTGGRGAAENSAGVLDKERD
                     AREAVQRHPCFTYWVDGLPALRSPYPSPYRQQRTTFVAVGGAITPFSTSVPPPLSTQV
                     TRSKVPIYRPPVPPPPIPPVVFAMGRTDDRLCAAFVAAFGHRTLRGEDGGHRFHHRRL
                     RRNMQALANDEEHVCTFHIDVQQQQELAPPFLSSGGAADQLTLTAPLFPPSNSYDLLH
                     ASGVTSKSVEQALSPYLRGAGLQQLEVFQSNRLAVAARFASDGFSGLFDSLSPSHPVV
                     LCANGDADNNADEESDDMGNGGGDAASMQRVHDVRDGRRTAATGTRSAEARCGVATSE
                     AAPTNTRLVSADGAHGPPSEDLLKAVVLPSAFRYAGGERPPPPETSPARGNSPRRSHP
                     YVQLAPFGVSLLTAATAGTGGGGVGSGLGSLQRIPLSGAATAALSSPAVPAQPSSSLT
                     AVPTLPSASLGRQAGSAADERCSVRFAELPLPSAAAATRPTRGGATTATATTTACVAW
                     SDNLGSSGRSVTRAAVAALGLADLFPTAPPLSKNSSPLDSRGTPLRTNSGDDTAAASP
                     PSSACTSSQPSNGTATPTTLTVSVVPPIYVTGSITWKVLLPALVPPASSRAHATHKGS
                     TDAAPPPVHYCMLCNYLCSSQGTLDQHCRSASHLEHLYHAVQLGLRREHLATLYGWAP
                     RTVSGHQCAGTDEAHTRDHPGFSESEGSVSTLHLAPPANAACPLASLLSLQSATRLPL
                     AQHVYPCVVGAQSFLNCLQWSAGDPAPSSSSLSSSQEAKRPGAHKAAGRAAGAHRATP
                     LAVAGSLVALQSVADVLPPPHLRKPAQPSPCRGEAGVGATPPSSLVDAETLSAHHVWV
                     LNWSNSGEVSAAPSRTPSPPMSALLVVAGYLAAASPQATVALLLNGTHTHLHAVMLYG
                     LGVWRLPTPLPMQGYMGLLEHIGRGGGWLGVLVPMTSDPSYKRHESVREEVSPATHGP
                     SDDLHWCAPEAACALCSDKHRCDMSASARALDRDAIVEATLLLVLHEYLHARRNMVTL
                     ADYVERVMHKLQLSPFVVSGARAVQGAEQASQAVTAADVLTAYLTHVRRGQTVQALLR
                     DLGCGFATPPRALAALMRPANASTPARTAQGSCRGAPAGLGEGRNREASVSPAAALAR
                     RLSYRALGAEGAAVEMMFTVPPALPSRLPPVTFAAQLRQFYVDRRAHRWAPQRQASAT
                     RTRTGDTAAITARAGDEVLNKGKPHARPARALQARDRAGRLRGPRKVDKGIDIVNDEE
                     NLPQF"
     gene            <101633..>103342
                     /locus_tag="LMJF_12_0270"
                     /db_xref="GeneID:5649917"
     mRNA            <101633..>103342
                     /locus_tag="LMJF_12_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681580.1"
                     /db_xref="GeneID:5649917"
     CDS             101633..103342
                     /locus_tag="LMJF_12_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681632.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649917"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR6"
                     /translation="MSTSSRSSSASTASSASRRSKRLSYADADTVLGEKLTTAPVRGL
                     RPSPRAGSINTAIGAARHASLRTRAQQRWLTLLLALMRTPYLGAVTMRVLEACAYAAY
                     VKGSVIVFTRRRSGPPVAVATEPGSSCENVDLCEADGTAQTQVSQARCSADLSAADDL
                     SAPPRLSPAGHPSSSLLFSRDAPLREHALDCLYIGASPIHSRGLFAARALPRGTRIIA
                     ESRRSLLLAPHFVTLLADTHEKLPDTWHYTQPTGCVVELVTQAQPHHLMNHSCAPNVC
                     SGLSHTFWEAATIAGKWQEQQQRSRRSGSTHRAASQRTEASHVNVREEGSCSDGTAWT
                     SSSSCLAAAAHSAGCGERLTRWPYFADANSFFLTRDVAAGEELTLDYSTRMAPLYAGD
                     SARALQSRSWLLCRCGQPCCRHYVYRPKPEVSVFLRALCTGSYGHERGTQPSGQHNVP
                     LMPDRAALSCPMDARDPVHVMAKLLELGFDDELVLLSYAASSADVVAYLYGQPLPSLQ
                     RPSRARSLAPFARMCPSSAGAPPALHESIIDVEVRRVTKRQLLSQYRYVFQLLNEAVP
                     VRT"
     gene            <104356..>106479
                     /locus_tag="LMJF_12_0280"
                     /db_xref="GeneID:5649918"
     mRNA            <104356..>106479
                     /locus_tag="LMJF_12_0280"
                     /product="putative ornithine decarboxylase"
                     /transcript_id="XM_001681581.1"
                     /db_xref="GeneID:5649918"
     CDS             104356..106479
                     /locus_tag="LMJF_12_0280"
                     /EC_number="4.1.1.17"
                     /codon_start=1
                     /product="putative ornithine decarboxylase"
                     /protein_id="XP_001681633.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649918"
                     /db_xref="GOA:Q4QGR5"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR022657"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR5"
                     /translation="MGDHDVALCQVSHYNHANYWDFVPLPTVTDDTGCESLRHNSDSE
                     RIRMAPPPSASKAGAAEERLPPCERRLLDQYHIHLQPANRNPLSRADSAAGRKEAAET
                     PAQVQMMACVAAADSTADQHAPVAATQDLVDLFFLEGSQAVDGLCFSPYPIYGWRTAE
                     ERRAAVCEVFKAYNVVTRLPASPAALAAAQRRDSRHQHSAIAPINKSVIETREQYWRR
                     LSNLYIQKGVKDAAAAADAATTTATNGAVPAAPAYEPEDPFYIIDLGRVVEQMARWRH
                     ELPMVRPYFAVKSNPQPAVLEVLSALGAGFDCASKEEIHMVLGRHLVASPDDIIFANP
                     CKQLGDLCEAQACGVTYVTVDNPLEMEKIGRLMPSAHVIIRIKTNDSKAQCCFSTKFG
                     APLEDVDGLLKVARQLNVAVCGVSFHVGSGNDDQSAYLSAVRDAYHVFQQAAQYGFKC
                     TLLDIGGGFPGTEVVQGSGNTSFEIIARTIRPVLAELFGGGDVTIISEPGRYFTAASH
                     ALLMNVFASRTLRLSDVEVSRQAFQSVVSMDEPEEYQYYVNDGLYHSFNCILYDHAHP
                     TLLLLNDGDGADGVKSGTAAAAVCSEEEGGMSLSGPLVNDPLFVSAWDRRRSFARRPL
                     RMTTIFGPTCDSMDCILKKQPFPEMKLGDWLLVPDMGSYTTAAAGFFNGFATRRREWV
                     SSVNLCARPKPVYTREGNTLRCMSE"
     gene            <111656..>116359
                     /locus_tag="LMJF_12_0290"
                     /db_xref="GeneID:5649919"
     mRNA            <111656..>116359
                     /locus_tag="LMJF_12_0290"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681582.1"
                     /db_xref="GeneID:5649919"
     CDS             111656..116359
                     /locus_tag="LMJF_12_0290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681634.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649919"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR4"
                     /translation="MNDTEDDEKPKAQESVVDDAGTDMARTAAEATAAEALDSRRGAE
                     AATAAAGGHATLWADRVETVTAYQLASAALRRLPTRTAPVDKDVWIRQRTEEGTTSRV
                     EASATHGDVSAPPPPSAARRRTIFDDADQPTGCTTDTSPRTPSAEQMRAAVFTAVSPS
                     SSRFQVPPLQAARMSAVQLSPHTSSYKDEETAVLTASEGQRSSSASVYHHTDRQGSGD
                     AAEGANARDDADDEDDVAARVLFSLHRKDDMIRQLTHAVEALQDENALLRSLRAAASQ
                     ADAAPPPPATGLALSPDRVKTPSSSWPATPVRWWKTKHKTALSDGVRPPHESSQGLEG
                     SDRANVKEQPLHTSPSLSAARAAVSTIAALQRTLADKEAELEALRSQIVTRGTENDTR
                     DATAPAEAPPVEYSAGDSVISGARGAPSASPSAGEAVAEARIAQLEWQLQNVQQEKRE
                     DTHTLRDHIDYLTRELHRKSRDMERQQRHHKLELAALQQEVTALADQLEEQIRVSANA
                     AAAPPRREPEAEQLTELQRELAQAKAREALLLTERAATQRRWLRELEEQKSLLDEARA
                     DAAREEAQNESRVQQERQLAQKATQQQQQQLEEQVRQYKEALAQAKRELSELRTVHQR
                     TEETVSEQRQQLQRISHDIATAALERAHDEQRAARAEEQARLLHQQLRQAAATVTSQE
                     AELESLRQARQDEVAAAVALQEEEHAALLKHVKGCMKGSEAVESALLAAESSRREMAS
                     QLTRALEERNEYHRLLCEASVQAQAQLLEQQQLLSEGNDLVHRRLQEAQAHLLQRTEA
                     LETTQRELQAAQQRMLALKDELTRSQATQRQLGEELHAAQARHEAQTAQLVHAKESLK
                     DALHAQLATMGKLRRKEKQLHSQQAAAQRAMERRQEEQRALQDIMSLLWSPAVSLSPT
                     CPRASGVRLHESSHVLSLPPPQVVRTAATLAPGGMPAMPRRALAMLEQSANIHTRKSY
                     QIRKQRSVSMASASASGAADARADATNGDVDVTVRPSRSASSVSSATASVVMSAVSWD
                     DVPAASLSDGDTALEERRRTAEAALEEGDVSANSRAAASARAPLHSRLDGGVPALERQ
                     LECSAIAHKGKGRTAATEADPSVLRLLRAVRDAVEHMCAAYTAAQHELGTKRIAVRSL
                     VKERKAQQVQLEELRTTLQEQRHKAERLRRDAVQSVRAASQAELEKVCHAWQEKYEAG
                     MACQLQTYEEQHRRAVAEVLKVCVEHLQAELIVFVQLLPTTLSAGLTRAAAVSAERTR
                     DEVLREVHHQYWCSPGTTSTADHLVCDHDRGTPARHTSTAAAAADDVSLLSLGLEVQP
                     EVQAECDAIIRDVLHMAGGWADLTSAVLVASSTAAADCPSGSVPPFSALPAPQPCKLT
                     YDAAVESRASPPAAEAARRIAVNAEAALWSAEEMAELKEVIHAHVTRSLSALTAAASC
                     SSLTGVSTSVSRNGASEERQGVDDHARDAPATIGGVSGGTRPTNVKGAAAGGESKAAL
                     PRWMRSLRASTPPASSPSCFSPVRVTESTSTPPRSSAVEDAAAARVPLHHQQPRLLAL
                     LLDACVAHVHARLLA"
     gene            <116757..>122453
                     /locus_tag="LMJF_12_0300"
                     /db_xref="GeneID:5649920"
     mRNA            <116757..>122453
                     /locus_tag="LMJF_12_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681583.1"
                     /db_xref="GeneID:5649920"
     CDS             116757..122453
                     /locus_tag="LMJF_12_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681635.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649920"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR3"
                     /translation="MQGSPYSHQSTTAEAVDAPYSDAHIATVLSLSPFSDFCKLRDKW
                     AAKPLIRGCYVGMCGGDPAQRERREDFELITLNTSPSASSHAFGGGARLSAVWGQVEA
                     YSRSAAGKTIDPAQQRTPLALEKSMHFLVEHYLRVPHTPLVYAEPFRVWGYLWDRFRG
                     IRTTWGPQLPPSNVSLQGYVDSETGRTLSVEELHRESYRRVRWLEFTVAALAVGGAYL
                     CCSPEGCQRFMQDKKQFLESMSQCFTDLTVFYRAEQRHRNAEFFSVLLLLYGLQQEMK
                     VEDRSSFCRFHTVIVNGEPRLCPENASESVNLAQVYRELEKQPHMLETQPVRVALELI
                     HFWAARQWFQFFEFCKSAPMTLLQRAVVFQSFTYGRYRAVLDLVLPNYYVYPKLRVRH
                     AILVAELADQLMMNHDHCLEFLKRMGLDAQLECKTPHQLRQQAASSFYPIASPPSGPT
                     AATVAEASASGGKAGWYLNLCHPNSDPLITADELEKRCVNKRALFFPTHPTFFGFRVS
                     HVAYERFPDAKGFPTAGTEDVCDALAVAGSSSPVGRGAVRSPSGLQGRVAPRSKPGTL
                     PRRRSGLAGRGDSGDGGDEDYYFDEYCHDGGNDEECERDDGSGSDDGGAYRNTGDGCD
                     SPPQRQSTVSPPSAVSPSLDKEAALLGQPGCPVNLMEVLEVYCPPYNSEVAALRLSDA
                     SEELFASLPAHRAEMLLRCRDAHRRARHWQRASARDADTAAAVPEEEALYWAEKMEME
                     SVSTASSLFDGSDDDDVDDDEGEGHDVDAPLPHRTAVADVSLSSRADAVPPAVIEARQ
                     LLTAIRDNPLYAAAAADHAEAEEKARRAKQAKADARRGTTAAEAARSDQPQQAPTLSE
                     TGSCIVAPLPDDDNNDADQRCKSQNPRVAVELPATLPTRRLVDIIGNDAGAQAVTEGS
                     ARGPRDVSATHQERQQSVDREDSATTVEPHRHLQPQKPASPSPPLSMPTLQPLVPTAA
                     NVFTPGKREPTVVAGTDNTTPIPTAGQREGSSSGSSSGSGAPMLGYSHLKPLKQTLSG
                     DGEDDEKSAGADTEPGLLSGSDEPTSASAVDGSEATLDSSSAEGDTSAPPCPPLWGGQ
                     RALPVPPSTVTSDSFTPRFPPETRPEYSAAGAVSHRTGGEAARGAASENESGEDAVAE
                     VRARVSDEGVWKHHRAETAWQRGVRVQRPSPVPIPAASVDVFARACVPLIEEYLHLWV
                     RLTHEDDTTLRTAAQYVLDIREAQAEAPATQGANGGPEGGDEARCAVHTRRGRLAQRR
                     CNSALRGGRGATVAASTWWRQRRLRSTARAMALVARQLLTTAVLRGSMSEYGQLMRDL
                     SLSGWAPSKAADHDSAFGGGLHATDPSRRGVAMARATQRHCATYDDSDDARAARLSRG
                     CSVAMLSASNVDAILAAAQTQSNRTLASTADGAVTAWPLATSAASTRSAVPFTFTQET
                     AGLGYAKDTCEAALGEAMNTVFSCAVGAVTLPARDSLAALLSSAVDVSLDSADACSHS
                     RRTCTAAALQLTSIYIWVSAESYCDCECPATPVAVADTGAADAALFARLFQSERERWL
                     VSVMLPATACTAFEVFGDVDNRSDDDDDDDDDDDERPSRGQSNARRRGRKRCRSSAQH
                     SHVGDNTRSVRWLSEVDTDPHSVTCTPSPAPLVARLFQRDHVAEVRMVRSAVLSPGHS
                     VGASAHGSSTLPLVTRIALYGCDTHTLPRLRVRRDGGVRLAQQHSGFSADDGHAKAEQ
                     VQASPDSTRALAMSHAHYTAFLTVDIAEPGYMVKARRALAAVVASHVGYTTTVTARGA
                     ATAMEWNGHWEGVPEQNCVEGIVLCLLSSPAQLTDTASIVAELEGMFSGLWHHRHGAG
                     ERHKTNTVAAASAPAVVGVEIVYGDAEGARAAMKKGMRTLLSTYAQQAMTALDNDS"
     gene            <122848..>124782
                     /locus_tag="LMJF_12_0310"
                     /db_xref="GeneID:5649921"
     mRNA            <122848..>124782
                     /locus_tag="LMJF_12_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681584.1"
                     /db_xref="GeneID:5649921"
     CDS             122848..124782
                     /locus_tag="LMJF_12_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681636.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649921"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR2"
                     /translation="MCTQACSSLSLFLALPLCNIMVYVRLITPALARLLDAAASAPEI
                     QQARRDFIEERLHALVHTQSPSQLEGALWIYLVSQQQLLLRAAHDSQAPAQQQGTNCG
                     APEASMSSSSFSCPLPPSLLLPESLACISDAVRWYCDELSIPAPCPAADECEAAPQTT
                     PQPSQDAQQEKPPKAKTVTHIKQEPCALPAGQPGARVDELIRQRQQPAPSPAPSQPAQ
                     RPEQAAGPLATVQLVLDALAQLKRVPALLQPRTIALLVRDLVSLWSLVYLCKQLKRHQ
                     QLKERLLTGTVTAAIGAMDVKRGLGGDWRRRDRARVGHSPIAHHSDTEPISVCFHDYD
                     LLLPWDLVQRVLSPPAVSMAAIAAQCQAVEEARAGALSSASARTAATFPAFALILNPA
                     VTAMDDNPDRLSKNARIDAIEKAASKYYYALLSARAHGQTSEHIRGAPSGASSASAAA
                     HQEAVRSSLTTVEIGEYGVLDPSRMRVPSYLAGADTSLSGGVGGGSSRAASASSETAA
                     KSYALFLRDASIGFDIQVMALTGAGVGYYLGYLRGLSSEWCTLYAVVGLVTMMLVDAA
                     LLIIRIGRQDEAVLKARARIRQQREKLNKEGEKLVRSMQAAAGLSSADGAELTSASAG
                     KAAAAAPLQTETDPHTKKNQ"
     gene            <126625..>136365
                     /locus_tag="LMJF_12_0320"
                     /db_xref="GeneID:5649922"
     mRNA            <126625..>136365
                     /locus_tag="LMJF_12_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681585.1"
                     /db_xref="GeneID:5649922"
     CDS             126625..136365
                     /locus_tag="LMJF_12_0320"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681637.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649922"
                     /db_xref="GOA:Q4QGR1"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR1"
                     /translation="MPTVSIVGIDAAWEPSCCPSVIADAAGAATQDSTGLLAVPEVDM
                     ETGIVILDLGRRSGDANASRGPHVYGTAHNTPKKPPIWARNGGVWAHLQASGFPCLVA
                     VLAQPLLRAAAAAPPPLRPAQRTVEEGSDDRGYADSAGLGADAGAGVATAPAHKLPPS
                     WTTASLLTPASSLGASDQTAKPLLVYLPTIAPAAATPSDAAAAAGHGGAAGEVGDTDS
                     EAPVVAALPPFSHSVSSRSVVDKLGKLPSPDLSPATAATTTAADLSFSVPSSIPLCRS
                     SQPRALLPLYFSSAPVAPLRHLLASAVVCVDGHGIPSAFSAAAAQDEEDAQTLLRGAG
                     ATCEAVKRESAREADTLPQPPPPSTSVCTDASTGAVGVAGVVCRAVWPIPPWPANPLP
                     LFAPEAVPLLSYSVCTDGRHRGVSVDESATPRVAGTAAADDDDVETAVSDLLEHLGEW
                     NSSLVAGMFLSAKVLAASTPTTQSAPPPLPQQQPETTATRTREGEAEAEAAALEKEGD
                     SASVASACPTSMSELLALLFRYWHQRLADPPARMCAVEPPGKHQQHHEASASLKAAAG
                     TTATAFAAQESAGVVPRPPSPPTQTPTLISRAFFQDPQGREHATEAPWHQSMKQTPAQ
                     ATPLSSPSPLPPAAPHHYTSVFLVEQLLMSIEFSIAYLVSRKRDAAAVAGSQLDADAL
                     RDAFNEDDARAPPLTPLRVQQRLRCYRLPPVSSHTPFEAVWGLYLAQRVRLFSGSKTL
                     ASAAKARVGAGAPAAARLRLPAPSKPSLEHAEAALADREAEEQRQDACGLSCTAMDVW
                     TLWQRAAGMASKRLPAAPTASAPIVKEAAVDATPLSPPLQCTAPPQPANALMKVSNPT
                     TSPPPLASPCRTHIVSASSMERRRPSSDRQLALPPVRSSTPQPLPSRLPAHISFTVQS
                     VSKPCKSSHSAPDVAAVAAAAAAATHDRALPSPYTVLAGQAAQLQQGREPGQMSSATS
                     VAAATAGLLQVLPSFLSSRGPVPGVPSPPSLQPSTSARNAPSAQWLHKRARVSTAVTA
                     DLRAATQPVQRRGRPDAWLQERRDMHGVSEANAAVGRVTASQQPATVMMQGGRIDSWG
                     SIGDSSLDSPDGMRDKWDDDMACVSGQLTASTTVSGSIHGTSTPLVAAGPQAHVQQRR
                     STLPATCTVEVSKSALPAAPAAESGRRKTHRAGEIGGGSDDGGRHTARATSATPLEGW
                     KETLPSDEAHWMESRGGVDAAATAPQTSRCRRPRGGLYSAASFVAVLSAAVTQVLSEQ
                     QDPSQQHQQQQFHGFPAAPPSFAPSGSVSFSSTAAAVAAQRLEQIRRGRLLPSLATLD
                     SLSLLPQYVPVWCYTYDPITGQQTARRRGDDGGGSSGHAHNQSYLQHYTPSSSGAVIR
                     SRSGGGAGAGGGIHELGRAGKAGLTATYRYVSETARTVLDAVKSSVPSKVQGARGIKG
                     DNTQPVSGGTGDEARAGFPATPATAGAPTETPVMSPVAVSAPRMSLDAPLPVMASVHA
                     PAYGSGNATRDATKDPSLYYAMCGLYITEQDIILRAIPTVEVERRREKARRKRRQQKG
                     MPSAPTRGSGWAQASGGGRGCLGRGGAPSVGSEAERSKCADGNNSGDEGNDDDDSEEE
                     EVVELLILPRVSLVSVTPCAVDRSAGGVFAVKHARKLYDHLERDRHFVPSSSAAAISD
                     STLAVPAAGGSGSGGAGEGGRGAAGSSVTSASTGHRVSVASTATSSTGINARHHLPRA
                     SAHSGQPGQPSFMTSSTVVVLKLQSGEMQTVWLEFEDETALNEVHQLLCAPLRPSTQP
                     RGMAVCQAGPWCALPQQQQLPCYGNRFLSSARRLWCMVPLVLLATNVPLQGAATSPFM
                     QALLKNVTVAAVMLNAQATAPCMAAATTRSPSLLSMEASMLSLPSPPPPPPRGPPIML
                     ADTWWLYDPAREFVRQGLSEERWSMTSANAEYAFCPTYPSTFVVPAAVARAMENNEVD
                     GRHRMSRRVEAVAFYYAPTGGVLVRSAQPTLASLVADVPTEQALEWTSRMTGGRLGRA
                     APAASSSQTQTSSLVVPLRDVLRLTLSAFAAAAGVTAQRIFVMDLRSARAAFANVGKG
                     GGTMELLLYPFGGVEYAGLPNIHSVQKAWRRLRASLTQDAPYQLRGDESGRLETQYVQ
                     NAGEPPYAAVVAAAELSATAKRPASGLGVASLLPRLQGCSPSTPQSARDLSSGADAEA
                     AIKLSAGESGDSDGNGESGGPRDGAAAEDYAANTTAATSAPSRPPFSLGGVRWSAIFS
                     VMAPVGSASVTAMMPAAQHEWLAYIAMLLNTAVVAARRVCGVPTDPLYVPALQHNGPL
                     ANCFSYIVGHAFTQFRLPKATTSASAAPRSGSRRGLWTSAAATATAARSCKAPLASYE
                     HSAHATLAHVVFLNCSDGWDRTPQISILAQLLLDPYYRTVEGLCILLEREVLCFGHPT
                     QLRSTAVRGNVDDYWDQLLRDDRDTAAAAKRMSAQVPAAAAAQTHATSATGEGQRLFQ
                     ATEARQRKAATAASHSPTVLAAHTLAAGEARNAVESEPRSDSEGGQASGNVGPLTAAA
                     AAARDDDDYDDVESDATSALLFDEEPVEAHEAAAADGLRERALHRWVQKARAALGGGG
                     SAGDVAATEDARQSRGASATTADAPSVCASSMSSKPPKVPLWSSSEAAPILAQLLDAI
                     RQLVVLYPACFEYTPQFVCLLLDLFHSQLISTFSVNCEQQVEAQRVAEGTLSLSQWCA
                     LLLSTTTATPSAAYAAAPVTVQPSPLRSTLDTHSDGGGDANTVLLLSSASHSRAPATP
                     GSLRQQLPRSTAAALSASHADPPSEVGGAEASVGAAVSVDASFHRLDSAFLMGDAGLE
                     QEESGENAVDSCRRSCSDAVERQAFAVYPRSGNGEGASGSLAAGKQPRQRAAAAQSSP
                     STHTPALLPLGQEGKVVEEEAAMTGGRSYAPQPQAPLPACPAAPLYLYDFDCTTQWGV
                     PVASAAPPLPRSGQALPSPFSISSSATSPRAHSARPQGEASLAASGRQTQHPHQQAGC
                     NASGATAADEFSRRLLPISYDALYTSGYLNPNFSLRHNRVNVGPLVDFILPSQLTLWR
                     AAYTRHSFWGVRQAQLQHATGQYQQEHYRLRGAGGGIGQGAPSATGEARSAVGRHGGN
                     GSASGVGGAHIGAEAHESGLWCHGASSTGAAASSGPSTSAIPEDARWQPRNSTPRVPS
                     FASASVTSRTGGGSSAAFFTGEEDSESPSQGRPAHFTDAATACTATSSTPGIYQFHIG
                     SDSEDEETDDCH"
     gene            <139121..>141694
                     /locus_tag="LMJF_12_0330"
                     /db_xref="GeneID:5649923"
     mRNA            <139121..>141694
                     /locus_tag="LMJF_12_0330"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681586.1"
                     /db_xref="GeneID:5649923"
     CDS             139121..141694
                     /locus_tag="LMJF_12_0330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681638.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649923"
                     /db_xref="UniProtKB/TrEMBL:Q4QGR0"
                     /translation="MEALARWRQVVEAQQRSLRMEEVHDYLAASQLFLAAAVEEQQLG
                     GGGGGEGARVPDAPCCESPLMLATHGVTHVLRACGLLLSDTLLDKEVPYPASVVKEMA
                     TAVVSVVTADAVADELGNTRRSDRAVYSPLPNQLALPPLLARAGPHATRVWMLLVQLA
                     SFLERNAVQLPWDTKDMPTGAAASTSLADDRVRGTTQLLWELSAAVLLHRPFDALQAL
                     QDVFEHASSSTTAAAKVPSLRDLFSDYMLPRRAHPSSPLTSAARASPSSSACSSSPAT
                     VSAANAWITQVQAQPGTLPLCLLSLRRAIAAAVRARHYAEALLDVEVGLHLLREQAER
                     LDPVRSDGHKAEPAEESSEQIRAADVAAANAGGTDYRQLVHWPKAATAAQTRRLGSAS
                     VSTTKTVASAVMYLSDGVVLTMLRVLLLFITSPMASGEAVARLQQRQCGKGSLWKREP
                     KKGHASVSASGTSSPSTQPERSNDDPLDCAGDVVRCVAISLISALDTLDTLTTQLQLL
                     ERHVMVPQCSAAQSPAASSKTSNVGSRVASATPARQPHPEAHHRFNPSASEEVHLLPS
                     LPSPEHRLEHVAATALKAAKTGVTLCDAHTPATNGTERGAPKERAPTTALGEGALAEH
                     LSSYATEAGTSHQRSSRTVCTLTSSARYQQLKHAYRSRLPFHIGNTECSATPTGPGAD
                     ASSTVARDADELRDDAAHVADVHPEVTAEEHRGHEAEEGSRFGTQSVALVELAEVVRE
                     LWMMVGALTLPLRAASTCTTPPTAAPVAAAPTPPAAGESWFGESATTATAASAPVRES
                     WWACESGISYGEARLALPTVEPRMERCLQVLGGRDRTVLVLLRRLQSELLFPAVCRPL
                     A"
     gene            <142795..>149406
                     /locus_tag="LMJF_12_0340"
                     /db_xref="GeneID:5649924"
     mRNA            <142795..>149406
                     /locus_tag="LMJF_12_0340"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681587.1"
                     /db_xref="GeneID:5649924"
     CDS             142795..149406
                     /locus_tag="LMJF_12_0340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681639.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649924"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ9"
                     /translation="MYCVARLPPLPLFYVFFCFVWCLLSSYFGVVCHSSASVTDSYLV
                     LPASASAADCVVAGLSYTSYSCLPSPPLLLRRVCVCVCVCVYVFHRYFSVACVIPPAV
                     AALFLAFLCRVRAGRCMCVCVCARARVRASLMPHPSPSSPSDIVAPPATASTSLSASQ
                     GTVFGSACGDADECSSRRAGIGTSLTSATDAQQRMRGNPMVAPLPGPTTVQLSFAESH
                     AFAIAVPSDTEAGKSLSSSSTLHPRGRWGHAHGDTAGASTSREAMSINGVKSSKSTGC
                     GGGRSTHPEAPQALGQVSETQNTASLMSQRTTSPPATPSTAAGPSETKTVNHHPARRS
                     HINKNAAEAGVRRTGRRLSCAAASTSSTTATSTPALCRRQSMIASMMPSAQHRQRRRL
                     SSPASSAPSLTAQDASAMNQREVKTSAASGRAWVALTTTAVPASERSRSPAAHGREVT
                     KAQTDEIAGMSEAFTEIASAAAGAGAKDRQSACVEDHTLSSAEDGDAGRGSSACTRSP
                     AASADASVAVVAATTRQLRLLHESRASSRSASTASSASPTRLHTRPLPMHFSSRCCHG
                     AHRCADESTFALACAGGANDAQALASPLTPSVLCAFALPHYRHHSQVQQASSPCSEDG
                     SSMPWRENRCGFPRVKQVSAITAEETQEPCVTDHHISQPAAFPATVARASSSAVTGRL
                     SAEGVNADAAAAAWRVDSAMRTSPPAPLHASFDGFAQSSAAVSPLSAFSAAQTAPRPA
                     AAERCTADHCMVRVQARKDASTHSKPWFSPALERQVRAAAEAAATIAGFGDDEYSLGA
                     QGEHAELSIPAAKFSSINSPRASDAPPQVSTLSSFARGGDITARGAGSPILPDGPPSV
                     EKARAASGHPSTSLELEGNGSAVIRAAAVAAEAEGGAPQPVLSSSPTPRSGVSMIAVP
                     AAASVSQLSHTPAVMLTTSLLGFSSRSPTPVANSCATPIPPPWHPLHPMLPLQQLSAG
                     STSSIYGDPGSGDAVVGGVGSNISASTTRSPLPEWSRLRALPLQPACMPATRTSGEGH
                     RADSSSRMNISCDGGGVPPPYQSVPFPLSYSAWKSGGPRQPESPSPSRSLSQQLSGGI
                     GGAGGDSPEGVAGAVGQHQHQPPACRLTAFKGLSVASHAQAGFASVTADSDGAMLQAT
                     SVSPPPPWQHRKSHSGDIFAPTTTADRPPMIALGPVVRSWPHQRTSSNVSLLSSIAHS
                     QLASGVGGGNGSDTTTSTPPPLPMAIASLGVAPTLGTFSASTTTGFGPAPSCILAAGP
                     RSASISDKAYVHPLTTSPPLRHRRFGSTSSLSSMSAFAFNDAGTAPVMHSGVRCRAAE
                     RVPPFTASSTPRNRFGGRMDGGAENDADNVVHGDKGEDYLEGGGADSCKASQGWNGRL
                     WRGTSSGCGGGAHCCEKPVRLKPGTAIETAIQAGVYARHPSCVSLFAGGGGGGASTGF
                     SRAGVANTAAAAAQTGDDGCWPSSEDLMTWLSCAASFTASSTSASTTYASSSFGTVPC
                     DGEHVRHGCSQHQHGSRDGGDDSRCDPSADAEESEDGLAVCTLYAAAPRHYHYRRTVD
                     VPASCDAVLQRGRVKRHHRYVRVHHPRRHHRSLSNSPAIGRDVVEGAEHAHAARPLPA
                     FTTDVNSTAALPLLNVDPAANENVNAGIHNGRGQQPAVAALPGTRVSYSPHLSTSSLL
                     YYDDVYSDDLDDVYYQIEKRLFPVADEAGQSLCRTSRSSPPPPQAPAAAASTSPLGNT
                     REAPHDGSDESSIDALFTVLNVPLRLNLRGGFHLSDYYAPCPVCHPAMRTAAEDTASG
                     LDATASSCSCSCCSCRCSSVCFPAKRQSTLSSRATSRMSGGTSPDSTQLIFSDASAKA
                     SVSGSAIGLRQTTPPPPPPVPAALAVRQSGLSSAATAAQPCGVGGALNSLPRRHGDVA
                     TTGDARRRERKATAAGAAGSHRNTAAGELVLSTFTARSGRSCAGGATDKPRPPSKLMQ
                     GIPPAPAAGNDIEDKVRDLKDGSRGTRGGGDPGRLPPPLVVTAAHRHSRYRRQRARHP
                     PAVVTARRRQAHHRGSGAGDGALRSQYSRLMRQRLLCVRVNDKITYIDQKGATCAARL
                     LAGAVLLAEKTKRKEAERERRHRAAAVDGGASGAAATVASRGAPTETSSAPPASQLPQ
                     QAAAYRRHRRCRNSHHHRHQCHHTHGELCCYAGDQRPQPVERQRQPSAFSTETAPGAR
                     GSNERVVPADGGG"
     gene            <152052..>153740
                     /locus_tag="LMJF_12_0350"
                     /db_xref="GeneID:5649925"
     mRNA            <152052..>153740
                     /locus_tag="LMJF_12_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681588.1"
                     /db_xref="GeneID:5649925"
     CDS             152052..153740
                     /locus_tag="LMJF_12_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681640.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649925"
                     /db_xref="GOA:Q4QGQ8"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ8"
                     /translation="MANRFNPHQHPMQPPGDGNQAQSFFYHPASTQQQQVYQGYPQGF
                     PPLHLMAPQQQMQFLQTLNEAQRRQALQQQQQQQQQEMKNRAGGGLAQQQQQQQQHPG
                     FTRLSAAELLLLQQQQQQNQERELRQRLGLPEGAMLANYGGNANNATAANNFLANITL
                     AQMRQQQQQQQQYQQQLSQLQSQQQQQQQQSTQQQQLAALMAAGKVGAGAAAPTAGMG
                     GAGAMMLLSSAVGPQVDPAIAAASPVMQQQSGTAAGTGNSSAVPAAATSVAPPAAGPA
                     AGGAGPTAAAAAATGKGKIEVDDEYGLKQLVKVVQPPLPMATTPYVPSADEPTDPVSG
                     RPISQQDADELNFTFITRGVDITQIGLSVTEEGWLHTTLATLPLDSYEYYILPEFKIP
                     DSYKKPRPKSLSMKSFHQFKEETLFYIFYSMPRDVLHLAAARALYERGWRYNKCAQHW
                     LHPVKADDGSLMEKTTTGPNGQKIFTGTYTVFQPNEWKQVRTQPNHVIAAADIEEQSA
                     LVAAMEEAARQQSQRARSKAAHGAGGGGSSAAAAAGSNGNNGSSAGNNTPSASA"
     gene            <155747..>156859
                     /locus_tag="LMJF_12_0360"
                     /db_xref="GeneID:5649926"
     mRNA            <155747..>156859
                     /locus_tag="LMJF_12_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681589.1"
                     /db_xref="GeneID:5649926"
     CDS             155747..156859
                     /locus_tag="LMJF_12_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681641.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649926"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ7"
                     /translation="MVVSLIGPLDSPYVQRTLLVAAYAGIQLKLVPIQIGRENETEEY
                     RLNCHPMQRVPVMKTDEGYLFESNAMIRYLARTEVMLVSVSAGIDSAGANNEKIPHPQ
                     YPIPYAMYGHSLLESTQVDSWLDFAITRIDFYTRQFFAYEHKTGPKPAADMKTLLCKS
                     LDGLERRVAYLKEACRALVQQSGSLTSRSVMTDEELVWNEEDYMASRATRDSRLSSVY
                     NVAGSIRQRHMEKERQEREKQLMLIKKTTDDALGKEEGADDPHHPSRRPSVSRDSMAI
                     SATPRASVLMSARSTMGSAAPGVQRHDLLFLVGGSLTAADLVMAMSLHGVLCCQELKP
                     VLTSKYPNLFKYYKSVLMLPVAAEVRKAIRLSIIKE"
     gene            <158790..>159743
                     /locus_tag="LMJF_12_0370"
                     /db_xref="GeneID:5649927"
     mRNA            <158790..>159743
                     /locus_tag="LMJF_12_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681590.1"
                     /db_xref="GeneID:5649927"
     CDS             158790..159743
                     /locus_tag="LMJF_12_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681642.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649927"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ6"
                     /translation="MPANSSAVPCLSSGSLAAACESYGVDSRLLYNDSEQLSKKCFDY
                     AQRLILWSRLLSAASMVAAGATGVAVYYQQAQIYRVWRLRNPHKVRRLAKFAMLSGSF
                     CLCNVLFLISPVGLMRLHEKEFSRTKQLDVIAVAALVQEQNFRTVAAWAHAAADAGRP
                     APAPSSSTVPPSPAGAATNTIERGREEDGGIGPEPQWVWKEVVLDPAQLLQLPCERKT
                     QQKRAAHVDKAKTDTDADMLAVKQQLSSQLLVNSESCSNSGQGGSEATSAAERPTWRQ
                     QPRRVWSRTADTAELQQLKDECVAMWEGLVAEKTAIVQKVL"
     gene            <165735..>170117
                     /gene="PUF4"
                     /locus_tag="LMJF_12_0380"
                     /db_xref="GeneID:5649928"
     mRNA            <165735..>170117
                     /gene="PUF4"
                     /locus_tag="LMJF_12_0380"
                     /product="putative pumillio protein 4"
                     /transcript_id="XM_001681591.1"
                     /db_xref="GeneID:5649928"
     CDS             165735..170117
                     /gene="PUF4"
                     /locus_tag="LMJF_12_0380"
                     /codon_start=1
                     /product="putative pumillio protein 4"
                     /protein_id="XP_001681643.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649928"
                     /db_xref="GOA:Q4QGQ5"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ5"
                     /translation="MFAQSESEELLHLLSQVRLVADEEERNEQEQHQHEKLEQRHRPS
                     IDGDHTIPVHTSAAGTTAGVLDKRISNGSSASIASGAGGSAAGRYTASSTAAVTSSWT
                     VHDNTDSTFGINTAAASNSFLADYEHRRANPFDQPPVSRTPATDVKVLLQPSDERARC
                     IEVDLADQGDGYNIFQQPKQLLFAFPSAAAQILTGQQQQRRCLEQLQQQRSLPLVTHA
                     RQSMPSPHAYNVYTASVSTAARTTTPHSIDDAAPILPVAVEREGSGYPGAAADSAILR
                     DTPSPAVTSSVPSAYTKRDDKAVAEGVLEGISHIAAVMQNDGFDRDCEEEFGRTSGGG
                     GGGDRLSDVWTPARSIGTPQSALDGSNRSLRLFHLQQQQQQQSHQHLHQHHTTPSSPS
                     SAAEAAVAQFFRVSSSADVMDNGGLDSAWRANVEAELAELQRGGRLSVNGAVVQGTPI
                     STVSPLPPTSTTPYHQLLSQLRQSPSQVPASGLGPANAAFTGRTAHANTPPEQRPLTS
                     SSRLASMGPTPLYTAHITSIPRASSAAAAAGASTEQGRSSWPRSSLTPSEAAALWERL
                     SPYERAAAAAAAASSNAVSVAAAAALLHTPDTVSKPVTLSSIAAHLHSGVGDLGSSDE
                     MGGAHAHAGHPSRTYASPPTFTTAPMRVPRPASAAQLFPPSSPSQPNSTSPATAGTDV
                     SPHHGWQQSHSNHRQGQYSQTASPRTSATTVMALPPPPPASTPSLATAAAAAAGPYKS
                     QQNHLQTPSMRRWSPVDAPPSTTGAGPVAGNAHNTNSPPSCSMRPSPHPRPSNGSSPA
                     LRRYTITTPSSNATTATAANNNNTNSGGKKRVDGSRLGVSGASVADRGASREARPRVQ
                     LSQTSCSTGVGAAVCGGARGARGSLSASAHGAGSGASPSSPSYHYNHSNHAGHHLNSP
                     SNSAGATTGTGASMVSAAAVQALIQRLQAAAAIVLPNSPSASSAVTGGGQMSFTAEES
                     SVVSVTAVPDVVSASIILAMSHDQHGCRLLQAVIDAECNESEALDGGHGELAADDAAA
                     AVSPSMTAGASAGEKKGSVSERRRRRRAEAFENSIPVRVVLRAIEPKLDAVMADGYGN
                     FLLQKVFDMAPDAERQRLLRLPSLQHHLCEVACSPHGTFAVQRLVETVRNTEEERLVF
                     VALERDLLRLLTNANGGHVLMKVMECIRRQYNALASGASSAAEPSSASMAAPGESSTA
                     PSRRLLEERVATLFQAIQQHLLYVCQHKQGCCIVQKCLDFLHACAGLSPSSPSSSGAM
                     EQMDYFERMAALLLPHVQELSTHPFGNYVVTRLVDVCYARGSTATIDAVAAGMQRDLV
                     QMCTNKFASNVIEHILRHCSERRIRLICQSLMVPLPHPSAPAVYASASTAAATNAAIA
                     RLPLTTVVMDPYGNYVIQTLLTVAPVDELVSTRAEGGGMLSVLQQLLPLLSSRNYGRK
                     LETKTELALLRVEQQQQQQKQRRS"
     gene            <171270..>172520
                     /locus_tag="LMJF_12_0390"
                     /db_xref="GeneID:5649929"
     mRNA            <171270..>172520
                     /locus_tag="LMJF_12_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681592.1"
                     /db_xref="GeneID:5649929"
     CDS             171270..172520
                     /locus_tag="LMJF_12_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681644.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649929"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ4"
                     /translation="MVSMIVAGATGAIGRTVVQYAIQQPSIDRVVALTRFRNTAVSNY
                     ENLFGIIVAGEAGNTDSRGDGANSKRKKGSGSPAGTVTATPAEAAKIRPITMDWEEFT
                     QLWVAKRSSTSAAASGADNCAAGAAATAITDPTERYRGIFGGHTYAAMCLGTTRKDAG
                     SAKSFTRCDYDYVMAFTEAVLAYSAPAGLSPAKAFVHHIGDGGASKQVHVQEGMGKEV
                     DVLAAMNANAAQSSGTLRVFCQVSSSNASSSSWFLYMQTKGIADESTVERVHRHNKCA
                     TAAAALSPVNLLLLQPGLLERHGKTRATEKFAKLIMSSIPVETCGAAIVSACKSLPIQ
                     HSVQRAETTSAAEQAKHDEVEGAQVEKENNTVAAGVRKTPLGKPYVATKALCKAGMPP
                     NEPLPYIYAANNAVITDLASRLTA"
     gene            <173959..>175104
                     /locus_tag="LMJF_12_0400"
                     /db_xref="GeneID:5649930"
     mRNA            <173959..>175104
                     /locus_tag="LMJF_12_0400"
                     /product="putative 3'-nucleotidase/nuclease"
                     /transcript_id="XM_001681593.1"
                     /db_xref="GeneID:5649930"
     CDS             173959..175104
                     /locus_tag="LMJF_12_0400"
                     /codon_start=1
                     /product="putative 3'-nucleotidase/nuclease"
                     /protein_id="XP_001681645.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649930"
                     /db_xref="GOA:Q4QGQ3"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="InterPro:IPR008947"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ3"
                     /translation="MAALAFSAPALRAAVVAMLLLLALPTQAWWDKGHMCIAEIARRN
                     LKPDVQAKVQACANALNKIGPFPKSTNIVELGPWADDLKSMGLYTMSTWHFIDTIYNP
                     QDVKVTINPVEIVNVASVIPMLISAITSPTATSDIIITSVANLIHFVGDIHMPLHSAD
                     LFSPEYPLGDLGGNKQIVIVNETAGTSMKLHAFWDSMCEGPQNNAVRPLDKDAYAELS
                     AFVDNLVKSHSFTEEQMMMTNSTIMAAESYELAVKNVYPGISDGTVLSESYKANGKIL
                     AAGRVTLAGYRLATILNTALAGVSLDTIINGTKHMQDEVEVTHTGDTYNYYAFSGVER
                     GAAAGIFLSSFVIGCLLATAVVLAVLYMRRGSSKDERAAAASANHRI"
     gene            complement(<177457..>178689)
                     /locus_tag="LMJF_12_0405"
                     /db_xref="GeneID:5649931"
     mRNA            complement(<177457..>178689)
                     /locus_tag="LMJF_12_0405"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681594.1"
                     /db_xref="GeneID:5649931"
     CDS             complement(177457..178689)
                     /locus_tag="LMJF_12_0405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681646.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0405"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0405"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649931"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ2"
                     /translation="MFAALSWLLDLDQGHAASSSSTSSCSSYSGSLDADAGVETDPAA
                     NHTTFSDAGGQLLAELHISSVAAATLSRSASEAAAPPRGAVYSSARHLEESFADLEAR
                     KAEFFAPSPCQEPAEDAGLGLSSLTERGGTPVSPLSCKIVPLGSLCAYANETVSLSPI
                     ASPVPAPVSATVATLLAPTHEDERLLLVSEGVMLSARLSSPSRGGPRAAAERAKITNN
                     DGSATGAMGAGVAAPTQRSRILDWDREMHARPQASPPPGLSANRGERAVRSGTGVQER
                     SEQIADAEPGEARLVRGAMKAAFMLSTPPHTPALGAAAFAPAAVPLHPSPPFLGTTVG
                     ARDAAVPGYSIERIHDTPAQEDSGVVYLADGLATVTSMDVGDLHRQAEQSSPPLTHPL
                     AAQLTTPSHTKQPHFDFS"
     gene            complement(<180316..>181347)
                     /locus_tag="LMJF_12_0410"
                     /db_xref="GeneID:5649932"
     mRNA            complement(<180316..>181347)
                     /locus_tag="LMJF_12_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681595.1"
                     /db_xref="GeneID:5649932"
     CDS             complement(180316..181347)
                     /locus_tag="LMJF_12_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681647.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649932"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ1"
                     /translation="MRAVSLAADPACTHPPTHTHTHIYTPIYVCRGFVCVTPQWRTEL
                     FNVVLLWRRAHTSLLSAACLCPYAQASPSCLHASFLSRLPRLSLSLSPCSCLHPHSTG
                     VFAYIVFLRCRAATQNTSPVSSCVVRLVTRDLCAQSPTPPLPALCGHRNLVSLHRRKT
                     PRLKRRVRTQATQRSDHRSSLIMPVFHAVMSVKESERVERIAPVKNRAWGLRFQCASC
                     NEESTGMMYVNQTEQHERDGGMHNFVSKCKLCKADITADVLPVPAGTGYYSAEEENPA
                     NVIAAFEVRGGRPVELEIDNQWMIVTAGGGLFEDVDLSQEWYDYDESSQATVSVAGVS
                     VDFEKSKKK"
     gene            complement(<182676..>183101)
                     /locus_tag="LMJF_12_0420"
                     /db_xref="GeneID:5649933"
     mRNA            complement(<182676..>183101)
                     /locus_tag="LMJF_12_0420"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681596.1"
                     /db_xref="GeneID:5649933"
     CDS             complement(182676..183101)
                     /locus_tag="LMJF_12_0420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681648.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649933"
                     /db_xref="GOA:Q4QGQ0"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="UniProtKB/TrEMBL:Q4QGQ0"
                     /translation="MHVTCLCAAASAFYIPMMRLVSAGSRRASGPKIRSMNFENPPLI
                     VTDKGVRRFGLLDAVVATLRKDAGITSMIVCDDLQPNSTVVSVYNGRRKVLKESRCDS
                     IIGFGSVSSRDAAPRHCAARTHTSTRNQQRHVPRRIWVP"
     gene            complement(<183739..>185748)
                     /locus_tag="LMJF_12_0430"
                     /db_xref="GeneID:5649934"
     mRNA            complement(<183739..>185748)
                     /locus_tag="LMJF_12_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681597.1"
                     /db_xref="GeneID:5649934"
     CDS             complement(183739..185748)
                     /locus_tag="LMJF_12_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681649.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649934"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP9"
                     /translation="MIHFKDAVGMLWYALLLAQESHHEQQRQSIWSSVKFTTEDVALK
                     KGTAAAVQSHRQSCGGVGGGGGSGSDPKGSAGASIPAVSPTASTTGPLSTAVQRSDCE
                     FDRWGDVDWTLLAAHVYALTRELHSARALHRVVAEDIYKGAYNGDREAMCAACALQHA
                     EMLAFYAKEVQEEEVRAATVRLQTPLPIRAGVAGGGSRLACTAGVLPIDSSLAPSSSM
                     AGARAARPPVTAGIQGPASSLQNSSSGEGSAAPALPSTRSDSGASLLAPTQWGGASTM
                     PRAAAVSHPVSPYPSGAKQTTTGETIADVRVAGVPASAGASTATCAPGSSPPSSQRDR
                     DIVGLHAAGGTGRAVSTDDGQLLALLPHTRLGSVAGVPQHCSHAVADQSAAISGQSLG
                     TSVAHKGDHTVLPSTTRPPSPFEPDPLDSPWYVLWCSLPSPQARAQLHLLRYATPLSL
                     EDFSSLLEQFFLVDGADDFLSPVHAATIMEFAGVRSGPYNTIVRSPLSLAEVRRYISE
                     SHRQYARAAMTVRANHAEGVASVEARSRPLLGTPSSNPASALATSSTLETSHAAVAGS
                     GFSAPSMPTSTKAEYRGLRRGGAPSAGALGSDARSLLDSAASSERRILTLAELERSIW
                     HVAANCVVFNAPESRYPRTARHFAAACIAIMTRYCEKQLASFFIA"
     gene            complement(<186884..>189016)
                     /locus_tag="LMJF_12_0440"
                     /db_xref="GeneID:5649935"
     mRNA            complement(<186884..>189016)
                     /locus_tag="LMJF_12_0440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681598.1"
                     /db_xref="GeneID:5649935"
     CDS             complement(186884..189016)
                     /locus_tag="LMJF_12_0440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681650.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649935"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP8"
                     /translation="MMASLWRLLVRLCPSTFAVLLPSSCFAVLPSCHPPHTRAHARAP
                     ALQWRDPASTPASHPSTRSMKRRVLRAHANKRCLRILSASHLIQTSSSPSSSFSPSAA
                     SGDRGYAVLCDASFLRAVLLSYWQANAPAIWREARRRKLRKAAAVTSAGESTRAGVPS
                     GLPAPLAADKIARLPFGDLPALSPHAFLVALLCDAFEGEGRSRPVSGNPAAAVAAATP
                     HADSTSVSKFHCYCLPETVAALHRMRDHAPTSAASATALVNPSLPNSSVVDASLTGAQ
                     KKSGASSTRQRPPTPLPSTTPPRSEQHYRMTETEAWLSASFGNLATMGDSNGNSGGAR
                     RHGGPSPSAAFPLTFQEVPAAVVNHLLSRITLIQSEEQRHRDAVTVEGREVSGSPEMA
                     DGAPLPTRNECRAIGEFMLANDTLLGRRPREGIDASACAPSALRLVSMPLFGDHRLAT
                     YSPQGAAANRRRRRRSKNRRAAGGGGDDVGELPCLATGNAGLAEPQEARGNGAGATPS
                     TTSHPYSPRTFFVATQSHDVRRRLAAVTPLLRLTTNPDALWIEQRGTAYHYGEEGAEA
                     RRPHIDMKGLGNCSSFSVAAAASSRGGRGSSEPGPPRSASFSHTPSFPHAATATTTVI
                     AAAPQLSRADVAFMKHLGTAAEVPLPAKPSHHPHQQEQQQLQLRASPASDTGVSNRAP
                     VDRKRRRQKGQNPLSMKKKQRREVFRAH"
     gene            complement(<190356..>193631)
                     /locus_tag="LMJF_12_0450"
                     /db_xref="GeneID:5649936"
     mRNA            complement(<190356..>193631)
                     /locus_tag="LMJF_12_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681599.1"
                     /db_xref="GeneID:5649936"
     CDS             complement(190356..193631)
                     /locus_tag="LMJF_12_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681651.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649936"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP7"
                     /translation="MSSTSVASLSSQRGKATTTMNTTTTTRPTAAPAYPYDANTKGLE
                     TYLPRLQAAASRASPVAPSKARNPLPEGSAQSRYLPSSSLKALTVAGAAEPGVPAARS
                     RNDYRTSPVRGRATLGSSQQRTNWGVETAEERDSEDDQQARSPLRTLANLPQRTQELC
                     EDLITLDSLVEVDEAFFTAQEDMEARIMALLRSWREAAAEGDSRGGSRRPSGVYALAT
                     ASTPTAAGTQLGDAVASSSSGGGGGGGGTQRVLQDFDEARDRIALLEKLHEELTEMEG
                     QHRELQRRYVVEGSPLSALDELCARLDGEDGEMRANGDEAGYAEGSEKADWGAHRDGR
                     SKARRRQERDVVRAGIAACRLLADRLRSRGMMIVDRLTDELLCMRSEVTRHDWTALQS
                     STPLTRMDRVAPLDSRNDSPVSGAPISWCTSLFPPPHLVAAVSRGGRDSARLFANSST
                     HYFGEAAGGAHGSDGDESDRSKATVTSTETPESFVLRVQVPVFASAAPPALATSLPAA
                     VTTTAEGATVTAASFTSRVSGDSLHSSGSAERMRRRSSGAAQALSTAPPTTVSVIATP
                     TRYALVQLYEYCREGLAAMLTRLCALRTRHSKEAELLQQEQSAMDVYDPAADDLADRC
                     AALLRYVAQLDAWAGEVLQMDQVLHERVKLPLDAALQTCERVRNQLLEVLKQRLEDEE
                     GRHNERAAAAADAEEYGGEADDRGEHHLPHERVCDDNSEELHALPGEGGEGDVNDQRR
                     MSGSIGDYRAHRVTQPPARASCGAAPPTALPRASAAFIGMLETILQDQQTAGEALCTT
                     ATTFAGGTSGGERELDTGEHCGKDGEPSEEAPAPEQGSSAAEGHSEGTCALAGLAMAP
                     EAEPVNTPSAAHSHRTTATVAVDKTSASAAADTQADRPSEGIDTGHVAGRRRQRDDSE
                     DESEDTPSHSVLSQATERKHAHTSHPTSTAAPSHEITVYISSTSCSELGEELGEDVGV
                     EPRAVETQGGVHRLAKMPGPEPDDSDGDDDVSDSDSGDDSRNSREGNLNPANQRQRYA
                     LGSSNGLGEGLRAFFSAVVRRAMSFNDSDDDADETEMAMTFQGRQQGGASQLPSHKRA
                     RRE"
     gene            complement(<200747..>203104)
                     /locus_tag="LMJF_12_0460"
                     /db_xref="GeneID:5649937"
     mRNA            complement(<200747..>203104)
                     /locus_tag="LMJF_12_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681600.1"
                     /db_xref="GeneID:5649937"
     CDS             complement(200747..203104)
                     /locus_tag="LMJF_12_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681652.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649937"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP6"
                     /translation="MQSFNAPSAAMAGSTLASRHSSGATRPLSPLLPQSLSMESEGPL
                     AGTPAAAPVTASSTARIVTSNAPTCMSDAHDSVSVTQHHVCVSVSSAVTSHAASTSPT
                     LPPRRPRKLALASAHMVVLPHGSHRNGSGSGEDLLSEHTATPPTPSPALDADPSRLCD
                     MHSFPDGEPWPSNDPAHGGFGPHHRHMHTLPRLSEGALSAPAESRTADLLPPAPRQGD
                     VGAISDAEGAVVRAHTLSVSATAATLASTRSPARRASVLPPPPSPTFESPAVPTSPPL
                     TKDNQDNMSPSYSCSMSIPSPSPAFSPFTQQPSPPLSPAIVACCPARGTEQKAVQRQR
                     SESVPPSAVAHKLLSTGCTAEPDMPVVHPAARRRSSYVSGSTMLGSFCLTEDGVESSD
                     GGATATADTPLMRSNTSRATAFSSAAAAAAMTTTSATPYTLPSPTTTQRCRSASAMMR
                     YASTFLSKDGSSVDASAAAAEAALLSTPSQSTTHPPCALSSAVVSRMQNDRDKDNGEV
                     AATVPAVAVTPAMPSTYHLLTAPATGARSDDLSWFLPSLPDGHAPSFLAEAPQHLRAY
                     LAAECDRAMRAVQRQELWAGQTAAGREELRRQVEGHIVAKHHNRAEGLRKDASAWRLP
                     LEALWPEQPLRSNKAVLVLDDGKSSARSAADTTIAVAGDALPSLALFPRLMSTSLPCM
                     EFRRGTATQPEVHTSTPTRTEPAGDEQDAVAVGSPVEKGDVEDSAIFEKSGLAESQGR
                     PSRSEAAASVPLPPGAPRSRASVSFLGSSLSYEAALLDAAQEMSG"
     gene            complement(<214308..>216563)
                     /locus_tag="LMJF_12_0470"
                     /db_xref="GeneID:5649938"
     mRNA            complement(<214308..>216563)
                     /locus_tag="LMJF_12_0470"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681601.1"
                     /db_xref="GeneID:5649938"
     CDS             complement(214308..216563)
                     /locus_tag="LMJF_12_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681653.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649938"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP5"
                     /translation="MMADTARMLSPRPSVTRTAAKTSGGPVQVALSQSCPHPHQQHQQ
                     HHQHHQHQQHHQHHQHQQHHQHHQHQQHHQHQQHQQHQQPCLGGLLDPFFLTEIDENV
                     QAFSGTAATSGSHTSLSGDGGSPSAKDAALCSPCVECVPPARGKTVRKSRSACELRLE
                     CLLSTSMGSDITKDEADDSKRKRRQPSSFPSSSRRDTAGCFSSVEVMGPTDEVAAADE
                     AIATTAATAADAEAGVKSRDPKRRSLLPTWVTARTSTVTRAGAPPTDSGETSRTANGC
                     LASPRSFSLSHSKPSSGSRDTSEGSHVLDCEATLLPSESVGVVASTHSSTVSSYASEA
                     QGRAAEEATNCATAGGATVGSKMTLLVSLIMRCTPSRRGPPHSASPTEDGAADAERLP
                     PLELYPPLVSPSSIEEASCGVGYDVPSAHHDDMYAMKDITVAVKEDVNQRRGALAKEP
                     TLPASTASRRTQHTKWSMHPSPVSAWLLGSSAVGASLSTALWRAALRSRPAMHTPCSC
                     VSARAEQHSVQVLSRVLANGSAVSTKVLAMRSWAEFERASVSFPSTWSASVSAHLSAV
                     PPSLTTDSTTLRGPSMLHLTLPPLPDQTSVGPASIAYINRAPSRPAATAEEVVARQPC
                     DVWRLARCYAHFERAVEQRGEDGVWSARGISSLATWDSVKLVVAAGVASRDAESSTDE
                     GCEDGGAWLLPSFTLDVVPDTLDTPSPASPQVTSTFPFSPVVSVLRAEKEEEVFTSAV
                     MWALEMMTGVR"
     gene            complement(<224933..>226762)
                     /locus_tag="LMJF_12_0480"
                     /db_xref="GeneID:5649939"
     mRNA            complement(<224933..>226762)
                     /locus_tag="LMJF_12_0480"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681602.1"
                     /db_xref="GeneID:5649939"
     CDS             complement(224933..226762)
                     /locus_tag="LMJF_12_0480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681654.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649939"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP4"
                     /translation="MPRSIRVRHGDPDVAEGALTIEVPSSPDADNKAVGDARTPVASL
                     GASSAFFTTYSTVSGDVAHPCANIASGAAPSDEVSPLTSALFMSVDSTPLASSCATKT
                     AASLVNVRSFNSSATVVSVELPNLQSEHAAMTATSCFATRSRDTEAPAAAAAASATNP
                     PPLRHPLGSAPIEGGGGQTQLAGEADTPVQDRTAAPSSSPLMAKASVSASFSGDSSKR
                     CSHTVQSGLSDDLQLTQTTCYLPLLGSAGSREVQRSGDDIDARWVAERESVPAAEPAR
                     TTVGNDSFPAEGSEGAMVATTQSASTDVRAAACTVPASNISNTVAATATDVAAPLCPK
                     FEVLATVPAPLVGRVPIRIHWCCAAHWRAVQRTERGAQWAVDGAPADVYCVPAHRNAK
                     RERRSLSASCVEAKSESERGGRSFSGTGENTAWLRDAAGEVKPQHWEVRALSSAVGAP
                     GSTLYDDSNYDAEHEKHGSLKTRSGLPHVHSHSCTDMLTCEFCGHAVERYHSEDCDDE
                     ASEASTSMTQTGRACSAPPGRFQDCHGCASAEARSLSSSKIVAFRSNQPSILTPQLLL
                     SSSESAETTVDLDMSGAISSVDVPSWSDSAREEALMAAVALLQ"
     gene            complement(<251645..>252556)
                     /locus_tag="LMJF_12_0490"
                     /db_xref="GeneID:5649940"
     mRNA            complement(<251645..>252556)
                     /locus_tag="LMJF_12_0490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681603.1"
                     /db_xref="GeneID:5649940"
     CDS             complement(251645..252556)
                     /locus_tag="LMJF_12_0490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681655.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649940"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP3"
                     /translation="MSSSSTEPTTTSSMLPAPHSSANMRHIEGLVVVPGVVKVSRSDV
                     ASQYTMPHTNNAPLLFSEPEHRAVDNSSGSNDAQLEPKDPHLGLMPHCLSCTLLTSAG
                     AQEPDDVYGRSMPSSSAVGAVTTELECAVVPTLHASFTPGVSTSIMPAPTEAHSACGS
                     RPLQQPRWGGNYDSGSQCVSFRGADRSNNVSGCGLRLVGDDVEWLQGSFEDSASSPRE
                     EVQLSWGHLQRQPCAGKSSAARAVPPALHDVREGTGGEKVLAAHHRFERAVQPQTQRQ
                     GVFPSADQENCQAAAMLWAAQQMAVFD"
     gene            complement(<258497..>261607)
                     /locus_tag="LMJF_12_0500"
                     /db_xref="GeneID:5649941"
     mRNA            complement(<258497..>261607)
                     /locus_tag="LMJF_12_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681604.1"
                     /db_xref="GeneID:5649941"
     CDS             complement(258497..261607)
                     /locus_tag="LMJF_12_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681656.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649941"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP2"
                     /translation="MVTPPPLLSSAAVTQGTSALRHFHFQHAIAAAAPSSLGFPGAGA
                     AAAAHRTSSGVAGSFFLPLEEVIRKALPVSRGGFSSRACSVYTGVRSDGTLSIIMLEE
                     YPGYTESTPAQPPRATASSPAFPATTAEGTPTVPDGREGHHSTKSPASPALQDWARLP
                     PTASAEQPVLSLSADTDASRRLLATVPQSAATGVAGATSSNNPHRQDLIDTGGVVNEG
                     VAIRDPCVGLTSGSLPRAPPTPMPPPPPGSGDSPYAASRDRTDLTCLGAATATLNAAA
                     GAASPIIALRGQSGSSVPPCGGRVCQRHWLPLGFCALPIAAGGDNGVSAPVSSSGTPA
                     VADVASRAAATMGAVMPESTEQMQLGGCDEGARRGPVPAVARTVWTTRVTDAAATGRK
                     PLLAAGRVIPSLTLFNPTELPSTGTASASLSAPQNTESDGGGSDRQRTTSLLPAWCHT
                     VAEALLAPPSPPTLHRPDQRRRTSTSGTTTAGTTTSTTVARNIHSRRWSMEARGGMPV
                     GWTAKFVTAAKRALAPQCAAVAASAVDDRRREGRVEEEEGCATPPSHSSHLPPRESAG
                     PDVAVFGNANPTGRQLPPPAPLKTTIPTSPPLVPYSSEPDGVGGGRGIVRIVAEATTV
                     DFDAHDAPHAYTQVFMEVDTKHATTTSTVLGSGDAGVAANADDAAAAASTLERARTRK
                     AQLSTSTTLCQFQGYHQRRREGGDTVANPGVDDGDLGAGAPIAAAPTITAASAQNNPD
                     DASSLNYGDARVGDPSASPTRLRTVDAAWEKRGGHASTITRSIGSAVLSLHSDAARPR
                     TRRCRSPLSAWAPAVAQLTMLAPDGTEMVMQEHSNEHPSQRRHGQVGGCASAAAASSG
                     YAAHTNSPYIMSGRANTGNLRVGDVATELPSTAEATASGMFVTPAAAMRPSVIMGSPA
                     VPAGPAGESEGGGDGGDVDHSSEGLVNTSQNTRFKGADGLDSLSIYAEAVPLFHMLPV
                     PIESVPTSAPSLVSPLQNRSEQQQPQGLSNVTKVSSVSRIPRRPLGQHPPKLGRPSGH
                     TAECDV"
     gene            complement(<279282..>282194)
                     /locus_tag="LMJF_12_0510"
                     /db_xref="GeneID:5649942"
     mRNA            complement(<279282..>282194)
                     /locus_tag="LMJF_12_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681605.1"
                     /db_xref="GeneID:5649942"
     CDS             complement(279282..282194)
                     /locus_tag="LMJF_12_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681657.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649942"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP1"
                     /translation="MVEYGKWLGMELPDDMPLLWIAREGLKAPLPDHWKACKSEKGEL
                     YYFNFKTGQSIWDHPSDEHYRELLKTEKAKLHAKENGKGDKEVTPAASSKAQVAHSGK
                     AAKKRRSKAGDTEAHETKPKAQEAAGKTKSVKDLEPIQEKKELPESLKISTMLNDGGR
                     ENKENIAAARMGSTELQSTASRSVSSLVSDAAKAPKIDEPDALPLPSKVVAGGGVNGL
                     RALDKLGTSSPEKVVTSSSKNHKAKVDQQVSKDLEEYRAQQQSNLKRQKEEIDADVAE
                     DLKRYQEGANAKKQKRRAAIEKETADALNIESARLGAELESKLAALRQDCETKLAAES
                     ERLRNKLKAHLEHDKRKVEAEVAQMLETFTREKRQESEIKKEAQSQAFQEAMKSMTDV
                     KQFSSAFLREYETALAAFAKDVQESHSVFEQIGAQRQKQMQEEMDARLAQIREEHDRH
                     VRQEQDCASRRLETLRNDMEREAEELKQTQKQQLQRMHDEFTEQRSAHQKEQLSQEHE
                     RFMETLAEIRASQAKELEALKQQLKEKAQEELNAIMQELMKEKESRRSSLSVVRLAES
                     HEPTPRMLESRSMSATDDDGDIGKGKAPPPHLDRRLLTRNSVEESAAGAVPVASPQPD
                     IKALVTEALREVFAGSPFILPSPQTGEFRTAPGTPAATASATITPSRSGQDFRSSNPA
                     ANLMPPALSGNPTKASGGFKLPLSFEEQRSLVEGERTRLQEGRRYVELQQQNLEERKQ
                     QLRRTRHQWKQDVLAAKREGVRSSSNRGQLLNKVRLTLEEQAQGLEHDMMILRDSQVW
                     LLSKEQRLITLEKQIEEQERLRSRNGGEASALNNCSVDTAALMTGFFKPPRHSIATHE
                     TAFHRDVMGYNALGSGSNLPMDNYAASPILSKALSRIERRLDEVTSIIHMQHQQTASQ
                     AMAPSLGHGSSRRHSTVSPVVREAVPGYVRRTSRSHSKSDALRRDTHLDQWQAPGI"
     gene            <291382..>291576
                     /locus_tag="LMJF_12_0515"
                     /db_xref="GeneID:12980907"
     mRNA            <291382..>291576
                     /locus_tag="LMJF_12_0515"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721739.1"
                     /db_xref="GeneID:12980907"
     CDS             291382..291576
                     /locus_tag="LMJF_12_0515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721787.1"
                     /db_xref="GeneID:12980907"
                     /db_xref="UniProtKB/TrEMBL:E9ACR3"
                     /translation="MQRVSTAASHDAAGACDRPGQRGARLMLYGRRSKLEARGEGVVH
                     YRLKSFGNGAEGVCAVKLCV"
     gene            <292753..>293166
                     /locus_tag="LMJF_12_0520"
                     /db_xref="GeneID:5649943"
     mRNA            <292753..>293166
                     /locus_tag="LMJF_12_0520"
                     /product="putative vacuolar ATP synthase subunit"
                     /transcript_id="XM_001681606.1"
                     /db_xref="GeneID:5649943"
     CDS             292753..293166
                     /locus_tag="LMJF_12_0520"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase subunit"
                     /protein_id="XP_001681658.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649943"
                     /db_xref="GOA:Q4QGP0"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:Q4QGP0"
                     /translation="MANSVRYRNGEQRIVGIIGDEDTVTGFLLAGVGDNRVMLNQREN
                     PEEGQQSKLPPNYYVVTPSMPLSEIEEAFTTMCRRKDIGIIIICQHIANDIRHLLEEH
                     NSVIPCILEIPSKGQKYDAEKDFVLEKITRALGIR"
     gene            <293730..>295547
                     /gene="PGI"
                     /locus_tag="LMJF_12_0530"
                     /db_xref="GeneID:5649944"
     mRNA            <293730..>295547
                     /gene="PGI"
                     /locus_tag="LMJF_12_0530"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_001681607.1"
                     /db_xref="GeneID:5649944"
     CDS             293730..295547
                     /gene="PGI"
                     /locus_tag="LMJF_12_0530"
                     /EC_number="5.3.1.9"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_001681659.1"
                     /db_xref="GeneID:5649944"
                     /db_xref="GOA:Q4QGN9"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="InterPro:IPR018189"
                     /db_xref="InterPro:IPR023096"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN9"
                     /translation="MSDYLSKLKEYVLESTEVNGCAPSMATSTFNAPYEVARRTKMLG
                     ATDSSLLSLPAWKRLQSLYEKHGNESILSHFESDHQRFGRYSIEVGLHSEDNFLFLDY
                     SKSHINDEIKDALVALAEERGVRAFAKAMFDGQRVNSTEDRAVLHVALRNRSNRPIIV
                     DGKDVMTDVNNVLAQMKNFTEKVRSGEWKGQTGKSISNIVNIGIGGSDLGPVMVTEAL
                     KPFSKRDMHCFFVSNVDGTHMAEVLKQVNLEETIFIIASKTFTTQETLTNAMSARNAL
                     MDYLKAHNISTDGAVAKHFVALSTNTEKVREFGIDTVNMFVFWDWVGGRYSVWSAIGL
                     SVMLSIGYDNFVEFLTGAHVMDNHFASTPTEQNLPMMLALVGIWYNNFFGAETEAVLP
                     YDQYLWRLPAYLQQLDMESNGKGVTKKSAAVAVQTGSIIFGEAGTNGQHAFYQLIHQG
                     TKIIPCDFIGCVQTQNRVGDHHRILMSNFFAQTEALMVGKSAEEVRQELVKSGMSGEA
                     MERMIPHKTFTGNRPSNSILVNALTPRALGAIIAMYEHKVLVQGAIWGINSYDQWGVE
                     LGKVLAKSILPQLKSGNIVSDHDGSTNGLINMFNTRAHL"
     gene            <296576..>297079
                     /locus_tag="LMJF_12_0540"
                     /db_xref="GeneID:5649945"
     mRNA            <296576..>297079
                     /locus_tag="LMJF_12_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681608.1"
                     /db_xref="GeneID:5649945"
     CDS             296576..297079
                     /locus_tag="LMJF_12_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681660.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649945"
                     /db_xref="GOA:Q4QGN8"
                     /db_xref="InterPro:IPR003718"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN8"
                     /translation="MQRTATRCFFSSFTRGFSKGFWKDAGGASGGLGGSSGSGGASLF
                     GRKGGSSGSNGGNIFGGFGGGSDFPPGGPLGGFFDKALEWCSESHARDIAREMGVDLR
                     DIRFEKTPEGGINVTVDAPKATPLQIEQLGKRVQEECPVARFRKTQISSPKHEMKWVQ
                     LPPRYDR"
     gene            <300572..>302071
                     /locus_tag="LMJF_12_0550"
                     /db_xref="GeneID:5649946"
     mRNA            <300572..>302071
                     /locus_tag="LMJF_12_0550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681609.1"
                     /db_xref="GeneID:5649946"
     CDS             300572..302071
                     /locus_tag="LMJF_12_0550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681661.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649946"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN7"
                     /translation="MHSEQSICEFIHMQRELRRCYATMENYEVVIAQLRDDCALSRAQ
                     LCRFQQEHAQRGKDVEAQVRAELTEQTNARLSALRQSEASDALCLKTSAGPDRNTTDA
                     AEEYRRDTCQATLDELRRALQEEQSAHAECLARLTEALAAKARWKSRAVELLKWRKQV
                     CGQMYMSSTPSSSSFVAGARAIGTCGALPGVSTISNCASDSQAEPNAGNSASDVSSPS
                     QRLYRPPSPYKPPPCVSSPSEAGKLRSSMTSEASAALPASPYEGGTGACAADKENEKD
                     SSSTPGADISCQSDSTAVSFLSPSTTPAGRVAQALGSGVVVVWPPLAERQEMSTRKSA
                     ESSRTQSSTTAAALESGNPALLDDSGKQGLQPSPPTSSVSPGVLPSSVGRYTTSAVGS
                     RTQAGCRLPLVGCEKAVVAAEPLRVMPDPFAFPRPPPSGGVTCTNHSLLSTSDELPTS
                     CDVSAAMASSAAERQCNELLRALLDKEQQLALIAEERTKYKRLYEATQS"
     gene            <305395..>309504
                     /locus_tag="LMJF_12_0560"
                     /db_xref="GeneID:5649947"
     mRNA            <305395..>309504
                     /locus_tag="LMJF_12_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681610.1"
                     /db_xref="GeneID:5649947"
     CDS             305395..309504
                     /locus_tag="LMJF_12_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681662.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649947"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN6"
                     /translation="MPPKRKESANGAETGRSAATVKRRREGQRSEFSSSALHSTFEAH
                     VTAAQNSFLRGDSQAAEHEAVQALRIRPTAHLFALLAVIAESKGKFDQASDFRLLQAF
                     LARDIVLWEELLHDFMTQQLYYKSVVCLQRMSALEKNQERYRALQLQLADLFIGLGEI
                     RRASNVLVPLWNSSRCRDFEVFALLSSLYFQLGKWASLQRLIESSVKHAFQLLPTAEV
                     TGATTTAGETMGHGAEATAQVSSSTPGTEQQLSSPPPDSSISEQRVSKRVRFFGMDAG
                     EDGAAAPVTADLTAPTAPMSLSPAEASLDEFRFDDFISPASPLSHPPSSLRPGDTASS
                     TGAHRGGVVHQLYGERIELRSSQDQKNFLTLVNVHAELLNEQGNFSDTVQLLRMAAGC
                     LDVDLIELPPDLLVRLGVAYAFLGGVYEQPCRDVFQHLVAHCSMEDYGDVLLDAAMSL
                     QKVSMHAEAAQVYVTLARYHQFVYDRVRRQVGVAEAELTLMQDTAPLDQVQAATDALK
                     ALKTEEADLKTVLAAALQGQAQSAYARELYEEAKEYAECVLQLEPTHLQARLLLGRYY
                     FYQRKDTAAAVEVLTPSKHEPALQRIQLGVFLVHVFQRAKRYVEAIALGVSIFELLLS
                     SEEDGDTRSVAPGTSSRRSGASLYLPTMTRASSAIIPASSLAGMVGGSASAGGSNVAA
                     RTSFSLAASIKASTSVARQQLARRGLESLTTTVYGASAAASLAAGWDRREEEEQLKDT
                     STIFRFNRRRRRPGGERRAADDALSTDEKPEGPVGDAGERSGDATVHGEPGATRLKTA
                     EERRAAIISMEPAAFWPAEEGGEGDGAEEDQPAPSRAKPGAEKSSATQSIKEEEGGDG
                     EKDRSRADALRPPVKRYRGGERVTDTAAAEAGVVKTSSDMEGKGVGKRTKKASAGAAV
                     GRFNNTIVGERDRDLAELEGFLIEAEAIASAEAELAESSGNAREVAAGPMRDDEQHDD
                     DAVDALPESYELPSLEEVSKQFQDPAMAQLFLAASSFTPGGGVRSGEGQDSAQNPWAD
                     LAEANHNASAAPGLPAGTGLEDKVTLREAVVVLGKAGFIALAVAVVECYSAVGQFTEA
                     REFAFVALTHFAQKRRLRQMGSGLERPLRLAVLRAALAAGESEDAYRVGLRLLQQDTA
                     EDKRHEVVELMHSVLNRCYDRSSILYRAVADGYNDPALLVLLANRYHQTRSYTRVLNL
                     YLMALRERPSDILLNFMVGLSYLFCSHRKRTRSREACVSAAIYYLTQYQQLRLALEPA
                     VGIGEVLYNIARTLQFLKLYYLCIPLYERVAYDLCPPEECTIALQRAARVNLYFVYRW
                     ASGNRTLALTALQPRSVPNGIAVASPRPPSPFRLKTDGKILNVPSQRTP"
     gene            <312162..>317786
                     /locus_tag="LMJF_12_0570"
                     /db_xref="GeneID:5649948"
     mRNA            <312162..>317786
                     /locus_tag="LMJF_12_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681611.1"
                     /db_xref="GeneID:5649948"
     CDS             312162..317786
                     /locus_tag="LMJF_12_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681663.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649948"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN5"
                     /translation="MKESRGFEDLSMHDPVLPYDQSKLGIQSRRLAAQGVLTAGKLRA
                     LEAQQAECGGGSTDYRNPHQLVAYSVAGGSVRPGAYLARCQAAQGGVPVFVAQEEALI
                     ASTRHHGRTLSEQSGWRRGGNVRSVAGGGQSMVGGRHAVTALPSSRAVTTLEAVTGGG
                     VGKTIPSSTTCSASFRTHAANGGILSSLGSGDSKPGIEEYKLTNIFQRKLQHTNNILY
                     AMESSCGGVAESSASNGGAAGAPRGTGEEKGAAAGGGGGGGSGGGGGGGGGGGGGRSS
                     SNSRSGKGEPGKVAKNSRSDTERVGKYKWADVKKMDTEGDEDERDERNFRTRNIDALH
                     AIPWDQRQQLPMSGFGTRFFALLSTPRFWEKLDWTVRASLLTVLPTMVLSLEPSTSHM
                     FPLPSSLAFNAFWITMPTFGSGLRELIIALKGFSVGLLFVCIVVGTHAGPAWLSLLML
                     FFFTFISSFVAEETKKTAAYVLASMIMKYIVDPVETDFRYIGKYYIGLLIGLAFGTAG
                     FLVPFIRWSSDIARHYIKAMGNSLSIDLQGTLSSFWVRTPLERELNVVRLRQLRATAE
                     KCLSKIETALDESEYEPHTGAYMMCMVNRFNFCKSIHNILGSLSHVIELIADNPSLID
                     TPMCTAFGEQIGDHLAVISSAMDSMVLKIVDFQRIVTPQEIQFFREARERFQDALSRV
                     REDVILTNENYQTEESDVLLGFFMFSVDEMCEVISQFDETAHPPSRLLNAMLFPVRDV
                     KSVIAAFRNLALTIVRRRTIPRRMKEAIKLSLCMVVPSIFQVYALDNSSVSPAAGAAV
                     IALIYNPTGSESFHYASGRLLGTVLGSIGALLSVQVAHGHLWVLYIFIIILSFIGAYV
                     QAAPGFYALGNAIVSSTISVCTQYQDENAAMVRIQQNCFAILMYFVIACILWPMHART
                     KVKMSLNVTLRCTREAVTRMLRNLDMPYDANEVTADVSALLIEMNKKVRTQSRFIPGA
                     VEEPTMGSVEYPEDSWKRIVEAEKKLCLALSMMCFAYNTFMSSRADPTTELSVHWVVL
                     HRIAPHAQDLSDLIYASIDLYLLSLSKMTIVPTAHLTRLRVGMVDANQAILDTYMSTI
                     FRKVAGEQDTDEGDMYSSSSYMDDDEYDNDNNAGYRGGEHGSSGGPHLPPSRGGRSYT
                     AKADGGVDSTASVDGKAAAAHAANRPSEREGDEAKVGNNDDPSASPKPRQQRRRVDCD
                     HGHCRGNHSSEDSSDLSSSENGEHDDNANAHPHKKAGGKGGDGKKKMGYLGYELTAEE
                     AAALRAFVANRVSNATFSTRKSTVVNNSTFGGRAAGGVPAAAAAAAAFAARASMAISG
                     SPPQGNNDARLMAVTGGDDGLAAALRKKHKVVVRRGRDEENDGDAEEVGAEEQHNEGR
                     AKSGRNDVDNAPGIFNTSFLNNSFMNNSLLGSLFAKRTKEPRDLDAAEMPQLRTGRSR
                     ASSESSTTSARSQRDGKKKKQQRRHPGKRRDAQDSDSGDEGVRQHSTPLTSPAPHPRA
                     SSVGSEFSDIEENPRPRNQRRSSGKVLRSSGTVAGAEKAKADERPPMAHSTPEVLPGA
                     DNLATNPLGEAGAGGEGAAGGQRHLPPMSQSAPMTSGRGSAAETVAVLRKEGSIEASQ
                     QQASTLTAGQLCGVAANSTVSFSGDDAAVLGASLNNTCSAATTISHHPTQPLAPAPGS
                     SSGSPEDHKGSPPRACSSAEEGKKCDNRDSNTRRAVSGKDGEEMTHVDTEKQQPHDRS
                     GDTPDRDVGASGKAWEGQRDATSAVEKDTHPLLDTASLRHTLDSFGSRPSSKLRRRSL
                     GIGGSSKCVPAMLDRSRDGDGTSMTPSDGDEILKGLSFFNAASGEFVLTNHDIHSLEA
                     FLFGTRALVVHINDLQKALLEMQHATDLARLL"
     gene            <322931..>328507
                     /locus_tag="LMJF_12_0590"
                     /db_xref="GeneID:5649949"
     mRNA            <322931..>328507
                     /locus_tag="LMJF_12_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681612.1"
                     /db_xref="GeneID:5649949"
     CDS             322931..328507
                     /locus_tag="LMJF_12_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681664.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649949"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN4"
                     /translation="MSNASALKDPVSTKDEKTLYAYQEQPPGQVSPKPPKPYVHRVAA
                     ASTPSVTPEAAAAAAEMPSNPEGQRRMMAAGTSDPLQEWGQEQSFLKSRFCHPQRHRS
                     NGAAKGPSDESAGATEMREHLTHAGADLWPPRSAEGKGDHSVATAAATKSEDILHVFG
                     GQAPSPPQARRDAVESNGSQDGQQQGGKGTSGGGAGARKGEGSSGGGSEGEGPLPIFC
                     TSEFMMQPKNVKASTWASLAVLRMRNMNALRAYSWDQRVFLPQGDGFMGTIFELLASP
                     RVWEKVDWAMRGSAIAILPTLIVCLEPTTSQIFPLPTSVVFLAYWTSKPTLGAGLCET
                     FTVLKAFIISLAFLCIVVAIQPGPKWLTILILFFSLTIGAFAAQQMRVMIAYCFASLL
                     MQYVAHPETTGYKYIGDFYLTLFIGQGFAVGALVFPYIRWSSESARRYLTVMGDAISL
                     SVHGACCSFWVESSLLERQLHVARLRQLHQTIEASMAKAEKGLSEMGYEPHSGVYTTR
                     LKTRMAFLKNVFNIVQSMTLVIEQIAANPTLIETPMCRAFGERIHGELSVAAAAMDAM
                     LLRVVNLDDLVSVADMEAFRCAKARYEDAVSRVRDEVILSNEDYRTDNSDILLGFFLF
                     SVEELMESISGFQDAARSQNNLRYFLMFPLRDLQSLWSAFVELHSAITLRHSITRRLK
                     EGIKLSLSMALAAYIQTYALKSSSTNPILGVDTIAFLYRSTGGDSFQYGQGRLLGTVL
                     GCLTGLFGVQLANGSRPVLYMCTLVLTFIGSYVQASPTCGAIGNGMSNGVISVVLQYT
                     NRDGAIVRIEQNCFAVIIYFIVTSLVWPVRCQTKVKTGFDGCMRMSREVTDRLLRNLD
                     LPHSAKAVSSDAMALLEEMQKKVGQQLQNLTGAQFEPTMDSAEFPEMAWRMLVSTQRK
                     LVVTLLMMRHAYATFMSSTIGEEAADSRSANGEASGGAAAAATSISVHWVVLHRISPY
                     TRQLSLLLYAAMEVYLLLMSKVTFVPTSELTRLRLGMMQCYDRIVAVYIETIQHELRD
                     SDDDDNGGGFDDDEDMADTAAKQTGSAGQATAPATAGTCVPVFTPSGLVVDAGAQENK
                     SFLDSTTGPKSHADLHARRRRSKLSKSANSERKKNDNGGGRIAYKLSPAERQRLREYM
                     FAQHTASTLNASFFASTTAMAADQETGGPSAALGNVDAGASFASHSMFNLNGTFFDRR
                     ASMLDPALLRNAGIVVQEPVHEEPKAKRSNSSVSATLSAHHSTVHSSRRPSFLNLRSS
                     VANVDGAVVIEVPGTEASAVTLPVFPLGLDRPLTIEGPLEGAVSAPPSLGHSCVSVAS
                     LGADERQQQRQLSGLPTLESLASMPLMSAAPATSKAKTLAPRPSVLQSYTVVPTSASL
                     AATQLSVVGAAANAQGVSGSGPHGSNAGGEAADQAAPSHGALLSPSRALMAATAGGAR
                     VVGGDVFALGRGARSTLQSHLGLMGASQHADRPLGADDSACHDDGASECSATHTAAPA
                     RDAAPTPAPVTAGATPRSDRAPHPIAARSATVPGEQGVYDERSTAAESSPEFMLDGTP
                     GGAAATNSGGNAGTEDGEGDWEGAREALGTLLSDRSPHPDNRTGRVAYRTASSQLAAT
                     LPIPTAAAAGVDAAADEHAASSGTNTFPSNLDNNGSFNGVGPAIPAALRSYVEGLAAH
                     QQQQAPPPPALLGNTSYITFSSNLPVMNRTLLGGSGLGSPAANPEDSVRAGPTLTASA
                     VAAASSSGGGAPAASTSAFPGAAPPAAASGAACTEDACLRSVGLNNNTTSDVADMLRS
                     FHGTQSFHPVLLRLLQSDGADGSEGGKNEYVLTNSDIHSLEAFLFGLRALITQVEDVE
                     RYLLEVVHGREMAKKL"
     gene            <330247..>331806
                     /locus_tag="LMJF_12_0600"
                     /db_xref="GeneID:5649950"
     mRNA            <330247..>331806
                     /locus_tag="LMJF_12_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681613.1"
                     /db_xref="GeneID:5649950"
     CDS             330247..331806
                     /locus_tag="LMJF_12_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681665.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649950"
                     /db_xref="GOA:Q4QGN3"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN3"
                     /translation="MFGESYVESGASKAAHGGGRYTTTRIESPALHAAGASFSGANGQ
                     QQHLRSVKEIIATLDEEHEISGLKGGGCCSRIFVPFLTLAMMIAIFVAIVYTSGTGSE
                     VEASPRVAMIVLEGFSGTVFHALMESGVHMPNIAHMLSSQKGVWAECATSSQSSCARA
                     VVVENDTSGEVYVSAAAAMTSLFSGVSPREHQVYNGSLESMSMYANTSKMNPSIAKRV
                     KDAGMKVSVVGTSHAINSLSIALGSCSRPGVLDMECAASREELLRASVDEYSGSVQLD
                     CLASSSCNMDTRKMTSPTDPQQCSSGQAEAQFTRHLNSIFGGLAYSTQTQEAAMQNTV
                     ADNLDNSLFVFHFDALAVRAASTYLPDFQYNASSKEYVAQVYLLDALVGQVISYVRDR
                     ARSQKENWLIVGVSNHGGDDKPYAIPNPVSTSENTIAFFMATYTNNMKRFVTLAPLQR
                     PVTQLDVLPTVLTWLNVVPFDAETSAVTAGTNTTAASPAVEARVMERRHFEGLVQGIC
                     SSGASLKNCAL"
     gene            <333324..>336401
                     /locus_tag="LMJF_12_0610"
                     /db_xref="GeneID:5649951"
     mRNA            <333324..>336401
                     /locus_tag="LMJF_12_0610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681614.1"
                     /db_xref="GeneID:5649951"
     CDS             333324..336401
                     /locus_tag="LMJF_12_0610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681666.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649951"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN2"
                     /translation="MDGVALQCERRGLTNAATWLSEMSLHALPSLLATPLQACSYGGH
                     GGNSLFSPLHRAIHLDSGVFGDHAIAGGVRSTPSAGWQRLHRVALGYFIKGEYQRCHH
                     LILREVMRNTAVGSSCGVPLPSTTQRTWPMPAGEVPDNEGGLSLPLPEVVRGFRTTTL
                     PPLLQFLSLYALFMDGVKAKQLSNNASQGGGAESSSMGRGGQQRALHPHARVLRAYLL
                     EAMRNPVNMLNLPSSNNSDPEPQHGDGGDDGAALHVAVGGALPGAHHTSSAKRPWTTS
                     SAVWLASRAVSAATTTGTAAVMTAGASASRPAATKPASCTHDTASPCTAASSVFSNVS
                     PAGSPAAKAAAVQGGESEAAPTSDLLHIDPYLSWLMGVVLRELRMRQESATFLLAAVS
                     VNPLLRCAWEDLACLVSRETQLAELDAALDGLEPFFMVDIFAAEVRGLLGVTPVSSAR
                     LRIAAAAASAPSDGFEPSPPCSAPPEGHAATTTATAAKAGTRTSPLLPPPRTNAGATP
                     PIPAAALSNAWECFSLLFPDTPFCLSQLAHFYYHQRNRLDRAEALYQRIRALDPHYLA
                     ILYDYSNVLYTKRDRLGLSSLAQSVYQADAFRAETNFAVGNYYVLLGQHDRAALHFHR
                     ATAIDPQCAEAWLLLGHAYVEVKNTTAAVEAYRTAVELNERDYRGWYNLGQIYELLEA
                     YHHALYYYWHTTSLRPADPGMWVAVANCLEHDGRIAESIACLERAETYDSSSSPSYPA
                     YVRRIATHHIANSSYTRACVYLEKLAQSPAASTEDLLLALPFIVQHYVQRARSSVEGF
                     ARSSSYDTVLFSPGANNVSLMSSPASGAVAAGRTALHHARAAAALQHLNKAEEHLSTM
                     AELVMPSGHNGAGNEEAAQTPATSAAAGESEQGGAENTAPQRAAEDAPHRRRTRQPRS
                     GAAANASVSASASAALAAVAASTAPSAGDVPPVAFVRSRHQEIGMLRAQAMHLLQIGA
                     GASGSTIPVAASASASVATQPSSSSSQQQQQQQQQRHQQHRNPFVSQLLGRYQ"
     gene            <337942..>341892
                     /locus_tag="LMJF_12_0620"
                     /db_xref="GeneID:5649952"
     mRNA            <337942..>341892
                     /locus_tag="LMJF_12_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681615.1"
                     /db_xref="GeneID:5649952"
     CDS             337942..341892
                     /locus_tag="LMJF_12_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681667.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649952"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN1"
                     /translation="MVPAATEEASGRHFPCTAADDAIAHSVPLPLLVEQQRHRIRALV
                     QERDAAAAELSELHTLFQRLHDDYEETTREADGLRLQLSSLRAQKDMQSDEHRLLRSS
                     HARQQERIEQFEVEWANNSKHLREQLDALVSERDAMQAQRDASMADSNDLRRQLIQLQ
                     AEVHRAESKHREALREQADTHAQQLRSALQEKEEQLQAKAAATRREARLVQQELDQLG
                     AGHTAAHEERESMRWRLSELETVVTKKEQLRVELERMVTMLRSRLDDQEEAARQDVQR
                     YAQRAQDLELLYRGQVAQEQRRAQALQDDLAAARKATQEAMRQQEALQQSHSEQAKDF
                     ATRAAKLEDDLRQQLRALRRELEEAQARALEHEAAARRSQRDADTLRATCASEQEARE
                     RLQQAQTAQAQQLSRAEGSVTVLQTRLREKEREAELLRCAMEQATWTREMRQAAHHTL
                     ASLLGVPRVSVRGGRRRVKEGEEAEGWSPALQLEWAAEAQGTANSPSPREAQQRSDSA
                     PTGAGDTAYAVPEGGESIPSSSEVEGVVPSPFRGAARGMRAQRDPAIASGSPQRPSAT
                     PTKAAAGQHVEAIERTVPRDTGPSDGEGHAGSSTEASHLLQPPLLFRAASPLTAAPPL
                     HPGTPRAAGSSSPWPGQGSAGYAAAASSTTAALRSGGAGASPFPSLLRALSFVPAQAT
                     AGGANPLRTATSVARSQPPSTPLLSCQQVGHIYNIPEEEEQQHHPQAAVTGGHASGAA
                     YAAEPARGYSRTRRPQSATPLSRQAGEVFFDDVVGPSRAQRFPARVLIRGTDAGAAVP
                     GSHQRQETSAQLVTASTAQVGTFNTHLTPSTYRGSLASSDGVRGAGGARDAQPSFSLG
                     DSPSYDHGASVPGVCAAELIAPLLHPSSAASNNAPAMQRGVSNTNRHRNVLHGGDSAL
                     QQYLRDTVQQVLAHHGRGGAPQRGSHRALRERPDGGSAIPAACGYHGDGVNSAGEGDE
                     DDFGSASLLRSSIAVPFVRLAPQPAYTGGFTNSGGATHMIGPGGSSQGDAGQHDSERE
                     HSDAGGAAAVTWNGSSTAATPHKTAAAVSAAGETVQTRRREGGIFQTLEQLAGRQQQL
                     LQSLSHPPHAVMSPTAHSADVPSSLPWQTTAADPSFSEALRSSASIIVPTSLSLQQQG
                     QREPDDSQGVARSSVGVVAAGEAPADAARSALTVSASLSNTNSAGFGKNTVAQSHPAA
                     SARYAKGSDAGTDVELDPRQLSYSTTVATTQLTDVKQRDRSAVKQDMVDPTAAAAAVV
                     QGPQPRAERQAAWSSEPALAVRAVATTTASARSAPSVSEISSLSQLERRFATPF"
     gene            <343177..>344670
                     /gene="ALAT"
                     /locus_tag="LMJF_12_0630"
                     /db_xref="GeneID:5649953"
     mRNA            <343177..>344670
                     /gene="ALAT"
                     /locus_tag="LMJF_12_0630"
                     /product="alanine aminotransferase"
                     /transcript_id="XM_001681616.1"
                     /db_xref="GeneID:5649953"
     CDS             343177..344670
                     /gene="ALAT"
                     /locus_tag="LMJF_12_0630"
                     /EC_number="2.6.1.2"
                     /codon_start=1
                     /product="alanine aminotransferase"
                     /protein_id="XP_001681668.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649953"
                     /db_xref="GOA:Q4QGN0"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4QGN0"
                     /translation="MLRHAARCFSPRQCYVSPRVMEAEYAVRGLIPARADEIKADLAT
                     GHGTYSFESLVYCNIGNPQSVGQMPLTFYRQVMVLVDAPFLLEDAEIVARLPEDAVAR
                     ARRYLSEIGTGTGAYTESFGFRFARAAVAAHINELDHGVSPAATVNDICLTDGASMGA
                     KLFLQLLVGGASDAVMIPVPQYPLYSAQIALLGGVKVPYGLHESEGWVMKLSDLVAAY
                     ERCVTESGATPRLFVCINPGNPTGNVLERCVMEDVVRFCHERGMLLLADEVYQENVYD
                     TRRRFLSFREVVLGMPEPYCSETMLVSLHSTSKGVIGECGRRGGYFCMTNLPAALRQQ
                     VVKLCSINLCANVNGQLMTALMCSPPREGEASYALHRREYDEIFTGMKERAELLAREL
                     GAVRGLSCQPVEGAMYAFPRIVLPERYAQRNEELNAKEGRQLALDARWALELLESSGI
                     VVVPGSGFGQEPGTLHFRITILPPLEQIDRMVRAIREFQDRIYEQYA"
     gene            <347231..>348862
                     /locus_tag="LMJF_12_0640"
                     /db_xref="GeneID:5649954"
     mRNA            <347231..>348862
                     /locus_tag="LMJF_12_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681617.1"
                     /db_xref="GeneID:5649954"
     CDS             347231..348862
                     /locus_tag="LMJF_12_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681669.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649954"
                     /db_xref="GOA:Q4QGM9"
                     /db_xref="InterPro:IPR014819"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM9"
                     /translation="MLARQEKKSTAFSFLHFRAGERFYQGHWESVVDMQAQLDAFTEA
                     AQTTLSKRISRPYLRGTPIPGLTLFNNDLGLQSPLVQCSYPLIVAQRLLLFPDHLRHF
                     HTICGRENVPCDFYADIDLPGESTAGAEKTLLEVLNYLEVRLPGVGFTDPFFLVLTNA
                     VPSRDKVSYHIHARSFTHMKHRPLANSAEASTSGRAKRRPARQRKAKAAAAAAPADRT
                     FGEDGIDEEHDEDPYDDLSDMVSAVDVGGKGSASSRGGSAATPKVVAFQDYRAVKLIA
                     DEVNQTVGRDVVDHNCYRTNGMLRCAFSAKMPSAQDHNYHQQTDSGAAAARKRLVPLV
                     TASDPALQQRLSETESVLRTMTDPEVLELTFVTRHLDADPKVIKAARKRAVSLLAHER
                     DAPAESAEQLRRAAVLDATTKHRFKLIRPRQIMGPQATRAVEYDAYGNVVPPFLTEAA
                     KWRRFKAVTAKLRTLPPRAAESYDVWVRVGLALHNFSNEDHVFEEWVRFSLKSPLKYS
                     REVCRKKWVQFERNPDALNWRRGFNYLNSTVWRQV"
     gene            <351234..>353690
                     /locus_tag="LMJF_12_0650"
                     /db_xref="GeneID:5649955"
     mRNA            <351234..>353690
                     /locus_tag="LMJF_12_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681618.1"
                     /db_xref="GeneID:5649955"
     CDS             351234..353690
                     /locus_tag="LMJF_12_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681670.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649955"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM8"
                     /translation="MSVCMCVCVFVCMMIATPSMLMAPAVQMDVSAKDVADTPKQKGR
                     ATTQSEEDKVNAEAVSAKHLTQHPTPYLKSSPYTHTHTHFSIYTFLFLCVSPHTPCVS
                     VPVCVNKREARCLSPLSLSLSLSLQLVAACTRSLTLCFSRTTDRGEEELFARRLCSVN
                     PIQAHAGTDTDAETPWRSGEACAIFHFCSCCSPTMTQPPGASEKEKTARLIESLSRDE
                     QVKLLAQALLREYMHRRGLRETLRTFDAENPRDERTISSRALMRQLLNIPVEGRPSRL
                     QPTASSSSAKPQAPTFMEELCSYRLTKNSYRSLDGKRGGEQQRIQEEDPSDVELRALH
                     EAADAQRAAKASGEQKQREYDELLAVEEAYEQRKEGHKERRRRKHKDKRGRSSKQRSC
                     GDAGSSDDEAESESEQSHDSEGKEGAALDAGYSHASRRPHPAPLGKRRLSAESGSGAN
                     AAAVAVGAHWQPPGSAARAGDDHSTSGDGVSRRSAKLISGGTVHLGLGNADSKDRSDD
                     ESEADPFGLSGASRQALMARVRAESEHWPPQAKGGAAHAHASSTSNGNGDGGAPDSIL
                     STAPAALSTLAGRGAGDRGPASLSGLRSVGRAAAGFNPNGTYASPSFSGSLSATVPAG
                     ATGGMAALHMKASSIPIPGLGADGVVRGLASTYSNGFASAMPAVSSAPSILVKHVSAR
                     QQCDDGAASDGPLYSYDRTAVPRSSALAGSSGGGSARTAAARSPSPNACALSESVSPV
                     FSHMTSRSPASNAGNGGNAGGSGGGGGSGLRHGIGFRTSSTSAEGTASSSASFTGAAD
                     PAAGAAKPSRKERRVKLLVD"
     gene            <355708..>358572
                     /locus_tag="LMJF_12_0660"
                     /db_xref="GeneID:5649956"
     mRNA            <355708..>358572
                     /locus_tag="LMJF_12_0660"
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /transcript_id="XM_001681619.2"
                     /db_xref="GeneID:5649956"
     CDS             355708..358572
                     /locus_tag="LMJF_12_0660"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase-like
                     protein"
                     /protein_id="XP_001681671.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649956"
                     /db_xref="GOA:Q4QGM7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM7"
                     /translation="MGCDSSKEGVASNTASASSRGSRNCAEEEKGGRRTCSNDSTEVK
                     GKSGASGAHNGGAMADQSRWPTCHFCHRKVPDKDYNAHTVMCDEREVTCWNSWCRQIV
                     RQGDLQKHLEECGRRQKAICPKCGAEILAIEMLAHRDSCQPKPCPQCGELCITRIHKW
                     CPKTILAKVKFINGPFATEALQRRFMPPGKEKDPRAKLEYSVARMQLLWRWIKCKGMI
                     EETIFRSVYKEMDLKKEGFAIFKAHDKVNEQHVMAPKRSRSVIQAPVVAPATSSHYFP
                     VNTNIPITLHHVEQMIKDIKNRVLLPYPAAWRVFTDAMNHLNTMPNVVRVSPAVGARV
                     SNGRVIQGCKVVVVGDLHGQIADLLHILKESGMPSESNYYVFNGDYVDRGACGVEIIL
                     ILFSLMLACPKYVTLNRGNHECDYMNDEYGFDVEVSTKYDRNVFRLIQRCFCALPLAT
                     LIGGKIFVVHGGPPRRRGVSINDISRIQRFRQIPIPNYSQPEEDEIFQDMLWSDPVED
                     IKSWRESQRGAGVEFGSDVTMEFLENNKLELIVRSHEDCLSGYEEHHNHKLLTVFSAS
                     NYDGPNSNYGAICTFIGDNPEPSYHTYQMFEDEYDDSQVVSLTDSFTLTAPNIARISS
                     FTATVGSVGFGVSKSNFMSRVLLHRRTKDNILRELRERIYQRRHRLLAYFSKLDRTNK
                     GSLWMIEWVESMRNVLNLDLPWYFLRGYLVEVDDHSRIWYAPFLNRFHNVLQDLWGEE
                     WRQSVCARVLQQQRMNHRSQLVSAAFNKEVVNYNEFCSVMRAIDYTTSDCQLFQLFES
                     FDEKGNGHISGPEFLKKVQQIANGKPDPLRWDIDAMEQLQNIVIQGRSQLPSLFRVTS
                     RDKALSRERFMAGMAQLGRCMRKQLTQPQREAIFDFMKQRVPEGEEVTFDMFLLCVYV
                     FDRRTVAGMKSSYSLSDLNELGLAPISFRNTSFSGLGTSR"
     gene            <363897..>364928
                     /locus_tag="LMJF_12_0670"
                     /db_xref="GeneID:5649957"
     mRNA            <363897..>364928
                     /locus_tag="LMJF_12_0670"
                     /product="cytochrome c oxidase subunit IV"
                     /transcript_id="XM_001681620.1"
                     /db_xref="GeneID:5649957"
     CDS             363897..364928
                     /locus_tag="LMJF_12_0670"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit IV"
                     /protein_id="XP_001681672.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649957"
                     /db_xref="GOA:Q4QGM6"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM6"
                     /translation="MLTRRAVSSAVGAAMVTSSSVSMQRRYDHDRWYGHALELDTHNY
                     KFNGEPPSWMKTRAKTEEETSFAKSVLPHIDFASSYECLLFDADRLNTNLNRKEFGNE
                     IKYRLEKQANTVARAQQLLRDKKAGTGPDAEKVENTLIARIFDEEHVQAEMKYVKCIR
                     ANELAEDNRLDILPGGSPNSLREKTRWNLNTELHPADRAEIGARLTAWLPEKYHIVYF
                     DDFQTVAANDATARKEMLEIVESVQKEYTAEAKEGGYESDLKEAVAELMDDVDPTRTI
                     TMEAIKSCKDLQQLEDWSRQVHEYNGDDRIIAIYARAAEITKNVEHQALVRQMREWRK
                     LATKNESKL"
     gene            <367308..>368606
                     /locus_tag="LMJF_12_0680"
                     /db_xref="GeneID:5649958"
     mRNA            <367308..>368606
                     /locus_tag="LMJF_12_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681621.1"
                     /db_xref="GeneID:5649958"
     CDS             367308..368606
                     /locus_tag="LMJF_12_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681673.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649958"
                     /db_xref="InterPro:IPR006606"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM5"
                     /translation="MRKGRSGGTSSSSGTSKGITKAFTFWQDREIHFDAATPVLKLRE
                     NTEHVYATFDNVEDTKGNNGCPGTLLVTNLRLIWRCKQRPNVNLSIGYYCVHKLTVQE
                     AESKLAGRMTECITLGSKCGASRFQFIFSVAHDVGDIGSGSAASTSTSGGAAAQRDCE
                     NRSRRRPSKGTGGHQRLYATIRAVWNAYESTRVYRELRVRSAVVQHGNLILLDGENVI
                     SRTSGVSSVSKDEGHLGTFIVTNIRVVWFAAAEFFNVSVPYLQFVGLRSQMSKFGQAL
                     VIETSSYASNFVLGFRVDPEEKLNEMYAEISSLWRTWTARPLLGMKVELHDDTAKAMV
                     PESLGVGGGGPGGKSGSAEHPHSGRIPGAAGDAQHERQMEGQSVLQEAPTDALAAYYA
                     AGGRKGEDRRPVYEPSIGLAVEKLRKGTTIQSLWDTSMSS"
     gene            <369810..>370310
                     /locus_tag="LMJF_12_0690"
                     /db_xref="GeneID:5649959"
     mRNA            <369810..>370310
                     /locus_tag="LMJF_12_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681622.1"
                     /db_xref="GeneID:5649959"
     CDS             369810..370310
                     /locus_tag="LMJF_12_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681674.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649959"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM4"
                     /translation="MQIILKNRNRFFAVALWSGATTVVMFWLVLRRTGFNTAYSRCTY
                     LVMMGEYKQLLEPGTFPSNDRLPPHLRLDKLSYLDLRDTEIALPPVIDVSLSNRDQVR
                     QLEGQLPSTERSDLHVHFGPIKSQTIIMTPSSNERYVRRRLGLSEKDRKNLEAESQQA
                     FAQARS"
     gene            <371325..>373865
                     /locus_tag="LMJF_12_0700"
                     /db_xref="GeneID:5649960"
     mRNA            <371325..>373865
                     /locus_tag="LMJF_12_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681623.1"
                     /db_xref="GeneID:5649960"
     CDS             371325..373865
                     /locus_tag="LMJF_12_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681675.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649960"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM3"
                     /translation="MYASLGISSEQVYGDMYTAWLRDTHEKNTPDVKRLYTTTIEKGF
                     GDQKILLRRQRLGANFISSLAPLLHQCSLVKLDLHGNMLRDVGCEMLIHVLRDAPQLT
                     YLDLGANAIGCSSVLTSGISGGGAVFKGKVGGGSSPAGALAPRRGGAGSSGGAGGSGA
                     RVSSSYLNAMQGLGNAIAQHKRLAVLILGSEREEVYVNQIEAIGAMLLLEGCVLSRTL
                     KRLDLSGNPFAMDGDTPFAGAVPGPLAAIGGAAAGTRVGSASTQMDTAAARGGSAYGM
                     RSAPRTPVQLIAQLLRTSVTLTHLTLRSVCLTDGGAAHLFEAAGASRTLQHLNLSANG
                     LSSRVADEAGRLLQQRTAAARGGALGCTLHSLVLAHNDLWDNGAAAAQAHRGSLGIGA
                     AAASRPATCDGIGLHNRAQNTTAMTLTPMSSTSKFVNRARALRDGTHGETDDASQSGH
                     HSQQQQQRDPSPGIVLLLALSHDQFITTLILDDCVMDDTALHTLCRSLTTNAMLKVLS
                     MRHNNLSPDGVVQLGRSLCRHPCLERLLLSGNAIEDEGACALATALGQPDAPLVELDL
                     VKTWLGDRGLIAIGVALQANTLLRVLRVSDNHFTHNGGASFAALLERNNYVVQCELGA
                     TSVPHHILLRVERTTARNCTRAANADADALKAEVVRLHYQKYKLLEAHLELEALRENN
                     TEVKRTIENFDLQTKQDHSDFLKRIRELEEHIENAKQQEARYTEQKAKLEADLTKAER
                     AHEVDMTYMAERLSVEVGLREKAEAELQQRQQELTYWQEKGPEREAQKREQLAALKAD
                     HEAWSSQRKAYRDRTAELQQQVATLQAAAATAGASRGMSKKRKKSAKV"
     gene            <375213..>375539
                     /locus_tag="LMJF_12_0710"
                     /db_xref="GeneID:5649961"
     mRNA            <375213..>375539
                     /locus_tag="LMJF_12_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681624.1"
                     /db_xref="GeneID:5649961"
     CDS             375213..375539
                     /locus_tag="LMJF_12_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681676.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649961"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM2"
                     /translation="MVNLSAKFQISASNHKEFYIYYLAKHSKQWTRRMHLIGTAVGVV
                     GAVVSAVRMDVIGATVSTAVGVAICWAGDTVVEQTQPTTFKNPIWSVMSNFKMVASML
                     KGDMSI"
     gene            <382553..>384883
                     /locus_tag="LMJF_12_0860"
                     /db_xref="GeneID:5649962"
     mRNA            <382553..>384883
                     /locus_tag="LMJF_12_0860"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681625.1"
                     /db_xref="GeneID:5649962"
     CDS             382553..384883
                     /locus_tag="LMJF_12_0860"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681677.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649962"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM1"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARADGTGNFTEEQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVGLNVSTYAGTLPEIPVNV
                     DYRHVMIRDLGFWNMPLLSGTLPDSWSQLGGLLSVTLSGCGVSGTLPASWGLMVRLRE
                     LTVRDCRHLTGSLPSLWSWLPNLQKLVLRQLQLSGTLPAEWSRVTSLLELEIVAAGDI
                     TGTLPPEWSSIKSLRTLNLEGTQVSGTLPPGWSEMKSLTNLELEGTQVSGTLPPGWSS
                     IKSLRTLNLEGTQVSGSLPPEWVSMASLRTLNLEGTQVSGTLPPGWSEMKSLTSLELE
                     GTQVSGTLPPRWSEMKSLRTLNLEGTQVSGSLPPQWVSMASLRTLNLEGTQVSGSLPP
                     EWVSMASLRTLNLEGTQVSGTLPPGWSEMKSLTSLELEGTQVSGTLPPRWSEMKSLRT
                     LNLEGTQVSGSLPPEWVSMASLRTLNLEGTQVSGTLPPGWSEMKSLTSLELEGTQVSG
                     TLPPRWSEMKSLRTLNLEGTQVSGSLPPEWVSMASLRTLNLEGTQVSGTLPPGWSEMK
                     SLTSLELEGTQVSGTLPPRWSEMKSLRTLNLEGTQVSGALPPGWGEMKSLTNLYLEGT
                     QLSGSLPTEWRGMKSLTNLYLEGTQVSGSLPPQWSSLTSLRTLDLEGTQVSGRLPPEW
                     SRMLSAENLQLEHCDLSGSLPPEWSAMPRLRLVGLRGNHFCGCVPDSWGKNAGLLVRI
                     EDEHKGRDCRLGNDCRTTEPTTTATPTNTPTPAPAP"
     gene            <388516..>389964
                     /locus_tag="LMJF_12_0715"
                     /db_xref="GeneID:5649963"
     mRNA            <388516..>389964
                     /locus_tag="LMJF_12_0715"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681626.1"
                     /db_xref="GeneID:5649963"
     CDS             388516..389964
                     /locus_tag="LMJF_12_0715"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681678.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0715"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0715"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649963"
                     /db_xref="UniProtKB/TrEMBL:Q4QGM0"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVEHAKARYRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEAAHYEAPYGRYEDADAGAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <391810..>392967
                     /locus_tag="LMJF_12_0980"
                     /db_xref="GeneID:5649964"
     mRNA            <391810..>392967
                     /locus_tag="LMJF_12_0980"
                     /product="promastigote surface antigen protein 2 PSA2"
                     /transcript_id="XM_001681627.1"
                     /db_xref="GeneID:5649964"
     CDS             391810..392967
                     /locus_tag="LMJF_12_0980"
                     /codon_start=1
                     /product="promastigote surface antigen protein 2 PSA2"
                     /protein_id="XP_001681679.1"
                     /db_xref="GeneID:5649964"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q25331"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEAVLCNAPDVYVSGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPASWHSMTSLESLSIEKCESISGSVPPEWGSMTSL
                     SVLNLRGTGISGTLPPQWSGMSKARSLQLQDCDLSGSLPSSWSAIPMLASVSLKGNKF
                     CGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCTTTTTKPSATTATTPNLTNFPPTPR
                     TTTEPLTTTSTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSA
                     ARCARCREDYFLTDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <397712..>399544
                     /locus_tag="LMJF_12_0990"
                     /db_xref="GeneID:5649965"
     mRNA            <397712..>399544
                     /locus_tag="LMJF_12_0990"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681628.1"
                     /db_xref="GeneID:5649965"
     CDS             397712..399544
                     /locus_tag="LMJF_12_0990"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681680.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649965"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL8"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTEEQQT
                     NTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVSLDVSTYAGTLPEMPVGV
                     DYRHVMIRDLGFWNMPLLSGTLPDSWSKLEKLTFLTLLGNKVSGTLPASWHSMTSLES
                     LSIEKCESISGALPPQWSSMKSLSFLNLDGAKVSGSLPPQWSSMKSLRTLDLGDTQVS
                     GSLPPQWSSMTLLSFLNLDGAKVSGALPPQWSSMTLLAVLDVQGTQVSGTLPPQWSSM
                     KSLSVLNLRGTSISGSVPPQWSSMTSLAVLDVQGTQVSGTLPPQWSLMTSLTSLDVQG
                     TQVSGSVPPQWSSMTSLTALNLRGTQVSGTLPPQWSSMTSLTSLDVQGTQVSGTLPPQ
                     WSSMTSLAALDVQGTQVSGTLPPQWSSMRRLTHLLLTDTLLSGTLPAEWSALQSLVTL
                     QLSSSKVSGTLPPQWSGMSKAQSLQLQDCDLSGSLPSSWSAIPMLAFVSLKGNKFCGC
                     VPDSWDQKAGLVVDIEDKHKGSDCTTDRVCPTAPETECEVDGCEVCEGDSAARCARCR
                     EDYFLTDERTCLMHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <401990..>403147
                     /locus_tag="LMJF_12_1000"
                     /db_xref="GeneID:5649966"
     mRNA            <401990..>403147
                     /locus_tag="LMJF_12_1000"
                     /product="promastigote surface antigen protein 2 PSA2"
                     /transcript_id="XM_001681629.1"
                     /db_xref="GeneID:5649966"
     CDS             401990..403147
                     /locus_tag="LMJF_12_1000"
                     /codon_start=1
                     /product="promastigote surface antigen protein 2 PSA2"
                     /protein_id="XP_001681681.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0940"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649966"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK6"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEAVLCNAPDVYVSGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPASWHSMTSLESLSIEKCESISGSVPPEWGSMTSL
                     SVLNLRGTGISGTLPPQWSGMSKARSLQLQDCDLSGSLPSSWSAIPMLASVSLNGNKF
                     CGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCTTTTTKPSATTATTPNLTNFPPTPR
                     TTTEPLTTTSTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSA
                     ARCARCREDYFLTDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <405110..>406486
                     /locus_tag="LMJF_12_0867"
                     /db_xref="GeneID:5649967"
     mRNA            <405110..>406486
                     /locus_tag="LMJF_12_0867"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681630.1"
                     /db_xref="GeneID:5649967"
     CDS             405110..406486
                     /locus_tag="LMJF_12_0867"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681682.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0867"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0867"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649967"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL6"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KRTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGSDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARYRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEAAHYEAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGXSEHG"
     gene            <407249..>408892
                     /locus_tag="LMJF_12_0870"
                     /db_xref="GeneID:5649968"
     mRNA            <407249..>408892
                     /locus_tag="LMJF_12_0870"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681631.1"
                     /db_xref="GeneID:5649968"
     CDS             407249..408892
                     /locus_tag="LMJF_12_0870"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681683.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649968"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL5"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARATVTNDFTEEQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEFIRCTQRAVYVRVISTTYAGTLPEMPVNV
                     DYRHVMIRELYIWNMPLLSGTLPDSWSKLEGLTSLTLSGCGVSGTLPASWHSMKLFSY
                     LLIQESGGIIGTLPPEWSWLPNLQTLRLRRLKLSGTLPAEWSSWKSLSNVFLDDTPIT
                     GLLPPEWGSLERIQQLVLRKLKITGPLPPQWSLMKVLRVLDLDSTKVSGTLPAEWSRM
                     STAAYFWLNNCDLSGTLPPQWSSMPYLRGVSLKGNRFCGCVPESWANKADLAVEIEDK
                     HKGSDCLAGKDCTTTTTKLPTTTTTTTKPPTTTTTTTKPPTTTTTTTKPPTTTTTTTK
                     PPTTTTTTTKPPTTTTTTTKPPTTTTTTTKPPITTATTTKPPTTTTTTTKPPTTITST
                     TKLPTTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFL
                     TDERTCLVYCDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <414606..>415793
                     /locus_tag="LMJF_12_0890"
                     /db_xref="GeneID:5649969"
     mRNA            <414606..>415793
                     /locus_tag="LMJF_12_0890"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681632.1"
                     /db_xref="GeneID:5649969"
     CDS             414606..415793
                     /locus_tag="LMJF_12_0890"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681684.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649969"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL4"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPELGEKWAGNDFCSWEFIVCNVIGVNVRGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPDSWSKLEGLTSLKLSGNKVSGALPASWHSMTSLE
                     SLSIEKCESISGALPPQWSSMTSLSVLNLRGTGISGALPPQWRWMRKLTDVLLADTLL
                     SGTLPPEWGSMSSLAYLHLYLTQVSGTLPPEWSGMSEAAYFWLNNCDLSGSLPPEWSS
                     MPKLRGMSLSGNHFCGCVPDSWADRGGLVVDIEDKHKGSDCTTDRVCPTAPETECEVD
                     GCEVCEGDSAARCARCREDYFLTDERTCLMHNDGGVAAVSSGVAAAAVVCVAVLFSVG
                     LAA"
     gene            <417800..>419248
                     /locus_tag="LMJF_12_0895"
                     /db_xref="GeneID:5649970"
     mRNA            <417800..>419248
                     /locus_tag="LMJF_12_0895"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681633.1"
                     /db_xref="GeneID:5649970"
     CDS             417800..419248
                     /locus_tag="LMJF_12_0895"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681685.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0895"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0895"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649970"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL3"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGSDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARYRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWQHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEATPKGAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <421097..>422635
                     /locus_tag="LMJF_12_0910"
                     /db_xref="GeneID:5649971"
     mRNA            <421097..>422635
                     /locus_tag="LMJF_12_0910"
                     /product="promastigote surface antigen protein PSA"
                     /transcript_id="XM_001681634.1"
                     /db_xref="GeneID:5649971"
     CDS             421097..422635
                     /locus_tag="LMJF_12_0910"
                     /codon_start=1
                     /product="promastigote surface antigen protein PSA"
                     /protein_id="XP_001681686.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649971"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL2"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTEEQRT
                     NTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVGLDVSTYAGTLPEMPVGV
                     KYRHVMIRDLGFWNMPLLSGTLPDSWSQLERLISLTLSGCGVSGTLPASWGSMVRLRA
                     LTVGNCRHLTGSLPSEWSWLPNLQTLVLRQLQLSGTLPAEWSRMKFVTTLEIAAAGSF
                     TGTLPTEWGSMKALTNLYLTDLPIGGSLPPEWGSMVRIRRLKIWELPLAGPLPPQWGS
                     IAGLETLSLRDTNISGTLPPEWSSMTFLTNLDLRGASISGSLPPQWGSLAFLRGLDLR
                     GTKVSGTLPPGWSGMSWMTLLYLELTQVSGTLPPQWSSMTRLRDLNLQGTQVSGSLPP
                     QWSSLKVLNFLDLEGTQVSGSLPPEWSTMLGAEFLQLEHCDLSGSLPPEWSAMPRLRL
                     VGLRGNHFCGCVPESWAKNADLLVRIEDEHKGRDCRLGNDCRTTEPTTTATPTNTPTP
                     APAP"
     gene            <424497..>425792
                     /locus_tag="LMJF_12_0905"
                     /db_xref="GeneID:5649972"
     mRNA            <424497..>425792
                     /locus_tag="LMJF_12_0905"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681635.1"
                     /db_xref="GeneID:5649972"
     CDS             424497..425792
                     /locus_tag="LMJF_12_0905"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681687.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0905"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0905"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649972"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL1"
                     /translation="MTVGVVARTARGCCRDGGAQRGPLDTRACRLSPPMLLSLPAQTS
                     SLSACPPPPPRLSPAHCLPGCVHVCVPVCAQRTTHSQGGQRRRQQCACCHMRPWRART
                     CAHTDGEGRLHSTHRSSCALCCEALASVPSLPCRRNRAATSCRDAEACARSGRSSACV
                     CARTCAPRVACATTGDADALLLPAPRPDRSAVGTAPLLSQRMMGAGVVRLSRPRHGQP
                     FLCFVVRDPIVCAVARTRTPTLPCPAHASFSLLHAALAHAPPSGCAQRWPVKGRGVPS
                     TVGAGELLAATPLDLTFSAHDELLGDAQRCDRVARTFVPAADLYRAGGVVFSARTSAT
                     AAGCEAAAPVANALVSALGGVRGGGEDWRSPRSACAPLTEWRQQLLCAWLCCSAWGWR
                     REDAAAVARRQRPPLRGTRLSACLRAAPPPALACACVSL"
     gene            <427116..>428027
                     /locus_tag="LMJF_12_1005"
                     /db_xref="GeneID:5649973"
     mRNA            <427116..>428027
                     /locus_tag="LMJF_12_1005"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681636.1"
                     /db_xref="GeneID:5649973"
     CDS             427116..428027
                     /locus_tag="LMJF_12_1005"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681688.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649973"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="UniProtKB/TrEMBL:Q4QGL0"
                     /translation="MRPWRARTCAHTDGEGRLHSTHRSSCALCCEALASVPSLPCRRN
                     RAATSCRDAEACARSGRSSACVCARTCAPRVACATTTTKLPTTTTTTTKPPTTTTTTT
                     TTTTTKPPTTTTTTTKPPTTTTTTTKPPTTTTTTTKPPTTTTTTTKLPTTTTTTTKPP
                     TTTTTTTTTTTTTTTTTKPPITTATTTKPPTTTTTTTKPPTTITSTTKLPTTTTTEAP
                     AEPTTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFLTDERTCLVYCDG
                     GVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <429396..>430664
                     /locus_tag="LMJF_12_1015"
                     /db_xref="GeneID:5649974"
     mRNA            <429396..>430664
                     /locus_tag="LMJF_12_1015"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681637.1"
                     /db_xref="GeneID:5649974"
     CDS             429396..430664
                     /locus_tag="LMJF_12_1015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681689.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649974"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK9"
                     /translation="MTVGVVARTARGCCRDGGAQRGPLDTRACRLSPPMLLSLPAQTS
                     SLSACPPPPPRLSPAHCLPGCVHVCVPVCAQRTTHSQGGQRRRQQCACCHMRPWRART
                     CAHADGEERPDSTQRPSCALCCEALASVPSLPCRRNRAATSCRDAEACARSGRSSACV
                     CARTCAPRVACATTGDADALLLPAPRPDRSAVGTAPLLSQRMMGAGVVRLSRPRHGQP
                     FLCFVVRDPIVCAVARTRTPTLPCPAHASFSLLHAALAHAPPSGCAQRWPVKGRGVPS
                     TVGAGELLAATPLDLTFSAHDELLGDAQRCDRVARTFVPAADLYRAGGVVFSARTSAT
                     AAGCEAAAPVANALVSALGGVRGGGEDWRSPRSACAPLTAELSAWGGADETRPWGAGA
                     RTAGLLTRGRGRRRRPCALPRLTGGLPGRA"
     gene            <433739..>435277
                     /locus_tag="LMJF_12_0920"
                     /db_xref="GeneID:5649975"
     mRNA            <433739..>435277
                     /locus_tag="LMJF_12_0920"
                     /product="promastigote surface antigen protein PSA"
                     /transcript_id="XM_001681638.1"
                     /db_xref="GeneID:5649975"
     CDS             433739..435277
                     /locus_tag="LMJF_12_0920"
                     /codon_start=1
                     /product="promastigote surface antigen protein PSA"
                     /protein_id="XP_001681690.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649975"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK8"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTEEQRT
                     NTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVDVFVGLDVSTYAGTLPEMPVGV
                     KYRHVMIRDLGFWNMPLLSGTLPDSWSQLERLISLTLSGCGVSGTLPASWGSMVRLRA
                     LTVGNCRHLTGSLPSEWSWLPNLQTLVLRQLQLSGTLPAEWSRMKFVTTLEIAAAGSF
                     TGTLPTEWGSMKALTNLYLTDLPIGGSLPPEWGSMVRIRRLKIWELPLAGPLPPQWGS
                     IAGLETLSLRDTNISGTLPPEWSSMTFLTNLDLRGASISGSLPPQWGSLAFLRGLDLR
                     GTKVSGTLPPGWSGMSWMTLLYLELTQVSGTLPPQWSSMTRLRDLNLQGTQVSGSLPP
                     QWSSLKVLNFLDLEGTQVSGSLPPEWSTMLGAEFLQLEHCDLSGSLPPEWSAMPRLRL
                     VGLRGNHFCGCVPESWAKNADLLVRIEDEHKGRDCRLGNDCRTTEPTTTATPTNTPTP
                     APAP"
     gene            <439494..>440942
                     /locus_tag="LMJF_12_0930"
                     /db_xref="GeneID:5649976"
     mRNA            <439494..>440942
                     /locus_tag="LMJF_12_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681639.1"
                     /db_xref="GeneID:5649976"
     CDS             439494..440942
                     /locus_tag="LMJF_12_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681691.1"
                     /db_xref="GeneID:5649976"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK7"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEATPKGAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <442787..>443944
                     /locus_tag="LMJF_12_0940"
                     /db_xref="GeneID:5649977"
     mRNA            <442787..>443944
                     /locus_tag="LMJF_12_0940"
                     /product="promastigote surface antigen protein 2 PSA2"
                     /transcript_id="XM_001681640.1"
                     /db_xref="GeneID:5649977"
     CDS             442787..443944
                     /locus_tag="LMJF_12_0940"
                     /codon_start=1
                     /product="promastigote surface antigen protein 2 PSA2"
                     /protein_id="XP_001681692.1"
                     /db_xref="GeneID:5649977"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK6"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEAVLCNAPDVYVSGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPASWHSMTSLESLSIEKCESISGSVPPEWGSMTSL
                     SVLNLRGTGISGTLPPQWSGMSKARSLQLQDCDLSGSLPSSWSAIPMLASVSLNGNKF
                     CGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCTTTTTKPSATTATTPNLTNFPPTPR
                     TTTEPLTTTSTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSA
                     ARCARCREDYFLTDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <445909..>447357
                     /locus_tag="LMJF_12_0950"
                     /db_xref="GeneID:5649978"
     mRNA            <445909..>447357
                     /locus_tag="LMJF_12_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681641.1"
                     /db_xref="GeneID:5649978"
     CDS             445909..447357
                     /locus_tag="LMJF_12_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681693.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649978"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK5"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KRTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPQMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGSDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEATPKEAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <449204..>451210
                     /locus_tag="LMJF_12_0960"
                     /db_xref="GeneID:5649979"
     mRNA            <449204..>451210
                     /locus_tag="LMJF_12_0960"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681642.1"
                     /db_xref="GeneID:5649979"
     CDS             449204..451210
                     /locus_tag="LMJF_12_0960"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681694.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649979"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK4"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEVWKGDDFCSWDHLLCLPLSVTIRVFVFTYAGTLPEMPVNV
                     DYGHVMIGNLGLWNMPQVVGTLPASWHLMKRLTSLVIEDFDSITGSLPPEWSSMPNLQ
                     TLQVRRLKLSGTLPADWSSLKSLSNVVLEDMPITGLLPPEWGSLERIQQLVLRKLKLT
                     GPLPPQWSPMKALRFLTLDGTNLSGTLPPQWSAMASVISLNLEGTEVSGTLPPKWISM
                     SRLQTLNLRRTKVSGTLPPEWSSMGSLANLQLSLTQVSGTLPPQWSSMRKLTQLLLTD
                     TLLSGTLPAEWSALQSLVILQLSGSKFSGTLPPQWSGMSKARSLQLQDCDLSGSLPSS
                     WSAIPMLASVSLKGNKFCGCVPDSWDQKAGLVVDIEDKHKGSDCLAGKDCTTTTTKPP
                     TTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTTK
                     PPTTTTTTTTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTKPPA
                     ATTTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCR
                     EDYFLTDEKTCLVYCDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <453173..>454927
                     /locus_tag="LMJF_12_0970"
                     /db_xref="GeneID:5649980"
     mRNA            <453173..>454927
                     /locus_tag="LMJF_12_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681643.1"
                     /db_xref="GeneID:5649980"
     CDS             453173..454927
                     /locus_tag="LMJF_12_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681695.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649980"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK3"
                     /translation="MLRCAHSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KRTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGSDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARYRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEATPKGAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGLFFCSPT
                     LFRFAFSCLVLVLLYPHPPIFLLRPLLPPLPFLLPRHRLFIVGIPTKRSGRVDGGAPA
                     RWSCSLFRWPPTPRRWSVRSSALRMARPSLPLASSSCAPLPPSPSLSILRCHLGQPSR
                     TRRRTCASTLPLASLLLL"
     gene            <455108..>456790
                     /locus_tag="LMJF_12_1060"
                     /db_xref="GeneID:5649981"
     mRNA            <455108..>456790
                     /locus_tag="LMJF_12_1060"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681644.1"
                     /db_xref="GeneID:5649981"
     CDS             455108..456790
                     /locus_tag="LMJF_12_1060"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681696.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649981"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK2"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTEEQRT
                     NTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVGLNVSTYAGTLPEMPVGV
                     KYRHVMIRDLGFWNMLKLVGTLPDSWSKLEGLTSLTLLGCGVSGTLPASWSSMVRLRA
                     LTVGNCRHLTGSLPSEWSWLPNLQTLVLRQLQLSGTLPAEWSRMKFVTTLEIAAAGSF
                     TGTLPAEWGSMKALTNLYLTDLPIGGSLPPEWGSMRRLVNLYLGDLPIGGSLPPEWGS
                     TAVLRKLKIWELPLAGPLPPQWGSLVGLQTLSLRDTNISGTLPPEWSSMRALRGLKLR
                     GKKFSGTLPPQWSSLALLIRLDLEGTQVSGALPPQWVSLASLRTLDLEGTQVSGTLPP
                     GWSEMKSLTNLYLEGTEVSGSLPPQWSSMASLTSLYLEGTQVSGSLPPEWSSMKSLRT
                     LDLEGTQVSGRLPPEWSRMLSAENLQLEHCDLSGSLPPEWSAMRQLRLVGLRGNHFCG
                     CVPDSWGKNAGLLVRIEDEHKGKYCRLGNDCRTTEPTTTATPTNTPTPAPAP"
     gene            <464061..>466175
                     /locus_tag="LMJF_12_1070"
                     /db_xref="GeneID:5649982"
     mRNA            <464061..>466175
                     /locus_tag="LMJF_12_1070"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681645.1"
                     /db_xref="GeneID:5649982"
     CDS             464061..466175
                     /locus_tag="LMJF_12_1070"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681697.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649982"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK1"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARADGTGDFTDEQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEFIYCNVTGVYVRGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPDSWSKLEGLTSLKLSDSGMGGTLPASWSSMTRLT
                     ELRIERCGFFTGTLPAEWSSMKSIQFVDLRVMKLSGTLPPQWSSMTSLDTLSLRDVGE
                     ITGTLPPEWKSMKSILYLYVTKSRISGSLPVEWSEMTTVREFSFRESPLAGPLPPQWS
                     SIKTLRRVYLANTDISGTLPSSWTALTRVDHLHLEGTKLSGTLPPEWISMSSLAQLFL
                     SRSLVQGTLPPEWSSMKKLTQLLLADTLLSGTLPAEWSALQSLVTLQLSSSKVSGTLP
                     PQWSGMSKAQSLQLENCNLSGSLPSSWSAIPMLASVSLRGNKFCGCVPDSWAKKARLV
                     VDIEDKHKGSDCLAGRDCTKTTTKPPTTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTT
                     KPPTTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTTKPPTTTTSTTKLPTTTTTTTTTT
                     TTKPPTTTSTTTKPPTTTTTTTKPPTTTTTTTKPPTTTTSTTKLPTTTTTEAPAEPTT
                     TATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFLTDERTCLVYCDGGVAAV
                     SSGVAAAAVVCVAVLFSVGLAA"
     gene            <468337..>470049
                     /locus_tag="LMJF_12_0755"
                     /db_xref="GeneID:5649983"
     mRNA            <468337..>470049
                     /locus_tag="LMJF_12_0755"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681646.1"
                     /db_xref="GeneID:5649983"
     CDS             468337..470049
                     /locus_tag="LMJF_12_0755"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681698.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0755"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0755"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649983"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR009030"
                     /db_xref="UniProtKB/TrEMBL:Q4QGK0"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTNDFTAAQRT
                     NTLAVLQAFGRAIPELGEKWAGNDFCSWEFIVCNVIGVNVRGISPTYAGTLPEIPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPDSWSKLEGLTSLTLSGNKVSGTLPASWHLMKRLT
                     SLVIADFDSITGSLPPEWSSMPNLNAVELKRLKLSGTLPADWSSLKSLSNVVLEDTPI
                     TGLLPPEWASLERIQQLVLRKLKLTGPLPPQWSSMKILQYLTLDGTQVSGTLPPQWSA
                     MASVRILNLEGTEVSGTLPPEWISMSRLQTLNLRRTKVSGTLPPEWSSMSSLEYFHLY
                     LTQVSGTLPPEWSGMSKAAYFWLEYCDLSGSLPPEWSSMPKLRGISLSGNKFCGCVPD
                     SWDQKAGLVVGIEDKHKGSDCLAAKDCTTTTTKPPTTTTTPTKPPATTTTEAPAEPTT
                     TTEAPAEPTTTTEAPAEPTTTTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEV
                     DGCEVCEGDSAARCARCREDYFLTDERTCLVYCDGGVAAVSSGVAAAAVVCVAVLFSV
                     GLAA"
     gene            <471517..>473280
                     /locus_tag="LMJF_12_0760"
                     /db_xref="GeneID:5649984"
     mRNA            <471517..>473280
                     /locus_tag="LMJF_12_0760"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681647.2"
                     /db_xref="GeneID:5649984"
     CDS             471517..473280
                     /locus_tag="LMJF_12_0760"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681699.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649984"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ9"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTNDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWTGNDFCSWEAVLCDAPDVYVSGISPTYAGTLPEMPVNV
                     DYTTVMIKQLDFSKMGPGLSGTLPDSWSKLEKLTFFTLSGNKVSGTLPASWHSMRSLE
                     SLSIEKCESISGSVPPQWGSMKSLSFLNLDGAKVSGSLPPQWSSMTSLTALNLRGTSI
                     SGTLPPQWGSMKSLSFLNLENTKVSGTLPPQWSSMTLLAALDVQGTQVSGTLPPQWSS
                     MRKLTHLLLTDTLLSGTLPAEWSALQSLDTLRLSGSKFSGTLPPQWSSMKKLTQLLLD
                     DTLLSGTLPAEWSALQSLDTLRLSGSKVSGTLPPQWSGMSKARSLQLQDCDLSGSLPS
                     SWSAMPMLASVSLKGNKFCGCVPDSWDQKAGLAVDIEDKHKGSDCLAGRECTTTTTKP
                     PTMTTTTTKPTATTTTTTNPTNFPPTPTTTTEPLTTTSTEAPAEPTTTTEAPAEPTTT
                     ATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFLTDERTCLMHNDGGVAAVS
                     SGVAAAAVVCVAVLFSVGLAA"
     gene            <475257..>476705
                     /locus_tag="LMJF_12_0770"
                     /db_xref="GeneID:5649985"
     mRNA            <475257..>476705
                     /locus_tag="LMJF_12_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681648.1"
                     /db_xref="GeneID:5649985"
     CDS             475257..476705
                     /locus_tag="LMJF_12_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681700.1"
                     /db_xref="GeneID:5649985"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ8"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEAAHYEAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <478552..>479679
                     /locus_tag="LMJF_12_0780"
                     /db_xref="GeneID:5649986"
     mRNA            <478552..>479679
                     /locus_tag="LMJF_12_0780"
                     /product="surface antigen protein 2 precursor"
                     /transcript_id="XM_001681649.1"
                     /db_xref="GeneID:5649986"
     CDS             478552..479679
                     /locus_tag="LMJF_12_0780"
                     /codon_start=1
                     /product="surface antigen protein 2 precursor"
                     /protein_id="XP_001681701.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649986"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ7"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEAVLCNAPDVYVSGISPTYAGTLPEMPVNV
                     DYRHVVIKQLDFSEMGPGLSGTLPASWHSMTSLESLSIEKCESISGSVPPEWGSMTSL
                     SVLNLRGTGISGTLPPQWSGMSKARSLQLQDCDLSGSLPSSWSAIPMLASVSLKGNKF
                     CGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCTTTTTKPSATTATTPNLTNFPPTPR
                     TTTEPLTTTSTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDY
                     FLTDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <484652..>486370
                     /locus_tag="LMJF_12_0765"
                     /db_xref="GeneID:5649987"
     mRNA            <484652..>486370
                     /locus_tag="LMJF_12_0765"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681650.1"
                     /db_xref="GeneID:5649987"
     CDS             484652..486370
                     /locus_tag="LMJF_12_0765"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681702.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0765"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0765"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649987"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ6"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTNDFTAAQRT
                     NTLAVLQAFGRAIPELEKKWAGNDFCSWELIKCNKMGVYVTGISPTYAGTLPEMPVNV
                     DYRHVMIRDLWLWNMSLLSGTLPDSWGKLEGLTSLKLSGNKVSGTLPASWHSMKRLSF
                     LIIEESGGITGALPPEWSSMPNLQTLQLRRLKLSGTLPAEWSSWKSLVNVFLEDTPIT
                     GLLPPEWGSLERIQQLVLEKSKLTGPLPPQWSSMRSLSLLNLNGAKVSGTLPPEWSGM
                     SKAAYFWLNNCDLSGTLPPQWSSMPNLRGVSLKGNRFCGCVPDSWANKADLAVEIEDK
                     HKGSDCLAGKDCTTTTTKLPTTTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTKPPTTT
                     TTTTKPPTTTTTTTKPPTTTTTTTKLPTTTTTTTKPPTTTTTTTTTTTTTTTTTKPPI
                     TTATTTKPPTTTTTTTKPPTTITSTTKLPTTTTTEAPAEPTTTATPTNTPTPAPETEC
                     EVDGCEVCEGDSAARCARCREDYFLTDERTCLVYCDGGVAAVSSGVAAAAVVCVAVLF
                     SVGLAA"
     gene            <488501..>489934
                     /locus_tag="LMJF_12_0800"
                     /db_xref="GeneID:5649988"
     mRNA            <488501..>489934
                     /locus_tag="LMJF_12_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681651.1"
                     /db_xref="GeneID:5649988"
     CDS             488501..489934
                     /locus_tag="LMJF_12_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681703.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649988"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ5"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLRQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KRTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMARHRRL
                     FGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGARDGES
                     EGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <491781..>492938
                     /locus_tag="LMJF_12_0810"
                     /db_xref="GeneID:5649989"
     mRNA            <491781..>492938
                     /locus_tag="LMJF_12_0810"
                     /product="promastigote surface antigen protein 2 PSA2"
                     /transcript_id="XM_001681652.1"
                     /db_xref="GeneID:5649989"
     CDS             491781..492938
                     /locus_tag="LMJF_12_0810"
                     /codon_start=1
                     /product="promastigote surface antigen protein 2 PSA2"
                     /protein_id="XP_001681704.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649989"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ4"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEKWAGNDFCSWEAVLCNAPDVYVSGISPTYAGTLPEMPVNV
                     DYRHVVIRRLDFSEMGPGLSGTLPASWHSMTSLESLSIEKCESISGSVPPEWGSMTSL
                     SVLNLRGTGISGTLPPQWSGMSKARSLQLQDCDLSGSLPSSWSAIPMLASVSLKGNKF
                     CGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCATTTTKPSATTATTPNLTNFPPTPR
                     TTTEPLTTTSTEAPAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSA
                     ARCARCREDYFLTDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <494903..>496351
                     /locus_tag="LMJF_12_0820"
                     /db_xref="GeneID:5649990"
     mRNA            <494903..>496351
                     /locus_tag="LMJF_12_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681653.1"
                     /db_xref="GeneID:5649990"
     CDS             494903..496351
                     /locus_tag="LMJF_12_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681705.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649990"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ3"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KRTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVEHAKARYRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVAFNDG
                     LCFEGNEGGPPAHPAAHYEATPKGAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARAVGSGPVCGAGA
                     RDGESEGEGRGGEAPLGYGARACSWRRREGWV"
     gene            <498186..>500132
                     /locus_tag="LMJF_12_0830"
                     /db_xref="GeneID:5649991"
     mRNA            <498186..>500132
                     /locus_tag="LMJF_12_0830"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681654.1"
                     /db_xref="GeneID:5649991"
     CDS             498186..500132
                     /locus_tag="LMJF_12_0830"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681706.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649991"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ2"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     NTLAVLQAFGRAIPKLGEVWKGDDFCSWDHLLCLPLSVTIRVFVSTYAGTLPEMPVNV
                     DYGHVMIGNLGLWNMPQVVGTLPASWHLMKRLTSLVIADFDSITGSLPPEWSSMPNLN
                     AVELKRLKLSGTLPADWSSLKSLSNVVLEDMPITGLLPPEWGSLERIQQLVLRKLKVT
                     GPLPPQWSPMKALRFLTLDGTNLSGTLPPQWSAMASVISLNLEGTEVSGTLPPEWISM
                     SRLQTLNLRRTKVSGTLPPEWSSMGSLANLQLSLTQVSGTLPPQWSSMKKLTQLLLTD
                     TLLSGTLPAEWSALQSLVILQLSGSKFSGTLPPQWSGMSKARSLQLQHCDLSGSLPSS
                     WSAIPMLASVSLKGNKFCGCVPDSWDQKAGLVVDIEDKHKGSDCLAAKDCTTTTTKPP
                     TTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTKPPTTTTTTTT
                     TTTTKPPTTTTTTTKPPTTTTTTTTTTSTKPPTTPTTTTTTTTTKPPAATSTEAPAEP
                     TTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFLTDEKTCLVYCDGGVA
                     AVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <502115..>503059
                     /locus_tag="LMJF_12_0840"
                     /db_xref="GeneID:5649992"
     mRNA            <502115..>503059
                     /locus_tag="LMJF_12_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681655.1"
                     /db_xref="GeneID:5649992"
     CDS             502115..503059
                     /locus_tag="LMJF_12_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681707.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0770"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0840"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649992"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ1"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFPRPPPMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHL"
     gene            <505413..>507302
                     /locus_tag="LMJF_12_0850"
                     /db_xref="GeneID:5649993"
     mRNA            <505413..>507302
                     /locus_tag="LMJF_12_0850"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681656.1"
                     /db_xref="GeneID:5649993"
     CDS             505413..507302
                     /locus_tag="LMJF_12_0850"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681708.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649993"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGJ0"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     HTLAVLQAFGRAIPELGEKWTGNDFCSWEAVLCNAPDVSVSGISPTYAGTLPEMPVGV
                     DYRHVMIKQLDFSKMGLGLSGTLPDSWSKLEGLTSLTLSDCGMGGTLPASWSSMTRLT
                     ELRIERCGFFSGTLPPEWSSMKSIQFVDLRVMKLSGTLPPQWSSMTSLDTLSLRDVGE
                     ITGTLPPEWKSMKSILYLYVTKSRISGSLPVEWSEMTTVREFSFRESPLAGPLPPQWS
                     SIKTLRRVYLANTDISGTLPSSWTALTRVDHLHLEGTKLSGTLPPEWISMSSLAQLFL
                     SRSLVQGTLPPQWSAMKKLTQLLLDDTLLSGTLPAEWSALQSLVTLQLSGSKVSGTLP
                     PQWSGMSKAQSLQLQDCDLSGSLPSSWSAIPMLASVSLKGNKFCGCVPDSWDQKAGLV
                     VDIEDKHKGSDCLAGKDCTTTTTKPPTTTTTTTTTTTTKPPTTTTTTTTTTTTKPPTT
                     TTTTTTTTTTKPPTTPTTTTTTTTTKPPAATTTEAPAEPTTTATPTNTPTPAPETECE
                     VDGCEVCEGDFAARCARCREDYFLTDEKTCLVYCDGGVAAVSSGVAAAAVVCVAVLFS
                     VGLAA"
     gene            <510360..>511430
                     /locus_tag="LMJF_12_0880"
                     /db_xref="GeneID:5649994"
     mRNA            <510360..>511430
                     /locus_tag="LMJF_12_0880"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681657.1"
                     /db_xref="GeneID:5649994"
     CDS             510360..511430
                     /locus_tag="LMJF_12_0880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681709.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0880"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0885"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0885"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649994"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI7"
                     /translation="MCVSPSVPSAPLIHREDSAVASSAPAATCAHGAHEHARTPTARR
                     RPDSTQRPSCALCCEALASVPSLPCRRNRAATSCRDAEACARSGRSSACVCARTCAPR
                     VACATTGDADALLLPAPRPDRSAVGTAPLLSQRMMGAGVVRLSRPRHGQPFLCFVVRD
                     PIVCAVARTRTPTLPCPAHASFSLLHAALAHAPPSGCAQRWPVKGRGVPSTVGAGELL
                     AATPLDLTFSAHDELLGDAQRCDRVARTFVPAADLYRAGGVVFSARTSATAAGCEAAA
                     PVANALVSALGGVRGGGEDWRSPRSACAPLTAELSAWGGADETRPWGAGARTAGLLTR
                     GRGRRRRPCALPRLTGGLPGRA"
     gene            <514444..>516726
                     /locus_tag="LMJF_12_0740"
                     /db_xref="GeneID:5649995"
     mRNA            <514444..>516726
                     /locus_tag="LMJF_12_0740"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681658.1"
                     /db_xref="GeneID:5649995"
     CDS             514444..516726
                     /locus_tag="LMJF_12_0740"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681710.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649995"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI8"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVDVFVGLNVSTYAGTLPEIPVNV
                     DYRHVMIRDLGFWNMPLLSGTLPDSWSKLGGLLSVTFSGCGVSGTLPASWGLMVRLRA
                     LTVGNCRHLTGSLPSEWSWLPNFQILVLRQLQLSGTLPAEWSRVTSLLELEIVAAGDI
                     TGTLPAKWSSIKSLRTLNLEGTQVSGTLPSGWSEMKSLTSLELEGTQVSGTLPPGWSS
                     IKSLRTLNLEGTQVSGSLPPQWVSMASLRTLNLEGTQVSGTLPPGWSEMKSLTSLELE
                     GTQVSGTLPLGWSEMKSLRTLNLEGTQVSGSLPPQWVSMASLRTLNLEGTQVSGTLPP
                     GWSEMKSLTNLYLEGTQLSGSLPTEWRGIKSLTNLYLKGTQVSGSLPPQWSSLTSLRT
                     LDLEGTQVSGRLPPEWSRMLSAENLQLEHCDLSGSLPPEWSAMPRLRLVGLRGNRFCG
                     CVPESWANKADLAVEIEDKHKGSDCLAGKDCTTTTTKLPTTTTTTTKPPTTTTTTTKP
                     PTTTTTTTKPPTTTTTTTKLPTTTTTTTKPPTTTTTTTKLPTTTTTTTKPPTTTTTTT
                     TTTTTTTTTTKPPITTATTTKPPTTTTTTTKPPTTITSTTKLPTTTTTEAPAEPTTTA
                     TPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFLTDERTCLVYCDGGVAAVSS
                     GVAAAAVVCVAVLFSVGLAA"
     gene            <518292..>519362
                     /locus_tag="LMJF_12_0885"
                     /db_xref="GeneID:5649996"
     mRNA            <518292..>519362
                     /locus_tag="LMJF_12_0885"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681659.1"
                     /db_xref="GeneID:5649996"
     CDS             518292..519362
                     /locus_tag="LMJF_12_0885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681711.1"
                     /db_xref="GeneID:5649996"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI7"
                     /translation="MCVSPSVPSAPLIHREDSAVASSAPAATCAHGAHEHARTPTARR
                     RPDSTQRPSCALCCEALASVPSLPCRRNRAATSCRDAEACARSGRSSACVCARTCAPR
                     VACATTGDADALLLPAPRPDRSAVGTAPLLSQRMMGAGVVRLSRPRHGQPFLCFVVRD
                     PIVCAVARTRTPTLPCPAHASFSLLHAALAHAPPSGCAQRWPVKGRGVPSTVGAGELL
                     AATPLDLTFSAHDELLGDAQRCDRVARTFVPAADLYRAGGVVFSARTSATAAGCEAAA
                     PVANALVSALGGVRGGGEDWRSPRSACAPLTAELSAWGGADETRPWGAGARTAGLLTR
                     GRGRRRRPCALPRLTGGLPGRA"
     gene            <522368..>524011
                     /locus_tag="LMJF_12_0730"
                     /db_xref="GeneID:5649997"
     mRNA            <522368..>524011
                     /locus_tag="LMJF_12_0730"
                     /product="putative surface antigen protein 2"
                     /transcript_id="XM_001681660.1"
                     /db_xref="GeneID:5649997"
     CDS             522368..524011
                     /locus_tag="LMJF_12_0730"
                     /codon_start=1
                     /product="putative surface antigen protein 2"
                     /protein_id="XP_001681712.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649997"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI6"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTNDFTEEQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWEFIVCNVIGVNVRGISPTYAGTLPEVPDNV
                     SYNNVVIQQLDFSEMRLGLSGTLPPQWSSMKSLIFINLQYTKVSGTLPLQWSSMTSLS
                     LLNLRGTQVSGTVPPQWSSMTSLSLLNLDYVNVSGTLPPQWSSMTSLTFLDLLGTQVS
                     GTLPPQWSSMTSLRTLDLGDTQVSGSLPPGWSELKSLSLLNLNGTKVAGTLPHEWSSM
                     TSLTALDLVGTQISGSLPPQWSAMSSVSLLNLNGTKVSGTLPHQWSSMTSLTALYVQG
                     TQVSGSLPPQWSSMTSLSLLNLNGAKVSGTLPPEWSGMSEAAYFWLEHCDLSGSLPPE
                     WSSMPKLRGISLSGNHFCGCVPDSWAKKAGLVVQIEDKHKGSDCLAAKECTRTTTSTE
                     APAEPTTTTEAPAEPTTTATPTNTPTPAPETECEVDGCEVCEGDSAARCARCREDYFL
                     TDEKTCLKHNDGGVAAVSSGVAAAAVVCVAVLFSVGLAA"
     gene            <524980..>526656
                     /locus_tag="LMJF_12_0995"
                     /db_xref="GeneID:5649998"
     mRNA            <524980..>526656
                     /locus_tag="LMJF_12_0995"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681661.1"
                     /db_xref="GeneID:5649998"
     CDS             524980..526656
                     /locus_tag="LMJF_12_0995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681713.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.0995"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.0995"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649998"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI5"
                     /translation="MCACVRVCAYIYIYIAISRYVSLSLYVQIYRRVGMHVLSAHLYS
                     LGHVCVCVYICMCVYPRAAPRSLARLFCACHSLWARWRLAPGGGRAEGGRRPSPISLF
                     LCFSVSPSSQQTRAARPRDPDPCCGRGKRVVVTPMTVGVVARTARGCCRDGGARRGPL
                     DTRACRLSPPMLLSLPAQTSSLSACPPPPPRLSPAHCLPGCVHVCVPVCAQRTTHSQG
                     GQRRRQQCACCHMRPWRARTCAHTDGEGRPDSTHRSSCALCCEALASVPSLPCRRNRA
                     ATSCRDAEACARSGRSSACVCARTCAPRVACATTGDADALLLPAPRPDRSAVGTAPLL
                     SQRMMGAGVVRLSRPRHGQPFLCFVVRDPIVCAVARTRTPTLPCPAHASFSLLHAALA
                     HAPPSGCAQRWPVKGRGVPSTVGAGELLAATPLDLTFSAHDELLGDAQRCDRVARTFV
                     PAADLYRAGGVVFSARTSATAAGCEAAAPVANALVSALGGVRGGGEDWRSPRSACAPL
                     TAELSAWGGADETRPWGAGARTAGLLTRGRGRRRRPCALPRLTGGLPGRA"
     gene            <529861..>531471
                     /locus_tag="LMJF_12_1020"
                     /db_xref="GeneID:5649999"
     mRNA            <529861..>531471
                     /locus_tag="LMJF_12_1020"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681662.1"
                     /db_xref="GeneID:5649999"
     CDS             529861..531471
                     /locus_tag="LMJF_12_1020"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681714.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5649999"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI4"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARADGTGNFTEEQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVGLNVSTYAGTLPEIPVNV
                     DYRHVMIRDLGFWNMPLLSGTLPDSWSQLGGLLSVTLSGCGVSGTLPASWGLMVRLRE
                     LTVRDCRHLTGSLPSLWSWLPNLQKLVLRQLQLSGTLPAEWSRVTSLLELEIVAAGDI
                     TGTLPPEWSSIKSLRTLNLEGTQVSGTLPPGWSEMKSLTNLELEGTQVSGTLPPGWSS
                     IKSLRTLNLEGTQVSGSLPPEWVSMASLRTLNLEGTQVSGTLPPGWSEMKSLTSLELE
                     GTQVSGTLPPRWSEMKSLRTLNLEGTQVSGTLPPGWGEMKSLTNLYLEGTQLSGSLPT
                     EWRGMKSLTNLYLEGTQVSGSLPPQWSSLTSLRTLDLEGTQVSGRLPPEWSRMLSAEN
                     LQLEHCDLSGSLPPEWSAMPRLRLVGLRGNHFCGCVPDSWGKNAGLLVRIEDEHKGRD
                     CRLGNDCRTTEPTTTATPTNTPTPAPAP"
     gene            <535641..>536948
                     /locus_tag="LMJF_12_1030"
                     /db_xref="GeneID:5650000"
     mRNA            <535641..>536948
                     /locus_tag="LMJF_12_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681663.1"
                     /db_xref="GeneID:5650000"
     CDS             535641..536948
                     /locus_tag="LMJF_12_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681715.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650000"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI3"
                     /translation="MRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVP
                     GSYCDPLLYNTKSTSPFRWHVANVQGDIVGHWYMDADELFRIEDWQPREPDDPLEMFP
                     RPPPMLLRWDESVDEHGNRAFRYRYHYDMMGPTGKWEAYPRCPFSHLYHGGSDQHGRA
                     EGYGFQQGHLLRCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEG
                     AVERAKARFRERVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGE
                     SLPFHVAFNDGLCFEGNEGGPPAHPAAHYEAAPKEAPYGRYEDADAGAARAAEAAHNA
                     ACEQSLSEAMARHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSGARA
                     VGSGPVCGAGARDGESEGEGRGGEAPLGYGVRACSWRRREGWV"
     gene            <538780..>540462
                     /locus_tag="LMJF_12_1040"
                     /db_xref="GeneID:5650001"
     mRNA            <538780..>540462
                     /locus_tag="LMJF_12_1040"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681664.2"
                     /db_xref="GeneID:5650001"
     CDS             538780..540462
                     /locus_tag="LMJF_12_1040"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681716.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650001"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI2"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARADGTGNFTEEQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWDHVACVSVNVFVGLNVSTYAGTLPEIPVNV
                     DYRHVMIRDLGFWNMPLLSGTLPDSWSQLGGLLSVTLSGCGVSGTLPASWGLMVRLRE
                     LTVRDCRHLTGSLPSLWSWLPNLQKLVLRQLQLSGTLPAEWSRVTSLLELEIVAAGDI
                     TGTLPPEWSSIKSLRTLNLEGTQVSGTLPPGWSEMKSLTNLELEGTQVSGSLPPQWVS
                     MASLRTLNLEGTQVSGTLPPGWSEMKSLTNLELEGTQVSGTLPPGWSSIKSLRTLNLE
                     GTQVSGTLPPGWSEMKSLTNLELEGTQVSGTLPPGWSEMKSLRTLNLEGTQVSGALPP
                     GWGEMKSLTNLYLEGTQLSGSLPTEWRGMKSLTNLYLEGTQVSGSLPPQWSSLTSLRT
                     LDLEGTQVSGRLPPEWSRMLSAENLQLEHCDLSGSLPPEWSAMPRLRLVGLRGNHFCG
                     CVPDSWGKNAGLLVRIEDEHKGRDCRLGNDCRTTEPTTTATPTNTPTPAPAP"
     gene            <544266..>545585
                     /locus_tag="LMJF_12_1050"
                     /db_xref="GeneID:5650002"
     mRNA            <544266..>545585
                     /locus_tag="LMJF_12_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681665.1"
                     /db_xref="GeneID:5650002"
     CDS             544266..545585
                     /locus_tag="LMJF_12_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681717.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650002"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI1"
                     /translation="MLRCAPSKLFRATPLLRVWAAEEDDASAPRTTFRNVRPGRLLRL
                     WRQMRHRAWMLYAWDEEWVSPMQEGYLHQQRLEQVCFAPLSAYGVVPGSYCDPLLYNT
                     KSTSPFRWHVANVQGDIVGHWYMDADELFRIKDWQPRDPDDPLEMFPRPPQMLLRWDE
                     SVDEHGNRAFRYRYHYDMMGPTGKWEAYPRYPFSHLYHGGPDQHGRAEGYGFQQGHLL
                     RCDEAEEEVLRRIMEGEDREWEMVKRTEAVQEPWSYPGKIRPRDFEGAVERAKARFRE
                     RVRHGKETDPSEDPEYDLVQASEYVEPRDGRRAEWRHLWASGRKPGESLPFHVTFNDG
                     LCFEGNEGGPPAHPAAHYEATPKGAPYGRYEDADAAAARAAEAAHNAACEQSLSEAMA
                     RHRRLFGDTSGAPSGPKAPLPTGCRPMRCAPGPPLPSGRSRSSAPEQ"
     gene            <547351..>548880
                     /locus_tag="LMJF_12_1090"
                     /db_xref="GeneID:5650003"
     mRNA            <547351..>548880
                     /locus_tag="LMJF_12_1090"
                     /product="putative surface antigen protein"
                     /transcript_id="XM_001681666.2"
                     /db_xref="GeneID:5650003"
     CDS             547351..548880
                     /locus_tag="LMJF_12_1090"
                     /codon_start=1
                     /product="putative surface antigen protein"
                     /protein_id="XP_001681718.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650003"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q4QGI0"
                     /translation="MAQCVRRLVLAATLAAAVALLLCTSSAPVARAAGTGDFTAAQRT
                     HTLAVLQAFGRAIPELEKKWTGNDFCSWEFIKCNVTGVSVSGIGPTYAGTLPEMPVGV
                     DYRHVMIKQLDFSEMGLGLVGTLPDSWSKLEGLTSLTLLGNNVSGTLPASWKSMGFLT
                     ALWIEDCGSISGSLPPEWSSMPSLTTLLLRHLQLSGTLPGEWAAMPSLNTLEMTAAGG
                     ITGTLPPEWSSMKSLTSLFVNESLISGTLPQQWSSMNRLIILGLMRTQVSGTLPAAWS
                     SMTSLTTLNLQRTNLHGTLPPQWSSMTSLSFLYLRRTRVSGTLPPQWSSMTSLTLLVM
                     QATQVSGTLPPQWGSMKSLTLLSLRRTQVSGTLPPQWGSMKSLTLLALHYTKVSGTLP
                     PQWSSMKSLTTLALQHTQVSGTLPPGWSGMTSAEVLQLENCNLSGSLPSSWSAIPMLA
                     SVSLRGNKFCGCVPDSWAKKAGLVVDIEDKHKGSDCLAGTDCRAKTTPQTATTATNYH
                     H"
     gene            <554885..>559735
                     /locus_tag="LMJF_12_1100"
                     /db_xref="GeneID:5650004"
     mRNA            <554885..>559735
                     /locus_tag="LMJF_12_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681667.1"
                     /db_xref="GeneID:5650004"
     CDS             554885..559735
                     /locus_tag="LMJF_12_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681719.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650004"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH9"
                     /translation="MHYVQYEEDGENNRDEEQHGISHSMDMHAGDGRYSEGLPADRTA
                     IWDDLATDPRTRPLLRLVPHESVAVTRGRSSYSAHTSILGAATDDTERRAGCGQGEQQ
                     AKANGCAVADDSTHRDSATASLADKHTAPSTSSGLLPLSSGNCDVRLDILEEVELCNV
                     APILPRTFAVEQLVQQIVPCTHALASPTPSPAIAESVSSAELACDAAISPSAVGPAQR
                     LCITPLHTSMTGRCLARLRKVSDEHLAFLRAAKSSLVTTGVVTSALAENGEAFIEDGS
                     VLRARMALPCVPVYMQATSVATYGGSDNVSSTATHTGESSDGDPHEGNEQQSSEGGKG
                     EVPTAPPIVGISQPLLSQLADFSSHRGAMGVALAHEAQAPQAAVTISAVHSRLEELLL
                     AGSDNAPMPREASESVSPISASLAGAMFTANATAEASLRGALNDHLTSPRQERPARAP
                     GSPTPSSLPTSASMENVASCLSEENIACTSFAAAQARYERYRQFLPPRCRAGAGFSIN
                     SASAQDSPTRLGGQISPTDAAQYAPSPCTAVLPRSTEDLETAQEFWFTAAAASLAPSS
                     MTDTATSVAASAMAATDTGADDADLVPFMTTLSRQRCTQRLCIPLESSSQQGSRGQQQ
                     PTHQQPLHASHQRQGGAVVEWSSGAVSYTADTLGLYEEQQARSQHFYHVLPPPPPSPP
                     LASAVPGARSVNTAQGDGSISSFASTEDRSSLRGAVLAQLQRLSRLRSVECAVAHGAA
                     VLEGEDTIEPVLLENRRPIAGAARVSPQPPDPVKGQPSLLPSNSSTSTRHTMSTVALS
                     VCQCRCYRCLPLLVQFAQVPSLASPVLRRYLDVLHQTALPGLPAQERRHGADVTSAVE
                     VGAVSSPEEAREPATQRVPSCMTEAVAESGGPGETTVAGARSSSDRRHRRETAHKNSR
                     HRRCRAEDKVKTANGAKGRKRGREEKTVVTRTRPHSPQTGGDPQRPRVAADPLKVFPA
                     LQQWLMRRQEGGTTTQRTLPNGKRSTTESGGAVLPLSDDIQQSGGAFLQPVAQVTTSH
                     RQDTETCASDAALPPTLPSETLSGEVGSLDWVDDAVLDEVVVVGVVPRGHPHQLQLVA
                     PSRAFCLTLTQRLEEVAEAAVQILGFLTPPHSAPLSSLLAGMRRAPEAAAATTSASSS
                     ETTSDWRAWLETQYFVAMWTTLRRRLTTVEWQTVLQEARGSPFLARWTTVAAAKSSAE
                     SAVFRGHPRSTGIELCLTRAGDEGVAGSPAAEKHKVEAAAIEVLQGVRESVCSAAELH
                     TSACLSAAEDIVTRVVLTALVPILHRRITVMYELLRHFASKSLYMSHRMQCDAYQHWY
                     SMTPSPAAVLRLLQRSGRFSRALARCYPQYDLFPVTLSGPTTLDDSDHAGAAKRAAVS
                     LMSFPSHPQNRARNAAGTPTAAYNVVDRESEVIADLSSKHEEYFPQLDSFSASCATAS
                     SVRGQARVTAPAEAWEVESPLSPSSSSSLTTTAAPTAATSAWVSFLQSWSDEASTQAP
                     LQQERQPVMTYVPEAALLDPRYLQRFAWWMHRAHHSTGTNGSGSAMTISSSGTGGAGV
                     RAQPLPRVATTVRIPGDYLRVLPMHEQDASIRTVLRSIAQKGRTLDLLEMSQHIHTHY
                     ASYVYH"
     gene            <560163..>562364
                     /locus_tag="LMJF_12_1110"
                     /db_xref="GeneID:5650005"
     mRNA            <560163..>562364
                     /locus_tag="LMJF_12_1110"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681668.1"
                     /db_xref="GeneID:5650005"
     CDS             560163..562364
                     /locus_tag="LMJF_12_1110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681720.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650005"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH8"
                     /translation="MCCVPFLFWVCPPPHLFSLSLPTPSLRSCGARTSCVAERSHASR
                     RGGCGLPSPLPAQPTSPPDTRTGDTCICAFSFTPDEVSQTMTDRCYRTLGLDRGAAEA
                     DIKRAYRRKALLFHPDRNPNGAEAFKALQGDYEEALTDARRRGARGGGVPPFSSMASP
                     SWDPAAPAAGAAYRFARAAGTACPPFFPEPSPAPLFTDEELFADSIPGGWRDVCARRG
                     ASARGGDKAGGRNNAAGRTEEINGSNSCCSQEAAAADARWRRAHGARVPVSAYTFSGP
                     VPPPPPLPSQPSPHLSSSSFTSFCTHTRARASVAGTGSRLSTQAQRNRFVSRECMWKS
                     SSAEALSLDAKQEAGGAGKVGRSRGCDGYTGQNREPVCGSDTGESAEDRVYREAVLLQ
                     RRMPALSGKSRGAAAERTRTHSQSDRAFSTEGVPVGSNATFPATRGVYHQRSDLHTSS
                     TTTTTTTSSSTKGERLEAALSQREALCRQCRDTETTLQHEVDDDHAPAFSDDGDASAH
                     PDKGDGAGSTNAALGPSAAGPLAASGRDTSRAGDPFPVKQSACPESNSDDRLRGDLPH
                     RDRIPDECPLLQSENPRGRYTPNPAEVAEMSDMEVYLLASVAEDINQKTQTVMTARLS
                     KEPYSCSASTPRAHQHVYFTCTHPSACEDCYASGVSKCPLCGASGVDRSSPPPSATTT
                     SSSIEKGGTTGASGACTGTRASLASSSAPSPETMYEPVRVHSVLTCGDADA"
     gene            <565065..>568925
                     /locus_tag="LMJF_12_1120"
                     /db_xref="GeneID:5650006"
     mRNA            <565065..>568925
                     /locus_tag="LMJF_12_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681669.1"
                     /db_xref="GeneID:5650006"
     CDS             565065..568925
                     /locus_tag="LMJF_12_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681721.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650006"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH7"
                     /translation="MAMEFAPDESRTSFSGSLTITKTTLTVFKATRSPATAVRDPATN
                     EFFFVGVCSTPLIQFYRHKSVITLMRGTSFLFDNAAVSIDLQLGSDASNHRGSSIHSS
                     NHSRRDNPTMWETLAMRFTSLEDCDRTVEVLLAHNAEEVFVPPFPMRLQGDASRNTST
                     TTILNRYNSHGSPILNSHRSASIPISERSERRDSTHRTNTRGSTAQTEVSTPRSSRLP
                     CRRESDDAATRSSVHTVELTPRSSRLPSRRDNDDTASLSTPSQSIRSLQQRVAPGRST
                     AARTPNQPDSEKLQGPQRRHHSSEKKRDTSAVTSASHSRLHSSAHRRLVDPAEREFAT
                     VEVARPHSRPHTCRSHSRASASSRSSHLNGAAIAMHEDIHVRRHGTPRSARSTHSATS
                     STTSASAFRRYVSPCTDTKDRNSSVSPRSPVSHTKLGQDAFLRSMQLLQHDRLHFMEH
                     LHKDAAHQVYLAEEAKLKAATASAERSLSRHRARSAAGGEMSEAEVARLLEIEGRLVK
                     VEALHSEAEREREEAARLRREYELKNEEMNARIGGSHDVSEVNSSLVSPHRSSVHPMN
                     GQLMVMPPQNGGGSSYFLMGHQGCVMSPEWALAADPAATPRPDDVDLGVAIVDRYIFG
                     EEWSRVYPAYEAEVRFNAQIDVCLTMKLPRRLVAITNIVVDRPGLRVTAEIRYDRAKI
                     ERDGVERRMNGCPFRFLQRFYDMRDLYDRMHDGAAALTCSRGAPMLMKPSAANGRRPS
                     AATSRRASRTVPAPCRRSSHGPQYTNSDVSEIGEGFEDDYGMGARRDDYDRVCAPEDF
                     MVKRRRRMAAELRHQLADNMAQLEQEEEYLRDRIQLAEAKDRQTVGREVRLNVKATLA
                     TSLANLEEEERVERAAMEVSAARQLHVLMGSHRRTLVLFGLQASEAERRKQIGAQEAQ
                     ARRDLNDAMNPALAEQRKQAVRRAREGEALARRGAPYPRKQELEAALVDVEADEVAAR
                     AIIRSQAMEALLDLLSRSPAPKFKDGHRVPSYASFTLKALLSDLQADEVAQRRQIAAD
                     ERRRRALYRHEDVVKREAADRVAIEGAEIDAREGIVDDMVALNRHQLERRLNDREQLL
                     SMINEEHFYRKTVLSDEQDAFEVIVELFTARLKDLLARTPEVGDDDDEDLRRRRVSTT
                     RQAKPFHYMTFSPDDMDYPPSAVLAVEGIVGCSINKNLEVVSVARPLPKAEEEDLQLQ
                     AGDMILDVAGHSLHSLSHLREVLSNRAMQIQEETFAEFPDVPQDQLTTSPALQKYIDV
                     LCEHHNFLVQVLRGCEIYQIIVRS"
     gene            571845..572693
                     /locus_tag="LMJF_12_1125"
                     /pseudo
                     /db_xref="GeneID:12980986"
     misc_feature    571845..572693
                     /locus_tag="LMJF_12_1125"
                     /pseudo
                     /db_xref="GeneID:12980986"
     gene            <573388..>574545
                     /locus_tag="LMJF_12_1130"
                     /db_xref="GeneID:5650007"
     mRNA            <573388..>574545
                     /locus_tag="LMJF_12_1130"
                     /product="putative NADH:flavin oxidoreductase/NADH
                     oxidase"
                     /transcript_id="XM_001681670.1"
                     /db_xref="GeneID:5650007"
     CDS             573388..574545
                     /locus_tag="LMJF_12_1130"
                     /codon_start=1
                     /product="putative NADH:flavin oxidoreductase/NADH
                     oxidase"
                     /protein_id="XP_001681722.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650007"
                     /db_xref="GOA:Q4QGH6"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH6"
                     /translation="MSAASKSIDAMLKPLLVGGRWMSNRFVMAPLTRCRADDNHVPTA
                     AMVKHYSDRASMGLILTEATQIHKGYSTFAHEGGIYGKEQVDGWKKVTDAVHDKGGII
                     FCQIHNGGRSTVPSNVDEDVRIVAPSAVAITGHKCAGSFARNGKTQPYPVPHAMAAEE
                     IASYVKLYAAAARNAIAAGFDGVEVHGANGYLVDQFLKTSSNQRTDEYGGSIENRCRF
                     LFEVLDAVIEAVGRERVGLRISPLNSFNDQSDENPEALTRYICSQLNCRRIAFLDVVR
                     GDFFSPARGADKWAREEYEGVLFTGMGFEIEEAANTVESGAADAVVFGTKTLANPDLI
                     ARAVAGAPLNKPDFATFYTTGEAGYNDYPFMECSSCLPASPSGAQEAPPQQ"
     gene            <578880..>581366
                     /locus_tag="LMJF_12_1140"
                     /db_xref="GeneID:5650008"
     mRNA            <578880..>581366
                     /locus_tag="LMJF_12_1140"
                     /product="n-ethylmaleimide reductase-like protein"
                     /transcript_id="XM_001681671.1"
                     /db_xref="GeneID:5650008"
     CDS             578880..581366
                     /locus_tag="LMJF_12_1140"
                     /codon_start=1
                     /product="n-ethylmaleimide reductase-like protein"
                     /protein_id="XP_001681723.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650008"
                     /db_xref="GOA:Q4QGH5"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH5"
                     /translation="MSSAGNHPVYTHLFRPCRVGQPTMKNRMVMSPLTRCRADDNHVP
                     TAIMTEYYGSRASMGMIITEAIMVQRDYSGFAYEPGLYSAEQVEAWRTITEAVHARGG
                     LIAAQIYHAGRATTPANLTSDGLVPIGPSSVGIPPEAQQCIAQWSRDGKAQAYPQRIH
                     AMTSAEIGAAVKSFTRAARNAMAAGFDAVEIHAGGGYLLDSFLRDAANLRTDEYGGSM
                     ENRSRFLLEVVDAVAAAIEPGRVGVRLTPLDTFNGEKDSHPEALTAYVCQQLDARSIA
                     FVDIVRGDSRANVPGNAEVWVRRSFSGTVLAGQGYTSTDMAEQAIADGTVDAVLFGEQ
                     AVSNPDLVWRVLTNTALNGADTSTFFTRGSKGYIDYPVCEPHSFSDPRVVAGTKTRSG
                     GDSSRRLSCQRSTSMTMPAKERSYFAVSQPLLLGATTMKNRLVMGPMPRQRCDAQQCP
                     TAMMEAYYARRASYGLIISEPCEVQPCYNTYVRGAAISTKAQVQAWRKITDAVHQEGG
                     LMYCQLHHGGRATLPCNITNGKEKRAVGPTTQGISADYRCPAAFAADGNEQPYPAEVV
                     RLSAEKLKWIVKLYVAAAKNAMVAGFDGVEIHAGGGYLIDQFLRKCSNTRDDDYGGSP
                     AGRCRLLDEIVDAVAAAIGRRRVGVRVSPTDLSKGMKDTDQDVVAETVATHMAERKIA
                     YITVASGSDGYYHGPVPASILKKVLHCFGGVVMCDDNISLAEAEKRVVADAVQGVCIT
                     LSAIANPDIMNRAIHGFAPAEPDMHTLFTHSSDGYDCYPPLAELRKEARAEQARQSAV
                     NRAHCAPAVSKHCTPVAMNAKGSLKAPIVY"
     gene            <586708..>590070
                     /locus_tag="LMJF_12_1150"
                     /db_xref="GeneID:5650009"
     mRNA            <586708..>590070
                     /locus_tag="LMJF_12_1150"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681672.1"
                     /db_xref="GeneID:5650009"
     CDS             586708..590070
                     /locus_tag="LMJF_12_1150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681724.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650009"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH4"
                     /translation="MRHLLREVKLPFMDVHLIETYLFHLAQGTPAKESIGNESTSNVP
                     LLGDRASPKAGICREVKSPPPPTLQGVGLKSTTTTRPATVATISRTPSLEVVEVSKSE
                     CYYPIKASTRDSERHRDGHTDNAAAVRTPLQWGAKRIAVDDCFAAAQADRHVKALSPC
                     PSTTDAPDMIYKVDIVNCAHAEESHPRPPPCPPRPQPSSRAAMVSHSALTESCAQQRQ
                     HTPAAFPLSLLGMMERVLRGYKAALAVALRAVMHREAVWTALQQFLNVVRSDWAPLAV
                     HVSQVAAPVASRAQGESIAAANGTLGASGISGALPKLRSPHDGVDSSGDMAVAACRAE
                     ALVSPHYTAHGMSSSASTAESDCDNKRSSTPEKQAVLHTSSDRTGTVVDGETTRSSSA
                     PFLKRTVPPAKSAAHHEDTGVRTASCEGEGQVDILAPPPEVTGGAQQDRHPRGQQRPS
                     LRLSVESLRQTSEQFALGAESEAAALNGSPVCKPQPPPSRILPRLLRVPISTPSSSAG
                     ATRDATSALVPTRARSAAAQSRKTFGRADPRRSAGAWGPVRNAAAHRTLAPRHAFPAL
                     PGKQQVCRAHRSATPADGTRRRSQSAPCVTEAAFPSPCPPCDSSFSATPRARIMARRN
                     AEAGSIPSRTRRLVLHPGDSVSPMTVRVDRELRASSALPAPGRQEPHDASRVTRRSGG
                     ESAPRPHSGLVPSLGMRLHAVSRQVYADCLYHYLYYLQRTTLAVVEAVDELRRHHLSH
                     AAPFVVERRNYLLEVLMQTSMLACDAAVQWLMHESTFEHEGDLKDGGDQHPVAGQPSD
                     STSDAVYCSTLLPGVAQQTCNRISDARRWTPEIPCTSSSRQCGAAAAQEIEPAGERGA
                     QGAVQRAVACGQWPEKLLRAPLMSTHASLARYAATPLFLVRLDEAPTSSPGARQETTS
                     RTTQPGDGGSAQSSAPTTTSPVSAFLSPWRLVLPGDVLASYGGDTAAPEGERYQTRIA
                     TTYAVRSSTAPSAAALRRRLESGEHVLHLEVATQLVYLQTCMRCALRHEYILYLRGMS
                     EVHRRFYADERKAAMCRHGAAGRVCATDCDRMDAAVARGGTPAKHGSMAATMARDRYD
                     RVSLKDELLRADWMRKLRESWQLLMAGSSSVA"
     gene            <591769..>594612
                     /locus_tag="LMJF_12_1160"
                     /db_xref="GeneID:5650010"
     mRNA            <591769..>594612
                     /locus_tag="LMJF_12_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681673.1"
                     /db_xref="GeneID:5650010"
     CDS             591769..594612
                     /locus_tag="LMJF_12_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681725.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650010"
                     /db_xref="GOA:Q4QGH3"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH3"
                     /translation="MAEVLAFAYGWVSGIVAVVVWILYGSAALPHLMWSVKSVCAHIP
                     VLSLLVEGMAAQPPGMQDGDGASASPPFCRFDGAAVDQNLEGLQGSPMRVKPITASAT
                     CMMSWYRPDGTIGPPIECLLSLENNMVTVYQLLHLTDSSSGIMASGSTGFGNVHSKSK
                     DARRESKFFRTATGVNVVEHRKGKVYVLNTTVMEVRQFNASKKTATAAADQLKPGTGD
                     RGASGASAGEVASAKASSKAPSSPGLPGSFSSGGFASSGAQVTEHWEGTLNESMASAK
                     GSMSRRSVAGSGAAVSGASETTAANLMAGSGGADSVFTGRVLIWRTVDGRPLFDSGTP
                     LPQSFSSRTGNSTFADSCGHSVPFSTSRSHGAGGACTPRNARSTERVAGHSTDSSDAV
                     DDGEDFTVADSEGGDAAAERRQQQAHRARSHHQRRWMMNDMASWSCVIIKFERSRECE
                     RWHTLLSGLKEADAWHKYAKTLPNPDTINTFLSRFFFQNMRLAAFSDTLIELIRKQLR
                     SLPLKKFPRDLGGDLILDDLLIGTQIPWISDVSEPRVSANGEVGFDFNLFYKGGEEGL
                     SLFFRLALTYCGIRIPHVVFSVKLLELEATVHVSIGPPPSKTFWVGAHKPPIIRLEVH
                     QGCASGKGVLHRILTALPDLSGILTNFVKLYLFSDMVLPYMDDFPLPSVVKSLKGSFT
                     DLRVRAFDWQRAAKISGAPHGGSFASGAGSNDGSPEGKAAERSIEQQVTSGHRSQLTP
                     WKSSVCSTATTPLFASTGHASKGAVAPDSRDSLPPVVLDGRSVSSRLHAGVGAKFPAP
                     ASGDSDGNTGSFTSSCDANASRGVRSPLIPALHSSRLGSQGTRDSPTLPPGRAAPDRA
                     SDQTWLSATHLGNRSGSCSASVSSIPMSTSAMDDGLFCDNNTCNSESDNVMSSASKKR
                     SVTSAAMRNLKNLLKVKGKDMTRESVSRSKKKS"
     gene            <596806..>598980
                     /locus_tag="LMJF_12_1170"
                     /db_xref="GeneID:5650011"
     mRNA            <596806..>598980
                     /locus_tag="LMJF_12_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681674.1"
                     /db_xref="GeneID:5650011"
     CDS             596806..598980
                     /locus_tag="LMJF_12_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681726.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650011"
                     /db_xref="GOA:Q4QGH2"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH2"
                     /translation="MGIFTLLAFFYGAVGGATSFLILCFIIFRKTESVLSDTVLKKAR
                     KHAEFDAVAKEAAVVAPAKVETLCKMVRFDNGIVGDAIPCRMVFYGSTIDVYQVDKLR
                     TLPDHRHEVVSEHMLGRIHRACIVATSQRISKYHRHRNQSTRYAAIKGKCTVLNHKDD
                     MPLFLECPNAILKERLRCIMEHQAHETIMEHPCRRSRRDRNPITEEEFAVGTKRMQYE
                     AYNERWDHCDTAARGLGYQHDLMGINTAATRCRGSSPLSASNLQYCSSGASAGRRGRE
                     LPPGALEEVPLSKWTCVAIKFPTRRVQERWLNLLQSTPESVQWHDFITHLPQVDVFNL
                     VIARLFFENSRANTLHDLLEEKLKKKLARVSKSLPPKLRGNIFLDLLDVGGEIPLISN
                     VSDPVSSTCGDTEFDFDVLYRGGLALKIRFSVLYRDIRVPDIIFSIKVLELAGRMRFV
                     VGPPPTRKFWLGGPQPPQLRLEFTQEVASHDGILNAVLRLLPDMSKTASYIVKVLLFE
                     DMVFPNMDDFPWPVFGEDSDDDDSATAYSDVAGAANAQNSRLESLGNARNSSDAGGDP
                     ERRGISSNSTAGGAANENRGVQNSATSEQPSTPPLRPMPPFASAPSTEVAPPHSGSLG
                     TFDSNRDAGAKSLTRSTLLQSSLRADPASAISTPLHGLPPRPPRMASSGFLHGTVARV
                     PTSRAARSLGSPASSGPNLQSPFDSGDDACRSTSGTSSDGRK"
     gene            <599882..>602518
                     /locus_tag="LMJF_12_1180"
                     /db_xref="GeneID:5650012"
     mRNA            <599882..>602518
                     /locus_tag="LMJF_12_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681675.1"
                     /db_xref="GeneID:5650012"
     CDS             599882..602518
                     /locus_tag="LMJF_12_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681727.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650012"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH1"
                     /translation="MPPKLTSKNIFDVLFDELPADAFIDTGPASLKEELMLEAAGMLS
                     STAEGTGGQRSAQRGGTNAANGSGGGGGPTSYRRHLLPSAFVAATAAIVRSSGRSAPA
                     ASEDTAGAAAAEQWGDLQDADVLDAEDLDDGTSSPLTAHARPPAYTLAPARTTEVSSG
                     SVFRRVDDEVDGGSADHFAARRRGIHDAHKRRDGGCDVTDAESGFDLQMNAEDDAVKE
                     ATKYAGCVAEIQATEKAGTEQQTAYSGQPVGGGSKPNLPHARPVASSAGAGIGPGVGV
                     VRCGTGLSVSDDAAAEGTVPATVTSVTAQATAGIKTGVLVEAGASSAAVSGAAGPHGE
                     GPIDDQALPSYAQGRSQARGTGHAAVSGGQTVSAAGGPLLQRPFGVARAPQRGGTLTA
                     AEQLALMPPGLDRVYTGACVMYRHPKNFGFVSPDVGGPDVFFIISSIALSFTRLALRA
                     FYLRSGMPVPPSVAAAYRVGAANDSSTPTGGDGAPISGTTTAMTDAATAADASSTAPA
                     EVSALTPAFPRVAAGVTAARDGQATIAGAVLNEVGVLGATPVSTTRPADAGDRVSIPP
                     TTAEELAWAETAASLLTSATARLLQYQVDQGIGGGLRVGDRMSFIVTRNHAARGGNGR
                     LLRAEFIRGVPAVQLAMPLEQSWFHPLFPGAIGQKTSAPYGAPSRPPPPPPPPPPPSS
                     SSAEGGGREASSAVEPLGPVGSTSTALTRYTGCVRTYDAEEQRGYIRCDESDGSGGSN
                     TPDVIFYAHSVLWDLTRCPPLKRQVKESMRLAYSVCGTERNGKYIATLITNPDGEPFC
                     EENMTFAQNVLPFFMADGGGPSRRRGRGEDGGGVGSGRAVMGTDGGAGASAEDVGGDR
                     KRVKAAEDDMLLLYAEDDYPFM"
     gene            <604235..>609058
                     /locus_tag="LMJF_12_1190"
                     /db_xref="GeneID:5650013"
     mRNA            <604235..>609058
                     /locus_tag="LMJF_12_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681676.1"
                     /db_xref="GeneID:5650013"
     CDS             604235..609058
                     /locus_tag="LMJF_12_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681728.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650013"
                     /db_xref="GOA:Q4QGH0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGH0"
                     /translation="MYFHGPSSSDVVDRPSLSRSPPTICTGAPSTAAAALPGIQGQQC
                     GPSPSSALSSNSTWINASFLRALHSAYAATPKAVGQSDGERARNGDGVRESTLFPCAV
                     ARLFHAWYEALATTRACAVVLPPDVDGPLVVHLTLLLVGWEMMQATSLYLRHRRAMRV
                     SAKTEAEATQDCDENAADAEEPSDFLTSRQFATAQVPSPPEMESVQTGQSLLPRSSTR
                     AVRRLCSYWALIEKAVRAAPRKRAGAPTNVAALGWFVSSELVGHNSAQGGRDRRAFHR
                     LPSDAAPHGAGTVLVLSDQAAFPVMTEPGGSSERQPGVASYAASLVTAEKPAEVAEPW
                     RVMHFLWTDVVRYSVTYTELRQLLLGCTVAEIAKVFENAGDAGSCQGGLCAAYSTRVL
                     PPRGRGNSSRNVSHEAAATTAHCVTSPTSSGVSPSCYADPRVAVACVALTWYLSLVRE
                     VYDAVIVHEDVQRCAGALEELEGHSKAMYQHGVQAGLAFFEEELHNVWYLGVADASSG
                     TGEGCASGQPHCHEHPMVLPEVVSTTDDHAAPAAASSSASMAAGVHLSCRRAGNGNHS
                     RCGGAGDSPLALSVPPRSREECVLVGATHTPIRVASPRACWAELNGALAALLLRRRLM
                     ELLHVRSLFSYMYTSSVAKMVSSAVLTGLTCLSSRVAASGQVAREAISSNLDTYYRTH
                     GALSPPGSHSDSGSGPSHGGAVSTQQRILSLCLLECMRLAVNTVLTRTTHAYINMAAS
                     HRRNAAKAELYEALTRLPLAFFDTHSFDEVEQIVYYVNDIEGVEVHVHHYICSLVMSL
                     FAMQHAVHQLPCRARLLVGATVAVSLTVKCIGQRIKQWVQVAQRTGGVLPPWLRGDEL
                     GGVVRGTAELDAQVEENTESNARQGGVMLRGLDIVAVLPQLRLYAADLSLMRWWTHHT
                     RACGAMAGATEASTFLQGLLVLPFQAYGHLLPALGGALMTFADWVLPTLVASYGASMA
                     FCSVDALSLSNRLVEAMRCIGDTVDAVVDGRRVAEVVLLNAYKANILEKVLDARRWEP
                     TTADYARGFGFRGEADEHDRDKDKSHDAGTGCATRAGEVGSPRYGQGRYLLQSLRPAD
                     SHTVTTSPPSLMLRWMHILKHNCCWCVTRAPPIRILRGYLRLVRSRLATMGIVKEDCR
                     GNRRRQSRKPYYHHRCPNRPCYLSCRRRRRSPQEDPQPSKSLRPLPPGSASAATDACL
                     SNHSSEDDVGRGADARPSSSPCSDDSDVDCEAAAAATLALLTSGTVHAVTVRNVQFCY
                     PTTPTVPVFSHPITCSFVLQGNRDASPSSSPSPSPSSASPPQRTRCSCSSRGRLVCLV
                     GPSGHGKSTLLSLLLGMYTHYETPSHILDKDNDASRGAGGGEVQQQGGAEALDRGAAL
                     FNLSSPAVIPDIVLTLAHSSDELEPAGLHDAASTPAASAVSEVVYEQLSVASIPRDIL
                     RGRLFSFVPQSPVIFSGATIAHNISLENYVSLEQEELLAEIAQCAAWAHCEYIHRFPQ
                     GLMTYIADSGAGASSSPLASAGTGGGGAGGGGVVRLSIGQAQRLMMARALFHGRRGGT
                     VLVMDEPTASLDKEVKLQILGEWRELLDSGIVRGAICATHDDDLIAVADQVVRLP"
     gene            <610907..>612493
                     /locus_tag="LMJF_12_1200"
                     /db_xref="GeneID:5650014"
     mRNA            <610907..>612493
                     /locus_tag="LMJF_12_1200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681677.1"
                     /db_xref="GeneID:5650014"
     CDS             610907..612493
                     /locus_tag="LMJF_12_1200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681729.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650014"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG9"
                     /translation="MASVGRFVQTADPAVTALESPPLPTETRLWRQSPDCQSESDSNR
                     VSGSVLDSVKSNGGPKHASTARLHASQDLPTSVTRFLCLSSSSNSAAAKDLRRQLLVV
                     RDCCVALGNKVKGSELLLLGGSQLSRKVEAMADFNSCLGVIFAASLTFTGETEGVAKD
                     TLCSVVEMLKSAQESGDEKVFRAAVVKIVNRILLCTPLRPPARNAAKETARKSAGKQE
                     QHAEQEPKLEDECLDFLTVEDGVPVLLECVWKRWLRYFEDGYVRYVKKLMAEERQALE
                     AAAAAAAADDYNGEEAQYVDGVSATTTQTISTVPLFTTCQDYWKSPASAYAQFCYILL
                     AIFFVRTKDFSLNYLARVTKLVQYFTYQLEFEDGEPIAVRTDTDAEEDSAQSEDEDDD
                     RTPPQQEGPRKEKQVHSLPMPEYDKAVTQRRFRMSRRSSSQGLVPTVVSFKKAEKPRR
                     HCHKCFFTDALPGDLRPSVEAVRQEEAEAAARDSEEHSHLPVVRRSANLDLSEHSISP
                     QREREQLDACDASMESVQGV"
     gene            <618096..>621116
                     /locus_tag="LMJF_12_1210"
                     /db_xref="GeneID:5650015"
     mRNA            <618096..>621116
                     /locus_tag="LMJF_12_1210"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681678.1"
                     /db_xref="GeneID:5650015"
     CDS             618096..621116
                     /locus_tag="LMJF_12_1210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681730.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650015"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG8"
                     /translation="MSHPYATNEPLHGAGDDAEHAVSNVVSPLSGAAPPVAAMTPSPE
                     EHADGSDNAHPAASSCTVEKHTLCDNTQVIHGSDQDDIATAVSHSPDVSSPSSSSCSA
                     ESSMPPSWLPSRSSSCSSATSSSVICASDCSSCSSGNADLVADGASSPESGHSHHLHQ
                     GHRHRHRRHHRQNSSRHCSDDRHVTHGEVDRRVGTTASRRVQTSEHTRFTSVLAGGRR
                     GSDRDGPGAATAVSCGRIDGDVDGGSSCTQDVAWWRSFAAAAKVTGAVSTATCDVHPY
                     CCAPHSPQFPLQRQQHAAGVDPACRDVATTPQAAATQRLSIISPFVATVSGTLFASPT
                     PLPPPHPRRSSSARIVTSNAFITHITGGVPRSSESLFTGKGSGGRFASTAMDGSVQMH
                     PSRSVGCVARHAQCGTLRRSFSFTSGVPPVSASSYEVPPFSTSRAASPIAAANAAIGA
                     PRTSLTGERQHERTASVASSVYSASSSARPSVPLPPSHVGIASNMMAAVWVDLPLSQS
                     GSRSATPLNSSDAYAPPRRRRTTPRRCSRPQSPATSTLAASGASSLDGAGYMSSATGG
                     APISARRLLVTVSTQTDNDRITVEGCTTPVSLPRHLYCKSSSTSPYAAKVGGGEHCGY
                     AAHQYNLNGPFERDGAALTAAASVSSTSAEVSPRSLLASAAEIRLDDHVAQAVLDTDA
                     ARCVQQHTTGDDMPAAPPNAPTSLSTDVATKGNHLSEGDSRSSASAEPPGTMYVYQTL
                     CVDVPPLQGGTKAAAAAVNTSAATEAGTDSTAGILAPPATFSLPTSFVTQLRGVVPPA
                     LPQSEAGAPPAGGVPQPTTTAAISDEAGAHSTLKAAGGEGRRGAARGTGSVGCGETAS
                     VEEAGDAPYPQPLPPSRRDEVWRLRAELAEMRHQYAQVVRQLRQMQESAVAAGPAAGS
                     RQSAAAAAALNAGHRVATEAVLITNSPPLPAASPPSSLRSVAIQNRSGAPENPLVESA
                     SSVSSNSDNSGDAATVTLDRVRAALQRARERATN"
     gene            <622919..>627142
                     /locus_tag="LMJF_12_1220"
                     /db_xref="GeneID:5650016"
     mRNA            <622919..>627142
                     /locus_tag="LMJF_12_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681679.1"
                     /db_xref="GeneID:5650016"
     CDS             622919..627142
                     /locus_tag="LMJF_12_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681731.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650016"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG7"
                     /translation="MWALRDAHAHGATRVSIGDQHLLTGGADGVVSLYSTKHWPKAAA
                     LWTFRCHDAAVTDVALVDALELALSCGRDGRILLHESIADSAKLVSRVICQVTGEVRC
                     LYMDIERRRLYIAGDSLRCLDMSQEKFQIRTIPLVVPFPLVSLAVSPCGRYIAMASAS
                     GELGVVPTHVTTPVEAGAAPKTQFVFRSVLSPTAKKEDSAMYRMSWCHTATGGLMLMV
                     PTSTEVQVYALEDRHSNSSLSAPRMRAIGGLHDQHFTDLHGALVYPITKTQVACLLAT
                     RDGLFVGKVQSKTLAMSRHMSERYNASCFSTPSSGTVMVAAAEGEDRGSTAAVTDVQV
                     NPMTGDVAVGLTDGRISLLRRASPKAWRPATAAGSSTAAMEGDADEDAESIAEQEDKA
                     KAGNRSTRHERRADKSGCGAAQAEKDDDDFVDDGSDDGTASVDSASSASSSVASSDSD
                     AAPEDFGKVVVDLQRDGASLHDHDGERPSRWRDDEEAALAHAKREAERPRGRSRFLDD
                     EAEEGTSSDDEEGGHGDDNMMRARGQARAPYDEEDHCDDDLSMEGNAEVNGDLANGSS
                     SRAGDLALPVGRVPAVQDYSFQVGATPAGEEGNCYLAYNSVGYIHCSRDATTVHFHDI
                     SHPAVRLQLRDTILMGALSPVGAAFIVLPADPTEAQGSVDEAPRLSVFYHAFTPLGAQ
                     SEWRVALLPGETVRCMAAGIRYVAVATSHYLRIFSLSGLELAVLSKSQRIVTMVGTSS
                     RKLMSSFKADFDPLVIINLTGTGELQMEVIDVGARTSALPPRTVPLTELPDGSTHQLQ
                     WLGWSEDGLLHIVDTAGVVRQFTEDWGGSWVPVYDPRTLVDQSYALWVYGISENALLA
                     YRYSRDDPSYPAAAASGLSTELVPLFLPLTRTMGADGLERWDKLLRQQLRCDELKRHS
                     TFYSASIAKYDEVHDHHLLQFFDSALKSQQTTRAMELAMLMEIHDRVVKCAQLANANG
                     HVKLVPKLLALYEMRMATKQKRKCGLPTKEKLASNKKKDELLHKLLGQMLPQDKGTKP
                     ADSAAAAPPTPIAAEVEDEESKEKKTENRTSPLRGPASTIASSLTATSPSAVSGVMTA
                     DPNTLPSQARRHISFAKEVALAPPPSLSSQSTTTSTLSTTRSSAPAPSRKLANPFSQT
                     SVKPAKATDQVRHSSLSNPQQSHNQHQSQLQVALPTSTPHSSMATATRAATLLGSSQL
                     DTPPRASVAATRTNAVSVVHESDAAKCLFADDATPTGSRVSAARIPSSPGHGASPLPT
                     ASTGCSAATPSVSAITCKPDVHRAAASTPSSAFVARELPTTSTTLVASGTPRLSSGAV
                     DPFVEEPAQSFAGTPSFEFLMGSHTSATSAAAEAPISVQSLLDVGHGETAPVVRSDSF
                     GEALRKRYREDEEEDAEEAPLATLPKLSV"
     gene            <630259..>631257
                     /locus_tag="LMJF_12_1230"
                     /db_xref="GeneID:5650017"
     mRNA            <630259..>631257
                     /locus_tag="LMJF_12_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681680.1"
                     /db_xref="GeneID:5650017"
     CDS             630259..631257
                     /locus_tag="LMJF_12_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681732.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650017"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG6"
                     /translation="MSALFVCSPSRTTVSVQLARCALRLQRRLGRLCEGVVVTMAIMM
                     HVGNQVERPARNALRVLVPLLICLFFFLYITGTFSVFSRVQEIVQAEETSLRSASGIA
                     EFCKDLQKLAQQQYWQVLLFITSLYLTLQTFCVPGTVVLNAAVGAVMGTLLGVPYCTL
                     LGTVGSMCCFLFSRIVGTSLVEAVDSRLMRGKGLTKIRSQVSYHRADLFVYLIFLRLT
                     PILPNWLVNLASPVLGVPLHTFAGATMLGIVPQTYLTVRFGSLAHSGRPGEKKRIVTP
                     WDTLLLAVTGVGILVGFRLKKKFVPNRKDGGSGGVAADRLSGITASSGSVCASPLV"
     gene            <631818..>634424
                     /locus_tag="LMJF_12_1240"
                     /db_xref="GeneID:5650018"
     mRNA            <631818..>634424
                     /locus_tag="LMJF_12_1240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681681.1"
                     /db_xref="GeneID:5650018"
     CDS             631818..634424
                     /locus_tag="LMJF_12_1240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681733.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650018"
                     /db_xref="GOA:Q4QGG5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG5"
                     /translation="MMAARRASSMDRSAVGGFDPVAHYSPCPPLPVIGQPQNTALSAG
                     DACPAPHAGLKQHDSGVAVLKSSRKTASSSPYVITDKTPRAELLAIIMQLQADLTQRT
                     DSVNAIQRNFERLSAMHHAEQLELRRLRLLEKTRSEVAPDGLDAATRQLESVLAEMRH
                     KALEQQTTFVQMEVDLQAANSSCALQQGIARLIASHADGFRDVLQAEAVAHSQLYQSA
                     MSERAIIGSRNEATQQQLLCKDVAQLVADHQAQIVTKLIRGGAAESCRLQKSLAQVST
                     ATVQELVRQGLRETAEAVHQYVASIHAADQERVLAEAEGQRDRERLRLALGELLRLRL
                     RATEEAEATARQALLFGALQACATAQRAAEEVRLLTANADAAAAATRSSWEVTAALLT
                     RRVSDWHDAADMRLVDFHDTIEASMAEKARERDAQSQQKTQELLLEERKRLENLHASQ
                     MQTMQVDWRRQRDAVQQSHAMQLEQVRSDLVAQVQVAEDRRVAAERRTGAMEAALIQL
                     KRDHAAEVQAVEAHWRSAVSDAGRHCEQRWRTMLEVYQEGQKAHRGAMLQLFVDFLCT
                     RGQCVYEEQAERAALCRSHWRNQTQHLREEQAAVMQHGVATADLLERMRCHKEDEAAS
                     RAVLHASEASDWAALVRKEAAHNAQAHHAVSMAAAAAGLEGLRAEMAGREVRWGQRLD
                     ALEADLRRAQQKCLGVVRRASDAVVAAQEAQAALQATQRDFAAYRCGVSAAAQRIEVA
                     ESATESACCCSLCLQLYCQPVACVPCGHIYCANCLLRHARNRSLSSVTSSFASAAGAS
                     TSENGAVGARAALEVTHWLRGKSTPHAFLFCPECASATVSTVVELPILGELTAKYDYK
                     KRSLAVLLAELR"
     gene            <636454..>640569
                     /locus_tag="LMJF_12_1250"
                     /db_xref="GeneID:5650019"
     mRNA            <636454..>640569
                     /locus_tag="LMJF_12_1250"
                     /product="puromycin-sensitive aminopeptidase-like protein"
                     /transcript_id="XM_001681682.1"
                     /db_xref="GeneID:5650019"
     CDS             636454..640569
                     /locus_tag="LMJF_12_1250"
                     /codon_start=1
                     /product="puromycin-sensitive aminopeptidase-like protein"
                     /protein_id="XP_001681734.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650019"
                     /db_xref="GOA:Q4QGG4"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG4"
                     /translation="MTGMPSSMSLPPVPEVVLQELQTPEFRMPSLVLPQHYALEFQPD
                     AQQHSFVGSVYITMRVLETPSVPLRHLVLHALDLRLEASSIRVFVPADPSNAFETAAT
                     QAHPSHHLGNEASRQRPFSIAKGSYVACQGLDRIDISETALLAFAAPLPSKVGDTFVL
                     IIDRFDGVIATPPAMEGLFHSNFKDAAVLSTHLEPTGARRLYPCFDEPAIQATFQLSV
                     IATAAQTVLSNTEVEADITVAALPYAAQKRQGTVEDTSNRRGEAPESPTAAAAPLPRP
                     APPWHCVRFATTPRLHTCIVGFHVGRFAFLEQRSRRSGVLCRVVLPHTEARSGGCFAL
                     DLVTKAVDFFADFFRVQLPLQKLDVVGLETFCVLGMENWGMVNLLKDYLVVTETTPLE
                     RRQRVTRLIGHEICHQWFGDWVSIEWWNGLWLKEGMCRYLEYFFVNAVFPGWGLWNEF
                     VCNTMNGALLADADPRETHPVDSCNPAPRRIYDSFDAISYGKGACVLRMLFSIIGVKW
                     LQRATHLLMVRFAGRAINAKDLVDCILDTTKERCSGEAQLQHVKALHACLRMVETVGH
                     PYLYIYQRPGESYTITQYVPPSKKHGLLVEYLQQQRRKPNAPVIDLFSAPVGASFEWT
                     PESTLRRVTASFSIPLRTVEWTPSGCAKASLIFLEEAEHHFACPTSASTLKTTRDTPF
                     TPPVAAPGHAGVETGAAPGSTASSTPQQTSSPSLLFGAPGCTRYFNQGGSGFFQCDYD
                     AATWRRLFELVAFFSEEDRVIITMHFINFAKAQLGHQPGDTGDRCTLFFEWLLRLTGT
                     PGAMNSFLWELVTNALTTLVQLVQHCYCHSIVKKFVNTLYTPLQRSRVLSFLAQEKTM
                     SFQSSIHLSRQLVLRILQLLCLCDNPAVVEEAEETAEWSLGALLSPGDSHTHTSSSIS
                     TSICGATANEVCAGGVTNQSMARVSAGLGFPSGSAAGAASPLSTKIPTAGNSHPLQSA
                     TSISVAGALPPPGEPAAQISRGANWYSCGSVLLPSSPVKLLRVSDTSISGCAASSITR
                     SVALLSSTLASDHGSSGNVLTDSSCNPAGDVAEPSSARSTSWHSYADQRTGEFDVEDP
                     SHIQAGSIALSHLVTQGRLEYWVAAAAVAVELLRLDRDELRRVSGMPVPAPRMANVSQ
                     EQRRSILRLVLPPVFALDQESAFSFMTKVFHAAPFLESSSVMGLYRNSRFFVHLLSNR
                     RLVMDRRTLEFLLRYGAEVCGNGYIIAQLKLLAQGGPSAHSAARIRSVEQYKGVEFAD
                     SVEPTDSSSSTKLSANASSPLSSSSSAAVSERSALRTQCPAVAAALDCMESNCVWIDY
                     CCSHYDQFLREQLHRKGWQAVHDESSAAVQLPTPLANKSCTHSESRGGISI"
     gene            <641806..>643110
                     /locus_tag="LMJF_12_1260"
                     /db_xref="GeneID:5650020"
     mRNA            <641806..>643110
                     /locus_tag="LMJF_12_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681683.1"
                     /db_xref="GeneID:5650020"
     CDS             641806..643110
                     /locus_tag="LMJF_12_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681735.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650020"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG3"
                     /translation="MLHLTSEPQKKGPAVPECSRFLLGVALLLTIISDGAMNSQFTAL
                     STIITANSDPSALQQLATFAAMEDVAEEEHLDWGSTARLVQTQPTSLTKPRNVVPPDP
                     TTLGSVSAHAHSRTDSENVLSDGLSKSLTDISTNGVVGTSSAASSSSSRRRPHRRHHR
                     RSGAVSDVSSSDDATAALSASRPVHSYHMWTQFHVMEMAYSTGTNNFVHITERFLEYQ
                     QMFPIIYCCDVSKVDCPYEAELLASPKAGLAASSRWSCENCGKRHNVVRESCLRCRAP
                     GMYAKLFIGQAVKEVGCTESLVRFLYATHPHIVIHRAECHHDTDADALQRGKGCASIY
                     VRREDAALLKQKLHRNAFFDVDSVTEQLLVYYVYAEQQQWLHSYAQQRNAGMGKRPLF
                     LPLSPLVVEESASSSVPARRVTRRGQGRQRQSIPGSTALPSD"
     gene            <646070..>647101
                     /locus_tag="LMJF_12_1270"
                     /db_xref="GeneID:5650021"
     mRNA            <646070..>647101
                     /locus_tag="LMJF_12_1270"
                     /product="arginine N-methyltransferase-like protein"
                     /transcript_id="XM_001681684.1"
                     /db_xref="GeneID:5650021"
     CDS             646070..647101
                     /locus_tag="LMJF_12_1270"
                     /codon_start=1
                     /product="arginine N-methyltransferase-like protein"
                     /protein_id="XP_001681736.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650021"
                     /db_xref="GOA:Q4QGG2"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG2"
                     /translation="MSSAKEYEEAAAEGTMVKTTANKDYYFDSYSHYGIHMEMLKDYQ
                     RTTAYRDAIWRNAYMFKNKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARRI
                     VQDNGFSDVITIIQGKVEELHLNEKVDIIISEWMGYFLLYESMLNTVLYARDRWGAPD
                     VKILPNRANMYACGITDPQYIEQKFDIWKNVNGLDFSYFKRLSYIEPLIDTVDPEQII
                     TDIVPFFSFDINEVTEAELSFTRTFTLEAKKGDFVHAISVHFDTPFYAGHDPVVLNTS
                     PMVSPTHWRQTVLYIFHPLIMKRGEKANFTMKCVPNPGNPRDLDISLRIDFDGELQAC
                     HYDQDFRLR"
     gene            <648543..>650507
                     /locus_tag="LMJF_12_1280"
                     /db_xref="GeneID:5650022"
     mRNA            <648543..>650507
                     /locus_tag="LMJF_12_1280"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681685.1"
                     /db_xref="GeneID:5650022"
     CDS             648543..650507
                     /locus_tag="LMJF_12_1280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681737.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650022"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG1"
                     /translation="MHIEAYTGVTRSSVIMRKPSLQQGTRKPSRSPAGSRGIPSVVRQ
                     APLSSDLDTPPPPSRRLRSRSNPCETTPSPPSLPPTSEICISVVAAQPCSRSKPLLQR
                     RTALSVCKTSAAALGAPQTSRLLSSSEVRRRREHVSKGQSGSHSADVTMLRRPKVRSS
                     SCVVSSARPAAITTVEPIASQPSLWISLDSSTSECAGVTTHHGPRRQLEAFDCSAPST
                     LVLSPVSEAVPASFSPHTPLFAREEVAPPMPRAAAADGPPMSGQAPGTALFTLPQTLC
                     MTHSSTLSPLPKAAPTAVESAPVVHLASLLESRCTTSSGQQNEERTVRHPSASHLSTR
                     SSAIHDSTTSVASLWSPPMPPIAINRQSTPTVPSITGCPGYPTIMDTAVPPPAGSCVT
                     WLPASNALDLSECAPTLYPESSPSALQPLDTPSLMEGDGSPHRQSCMAPASQGTESND
                     AAPAQVKSRPLGTPPLSRNPVAEDPCSTPFTASAHVVSHVVHITHTPEQHRLRLDFPS
                     SGHAVKATIPSQRVSASSAGTQGASIRPTLMREGASCGGGIRVTLSGSDACTPSCHST
                     HHARKLCASPSRTPHHVSNSSDRHRPLTPTTSVAGAGNSVASALTKSSAGTLSAELTR
                     RAIKERRRRELYAWNEQLRLQNESSVQDAV"
     gene            <651550..>652191
                     /locus_tag="LMJF_12_1290"
                     /db_xref="GeneID:5650023"
     mRNA            <651550..>652191
                     /locus_tag="LMJF_12_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681686.1"
                     /db_xref="GeneID:5650023"
     CDS             651550..652191
                     /locus_tag="LMJF_12_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681738.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650023"
                     /db_xref="UniProtKB/TrEMBL:Q4QGG0"
                     /translation="MEGFPVKNEVLKEPRPAVAPASALLPASTAYSADADRDVDAIEI
                     ADVDIKDPFSAGVDGRDVLVGTAGVLRGGEEMPPCLSAPYMEALLNTDPRISFDVLHI
                     GALRAIEEREEMNRPYYDYISWCVPPTEFVEHPPKGGVPFFTVPLMHPAVRTRPPLDR
                     GDRDVDELLSHPTREALTAAIGADMLEHLRFSRNADVMRRRRSKRAAAAGGKG"
     gene            <652656..>654524
                     /locus_tag="LMJF_12_1300"
                     /db_xref="GeneID:5650024"
     mRNA            <652656..>654524
                     /locus_tag="LMJF_12_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681687.1"
                     /db_xref="GeneID:5650024"
     CDS             652656..654524
                     /locus_tag="LMJF_12_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681739.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650024"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF9"
                     /translation="MSAAPSEAFAEAETMEQLRLKGNACFADDPAEAAKYYTQAVQLY
                     EERHGEDAACSLDEFTKSAGNALTCLFKMGETEQCAALAVRVLASNPILAKANAFYGR
                     CALVDPSLDSVSTGFGTASAAALVHLCRAIYELPALEPNTRENIDEALTRLIGERVSV
                     TETFARSPEAGVKLVRGQCGVGVEAIRTLPPLVEVVSLLTPFSVGAFEDFAGKGCCVE
                     CSKPIGLDVADAAAEEPNEDDGDEENDKDEGNVKATKEKPSTCTACNMVVYCSPACAD
                     AHREQHERFECARMTRLSDMMQGIEARKLDVPEQFFELAYHCITTLAGIKAKRAGHER
                     VLTLTAHVDEVIQSLHPIGPLMCDLFKGEERPATLYTIIGVLCCNALELADPSGLGVA
                     QALHAGNSIASFFNHSCTPNCAIDTVRHAIVTTRTIHVGEELSIAYIPQLYWPTRLRR
                     ERLSESYYFVCRCQRCESSNKDPFERALSMELPTARREATKHFHPIVQTTCATVRSRM
                     VGDVSQKDADELSKLLRELSTHLFPFHYLCHEVRNCLSFVYAVLGQTRECLCSCLDEL
                     LMWECILPGALPVKRMKIENALQCVQGFGANVSDCSAALLPHLSRLALVYDAEGPI"
     gene            <655572..>655937
                     /locus_tag="LMJF_12_1305"
                     /db_xref="GeneID:5650025"
     mRNA            <655572..>655937
                     /locus_tag="LMJF_12_1305"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681688.1"
                     /db_xref="GeneID:5650025"
     CDS             655572..655937
                     /locus_tag="LMJF_12_1305"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681740.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1305"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1305"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650025"
                     /db_xref="InterPro:IPR013924"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF8"
                     /translation="MNRDPDNGLWYATLRGRTLLGEEVQLPESGIVGMTTVTTSKPSC
                     SPFPTPASLSTFPPQIAEVGELEMVDEVFIEACAPRYVVWDHGRAPSPAASLLQWMML
                     AEVLHGPSKWAQGEGDTSL"
     gene            <656716..>659328
                     /locus_tag="LMJF_12_1310"
                     /db_xref="GeneID:5650026"
     mRNA            <656716..>659328
                     /locus_tag="LMJF_12_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681689.1"
                     /db_xref="GeneID:5650026"
     CDS             656716..659328
                     /locus_tag="LMJF_12_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681741.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650026"
                     /db_xref="InterPro:IPR028091"
                     /db_xref="InterPro:IPR028097"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF7"
                     /translation="MAASVDGAELQQALRSRAPYNLLPASLQQRMTPYDYQTKAIHHA
                     ILHGHAYYRLPEFVRAAVKEDAYYQEMVRFAAEQLQLYPYVHQKSIVLYTKETPLSYY
                     TGIFAELLRQEQSYHRLPNFTAIDALNLLGIGRNQYLQLTKDVRSKLRWHVNRTYVNE
                     YLPSALLPSVTADPFWSIGTIDYTADVLKKRFQRLSPEDVVLYRMLVSKGTASVRPEM
                     LAALQTPLSVFAKDTICTYELPKAALRQLYQNGLVFASFDVSPDAYVVVPPLGGNFVM
                     NRTSDDPQELLLYRVLSTVDDRTSLGLLAQLLMLDEEDVCGAVQLLLRLGLVQWKSPS
                     LPPGLDVTTLDGVHPSWQEEVAARVIAFTRYQLQTSMNGLTEHGDAAAGCDSGPTASD
                     PHPSKRVALLYDATLTGFLMMTNLSHDPTFKRQAVMLFEVGKMPYEMVPAFLALLDRV
                     DWKEMERFGGEAKKYINSVMCMRRLLHALCEVVGPQGAVGVDLLKIESLNELEATTRY
                     SVLGRNYWAYVITSPVSAAPLIDVELNCVYGSTVSFMTSPWMLLFLYTKLQRGPPSLL
                     LPFGTLLHRWPPFLDELEEAPESETSAETGSPVVVGYSVVLRQQTMTLDAEISYTDLS
                     SSLLLLNEVTSTAPVFVQQVARIPLLLHKDGSVAAHSTYQHLEVAVPFSVSEAQLHRL
                     VESSIAAHHPSATAVTLVDGVDTMWSLLTDSVAALRLQNSLGYLTFTFTYEQFGAPDG
                     ASASELFCQLRTAYVVDVGLGIPLTHVEACELLVDAIPRLLSDGCSERHNAAMRECVA
                     EFGAFLERYSTLTRAVHGKMTIQSTTTTGPVTQHHLRKIGGVGGAPYPATLLSFDGTS
                     LSVTDDADPLSEQW"
     gene            <660011..>662926
                     /locus_tag="LMJF_12_1320"
                     /db_xref="GeneID:5650027"
     mRNA            <660011..>662926
                     /locus_tag="LMJF_12_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681690.1"
                     /db_xref="GeneID:5650027"
     CDS             660011..662926
                     /locus_tag="LMJF_12_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681742.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650027"
                     /db_xref="GOA:Q4QGF6"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF6"
                     /translation="MQAEEAGHAALRIEAYRVVSLGGPVPHKIESITTYRTLVFVGTS
                     DSRVLAYRIGTCNGSAAPLTLLQEIADSRRHAVRQLTVIGGRRLLVLVGDVIVVYHIH
                     DDVDSSGSVFQLRDVTTITGLKDIVAFHVKQHRCVVSMAVLQRKRVTFYEASHTNLDF
                     LLSATTALPDGVKTLSWMGRSIVLGGRKEYLLCNPSTASTAALYPTPRSGAAPLVLPM
                     APVPEVLVASDGAGLRALLYDGSEVPGDSRVLWATPPVEMRYEHPYLVSYHPSAPHQA
                     LQVRLPLLTTLEDVTAYPRSCLYQTIDLPKVVKVSQCHWIDYDCAMPSKTAPPDVLSH
                     SPIVVADADHHLYLLARTSVTDQAEALAAAKLFAAADLLCRLCPHEVAPMTVRRIVVS
                     GALHKFIRHQDYVGCFHDLSSVESDPRVAIQLFPGFLRPDEATPTCPALPLVAPATVE
                     AAALPALAEYLQSQHAALVLLNGGAPTEPVPSQFKAVDRALVLSFCAMEREEALLELL
                     RGENACDAADVAVILRERRQWVALTLLLEVHGQYEEAASQLRDLASTREAGTEVLQTQ
                     SGALKELFQRHPFSAAMLDAYVPQCTIREWLTSRSSAQLLSAADSTAMCTVATAMMTA
                     LSFFRRRPLAQFHSLFEQHSPWVLGMVPAEHAVRIFFSEANAPHYTAALQVLQTYTEN
                     TSTTPRLMLVVEYLFQLFADARVHVMEPAVYERYWRGLGELLFASPVKTVTDVEERQR
                     LRDRLREFLLTSPHVNLDSAEAYFDAADIRSACLPERAAVHRRKGSHRAAIAMFLHES
                     QRLDDATAYARSVYADGSSDAYTALLEALLRPAVGSPQVTEALEVMNTCDGVDAAAVL
                     PMLPDEMPFAQASSFLLHTLRSNTTAYHAAAVYSAILKARTLQSQESCVRLSSRAVVL
                     EEGMVCPVCQRRLRPDTVLAVYPNNVVVHHGCTCDEHVCPATLRDYRHDAYAALEDL"
     gene            <663848..>665710
                     /locus_tag="LMJF_12_1330"
                     /db_xref="GeneID:5650028"
     mRNA            <663848..>665710
                     /locus_tag="LMJF_12_1330"
                     /product="putative serine peptidase"
                     /transcript_id="XM_001681691.1"
                     /db_xref="GeneID:5650028"
     CDS             663848..665710
                     /locus_tag="LMJF_12_1330"
                     /codon_start=1
                     /product="putative serine peptidase"
                     /protein_id="XP_001681743.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650028"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF5"
                     /translation="MVAMTSRLDAFVKSIIFPRPKIATYDTSTHPHKLVHIPLVDPHR
                     HVENGAFTYGYLLANPKATHVLLYAHPNAVDIGMAYKELRYVSKEASMSVLLFEYSGY
                     GLTHTPITEESIHQDTLSAYLFLRRYFGVPANRVILCGRSLGASPAAFLAAFLPPLQR
                     PCLLILQCPFTALSECINEFSQNAVSIANFLGYNWFRTIDIITDVSCPVVLHHGTNDT
                     TVRIDHSYTLQRARDTAAKPCVTYLYQEDGKGHNNLSSATLVRILRERVVTEALLPPL
                     LPHLKLFLANAPVYARLFCDDGGMGLATLSDAVASWFAKLSLHCCAPPLDQLYVLLTA
                     SVCAFTMECARSWQIYCALIRKNLCGDAAHKRCTKDVFLHRCLACWGSPLAVHVAVER
                     VNSTKEVRCFGFATCRDAMLDAPAVYPAKSTEALLSVLEIGVTPGLLSCIKRCLNTAP
                     DMLEEEEIPCFVQQDTVSAVQLECERTVAFLTKEDKQRLCALLKDMDTGFSDNLSNKA
                     YERLRRSPSTSPQMSAESFEELKEWLRPWTSTRGTDMHALAQEVPWDDYLLRSRSVAR
                     QHVLNESMSWEECCQAMEESDVVFKIYTLFQEMSAQYLRPTFHPHTTASVASRA"
     gene            <670586..>671902
                     /locus_tag="LMJF_12_1340"
                     /db_xref="GeneID:5650029"
     mRNA            <670586..>671902
                     /locus_tag="LMJF_12_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681692.1"
                     /db_xref="GeneID:5650029"
     CDS             670586..671902
                     /locus_tag="LMJF_12_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681744.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.12.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.12.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650029"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF4"
                     /translation="MATPRHGDLDSICSLSSSENSPRGGGQSSERLIDLLTRPCAQGG
                     YGGRLNYTGFATLAASLGWNQEDMDDCWYDIVMGEPCAEAVDMKRVAECVCSYCLASP
                     LPILEHSTLAKSSAAKPATPPRLPHASRERSTTVLLSPPTPRFRRAESVASTLPKTGD
                     KQRVTTATASPSQACAHRRCTAPNVFPRYAVETVSSEQKKASLSPGRGSHRPHNRRTT
                     AKSSRQTSPAPTLSQTSGPSGCSVFSRLYEKGMEQHRKRIAVKPVDSDAAECTFQPHI
                     TPYTPKAADTASVHYNKPTESYFAKLTAPGTPPDAICASPETPRVTYHPAPGPSSDVP
                     AGYVEGVARLRSYIASRYAHATFASSLRGSSSADVAHLVEAPILRLPVTVRGVTDAVD
                     VRLASPDTRASLGRECSVGPRRPCFRQRCEARHVSFPSPSRVRFQS"
CONTIG      join(FR796408.1:1..675346)
//
DBGET integrated database retrieval system