GenomeNet

Database: RefSeq
Entry: NC_007254
LinkDB: NC_007254
Original site: NC_007254 
LOCUS       NC_007254             654595 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 13.
ACCESSION   NC_007254 CT005252
VERSION     NC_007254.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 654595)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 654595)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796409.
            On Jun 1, 2012 this sequence version replaced NC_007254.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654595
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="13"
     gene            complement(<1923..>3875)
                     /locus_tag="LMJF_13_0010"
                     /db_xref="GeneID:5650200"
     mRNA            complement(<1923..>3875)
                     /locus_tag="LMJF_13_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681693.1"
                     /db_xref="GeneID:5650200"
     CDS             complement(1923..3875)
                     /locus_tag="LMJF_13_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681745.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650200"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF3"
                     /translation="MNFQAAPNGGGQGDAGGSARSAFAPTSIVDIESNDVTRSEMVQI
                     ILAWLIEEGFTSSAQILREEATSQLRGEYYLRKTLRGLSRAIEESSWESAQKSLKKLQ
                     TKAATKSGLRSEGSSPEALLVRSLPFLLAQQQYMELVEEESDQRAFTFFMRSIKPFER
                     SISREHFQKLTYLLTCKTVAESSNVYPEYRGWTAELGRAQLLQHIRTQLGSVDYSNYC
                     RHANVCMPPPVELTRSLRTIFQQSFSYELVSRQHPNLVRCLQRTTITSLSAPLEAQLP
                     ATEPFLSIDVSALARSTFPALAPGDARQCVRLTACQPFLSHSAVVAATDTGAVLWIPT
                     GPLSCSNVAAPSSEACVADKAQLLYHHKHPIRDLRRNGTKLLCWGSCDTLVLNVQPLL
                     DSGSVAPANDCVPCVLKHAADVYAGCFFPCGTLAVTGLSEGTVCVWDLNIGTKMYEHL
                     FSNYGVVSLVVNCTGTSYFAASKDGTIRVVDVATGVLTASLVSPIAMEICSLAVSPSS
                     SFLLASYRGGLMRMWDVLTGAPLPYRFTGTDNNTKARSPTSFGNTDAELFSGGEDGCL
                     YFWNLRSRDRATKPAIPARAAEAPRSGNLYLSQASINGNLVHYAAQLPLHRLPITDVK
                     VEGSYEVSCGEDGMIVLCTTCASAYA"
     gene            complement(<5465..>6640)
                     /locus_tag="LMJF_13_0020"
                     /db_xref="GeneID:5650036"
     mRNA            complement(<5465..>6640)
                     /locus_tag="LMJF_13_0020"
                     /product="cis-prenyltransferase-like protein"
                     /transcript_id="XM_001681694.1"
                     /db_xref="GeneID:5650036"
     CDS             complement(5465..6640)
                     /locus_tag="LMJF_13_0020"
                     /EC_number="2.5.1.31"
                     /codon_start=1
                     /product="cis-prenyltransferase-like protein"
                     /protein_id="XP_001681746.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650036"
                     /db_xref="GOA:Q4QGF2"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF2"
                     /translation="MLTGTLPQLQHGATPAQRGASSAMNDSNDILALRTACGTFGVVC
                     FSVLIFAFLGHIALALLKVSSRGGVPPAGKAITVNKQHHIAHNVRHLGIIMDGNRRYG
                     RRQSTAARGPDPSALREIREELCSATELTAAHSAAEQACWLAARYKRFAAVIQHSSLV
                     GHRLGGEKLLEVIKHSMAAHIDMVTVYAFSTDNWNRPAAEVDALISLFFFFFDRIRKE
                     ALERHIFVRFISTEPFRLPPRAVEFMRSVERETRAVQPRRLVLNICVSYSGQSEVLAA
                     CNRLVARRLRDSTDPGSAAAVATEVTKKELDREMLRSITQDEHEAEDAHIFGGGASVE
                     PELIIRTSGEQRISNFLLYECAYSEFVFLDKAWPEVTQEDIRQALADFARREKRKGR"
     gene            complement(<7259..>7864)
                     /locus_tag="LMJF_13_0030"
                     /db_xref="GeneID:5650037"
     mRNA            complement(<7259..>7864)
                     /locus_tag="LMJF_13_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681695.1"
                     /db_xref="GeneID:5650037"
     CDS             complement(7259..7864)
                     /locus_tag="LMJF_13_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681747.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650037"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF1"
                     /translation="MAEPRIKQLRCAATEVPEDQRNHLQHLYESIEQLSRRCRHLENA
                     SERKSVVIEDLRAHVTRLEELFGKSQGEMAYAQQQLEFVVMSLESQHGIVADHTEQLR
                     LFAGESTHRGYVTTQGNAQRSLLLLIGNWLYTPVVHFAKGVYTLFSPIITTAQSLSLL
                     NSDVLHRNSSERLRWGAARKGDLLGMLQRGALDPDSAANRK"
     gene            complement(<8690..>9574)
                     /locus_tag="LMJF_13_0040"
                     /db_xref="GeneID:5650038"
     mRNA            complement(<8690..>9574)
                     /locus_tag="LMJF_13_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681696.1"
                     /db_xref="GeneID:5650038"
     CDS             complement(8690..9574)
                     /locus_tag="LMJF_13_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681748.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650038"
                     /db_xref="UniProtKB/TrEMBL:Q4QGF0"
                     /translation="MLGSCRSDASQALFRWGFSDAAASSRANFAHLPTDGTPTDGRLD
                     TSPAHRASVISELLRQGKDSQQMLAVGKSAARETEELRRTAELEEHKLRLAQARNRLL
                     RGRLATLTRERQSEAQQVLLSRNRNSADIVGSKRAAASLIGPSPDGYDYTNDIVEARR
                     QLDQCTKELEESQLRLHQLQQYHLGQLSGHLQPMMTANDALRTTENFLDPETNMAVRA
                     TVVDSLLEVNRALKPLSAQHDGPHSLEGVLPCLDNVATLWDRLAVQNFVVGRINRLFT
                     CMCPTAPPLTLLKDTNMM"
     gene            complement(<10292..>11098)
                     /locus_tag="LMJF_13_0050"
                     /db_xref="GeneID:5650039"
     mRNA            complement(<10292..>11098)
                     /locus_tag="LMJF_13_0050"
                     /product="putative ribonuclease HII"
                     /transcript_id="XM_001681697.1"
                     /db_xref="GeneID:5650039"
     CDS             complement(10292..11098)
                     /locus_tag="LMJF_13_0050"
                     /EC_number="3.1.26.4"
                     /codon_start=1
                     /product="putative ribonuclease HII"
                     /protein_id="XP_001681749.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650039"
                     /db_xref="GOA:Q4QGE9"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE9"
                     /translation="MAGPVGVAATLYRISATPVRYAVMDSKKMKESDRAETLEAMCAE
                     LSDAGVEGFVGTTVRDGACCLVRYQRRKPLQAVAAALVDVSVINERNILNATLEGMSA
                     VCEAVVRSYNAVSGLGTLTPLTCAILIDGNRVPWTFLSGEERQRVCVQAVRKVEARKR
                     IGVEYPALDGFSCTTVVKGDATLLSIAAASIVAKVARDAYAVSVMHPAFPQYGFDHHK
                     GYCTAAHKAELARWGPSRFHRLDYAPVKGTLGGQRGDAERTPASLEGPVM"
     gene            complement(<11913..>13091)
                     /locus_tag="LMJF_13_0060"
                     /db_xref="GeneID:5650031"
     mRNA            complement(<11913..>13091)
                     /locus_tag="LMJF_13_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681698.1"
                     /db_xref="GeneID:5650031"
     CDS             complement(11913..13091)
                     /locus_tag="LMJF_13_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681750.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650031"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE8"
                     /translation="MSEAAALESIMRPPSPELQRRLFVPTPSLHASAETARQHRAERQ
                     SALLAERATAYTCHPAILPVSREMAASERRRNGWMQLPVGDVLMERHKRVEGHLEEKR
                     QQEVARFSFRPTISARARTMQSSRPVVERLYSGTADAGTDTATFTDVTNLRSSSGEKT
                     KTASMATYQRLYQDAVTRRAHDQMQEKLARVRSKNEFCPCTDSVSGLIASKRGDTTRE
                     RLLRPKAALDVARDVYPQETFAPRINTSTRFERVPLSARAAIWQRRRSERLHHAVVAR
                     CEVEMRECTFHPRTRRGLTALSQAHARATADSYTGPLASIMSSAEELLRRVDLEASAP
                     LPESGRCAPLLDDDGKLPGTVPVDILAVLHEAEHVSEALRLLPDTNLDLDLSQHTSLG
                     "
     gene            complement(<14171..>15094)
                     /locus_tag="LMJF_13_0070"
                     /db_xref="GeneID:5650032"
     mRNA            complement(<14171..>15094)
                     /locus_tag="LMJF_13_0070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681699.1"
                     /db_xref="GeneID:5650032"
     CDS             complement(14171..15094)
                     /locus_tag="LMJF_13_0070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681751.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650032"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE7"
                     /translation="MHAARVGRGRWADMHTSCKGASFQCLFASCSALSGLRTLFFSPS
                     PSLPHTLTPLFSLEWPRSGACPRCQRVCGLFSPLAVSPSFFFIVPFSTQPSTPSSASA
                     AVWTAIVTAMDAAAPPSRPTPQFRYMDVLVESSNNHELAALETIREASQSRENATKKA
                     SFSPNDTAAARDRQLVTRVPTPERIRRASARLYNDIHAIMDRHDARTGRERKLRRRAS
                     RETSISYVAEQPGSLHQRVAVAPHTSPAAKTALPKVHQLFEESRRAHLAEAQQQRTYF
                     PSSSKPTAYSPKNPSTFSYRFQSPPSAGSSA"
     gene            complement(<15528..>19817)
                     /gene="POLIB"
                     /locus_tag="LMJF_13_0080"
                     /db_xref="GeneID:5650033"
     mRNA            complement(<15528..>19817)
                     /gene="POLIB"
                     /locus_tag="LMJF_13_0080"
                     /product="putative mitochondrial DNA polymerase I protein
                     B"
                     /transcript_id="XM_001681700.1"
                     /db_xref="GeneID:5650033"
     CDS             complement(15528..19817)
                     /gene="POLIB"
                     /locus_tag="LMJF_13_0080"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative mitochondrial DNA polymerase I protein
                     B"
                     /protein_id="XP_001681752.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650033"
                     /db_xref="GOA:Q4QGE6"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE6"
                     /translation="MFRRLGSSWPRALAQPLRSSCTVQSLTKAQAALARGRAPSVDAA
                     AEYAEFFRVPISVDAGVVRSTQEYYTNIRRLAAENQSDVAQRNSPKKSCGDSSVATFL
                     VGYHFQTATFQIFSIAADDIVCSVDTRMEASEVWSVADELMTHISGESPQLALIPVVE
                     TEKERKRLQEPLQKLTSLLKFSGLQVATHVDTLELSSVLCNSPPSPRAITQDAVSGVS
                     PAPMTRTWFQAHWAFIRTAACQAMSADPLQTVSTYVLPRFSVYLIHLVRAGSRGLNVS
                     LWDPVSRRRFSAKGMLSDVLACLLDTRSSQMILVPTTRTDRAALFRCRTAVVKAGHDC
                     VVVYASEVSERLRGCYQSDLMRYWGAMKETASFLDADLLFGIYTAAGNTLRSYQRKKL
                     SQSHTCDHLSLLNSSDEGIATPQNALNWACYFTLPKRVAAEKAELRHYDKFITIAYVS
                     TDHTVHAQPVNPVADINHVLSACITDHANRTVEPWAIYTKRGQFCLPSLDGYDVLVTH
                     DAKSLVLLLSGDAELQKFIKRGGRVWCVTLAEYLLEAQRCTTGSNSLHDLALRHGVQL
                     PPSSRVGTPNDRLPFALQRQFLLHAAPAVVKVFVEQLKRALEQCQVLSLAHRMDSLLA
                     MTSIEKAGIHIDAEEAARQTASLKSAASVLDAAMEAYVPSEVPVDMRIYFDWASLQQQ
                     HAYFFGGTISLGHQAYARDTPLWTSNVVHLCHRYGAFLHMVGELHLQRYAAQCALPTS
                     GGLPSRIHQHIEVQGSQKLKTYRVVFFDIETTGLNPSTDAIVEVAMFDPIENSTFHTL
                     VNPQRPITPRTVGIHHITNAMVRDAPTVDVVAKSIGQYLRLDKASYNPHEILVLVGHN
                     VFSVDEPMLRRALECHAPECQLDGILFCDSLALLNAHRSELRWRMRTKRTNQPLMDAL
                     ASSLRLSRLITALNVRPEGDLHRADTDTKALWYVLINILGVADKDAVAQRDKILIEAA
                     NCFLRSPSIGCFVPAERQNRLVKVRLPGVAADYVRNAKLIASLQSKVFSETVLASLHA
                     HGVKPAGLLLQRQLLDRHTSTFLQPSTGGRLAILHRDGRVHQHIDMTATTTSRTVSAY
                     PSCQNIPKDDKSSVRRLFVSRFGSKGRCVEVDYSQLEIVVLAILCNDANLTNDLNSGV
                     DFHVKRAAFFSGLPYDEIYQGYKRNVPKYVKLRRTAKQFSFQRLYGAGVPLLHKTTGI
                     PVKDLEASIQRENEEYPGIAQFHRIIRSVALRPNNPGLPTSFIAEMPTGLRMSLRTRD
                     VVLNLPPIKNYPIQGYGAELAQMMLGRLYRHFVRKDFYDDRAFLINFVHDSVWMDCHV
                     DVLRECVRDTCRILGSVHEYVPKVFPGVKISVPLQVSASCGVDMCSMESIKGDDYMFV
                     SKQRKTRSAEVQDFLDLTTAKSNFSAVMEESVASEEEGSGETATSEAEATE"
     gene            complement(<23388..>24899)
                     /locus_tag="LMJF_13_0090"
                     /db_xref="GeneID:5650034"
     mRNA            complement(<23388..>24899)
                     /locus_tag="LMJF_13_0090"
                     /product="metallo-peptidase, Clan MA(E), family 32"
                     /transcript_id="XM_001681701.1"
                     /db_xref="GeneID:5650034"
     CDS             complement(23388..24899)
                     /locus_tag="LMJF_13_0090"
                     /codon_start=1
                     /product="metallo-peptidase, Clan MA(E), family 32"
                     /protein_id="XP_001681753.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650034"
                     /db_xref="GOA:Q4QGE5"
                     /db_xref="InterPro:IPR001333"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE5"
                     /translation="MQAYTQLEKLCHKVHRLTHLLSLGAWDAKTMMPSKGAAARGAAL
                     GELHGLITEMITSPSTKALLDEAETAKAELTTVQQANLRELRRIYASQAALPTELRVL
                     KTKLSATTPLIWAKCRSNNDFATFLPALKEMIALARREAQYRSAATGKPLYEALFNQY
                     ESGMTLETLEKILLDVKSWLPELLQKILAAQRDAGLEVVAPEAPFPKDKQEALSRHLM
                     EVWGFDFESGRLDVSEHPFTGMVKEDSRITTAYDLQDFAKGLFATIHETGHSKYETNC
                     GPMEMRGQPVCEARSMTIHESQSRFAEVVIGHSSAFLEFLTPLLKEYFGDQPAFSLEN
                     VRLMNQTVKPGFIRIRADEVCYPLHILLRYEIERALIEGTMEAEDIPRVWNEKMKAYL
                     GLETEGRDEIGCLQDIHWSMGAFGYFPTYSLGSMFAAQLMVTIKNELGEDTVDKCIRT
                     GQMEPIFEKQREKIWSQGCLYDTEDLILKATGEALNPKHFREYLERRYLRQEG"
     gene            complement(<29247..>30848)
                     /locus_tag="LMJF_13_0100"
                     /db_xref="GeneID:5650035"
     mRNA            complement(<29247..>30848)
                     /locus_tag="LMJF_13_0100"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681702.1"
                     /db_xref="GeneID:5650035"
     CDS             complement(29247..30848)
                     /locus_tag="LMJF_13_0100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681754.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650035"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE4"
                     /translation="MHSLLPRHCTTAPTHMHREMHCVVFLSPALTSATPFGIRFMRCP
                     VRVCTRQLASPLRRRVCLFTCSGATVKAKSAAFLLFTIRPSLAPVLFFRQPLLSAASL
                     YPTPLPLLHAPTHTNWTAFSALEEVEHMHRELGLHTHTHTHLLIRVRRAREPARVAIL
                     IAISALPLTRVLVVVPRQPQFLSPAPLLVLSRSILRASSIIGSRHRSLSSPTGTAMAT
                     ATSEFTEFAREWGDLLAKDSSASMDHLFSTYARLKGANEVASSSSSEGSGEPPFGSPV
                     ASIEDFTDVWAAAKRVHKEWEATCMVRSIRHSIGGSVTQTRLMLSMLCWAALLRQEEQ
                     KFFKEFLAQVREIIHCAALRCTASGYGEDSESIYEEVAFCVALELLGWHDSLLICLQR
                     AMASPPPLRSEDDVLLFTRKVAQQLVSALSPRQYSTDDMPVITITRSSATSNSLEHEL
                     PAPTAEGDIRTEAMAGDRVVVISPMRSPSKECVSSSSRYRDEHAHTQPDAVPRSSPSQ
                     SPPPSPPLPGILQTPENRGRLLATR"
     gene            complement(<31273..>32331)
                     /locus_tag="LMJF_13_0110"
                     /db_xref="GeneID:5650040"
     mRNA            complement(<31273..>32331)
                     /locus_tag="LMJF_13_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681703.1"
                     /db_xref="GeneID:5650040"
     CDS             complement(31273..32331)
                     /locus_tag="LMJF_13_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650040"
                     /db_xref="GOA:Q4QGE3"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE3"
                     /translation="MRPDYMGVMFLCSSVMSFNAGIWQIFRRGQKKQLIENHKNIEKS
                     PLTDLPPESATVNECEYRRVKLDGSFDNEGSCLVGPRSIPSYKGAANEDESRGGFLVM
                     TPFEIADTGRFVMVNRGWVPIDAGKHRTMLKQYIGEGFTPAQVRGVLRKEEFLGGSLF
                     WGSSPDNEGPVAADLSWLVVRPWNMAMTYYRRRWGVDHLKESAEKHGAHHYYVEMLED
                     FSGDDQRIVRGRAWPRRREVDEVTYVHLTPVVHSMYIVFWFSITAGSLYGVLRCWRRQ
                     KDIFALRKYVNKQSMQLETRRQVEAQAYMKAVEEVERLKRISTAAAAAQIDIGNPATV
                     THSEGTASRKKYDSQPSK"
     gene            complement(<33513..>33872)
                     /locus_tag="LMJF_13_0120"
                     /db_xref="GeneID:5650041"
     mRNA            complement(<33513..>33872)
                     /locus_tag="LMJF_13_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681704.1"
                     /db_xref="GeneID:5650041"
     CDS             complement(33513..33872)
                     /locus_tag="LMJF_13_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650041"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE2"
                     /translation="MKEFAELRCQNQLLKAENAVLQRKLEEERAQRRQSQLDVNHYNL
                     EAEACREAIEKADGNAQVLALYDELQRLRKKCDIYAEAVEESRCYFFEMKRLYMEVSP
                     YLRSLSGEAQAHRAASV"
     gene            complement(<38118..>40307)
                     /locus_tag="LMJF_13_0130"
                     /db_xref="GeneID:5650042"
     mRNA            complement(<38118..>40307)
                     /locus_tag="LMJF_13_0130"
                     /product="putative MCAK-like kinesin"
                     /transcript_id="XM_001681705.1"
                     /db_xref="GeneID:5650042"
     CDS             complement(38118..40307)
                     /locus_tag="LMJF_13_0130"
                     /codon_start=1
                     /product="putative MCAK-like kinesin"
                     /protein_id="XP_001681757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650042"
                     /db_xref="GOA:Q4QGE1"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE1"
                     /translation="MRAESSGSESQSRQSERTCGVSPGGPGGPGASPSIVVAVRKRPR
                     IPGREDDENDVVRCGENGGPSVTVYEPRTKLDLTPIIEPSSFSYDHVFGEACTNEEVY
                     RGCCQPLLQNVREGGGAVIFAFGQTGSGKTHTMLGTGERPGLYSLAVTELLTMTEHST
                     MTASFYEAYGAKLYDLLNDRAEVKMLQDEYQNVHIVGITEQIVSSVDDVNALMMRGQQ
                     LRAIGTTHANDRSSRSHAVLEIKLKLADSSSESQLGRITFVDLAGSERASDTAETDAK
                     TRREGAEINKSLLALKECIRAMSMRKRHIPFRGSKLTQILRESFVGRCKTCVIAAISP
                     CQGHCEDTLNTLRYADRIKELKGPANPHNGVKPIPCKTCGQPIFIGDRHVCKRQLVVC
                     PHCRQDVDKQELDTHMSECKESPMRCQYCNERMLRSESVGHSRRCARAPIRCGACGAT
                     VPRQLIDRHAQQECAEAKVKCRYCGCVQSRQLLAAHEQNCDAAKVACPHCLQFMRKRR
                     LDGHVATCVRNLSRAMHTPRSTALNIIASTSMETSQTLASSSSSIGAQQSIPKSATAQ
                     TAASSRASSSHNRNVAAEPAGGQVDLVAADEGTGPLNFTRAHSSRRSSAQLASGVSLA
                     NQSQSNRAPGAGGRWNAGALGADEVSAACDSDCGSVVCPYSRYGCPVKVTRLNVAAHL
                     KESMQQHLELVTTYADRVDEQNMQLRRLVIHETDTLSSRVTMERLDK"
     gene            complement(<41431..>41991)
                     /locus_tag="LMJF_13_0140"
                     /db_xref="GeneID:5650043"
     mRNA            complement(<41431..>41991)
                     /locus_tag="LMJF_13_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681706.1"
                     /db_xref="GeneID:5650043"
     CDS             complement(41431..41991)
                     /locus_tag="LMJF_13_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681758.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650043"
                     /db_xref="UniProtKB/TrEMBL:Q4QGE0"
                     /translation="MLHHGHGDRYGKYGPSREIADFEYADGTPSSISGKRFALKHHQD
                     HLLVQLIRSAAIVERFEEEELLPRIPGTPEQRSWDPEIPLFLEDVDEFGRPPRPVAGN
                     MVARVIEERFAQESGRTPVNLANKHAGEVLEPNTMFATYDPAAFVSDDIKKDVRRPFW
                     SRRRWALSDNFMVPMSPKPKNTIKDE"
     gene            complement(<42853..>44274)
                     /locus_tag="LMJF_13_0150"
                     /db_xref="GeneID:5650044"
     mRNA            complement(<42853..>44274)
                     /locus_tag="LMJF_13_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681707.1"
                     /db_xref="GeneID:5650044"
     CDS             complement(42853..44274)
                     /locus_tag="LMJF_13_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681759.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650044"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD9"
                     /translation="MIPKGCVVQGFREVFAPVSVRAYRHYGFLVAENFLPASLAHQLT
                     TMCNTVVRQRGDNIFPGLDAQHRLGATVAPNSKLKPLKTPDGAPDTGAKPLHPATPPL
                     ASSTSLGFGNAPLRPDRQKEHEAAERDRHAGTRARKIQIMLRGRRAVDRVYRRLTKAR
                     ERYSAHRRVGGYVTAEEEMAGNMTEERIQELQSKYTYEDFQRSLQHSRDSGLLETGFH
                     RDHHINDAMTFMQDWPRTWCWLWRTSPELKALAVSAEGAVGQLVGEAAGYLAGEVVLR
                     VYSDSATEATSLSNATPMGFAGVATNFAHPHALSAQLGLERPNSTHSDAATMVMPGSH
                     HIVWRISLDGKELDRFQPGGIFDVGSMVRALPEVSHLPVIALPPLSPGAVLFFNNYLL
                     MGTQANLYGAAQNATGTVAAGPVAHATSYALSLIPDRCVFDGKRNSWASRDSHGPLYS
                     YRRGQLLTDDAAFPVIHRALDIE"
     gene            complement(<46572..>48080)
                     /locus_tag="LMJF_13_0160"
                     /db_xref="GeneID:5650045"
     mRNA            complement(<46572..>48080)
                     /locus_tag="LMJF_13_0160"
                     /product="putative protein kinase A regulatory subunit"
                     /transcript_id="XM_001681708.1"
                     /db_xref="GeneID:5650045"
     CDS             complement(46572..48080)
                     /locus_tag="LMJF_13_0160"
                     /codon_start=1
                     /product="putative protein kinase A regulatory subunit"
                     /protein_id="XP_001681760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650045"
                     /db_xref="GOA:Q4QGD8"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD8"
                     /translation="MSAGDTPVSLFLQACNQEGVKTPNPKLVEFFQSHETFDSILEID
                     LSNNYIGNRGLLAVLGVIEHLSCFRCLNAMDQKLYNSDFSEEAVKGNAVIDRIVEVFK
                     VHPTANSLNLSNNPISNYAGRKLLSLAQVNRRMCLIEVSDTRIDFDLRNKIAKQCEEN
                     TRNMWDAEQDENANSCAVFGENLEWVPTQATADLTSLGAGRARRQTVRVEGIDPEAAK
                     NYVPPVHEKSQEDTDMICKLLSHNVLFGFLGSKDILTVAGAMYREEFVKDERIIEFGQ
                     THCDKLYVIQSGEADVIKEGQKVFVKTEGTAVGELELLYDTPAVATVKVSTEVLVAWV
                     LDRETYRNLVMGSCIRRRETYMSMLAKVPFLQSLDAYERMQIADALTSDEFAAGDYII
                     HYDEEGEWLYIIIEGTVEVIGRDAAGNKTKVCEFHSGDHIGELEFLNKHRTVADIVAV
                     TGVTTAKLNRRHFEMCMGPVMDVLKRNSTSAKYDYYQQVLQQQQQGAPAAVQ"
     gene            complement(<49101..>50972)
                     /locus_tag="LMJF_13_0170"
                     /db_xref="GeneID:5650046"
     mRNA            complement(<49101..>50972)
                     /locus_tag="LMJF_13_0170"
                     /product="putative MOZ/SAS family acetyltransferase"
                     /transcript_id="XM_001681709.1"
                     /db_xref="GeneID:5650046"
     CDS             complement(49101..50972)
                     /locus_tag="LMJF_13_0170"
                     /codon_start=1
                     /product="putative MOZ/SAS family acetyltransferase"
                     /protein_id="XP_001681761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650046"
                     /db_xref="GOA:Q4QGD7"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD7"
                     /translation="MEVGQRCRLLVADCTYTHATNSSDDIHGNGFTVTGVVVGVRPHA
                     EEPWRRLYYVHCTRIEFGTELARQRRKAAAPSWSGAPLSTIGSGTIHSCNELRAAGGS
                     FVSNGGYHYRYDGWYDAFALTPLSADVALANNTAAMASAGSSPPEPPATVSEPRDDEG
                     AASASAVSHLPGQHRDAPEEWVAAMERDTAVCEVVYLCYAFQPWFSAPYSALQYLALP
                     EDDVCHSVYVCHRCLSPFFTREQYYVHLAGEYCRLRTPPGRLIYHDEDAGYKAFLVDG
                     AKNLHYGRCLSLLSKQLIESKVLSNDVDLYEYVVVTIPRASLPYMPAALPSCTSAEQC
                     GVANLVALSREGFRQAASDFDAEDWDGDAVMGYFSRLKHHPDHTLSCIVTLPMFQRTR
                     VATFLLDVAYWMTRQRQRLCGCGFCGRSGGAISRPFSPHGQSLLLSYWRRALLRSLAE
                     VAPLHRRASRTAQPELRFTLAELRALMDIPIHTNDMETLLLHSEFAFYQPAAANAAAA
                     RYSDDDDSASPPTSPTSARRRQRHERGSTSTSLKDSQASSGSKLSSSSAGGSAGNGGS
                     STSGARYTGTLVLEAALLEAAAELHTKTPRSCVMFDKRWLVKDGRGAYAYDTPYYHH"
     gene            complement(<51565..>52833)
                     /locus_tag="LMJF_13_0180"
                     /db_xref="GeneID:5650047"
     mRNA            complement(<51565..>52833)
                     /locus_tag="LMJF_13_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681710.1"
                     /db_xref="GeneID:5650047"
     CDS             complement(51565..52833)
                     /locus_tag="LMJF_13_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650047"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD6"
                     /translation="MCALPVMEGARGSTLQVCGERHTMSLSLATALYADATRLYRLGD
                     LHHARGAAEEALLSLSHSPHSDISDHTNHRHGDAHHEEAADSVSVGCEGSQAQQRQRH
                     RLFGNTLLLLSSIYMAVQDYAEAERLLVTCDGYWRERLTSTHTRLSSVGTSAEVECAC
                     CSELDEGLAGVAYNRAVLRLEQLRRTPSFPASRDDGELWVAPPADLCGTDARLTYSLI
                     PLSSTAASSGTPETLLASVMALLLDAQDRLAHTLGPPRGLLADVLHTIGVCHYEAADY
                     IAALQAWQRSMAIRVHLQALRRRSDKNAAQRALHGGGGGECGDGTEELKLALTMEHVA
                     QVYRLLEGRSVEALKLLDTVAATRRRYLGPTDPLCVRTLVLKGVLAAELGHTQLARAL
                     LERCSAIGGDASPETPPPSSSAYAVQEVEQ"
     gene            complement(<57810..>58556)
                     /locus_tag="LMJF_13_0190"
                     /db_xref="GeneID:5650048"
     mRNA            complement(<57810..>58556)
                     /locus_tag="LMJF_13_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681711.1"
                     /db_xref="GeneID:5650048"
     CDS             complement(57810..58556)
                     /locus_tag="LMJF_13_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681763.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650048"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD5"
                     /translation="MLMLTLVRRSDVGAAVASAMHKGYVSKRQNSSGAYYTARPRTKP
                     SPLSALRHPVSTPSKAQLKEFKRFYEVVTRSREATSLPPTPLGHGGSERILNNEFLHQ
                     CPWQASCVELRERAVEPERKVFSYGDVDFASLRKQSHRNAAAAGGTSKTTSSSPYGSY
                     SNVEDMLDKSSGESAQQQQQGPGLDVVHYYETSTPEGLAGYQQITMQVRKGKLPGSCT
                     NFSAEGGFAVWVVPHNEYIETLRAMGYLPE"
     gene            complement(<62085..>64349)
                     /locus_tag="LMJF_13_0200"
                     /db_xref="GeneID:5650049"
     mRNA            complement(<62085..>64349)
                     /locus_tag="LMJF_13_0200"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681712.1"
                     /db_xref="GeneID:5650049"
     CDS             complement(62085..64349)
                     /locus_tag="LMJF_13_0200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650049"
                     /db_xref="GOA:Q4QGD4"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD4"
                     /translation="MDDGMGPYDRGGLIPEAAATTSGARSNDPAKRYGSCYEGGTNAR
                     CDTCKMVKIACNCQSCHCCHRFLMSPSSIHHCRLCWRATCAECSNYMRMNDFMGGRIT
                     RTCLTCAVPKALVFITQMRYSVYDSAGVSSRTARGGSDRTARGGSDRTARGGSDRTAR
                     GGSDRNGDADGRKWGGVLPTVMEPNSFRWGLYVLGCEMEAPRRCINPLCSSPFAYLET
                     CIKCKSPTVTISFHEQRHVSLMNTSKKAAKLIDGGSLPSGSIEVLEDLVRDKYEALVD
                     SRSADEVDEIFACAMPLQLEKRLFTSMAGNVGAARKVLLALVACSIAGEALAAPVISL
                     AMTDFPVYARVMRPLQVTELFTVFSGPGNLRLVAFSSGASRPPSVHQVLSTRLVSREL
                     WTSEAMQQNEVLGKIVSNKDEAHQAGLKTNLATWNVREGLLGYISDDNIMHRVLSLVL
                     RMVKNGEEVVLCGHGIGGAVASWLTTCMLLENTSQMRDRLLCVTFGAPLIANQSLSNF
                     LTKHGLAKSYQNFVNGSDMVPRLGYVDSLLSSGNAASCASILGQDGPMHSVRKVRDCV
                     VLWTASHEEPRGTGSTRNADDGGDGNLSALDIGRSARYYSVDMANGPQTARKKDSKRP
                     PSPVDPVICVNETEHGDLFQPSREPFDNNAVRVYEGEQIEKGISVEGDLAMCDIDFKR
                     YSTTEHRDKQALDPLGFYHFLWQPRGKYICTDDPSAVIGLLSDRTNLRVVLRDHLMSA
                     YHKGIIEYVYSAPP"
     gene            complement(<67027..>69027)
                     /locus_tag="LMJF_13_0210"
                     /db_xref="GeneID:5650050"
     mRNA            complement(<67027..>69027)
                     /locus_tag="LMJF_13_0210"
                     /product="putative class 3 lipase"
                     /transcript_id="XM_001681713.1"
                     /db_xref="GeneID:5650050"
     CDS             complement(67027..69027)
                     /locus_tag="LMJF_13_0210"
                     /codon_start=1
                     /product="putative class 3 lipase"
                     /protein_id="XP_001681765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650050"
                     /db_xref="GOA:Q4QGD3"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD3"
                     /translation="MMVCDRCSTLWALANLATRSDAGLLWGLYILRTVGPMPRMCIGS
                     SCRILTRRLVCYGCGLPTVVTQPHTARVVRPNGVSKSVMDDVSVLDVQQLSLRAMEVG
                     GMTTTQVERMFRGLFHRYEEMLAFRAITTAVLAQRVLLSMVASAIAYEYLGAPNITLS
                     LSDIPYASVLRITVARERYTILEAPGRVKFIAFPGTHNWRTRWVDMQFARVTETVWST
                     LHEGVCLTTTAEDEEGANRAEATVLLNGGVRKVWEYQVHKGFAQEAQEVGLPFDTLLE
                     DVRSGGYTLVLCGHSLGGATAQYLSLQLLQRCASLLVPRGSQEETPRLLCVSLGAPLL
                     GNYELADHVQSCGWTHIFHNFVYRSDIVPRLSCTDELAWDAQSRLKELVTSVFTAAQS
                     WWRGGGSQSSPASAASPAANTVASSSAATVAASTPTLSAGRLSTPLARLRAKTPSGTS
                     IADTFPGVGASVTSALFSINNATGKETAVPEEEGISDESSALWEEQAQLAAYADTTLR
                     NSHDALENDTPAPSREVAAQLDADVEAVLHDFKSRCARRSGAASRRWNTVHHSCREGG
                     GAEPDVSDEPVTPSEIRVAADTVADVVLPVSSRRMHRCFTCFGRYHFIQYGAYGYVST
                     DDSETAFAVLKHGCGEASVLSDHSVEAYNRGVMIHLYRNTES"
     gene            complement(<70688..>71326)
                     /locus_tag="LMJF_13_0220"
                     /db_xref="GeneID:5650051"
     mRNA            complement(<70688..>71326)
                     /locus_tag="LMJF_13_0220"
                     /product="putative small Rab GTP binding protein"
                     /transcript_id="XM_001681714.1"
                     /db_xref="GeneID:5650051"
     CDS             complement(70688..71326)
                     /locus_tag="LMJF_13_0220"
                     /codon_start=1
                     /product="putative small Rab GTP binding protein"
                     /protein_id="XP_001681766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650051"
                     /db_xref="GOA:Q4QGD2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD2"
                     /translation="MSSISRASTTTKAGGSASTRKFKLVLLGESGVGKSSVVQRLMKN
                     AFSEKLNSTVGASFFRYTCNVDDDTAVHFDIWDTAGQERFKSLASMYYRGAAAALVVF
                     DIVSADTFEKARYWIRELQANSPETIVMLVGNKKDLESERQVSVADAQQCAVEMGAVY
                     HETSARSGDGVRDAFHAVAAKLIETNSAFSVREGGVMCHTENAAPRQENGCC"
     gene            complement(<73049..>74311)
                     /locus_tag="LMJF_13_0230"
                     /db_xref="GeneID:5650052"
     mRNA            complement(<73049..>74311)
                     /locus_tag="LMJF_13_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681715.1"
                     /db_xref="GeneID:5650052"
     CDS             complement(73049..74311)
                     /locus_tag="LMJF_13_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681767.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650052"
                     /db_xref="GOA:Q4QGD1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD1"
                     /translation="MSFQPICVVCLGDCNRDGGVTSCNHYLCSRCVSRLPAAAPCPLC
                     QQPYQLVTLDHPNVQQLLQDGATVLGRTEKVIVSQVRHYQQVIHRMRQALAMLHGQNQ
                     DMARQSQRKQAECAAAVSQAQALQEEVCRLREELAHATTAATCAYSQRKTSQQQSQPP
                     PPQQQQRAHMLADPRVTHASGGYSHGAPKTVEVCQTPAGQIIPPPLAGRHAPFLPAGV
                     VGARASDTSPRGSWPRPSVTSSPSPSSHSHGQHRGHHSHGNGGESRGAAASETSASSA
                     VGAAPPLGWSASSLIAKRHRSDSNPSLPRRRVDDIRASLPQPAASVGAGAKVALTPRT
                     HATVSPQQRPPHQSSHAFAHQSGSGGGDSPGPSIDFWLTTPLAAAAQQQSRRPDSFMP
                     AGTSYMPRSSSKPLQRLFSSPRDGPRSF"
     gene            complement(<76031..>76954)
                     /locus_tag="LMJF_13_0240"
                     /db_xref="GeneID:5650053"
     mRNA            complement(<76031..>76954)
                     /locus_tag="LMJF_13_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681716.1"
                     /db_xref="GeneID:5650053"
     CDS             complement(76031..76954)
                     /locus_tag="LMJF_13_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650053"
                     /db_xref="InterPro:IPR025252"
                     /db_xref="UniProtKB/TrEMBL:Q4QGD0"
                     /translation="MSSALDSITAATKLRRAEIDVQRELEAKREEYNRRMAQVKEGEA
                     QLAADRAELQDTLVQYYKFIQENEIKRSRAMKKVAIEEKQRKEREAYIAQLTQRLQGL
                     ELKRDEMKTQYEDIEKYQTFLEEVLSRNDGDEYQEPRDIMKRWMTLCDNTSVLQARKT
                     QLEEDLLRTRSSLNLARQRRGTENIALQNQLNEMQMSFESLQKAIKAKQDKLDRVIKQ
                     KSSTTRTVSHVSMATANLYDRCVSWVRDYSGRGKVETLHSNVLHQLHVICDCLEDFQS
                     IIVQHQEQQRQVAAQQAAAAAAQQAAAAKAG"
     gene            complement(<79418..>81019)
                     /locus_tag="LMJF_13_0250"
                     /db_xref="GeneID:5650054"
     mRNA            complement(<79418..>81019)
                     /locus_tag="LMJF_13_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681717.1"
                     /db_xref="GeneID:5650054"
     CDS             complement(79418..81019)
                     /locus_tag="LMJF_13_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650054"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC9"
                     /translation="MFEPLRELFLEDPQALIEDERVLGEKAGRLFGLRDLSAYATLGG
                     AVYPLLRCANDGVVPWGAVHGVNGSSNGSGSTRATNSASSLSAGGDAGLTSSSLHGQG
                     EVDTRWWSSLATATDARRRSRHGRRSWLQQLWASAPHLIPHLAHCLIKTASFALPGLR
                     SVFPTALPGARRLLLARRSRCGGPERVTGLSFHPLYMWLAVAVEEGGADSSTRVVVYD
                     VGEGRVMCVLTHAFQMKVSWLQWRPQSRDVLAVGCCGGVLLWRLFADTSGSAADAPWP
                     ATKAFANADASARALFYPTRSGFTVTAGAFAHQDANTLACASVGDTRLVFLQLNEPPF
                     QPQACGTVVVPSVDGGLGQVVFDDDDLFLLCTVCEHSSLALVRIRPSPTSASAASSAA
                     AFQSCVVPTPAPVDCVVRATGLGPSLYFMSTARLEGVLLARINPFIGVEVVSMISTGL
                     YRGVGGCVTGLECSRRRLWIQTETNHLLVCRCGLRDGAISLIPIGVAAIEVVAMASFA
                     GCTTGSLFAGVEVDGTIHFLPSYHG"
     gene            complement(<81530..>82312)
                     /locus_tag="LMJF_13_0260"
                     /db_xref="GeneID:5650055"
     mRNA            complement(<81530..>82312)
                     /locus_tag="LMJF_13_0260"
                     /product="putative N-acetyltransferase subunit ARD1"
                     /transcript_id="XM_001681718.1"
                     /db_xref="GeneID:5650055"
     CDS             complement(81530..82312)
                     /locus_tag="LMJF_13_0260"
                     /codon_start=1
                     /product="putative N-acetyltransferase subunit ARD1"
                     /protein_id="XP_001681770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650055"
                     /db_xref="GOA:Q4QGC8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC8"
                     /translation="MQLRRATMEDMYEMQHSNLRCLPENYNLRYYYYHLLSWPQLLYV
                     QQDYNRNTVGYVLGKMDDEEVPDKKHGHITSLAVLRSHRKLGIASRVMRATMKEMDAE
                     YGAHYCSLHVRKTNDAALHLYQDTLGFRCVGVEEKYYMDEEDAYHMKSFFHQANPGSY
                     VDDHKRLIRKTVPGELEGGPAAAGASSPAVGGRGGDKNGKRGNDKAAKEISAKEREAA
                     MAELLGLEVGGKGRAAGGGAGGKGKSGNSSGGGGKRGSGRQK"
     gene            complement(<85224..>90485)
                     /locus_tag="LMJF_13_0270"
                     /db_xref="GeneID:5650056"
     mRNA            complement(<85224..>90485)
                     /locus_tag="LMJF_13_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681719.1"
                     /db_xref="GeneID:5650056"
     CDS             complement(85224..90485)
                     /locus_tag="LMJF_13_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650056"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC7"
                     /translation="MSGRQELQSVALPGRDGVRRKLLFFTPSHALRERVMGFSITSEK
                     LEMVSSFIAENAVLGWDRLPSTPEFKARYKNHLVGSGLKWLRRVHKVAPVYMYHEPSR
                     EVFYRFFPHFALPLTEREKKRQPTWAVEEGSGSRAEASSLGDGRVPSSSREEEQLYGE
                     WGHTSGSDGGVVLRTTASAASASSLQQRRTCRRYYPLDHYYARKRRLEAAFPSVAFDL
                     QLVRQLVQESPERRLLMQDAVHAILAAHGLFLTRWEDFSRTERMHLRRLMSLAGLSIV
                     VASIALRGHLRELRLVIPSEDLVRQVSAASTSASSSAPVRPRARARTGEYDVEEGAET
                     RDLYPSGSERDDDDAEHDQDGDTNSRDEAALRSQLVSAHVILRADRESGRSGAAEELD
                     LDHEGDGAWYSAGDEDDDEQGDEAQSQAAAPLSHLSTRHQQAEAVAVLRVEPNQPLEL
                     QAAHEAERRPLSLTAAVPRVRFHMPYKQRSKALGGFLERYAKTRGTLVTRYLLLRHTK
                     VLTLVYAPRLPTGPPAQGPCPVEATAATVIKREEQGDSHHSGEGVAVATAAAAPLPLP
                     RTLHFEPSDPRLPKGLSAYSVNTVLDVLVQAAPHYAASVPRLMQSIDVSTLNRRVLPF
                     LRHLKYVHTTAVAQRGRKHVGLVVLVPAEGEMRSGTLSDTAKQAVLDAEAAAAAELTK
                     RVARQPVPPSAASGKSIPSDMVLQSLPAVTEGARRSTLGERLIEVHPAATKAVNRVMA
                     VRNGYARSLTQRMSRLHLELWYQHYRYPIDGAVRGAAAGAGGVRVREMYARMSLSTFV
                     VVVGLPQADLGRVIGRTDGVCGWSTPLRDLPPSVYGWCVQRGTQMLFACLQGLHDRRL
                     IRSAQGGTNSFLSPEACDDVAYTLEPQCTVDGYTHYFMSAPPTAAASLYACLRYWIPF
                     WSAIGRPSRRLSSQLLELESNATVAQVVALSKVLRQDPSMLAAQLYQSGGLPLELRRT
                     TSLGDVAAGTTRRGAELRGASGGRSIFSSASLFVHERRGRADDGERTCPTATTASGRR
                     VARQRPRKAPRTEISGTTVAEALDRAFHHFAPLKRVEEVVRLVLRGRSVHLSHHPLFC
                     VPATLPAVLVRRHGGAEASNTLLCPCSGGGCGGAATPTEFSLASAGQGGGAYNRLVNT
                     STMHMAVLAETLRAVRNSSATRRARQVRHPSSIETLREEVESVYAPRAAASTAAAAAA
                     TTDVAPAQSCAASAPLSPPLVSLPLSPHTSETCLSSPVSSSLRQLEGGFEVVADMLRM
                     IVFCDQAHYRASVARSLLTALNAPWLVSRARAYLQRLPVFRRVRQQNIRVPQLSLAQS
                     PYVLPLNALRTAPRPCANMAVLHQWAQEADAVGAAVAGGRERPVMLWAHAEMNSLLAL
                     GAQESLQRTPPLALELLHQPSMDQAHMSMAMNAVREKMTRLPLPQLAWPAEAVACEGF
                     LRRQRSDGAEGTGIGETDVVMDTVAARRDGQHRKRKRSSLVRGGNEESSGEEDKDNSS
                     ESSDDDGDSVAVTRAEEEAARQLYPARTIRNYGDPPYLQDLPIDGPPTAAEQRAVEAC
                     REELSSGAFASFSPLRQHHDSSHSRDGCSLIPYPSIFHHVDGSWHSYMWHLVVHTVYR
                     YILRVPGIRHVDLEGRVLASGVVSQRALWAVLQFLIDHQLLLCLEEELAQPLCTPGGG
                     VLGDPPRLRSPFELRKRSRPDAAPSLPSLPSSLSAAVGERDIPYRRRDDDAWLGCTRG
                     NCCYHPTIPLEGLRLAMSPRLLDPLSP"
     gene            complement(<91772..>93127)
                     /locus_tag="LMJF_13_0280"
                     /db_xref="GeneID:5650057"
     mRNA            complement(<91772..>93127)
                     /locus_tag="LMJF_13_0280"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681720.1"
                     /db_xref="GeneID:5650057"
     CDS             complement(91772..93127)
                     /locus_tag="LMJF_13_0280"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0280"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0290"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0300"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0310"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0320"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0330"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0340"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0350"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0360"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0370"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0380"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650057"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<94047..>95402)
                     /locus_tag="LMJF_13_0290"
                     /db_xref="GeneID:5650058"
     mRNA            complement(<94047..>95402)
                     /locus_tag="LMJF_13_0290"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681721.1"
                     /db_xref="GeneID:5650058"
     CDS             complement(94047..95402)
                     /locus_tag="LMJF_13_0290"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681773.1"
                     /db_xref="GeneID:5650058"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<96322..>97677)
                     /locus_tag="LMJF_13_0300"
                     /db_xref="GeneID:5650059"
     mRNA            complement(<96322..>97677)
                     /locus_tag="LMJF_13_0300"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681722.1"
                     /db_xref="GeneID:5650059"
     CDS             complement(96322..97677)
                     /locus_tag="LMJF_13_0300"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681774.1"
                     /db_xref="GeneID:5650059"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<98597..>99952)
                     /locus_tag="LMJF_13_0310"
                     /db_xref="GeneID:5650060"
     mRNA            complement(<98597..>99952)
                     /locus_tag="LMJF_13_0310"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681723.1"
                     /db_xref="GeneID:5650060"
     CDS             complement(98597..99952)
                     /locus_tag="LMJF_13_0310"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681775.1"
                     /db_xref="GeneID:5650060"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<100872..>102227)
                     /locus_tag="LMJF_13_0320"
                     /db_xref="GeneID:5650061"
     mRNA            complement(<100872..>102227)
                     /locus_tag="LMJF_13_0320"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681724.1"
                     /db_xref="GeneID:5650061"
     CDS             complement(100872..102227)
                     /locus_tag="LMJF_13_0320"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681776.1"
                     /db_xref="GeneID:5650061"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<103147..>104502)
                     /locus_tag="LMJF_13_0330"
                     /db_xref="GeneID:5650062"
     mRNA            complement(<103147..>104502)
                     /locus_tag="LMJF_13_0330"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681725.1"
                     /db_xref="GeneID:5650062"
     CDS             complement(103147..104502)
                     /locus_tag="LMJF_13_0330"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681777.1"
                     /db_xref="GeneID:5650062"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<105422..>106777)
                     /locus_tag="LMJF_13_0340"
                     /db_xref="GeneID:5650063"
     mRNA            complement(<105422..>106777)
                     /locus_tag="LMJF_13_0340"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681726.1"
                     /db_xref="GeneID:5650063"
     CDS             complement(105422..106777)
                     /locus_tag="LMJF_13_0340"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681778.1"
                     /db_xref="GeneID:5650063"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<107697..>109052)
                     /locus_tag="LMJF_13_0350"
                     /db_xref="GeneID:5650064"
     mRNA            complement(<107697..>109052)
                     /locus_tag="LMJF_13_0350"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681727.1"
                     /db_xref="GeneID:5650064"
     CDS             complement(107697..109052)
                     /locus_tag="LMJF_13_0350"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681779.1"
                     /db_xref="GeneID:5650064"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<109972..>111327)
                     /locus_tag="LMJF_13_0360"
                     /db_xref="GeneID:5650065"
     mRNA            complement(<109972..>111327)
                     /locus_tag="LMJF_13_0360"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681728.1"
                     /db_xref="GeneID:5650065"
     CDS             complement(109972..111327)
                     /locus_tag="LMJF_13_0360"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681780.1"
                     /db_xref="GeneID:5650065"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<112248..>113603)
                     /locus_tag="LMJF_13_0370"
                     /db_xref="GeneID:5650066"
     mRNA            complement(<112248..>113603)
                     /locus_tag="LMJF_13_0370"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681729.1"
                     /db_xref="GeneID:5650066"
     CDS             complement(112248..113603)
                     /locus_tag="LMJF_13_0370"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681781.1"
                     /db_xref="GeneID:5650066"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<114524..>115879)
                     /locus_tag="LMJF_13_0380"
                     /db_xref="GeneID:5650067"
     mRNA            complement(<114524..>115879)
                     /locus_tag="LMJF_13_0380"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681730.1"
                     /db_xref="GeneID:5650067"
     CDS             complement(114524..115879)
                     /locus_tag="LMJF_13_0380"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681782.1"
                     /db_xref="GeneID:5650067"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<116800..>118155)
                     /locus_tag="LMJF_13_0390"
                     /db_xref="GeneID:5650068"
     mRNA            complement(<116800..>118155)
                     /locus_tag="LMJF_13_0390"
                     /product="alpha tubulin"
                     /transcript_id="XM_001681731.1"
                     /db_xref="GeneID:5650068"
     CDS             complement(116800..118155)
                     /locus_tag="LMJF_13_0390"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="XP_001681783.1"
                     /db_xref="GeneID:5650068"
                     /db_xref="GOA:Q4QGC5"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QGC5"
                     /translation="MREAICIHIGQAGCQVGNACWELFCLEHGIQPDGSMPSDKCIGV
                     EDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFNPEQLVSGKEDAANN
                     YARGHYTIGKEIVDLALDRIRKLADNCTGLQGFMVFHAVGGGTGSGLGALLLERLSVD
                     YGKKSKLGYTVYPSPQVSTAVVEPYNCVLSTHSLLEHTDVATMLDNEAIYDLTRRSLD
                     IERPSYTNVNRLIGQVVSSLTASLRFDGALNVDLTEFQTNLVPYPRIHFVLTSYAPVV
                     SAEKAYHEQLSVADITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARID
                     HKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAESADDMGEEDVEE
                     Y"
     gene            complement(<118818..>124913)
                     /locus_tag="LMJF_13_0400"
                     /db_xref="GeneID:5650069"
     mRNA            complement(<118818..>124913)
                     /locus_tag="LMJF_13_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681732.1"
                     /db_xref="GeneID:5650069"
     CDS             complement(118818..124913)
                     /locus_tag="LMJF_13_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650069"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024986"
                     /db_xref="UniProtKB/TrEMBL:Q4QGB4"
                     /translation="MLHSCNVMSAKPDTSLPPQLCLIAADESVNPVPKLLLSFPVPRL
                     ISQLRLETGWARPEEDEVPAGGVPTEPSALPSWRAEELDYLSRGMQESAQQLLLTGGF
                     SHFLQEQFHHEADPNCECCGSAADSGSALLCQDRASAAHCVSRTVTLGLQGLLSSVAQ
                     QNTLVHVARLRKQGESATTSSALLPAGKGTSGHRVPLTRVPESESWVNGEDTAAVALR
                     PRRSAESGSAWADTPTGLRDLAPAGGTPSIPTSGRRRASGAAASTSITTGVATSYKPR
                     TAPEPASLEALETSLRGSEHAAARSTAFADFVRQIASDSGSSTAAHDAPLLLHFVSWL
                     PLQVRPFDGIPCAQVTACLTALVASCTEAEDAAAVSSSNSSLQGSLWSARAWLCCQCL
                     AHPRFPTEAVPAGLVGRTVDVFARVIRDVAGLILQVQQSADAAVVEVSADAGGKQEGH
                     PSSVPERGRGADGSCATSSLLPWLEQLRGYLRSFAVMLCNRTLQLVPDTDVYRLEELC
                     YQCLFHATRSCTKEVHLLYSTYIIDSAVHLYRCIWNALHVERQRLVEVFFQRLPTSSA
                     WLTHRSYRVNYDGRTVLPLTVTMLAGAQSLVVSSEGGKLVTAETLQRQCSLWANTFVH
                     ELLLRRAAEGDRAEDTASWAAAVRVAEDLTDLLGVPEWPGADVLLRSLVHSLTQLCLG
                     AESATTASAEALRPLALDVVAHVALRLFDEKQFSVPTAILAEVERLGDLTSTNQAAAR
                     MALQHILGVSVPAQPSAADQQAWERMCGAAGKATTSIFGTADSRLLGIMTAVYVAESQ
                     LITNPSTAADYAAVWFHVRAAQLTTWASLQDADQEWISQAALNSLVRWQRPPGAGDAP
                     ANWNDVCAWTQAISTQFSNSMLSRRTRHTLVSMLLSIFHLKDAQGVAVPVSDVVQKRA
                     LGHLARLTAVHPALHRYLWPVARQCVQDDSARVRESIVPLLLTMLNGATVTATEGESA
                     STDHFSATGDGVVAAVVSSLLYLLNDKSASVVSRTIAALDAFLTDDAHQCLFATPHGA
                     PLLFFIQHKLLQLASPDEAEAQRNQKEVVKHFLRRWVVTLGDAEGSLTGAHAQLAKEL
                     VALVVMAAPDYPHDLGEDHPLVQVLQGMHAYVAAYDPARETSSSTATAATAAAARRRP
                     RGYHIDGARLLHVMRCAARSLWTRYNCFHSTEDAVSCLAALRALAQAHGEWVQPLAEV
                     LVQSIAYPPPPTSPLAKAPEALGGALLHMCQTLHAILKVPRLPFISLDQLARCLTALL
                     SKYVGPYQQRVIVASCGTLSALITCGAKHHLSGQVNVPYLQLCYSLMNTYYTRVRGLL
                     PSLATQPQSVAYTQRFLFLLSEFLRMYPGWKQHPPHPALMEESLAGHDSGETALNALI
                     AGPGIMANTYQLLEDVLGSCGGPVTQKGVGLIALRVVASLCMLDPTTYFLRAEGRIRD
                     ALRSHDMSFQLQGLSLLSDFLKEEDQRVEAAAQKATRLGTTALILGSSGGGDASDTSS
                     GSRESSDRSDKFEAPPPGGRAKRTCYKRAAAAVDAPKQMKTRTNAKRAPPPHSPTAAH
                     TEDFNSGMGTWIFQQFHGDIARLSCGTPNTQVRSLCLRLFLQAAHGGLLPPDKYMQAI
                     VALAADVHGPLRQQAAASLTIHCERQEEVVGASVGRGVVLAFCLHHTCGVNLLRSAVL
                     PGKPLAATTATVADSGAGDVLGGCSVHSSVYTLLHKRLRDSMITTLVRFFYQDDKARS
                     WCEEHARQITDAAATLAASSSPSVVFRLFHPYLFLCHLTLALATLPFPHESDVVHLLQ
                     QARNGLDLNGQAALDWLRDKEASTEPLSSADASASALMRWKAVGAVLLHYLRHSLTSE
                     YHVTSATLMRHHNRSNYRLATAAAQHSAAPALHRSPANSAATAHLTERVERLVRILEP
                     VFRVSSTACPSRDVEEAAWHALSVELETALMEETTYDIRRCAPTRAAPVCGRAKAARG
                     ARAARAATAPSRRKRQRCSSSTDTSSTDDTVEEDTASEADATNPSSASSGIDTERDAP
                     TRHRRTCSTSQADDA"
     gene            complement(<125963..>129253)
                     /locus_tag="LMJF_13_0410"
                     /db_xref="GeneID:5650070"
     mRNA            complement(<125963..>129253)
                     /locus_tag="LMJF_13_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681733.1"
                     /db_xref="GeneID:5650070"
     CDS             complement(125963..129253)
                     /locus_tag="LMJF_13_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650070"
                     /db_xref="UniProtKB/TrEMBL:Q4QGB3"
                     /translation="MQEAFLSAVLLPLTEKSGEVERVEELLSMLEHFFVDAFKLSPSS
                     DNNRNADPPTGAGGVSGSLFASTSASLDAGEEAKLLAVRAVANFHRRGAARHGAFFRT
                     RDYHPHAALFILELLKSLNGNSKHWFRQLQLDSLDACLAILEVTGTENVRLCLPGVVS
                     VAVRYIHRAHHGKDSIKVCLTAIKVLCTALTISFATAEPVAWVQDTAVHLTSALRSIL
                     DPAVLVRSARAPVTVAALKSLIVSVLLSSAMTELANTPLSSLLMVAYAIVENMDHLHH
                     LGDDVVGAAEATSSVMCTSSSLCSSTDDTGMCTLMGSSWAVLAISEALQYLRGVELLH
                     LATTVARAPGLRDRFFPLQVPPQTASSTAESPDVRESAVAIFSSVVRKCVRVVGTEMD
                     EAALYTHRRPRKYPAGVVDEFLFCLAGALARFPTAATLTPQSRVGADDLGDDDETVGE
                     RLTNALLSEYEAVLQDWDAYAVHPAVLYVLSRLVVWQFHPAHALHNLPRCSPPTTGVV
                     APDGEAMESCMYPQPADLTAGPFEQLWSIMAQPHLWAITKDGELCTYQQVHHRQVVAA
                     TLLRFLALSAEVLACGGGATSEGSNAERAEALERLFTLTLYLVLEKATASGILHEAAM
                     HCVEVYSAACGEADTLLFLLRHSALIVDETARAVREEHLRPAAASVLRGSLALLECRF
                     VRGGEGSSSDRAASGCSGASLTTLVRQRLSVTAMSASFTRASAKAPSLEEAAQVADFV
                     ASTIHVARDTLQLCSRYNSTAAAEDVIGRRAALTLLRDALDLAAYLNYCVPQEAMDEE
                     QERRTTSAHTRVRTLQLVVLEAVYAVLQHCTLHDQVTVTAVQTAVRGLTCFLTTTAAL
                     TWADVTRKRLMDEAAERRRSTQRGRRGGQKARLMASEVEEDDAADDECDDDPGRTPLP
                     TPPPIDWPWTHYTPTAVAAAEAATGVNIGLPRSHLHTVYRVYLSLFALLREPMAAFGA
                     VAAEPHARAGMERRKLGDVAVSPALFETLNGLEAIRLLACDFLLHRMVEEVLPLVLLW
                     HERACLSRIPTHTEERAKLATQQFVERLYEDCNDSVDLQESMIAKCRCFDLLPTPSQE
                     PVLSHPQP"
     gene            complement(<129881..>131890)
                     /locus_tag="LMJF_13_0420"
                     /db_xref="GeneID:5650071"
     mRNA            complement(<129881..>131890)
                     /locus_tag="LMJF_13_0420"
                     /product="putative acyl-CoA synthetase"
                     /transcript_id="XM_001681734.1"
                     /db_xref="GeneID:5650071"
     CDS             complement(129881..131890)
                     /locus_tag="LMJF_13_0420"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /product="putative acyl-CoA synthetase"
                     /protein_id="XP_001681786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650071"
                     /db_xref="GOA:Q4QGB2"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:Q4QGB2"
                     /translation="MLQRLSHRSVLGYHGAPQVAALRCSLRFGTNIGGSYYQESDTAG
                     THQMNNDIRLGLVIKPQSTLVELWEQALKAWPTRRFLGSKMWVRGKLGYVWATYESIN
                     TEVEAMRTLLHSMGVEKGSRVVVISENRYEWVVVHFATMQLGAHFVALPTNVTPSEAQ
                     LVVKSTQSKVLFVETKASYAAIKGWIGRVGQLEHAICFEDQVGEGSYAVAISIAADVP
                     EKTLARTDVRAEDTAMIVFTAGTTGPPKGVMLSHKSIVANVSSVYASLGEALTHSDMF
                     MSLCSWCVAGALTTDLYQALCKGACVCIPPEILEGFQDLPLVNPSVIVSVAQPFQRAY
                     ANIVDDILNRRSFTKDLTRFVVGRITENRLMFKKPGRTLQAFSHALLGKFKAQFGSEL
                     RVAIIIGHQLTKDQSELMADLDVFVVNTYGFMEAGGLVATDVDVPQRLKALPGLEVRV
                     VNEKNEIVAPGDLGEILIEAPNAMQGYFDVHIDPEEAKNSLVEYGSRTFVRSGDYGTL
                     TGGWITVKGNKDVLITLANSKTVNPLEVEAALTKSPFIKQVFIYGNRHPYVVALVVAN
                     TKAIAAHLRKVERRDGVPLVNDREKADCIRAELRRVSQDLPPRAHVRRFAFVDEFTLA
                     NGFMTVKMGYARQKIEDHYVHYFEALYDETPKFYGFAVDDYDDLF"
     gene            complement(<132922..>134697)
                     /locus_tag="LMJF_13_0430"
                     /db_xref="GeneID:5650072"
     mRNA            complement(<132922..>134697)
                     /locus_tag="LMJF_13_0430"
                     /product="putative flagellar radial spoke protein"
                     /transcript_id="XM_001681735.1"
                     /db_xref="GeneID:5650072"
     CDS             complement(132922..134697)
                     /locus_tag="LMJF_13_0430"
                     /codon_start=1
                     /product="putative flagellar radial spoke protein"
                     /protein_id="XP_001681787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650072"
                     /db_xref="GOA:Q4QGB1"
                     /db_xref="InterPro:IPR006802"
                     /db_xref="UniProtKB/TrEMBL:Q4QGB1"
                     /translation="MASTALSAAELEAQFTNAKAYLMQADKDGVSAYDQLTRLMELLL
                     EENPENVAGDPSKLHEILSFIQTHSFACGESTSACYEATQVPAEELRRFEDNKKLFDL
                     PAPQVRTVIEQPDPYTTITTTTVLPLKAPSFESVAAQNKYWTAAGCGLSDEEAFLLDR
                     SITNLAMEANLQDIKFFGRIFGTHSDYFVLRTRRYLEAGETVYVETNTMGKPPRKKGI
                     VPVQAEPGYVGVNRYTFWVTASPSDKWEKLPDVTPQQINAARETKRFFTGDLSASVAA
                     TFPWGEAAYLRAQLARITSSTTIAPQGALEEPEPEQETEEDEDEDAEDGAPRKLKEAK
                     YKPLVVPSPDYGEEEVDVAQLTVDRWVHAEGYIYKNGRQTKVPEKPEPEEGEVEGEEE
                     AEPEADAQGEEEEEEPEEEEEVELFAPIQNDYLYGVVDIPQPPPAINDEDEEEEEEPE
                     EEGEEEPREPDNTPLKPLRDDDVPDDDPTKMKIACWTMRVENNVSKAHRMAVVQSLRW
                     PGATAYAAEGGKRWSCVYFGNGMKKTDAAFTPPPAPPVQSECADVTEVEDPTATVEKL
                     VRRGEEIPEADSEAEPDELEEEEDS"
     gene            complement(<136798..>140070)
                     /gene="MKK2"
                     /locus_tag="LMJF_13_0440"
                     /db_xref="GeneID:5650073"
     mRNA            complement(<136798..>140070)
                     /gene="MKK2"
                     /locus_tag="LMJF_13_0440"
                     /product="mitogen-activated protein kinase kinase 2"
                     /transcript_id="XM_001681736.1"
                     /db_xref="GeneID:5650073"
     CDS             complement(136798..140070)
                     /gene="MKK2"
                     /locus_tag="LMJF_13_0440"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase 2"
                     /protein_id="XP_001681788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650073"
                     /db_xref="GOA:Q4QGB0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QGB0"
                     /translation="MLVTMEDYQIIESIGEGSFGKVYKARIKGTGQIVAMKFIVKKGK
                     NEKELKNLRSEIEILTKLNHPHIIMLFDSFETDSDFVVVMEYAQGELYDILEDEKQLP
                     EKEVQKIAKQLIQALNYLHSNRIIHRDMKPQNILIGQNGAVKLADFGFARSMSYNTIV
                     LTSIKGTPLYMAPELVQERAYDNRVDLWSLGCILYELYYGKPPFYTNNLFALIKKIVC
                     EPVKYDSKANDPISPEFKSFLSGLLTKSASSRLNWPELLNHPFVQLTKSDASWQDAIM
                     QHDSRMKARMDRLGCLRLHGNAGRAAPKRKSTQSDDIFNLKTVQKLTSGCEFDVCATL
                     TQLVRMASAFNGDVTKSTALLGVFDSGVLEAALTLLNEKQSVKVVGLVLQFVKELAFP
                     EHSDVLPFPSQRPKRDGLAVLEEKHSRQQEDLFIRQQVALKLMKKPHTALDFIISEIS
                     SDSNSLAETCVKIMFQCFRWENSFGPMVTQLRTFPEMWAAILKSVNHDSVSRGETSHE
                     YAALVFHTVSIVIPHVKLASPQRINREEVLELVTQGLSAVCYYEAGMVDAHRNKSPPL
                     VYAAAAALLIAFAHRELKDIVSFKVNDALLDGIYSIVDAVTDAPSRPVTPRALGSSYG
                     YPDYGLLDGVAHMLSLIFSDSDSLVYAKLPGRSEHRFLESDTKSLALLVMTLLRDSDP
                     RMELSPNGVQTLLRAAQQIFQQQKEQALSMSLLMEPIAPYSGESGSLCWLSVICCTLK
                     TDYFRQLFYWPACRGGGATGVSAHVTIVSQILSDSLRPVSSSSNPTPAEDKLLGDVSR
                     VLYKEKVIELLVHAMDYSEGVFLGSPFAIIAKLCANSADSIKAFVDCGGLDATRIRRI
                     LDPDKAGTGLMSDGLVVLSQMARMSAEFYEPIHRSNLYGCLAALLQHSEKDLRGKTCT
                     LIGNLCKHSDFFFEPLEKNHIVERLVKCCSDSDAQTQKLAAFAIGNAAFHSDYLYNLL
                     SPAIPSLVGLLARGDAKTRQNAAGALSNFVRNGDQLVSSLAESSVVESLLKMLRDDDT
                     LSSKKVAVLTINSFCAYDVFRRKFVALDLREDIRKLQQDPNARTDPSIQKYVGNLVDR
                     LG"
     gene            complement(<141985..>142350)
                     /locus_tag="LMJF_13_0450"
                     /db_xref="GeneID:5650074"
     mRNA            complement(<141985..>142350)
                     /locus_tag="LMJF_13_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681737.1"
                     /db_xref="GeneID:5650074"
     CDS             complement(141985..142350)
                     /locus_tag="LMJF_13_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650074"
                     /db_xref="GOA:Q4QGA9"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR014560"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA9"
                     /translation="MSAENGGNAIVRVSSNKRKFGYVDYTKHRLHEGYPEVIVSALGT
                     AIADAVSVVELLKNQGVVEVKKICTSRAQFDDVRSTTTDKIEVVVVKSPEFDAIYEQQ
                     QKDREIAKARAEAGEADDE"
     gene            <148029..>149522
                     /locus_tag="LMJF_13_0460"
                     /db_xref="GeneID:5650075"
     mRNA            <148029..>149522
                     /locus_tag="LMJF_13_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681738.1"
                     /db_xref="GeneID:5650075"
     CDS             148029..149522
                     /locus_tag="LMJF_13_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650075"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA8"
                     /translation="MVSGFVEFEILRGKNYPQTEDDPNPCTTQVTVSVVDALSGAVLS
                     RAQLSSIQQNSNAPFYNDTLNFRVEDAPEDVCLSISVSEHSRQKIPFVLFYGKQIIGL
                     SKLKAKQRFVIPLFSGEEGTQQVEIGADTLDLESSGKVPFLSARIQFTKDKVFDKTDP
                     YSDVDVSGKGLSFDGKNQLVPEGTQYVWLRLKSDKKWTNSFQYELSVAWRSRAPLEAE
                     NQGNTKSRKGTTGGMAAISAEPDSARTLGDIIIKKWCCRRTHQVLTRVCITAEKYGNK
                     VTDLTFTPKEEVEFRTNKKERCVFLEQICKKRLEDACSNCLRQWLNRLWILFVTGVDS
                     DPAEARALSYEVRKAVHDAQFTEADAIILQACLLFSFIPSLKYEVCQALSESDYQAAQ
                     SEKKIEVGALESPQCRVTPSQEMFTRVFISFVGSLLDTLTEAEIAKAAAEFKPAIWDA
                     QQRIAKGAKSTIGSCKKKYEGSIFKGTGIHIDHLDKLGRRKQVPKFV"
     gene            <151116..>152594
                     /locus_tag="LMJF_13_0470"
                     /db_xref="GeneID:5650076"
     mRNA            <151116..>152594
                     /locus_tag="LMJF_13_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681739.1"
                     /db_xref="GeneID:5650076"
     CDS             151116..152594
                     /locus_tag="LMJF_13_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650076"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA7"
                     /translation="MDGIVSRGARLTFLNADFAESEACSSALNVSLQPHQGNATWVYF
                     ARGKLAYSNSITLVSASGATWPMTLTFSSECAIQLILLLDRYGAIDRWFVWIPTTAYT
                     GAVVAILLPVVLLRSRLPVHLAGVCLFLVFLGFFGSCIGLVVELLQWQSAVGRLYPFP
                     DSVTLYCCLCLLYTLLFVPVLYRQGNNTILFMGVTRLLIFGLNCALCIGYWIMGFVVL
                     GSLAILQYLVTNLILTYYYAYVSVYLRRAVRGTSSLPKFSNNFVYLWCAPVTPFACCA
                     LMYYDLYLLSHSNVERDPVAARMRDVVRIYNAQLSLPLLFFQNVYGAALLATACAYHM
                     AFLTLLFVAVLLWIVHSICVVEQCAKEWARWHRRGRSLGFCGCLSLSTAMTALLSLDY
                     EANASRTASLSPHSVRQAPQPNQHQRGIAAYQTGEALYTPSAENDSSEVVSPPPPSSY
                     HSGINHLSASQQRPASNPAGSTTLPTEHINDVLEFWPNSVER"
     gene            <154018..>155586
                     /locus_tag="LMJF_13_0480"
                     /db_xref="GeneID:5650077"
     mRNA            <154018..>155586
                     /locus_tag="LMJF_13_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681740.1"
                     /db_xref="GeneID:5650077"
     CDS             154018..155586
                     /locus_tag="LMJF_13_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650077"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA6"
                     /translation="MSFPPSPSLLAATGPSPPPSSAVAGEFSDIRQLLRFQQQLAEEM
                     ENVAKLQRQNASLKDRVSALEEQLAGATSSLARTGDCEQQISLLIERLGKEKERHKAV
                     AEERNQLKDHLQDLEEEVEEYRTREEGWISGQERQQENEIAAQQRIAQLENDMRSCNA
                     IVDNLTTQLTEAKHLNGVLQNQVKELKVSYSAQLDTVKESSSETVDQLRQEVEQLRSS
                     LQNLSTEYDTRTAELEREVQNANMHAHQAEARLSEMALGSVNTLQDLRSELEDSQRSS
                     ATWKAEAQKARHEYTTLLEQYASLKRSRAAAEADLRDRLSYESNTVSALRKGIREWED
                     RYLALQESVGATQTEIEEQRKTIMQLEATIQKLKASGSDMLSPSQSEVVVSTNAPPVK
                     ASFSEPSLSGLPLDEILGRRLMPAPPLNPFMSMERPAWSDSRDRKTRERLEQEVVRQS
                     AELERVRAAVADAEVWKAKYDRLQEEHDLLLQLYGQLEEDVSALRKNGAGILSADAAA
                     TSSTSGSVSAAAVP"
     gene            <156993..>158531
                     /locus_tag="LMJF_13_0490"
                     /db_xref="GeneID:5650078"
     mRNA            <156993..>158531
                     /locus_tag="LMJF_13_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681741.1"
                     /db_xref="GeneID:5650078"
     CDS             156993..158531
                     /locus_tag="LMJF_13_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650078"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA5"
                     /translation="MSPAADTTHSTTKPCAPNRSSIPETCSRAPNGTRASAADEVTLL
                     TAPQFAKSTKDTRSTARQQEEQLSDVLVLIRHGERQDHVDRAWKGNALLPLYDPPLSN
                     AGRMQSFETALRYFALRQERKVEKRIRGTFTLFLVSPFHRCIETAAVMNVIAFEGRLP
                     MYVEPFLSDWQQAKVFRTAPVLGGSYTTSGRPSVPGAKGDRLLFRPQVEALRVTLIPF
                     LKTRAAEETELLAEYKIGAEVASAWTTLAEEWLNTHTALPVWTCAAATNVIEAKVASR
                     SDGASDVRATSRKAAKGSQPSPRDASNEGYRGCGVAHPEGKSDLLRRCEQVMSTHFLR
                     CAAVASDTMVPLAIQTAVAAERTTRLPKYFQIWAERPEENRESAGPPALLPPMHIMAI
                     THADVVSTLLEVCCPKYHDKGAGYSVPYCSVTTLQRHNNYYRIPTAEERRRREASAST
                     LAPAQNRGKCYAKKKGNTPSSKNQLMTPIRTRPLSPLSVEWNVEAVGSTDLLRTRIVI
                     QYTK"
     gene            <160993..>166950
                     /locus_tag="LMJF_13_0500"
                     /db_xref="GeneID:5650079"
     mRNA            <160993..>166950
                     /locus_tag="LMJF_13_0500"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001681742.1"
                     /db_xref="GeneID:5650079"
     CDS             160993..166950
                     /locus_tag="LMJF_13_0500"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001681794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650079"
                     /db_xref="GOA:Q4QGA4"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA4"
                     /translation="MAQSSLAEDIFTGSVQTNSFVSECMQAQRPVALLTHSGEPLSPR
                     GDRVGGSGRSAYQAQRKIALDMLLSSVDDIVSQVYVNFDEDLTKVLLNALDRVTACDT
                     LDQRERAKVRVIDELLEVLGDKHYDLLQCVMYRPREVFLRLLEEFCTLEDAGDATTSQ
                     SSSGPKGLTVRFVKNNQRSQGQDVVINDAGKLTGQKWLAHMNRRYRVLMQESELDELF
                     KRDFSVTGSIMPAGATVTKKAGHVRIHIPPPRQEILPESKRVCVATSLPEWTHPAFLS
                     ITHLNTIQTTIFETAFHTSQNMLVCAPTGAGKTVCGLLVMLRCISEHFEGGVLDRDFK
                     IIFVAPMKALAQEMVENFSRRLAPFMIKVRELTGDMQLTKRELAETQVIVTTPEKWDV
                     ITRKQSNEELVSQVRLIIMDEIHLLNEERGPVLEALVARTLRHGELNPEQRVRLVGLS
                     ATLPNYKDVANFLQADLREGLKVFGPEYRPVPLEQTFIGLQNTSGAPKRNKEFELDRL
                     AYEEVVKNVREGHQVMVFVHSRKQTVGLAKYFIEESTRRGEEHLFQYKGVMPSAIEKK
                     GRTLQGRDLASLFAAGFGAHHAGLVRYDRTSTEGFFRDGYLRVLCCTSTLAWGVNLPA
                     HTVVIRGTQMYDPKRGGLVSISVLDVMQIFGRAGRPQFDTSGHGIIISDEKEVSHFLR
                     LIAHALPIESQMQGKLCDHLNAEVNAGTISSVMEACSWLEYTYMWQRIRVNPLTYGLK
                     VNNVRKDPELKTVRYSMINTSFTDLAIAGMVRYNPETGSVESTDLGRLASHYYITYES
                     ISIFNEKMRRPDDTWIDALDMGTAMNIAASAKEFSQLKVRQEELDELQNLHQLLPKQV
                     REYRASGESADETSTQWKVTTLLKAYINRLSVETHSLSSDMVYVLQNMPRICRALFEI
                     ELERGHPLTTYTYLTLCKCIEHRCWDFEHPLMQFANWSHRVNITDAVWMNLNKCNPSM
                     QLLQELTAKEVGEMVHNVRAGRDIADLVSKFPSVNIDIDVQPITRSILRVKVTIEADF
                     VWSRDLSGNSEVFWLLVEDQDNHFIFHHESVMLTRKEVETGTPHVVNLAVPIVPQYDM
                     YAVRLYSDRWMGCKEDYTFSIGHLHLPEDSQMTTKLLPLSPLRLHVIPEEYHAMYRNY
                     RQFNAVQTQIFYTMFHTDQNVFLGAPTGSGKTIAAEMAILRVFEQYPGKKVVYIAPLK
                     ALVKERLRDWKARMMLVGRSVVELSGDATPDISALAKADILCTTPEKWDGISRNWQVR
                     SYVTAVKLVVFDEVHMLGTDRGPILEVIVSRMRYIGWNRKAPIRLVGLSTAVSNPGDL
                     SSWLGVEKKWAVFNFDPSVRPVPMTVHIAGYHGKNYCPRMATMNKPTYNAICEKSPTQ
                     PVIVFVSSRRQTRLTAMALIGFLLMEGNTAKWVHMDVDQVQKYTSKLDDPYVKHCLQF
                     GVGIHHAGLLEGDRTIVEEAFLSNRIQVLVATSTLAWGVNFPAHMVVVKGTEYYDAKT
                     NSYVDFPITDVLQMIGRAGRPQFDTEGVAQVLCHEPKKGFYRKFLYDPFPVESALHKQ
                     LHVHINAEIVSGTINTRQDAVNYLTWTYLFRRIARNPSYYGLEDGSPKAVTIFLSTLV
                     KGALADLERCGCIEQPDTMDEDADPDAIQYTVLGKLCSYYYISHITVDLFNRNIEPDH
                     SSGELLRLLCDAEEFNELPVRHNEDKLNMELARQLPLPVRDAEADSPHVKAFLLFQAL
                     FERAPMPITDYITDQKSAMDNAVRVIQAMVDVAANNGHLYAALRCMTLMQCMVQARWW
                     DDNSLLQIPNVVKAMLPVIEKECDGVRHAAELANCPLAVLQKFRKVLEMPVFGLRERD
                     VNESMEAVRGLPLIQVDLTIQQQQPAAAEETDAEDEEAVVTYELVVHLQRLSFGQKRV
                     IAPHFSKAKDEQYWVVVGHEPTGELVALKRVNRLRQSSTATLRIDWDEDWVQYSPDGT
                     VELNVYLVCDSYIGMDQQYSFILPRSN"
     gene            <167827..>168576
                     /locus_tag="LMJF_13_0510"
                     /db_xref="GeneID:5650080"
     mRNA            <167827..>168576
                     /locus_tag="LMJF_13_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681743.1"
                     /db_xref="GeneID:5650080"
     CDS             167827..168576
                     /locus_tag="LMJF_13_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650080"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA3"
                     /translation="MECVELTPSESGTINRRGAIPANLAGNSYYARRYSTQGGTRRGT
                     LDATEPHVQFRSGDLVLQLCLSAVPRELSHKRIVDVTGIQTSFHNVSERQSKALATVE
                     EAMQTMHLHDGHEVPALQRGDVNLVRLQPRCVYISPPPSHSFAAGEAVAVDLRHLSSA
                     LRPLSNPYVLLAQTRRLSFRSEMEAVQTAQVMASFLTELRGGGAVSEGCGSSVGVFGS
                     AAVLRPVVRDGHLVAMTLCPPRDTARGCRRR"
     gene            <169199..>170035
                     /locus_tag="LMJF_13_0520"
                     /db_xref="GeneID:5650081"
     mRNA            <169199..>170035
                     /locus_tag="LMJF_13_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681744.1"
                     /db_xref="GeneID:5650081"
     CDS             169199..170035
                     /locus_tag="LMJF_13_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650081"
                     /db_xref="InterPro:IPR010422"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA2"
                     /translation="MPSGPKNNKYTNRHSEEARLRDEERRIDSRAAREAAKEDARWSE
                     TDPKVLKKMDKKREMEQKQEAKATRDAEKREQLEEEEREMNVKVPKKVAQRQIQKDLA
                     KMLADYDKERNALRGGQHGAVAKSEKREEAPLPSGNVNRERGVAPHPAADQESNTIKA
                     SGTVADVVAALEKGGNASGAAEIPDNRHIGKRAKMLYKAFHAEHLEQVKEEKPGLRRT
                     QYNDIIWEMWQKSPTNPFVMRSEKIAHERLEAERRWMEGDSDGEDEEEEEFKNGGKCA
                     AK"
     gene            <173304..>176294
                     /locus_tag="LMJF_13_0530"
                     /db_xref="GeneID:5650082"
     mRNA            <173304..>176294
                     /locus_tag="LMJF_13_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681745.1"
                     /db_xref="GeneID:5650082"
     CDS             173304..176294
                     /locus_tag="LMJF_13_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650082"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA1"
                     /translation="MEERKKKEIRDLYATLDAVDMEQERLEESVGDRQVREETELLAL
                     ETSLLVKTTELEEKEQELASKRAELKRYTAERIEALESRYAKEMEAQAAEVRSLDGAR
                     LEKQLQHVCDMRLATEQTVRELRERAALVLEMQPYSEAGVRLALFPITSNVAVPPTGD
                     TDSSSSTAGAAGASSAEPSSTELGSALQRAVMVLRGYCDKRLRHTRDNLVDYVHTSTL
                     DAAHSVRRGREQAWMQDAVQHKQVFSRYMVDMMQRYMVFYKERAVLKQDNIAALQADV
                     QRMAAQLRGHAAERLQQLLRDVTARITLSTQRHTQAAEEARALLQKKVNTIVEGDMAM
                     ADAQHRELEGRLLAEANARRQRHHAEDESLTEQLQRLRRSGEAANRNVFQALRDAASA
                     TSSQHAQPLREEVLALKTRLVERLRGGTSGVAAACSVARMHTEELTHVLRSTMAQEAA
                     RQQAASLLRQQCDELRRGLTTSLCTEAVERLQQTRCAQHAHQARIDALAKSWGAAHLQ
                     NLAAACSLILPVSSSTPGTADAQYVSETYAAPQDVVTTALLDVLQDKLRARDDKRRSL
                     LASRRQCTAASLSRLEEVRDAQAALQDRCAELWSAAQTQATQQRITQEMEVEVEKGLI
                     TLAAEQRVVDRDRRVMERRSRRIAELTSSLPQEPPHHLLGSLLSPPLQEEVTTHLARA
                     HPLGTVDINVIPKISSSNNTFTAVHASNNAATTVKKSSAEVSSSSSPSPASEVFQVKR
                     GEEAPVTPQKMCRTPNTAEPSYATDTQPWSSALLRAEQRLPHAGTGESSDVSPAAQGS
                     QQGRPHSDSAPTAHHGMCNEAGAKVLTSSQRAQQVDTTRVYRCSADMTVGAEGNAFSR
                     DMDPRNSGSTRDAADEKQRGGSWSRDASLPPVSSTWAADSDTIPPGCTCATMASPAVL
                     PAQRQRQQSLQALHTLSEPSVSQPTWSTLEEYRSSSADAPNRAAAGTSATFNFTATGS
                     PDDWSDFLALLSCTDSPASSSFTS"
     gene            <177144..>177740
                     /locus_tag="LMJF_13_0540"
                     /db_xref="GeneID:5650083"
     mRNA            <177144..>177740
                     /locus_tag="LMJF_13_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681746.1"
                     /db_xref="GeneID:5650083"
     CDS             177144..177740
                     /locus_tag="LMJF_13_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650083"
                     /db_xref="UniProtKB/TrEMBL:Q4QGA0"
                     /translation="MQTPAAANTSASPAPVLNNKPTGRSISYEEIVKAAKCSVLTDFY
                     REKRYLDLRRRIAERGEDVQLIPVASGDDAISPALVRASTSRLLKEHGSASWSASLYQ
                     SGVYGLTGISSICTAIALYLGIYQNRLVLPVVPMGVAATWRLWGVLEDVWNEQRYIDN
                     AAKMREERHGNPLNAVVKRRRKLDTTAKEGSPAAELME"
     gene            <178665..>180677
                     /locus_tag="LMJF_13_0550"
                     /db_xref="GeneID:5650084"
     mRNA            <178665..>180677
                     /locus_tag="LMJF_13_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681747.1"
                     /db_xref="GeneID:5650084"
     CDS             178665..180677
                     /locus_tag="LMJF_13_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650084"
                     /db_xref="InterPro:IPR003774"
                     /db_xref="UniProtKB/TrEMBL:Q4QG99"
                     /translation="MEKVVLTTYRKLYKMCRRVDASVAMRTQLMCCPLQVYDHRMMEW
                     QPFDISEMKWAESRTFLDALIRRLNNGSPQYIPPLPQETTRAVEAYKEQCASMFTVAK
                     GNADGAAASDEGAPATTSAAEEAAGTEAAAASGSSTASLGGARGTTVPLCVLPYSALT
                     VALRQIYEATPFSMSNVTNAFAAVKELQYVCDLDNAGKTKLVTMTAGSSSTSSAEAAD
                     VVRLQRALEVMPLHNLLIHGLSSDQRVSLDRQTRRARKCSSASRDNDGPPVTIEAAAA
                     AAASRAAMTPEAAAPTSAENVFDGAPDVEGEADLTGEGEGGGVAEESERTERRSPPEG
                     SRVPSVEELSDNLPAQAELAKEPKEVQLLISHPTARGFFRRTVLLMVRHVTHESAALV
                     LNKPLRNEEGLEMSIEATVRLGRVHPIFRRHLAQHTLMIGGPVMSGSSFDDSIFLLHR
                     VPGVPHALPLGSNLWLDGDLDVLMAKLDAEEASAEEDIVVLCGFAGWGFDQLKGELGH
                     GYWVVASGPSADASVGAFVMSLARTTRDQSQHQQKQQAPNTGAAAASSSENEKEPTEV
                     AGAASAGAESGSAEQEQAAAPAFEGTGKPEEILRAEAQHAADAAASPTLRFLKRRRRR
                     AADFGKVRSGHIETLSWVRAYASVGQPYADMAINQKAFAEDDDFQE"
     gene            <181906..>182502
                     /locus_tag="LMJF_13_0560"
                     /db_xref="GeneID:5650085"
     mRNA            <181906..>182502
                     /locus_tag="LMJF_13_0560"
                     /product="putative 60S ribosomal protein L18"
                     /transcript_id="XM_001681748.1"
                     /db_xref="GeneID:5650085"
     CDS             181906..182502
                     /locus_tag="LMJF_13_0560"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L18"
                     /protein_id="XP_001681800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650085"
                     /db_xref="GOA:Q4QG98"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /translation="MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGF
                     NKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAKSKAAPIAVVVGDVLDDVRMARI
                     PAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG
                     ASGVPGSHSKPYATNRGKETKRGRRTGRSYKRKAFRHV"
     gene            <183714..>184139
                     /locus_tag="LMJF_13_0570"
                     /db_xref="GeneID:5650086"
     mRNA            <183714..>184139
                     /locus_tag="LMJF_13_0570"
                     /product="putative 40S ribosomal protein S12"
                     /transcript_id="XM_001681749.1"
                     /db_xref="GeneID:5650086"
     CDS             183714..184139
                     /locus_tag="LMJF_13_0570"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S12"
                     /protein_id="XP_001681801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650086"
                     /db_xref="GOA:Q4QG97"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q4QG97"
                     /translation="MAEETVRVEVPAVEENVVVDVAPESLEDAVRIVIQKSLEANGLV
                     RGLSEVARTLDCKTAHMCILADDCEDEEYKKLVTALAKQGNIDLINVEEREKLAQWAG
                     LVRRDVAGEVTKTLKCSSVAIRDFGERTKALDYLLSQLH"
     gene            <187619..>192313
                     /locus_tag="LMJF_13_0580"
                     /db_xref="GeneID:5650087"
     mRNA            <187619..>192313
                     /locus_tag="LMJF_13_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681750.1"
                     /db_xref="GeneID:5650087"
     CDS             187619..192313
                     /locus_tag="LMJF_13_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650087"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QG96"
                     /translation="MNSGMSAPRRSNGAGANASIGGSNADVLGGGAAPQYSRMNSNEA
                     VPGVVYRATVPSNIRAMAVDPVEPVVWTAVGDDPLAALRLSGRELTHSKSVKDIDQVH
                     CMAVVRIAEEQATTFKSASTSPRAGGTTPKAAKAGKRKKGGRGSSGVRKSVKQRAGSN
                     GVLLGRSLASGFGGEDDMGNHWNSDGDDGYGDDAMTSGNPQGHDKQGVSFSNYLWCGL
                     SRGHVAVVNMSNLEYQLIHNAHNQTINKIWYWEACNKVWTAGREKGVHVWDPQRRVVL
                     KRRNIAAILTDATYAESTDKVFAVAGDACVRVFEPSGENVNVPKGQENRIRMKLDASV
                     IEYHRNSGFVWVGLARGSALMNTSTLDVERTLPYTFSAILFKGNNAIIAGQESPNGEG
                     RLMVLDVTNPREPSVLAYSKFAGALPLGLHIVPRTRFAVAAQDDPKKGCMMAVFVYDG
                     TVALTHATAPGGAPPQRTEWVPRGAAMTTTVGTPSPLVQPTTQAPDQMGGSSAITATT
                     TPPAVSNVTHSAATVAAVDRATLHRGAVVKTSPDYRTDRKLAVEADRSSLVEAIAPDA
                     QDIKNALKHLVKTTDEVRQSLVQQRSAEATLADFSRVLRGRQQWLLEQGSITNLPVLP
                     SAVADRIGRDYATAEGKTIATSIEQLQQLYTAALAKQHELLHSREAGSGGNESGAVAL
                     SLPAASSPRELRMSSSAVVTSPLVPGSSRKGWRGDALGSGVVGGDAAALRVAAGSGHH
                     YPGAHLVEGNSLPYGYSPRQSGVSASDSGAGDAAVPPWAVQLASALQRERTLHAQQLN
                     ALQLLTERLTERNTALSAAFVRLQAHVAALGQQALASAMDAESTGSMTVESEKSPPSF
                     PLQHRQPLQAHQPSQPSPQYRSAAALFAKLSHGQYHKPKCVRRSTDILVKAMDEVVRL
                     AQGRRGDRNALGITLEMVHSMAGLAGTGSVDDPDGSADTVPAHTRPSRIQDVSLSPSS
                     PSMVLPLETTLSAEKVAATRGAQSSSAAVDDTLLDHPLTSLPGVCSMAEVELRNLTER
                     YAEVASLWARLQSIRSQPRDAGASHHATEQHATPTGPAADVAADSVKAVKGGLLLRAP
                     IADSTTDSSAAGSTPVLLTRLMTARVLQAVCWAECVQAVLHELTHAEGMNNIFIAGCV
                     HNALMSPRAPAVGRCGDGASDGVRGQGPLEVLGYESTQEQSMVLAKVGHMSKSATLEL
                     SNTSRVREGLRQQECRSQGEEGTSGPAAFANSDFRLHRLPGALRWSLTALRLLFAFLS
                     DAEAHLLVSGGHGRGSDTSKVDAKTARAAGKHKVGATPSRGDAAATRAPSAVGVAMTH
                     WAMFLMNLQADLTAVHHAARLYHAWRWGPSALSATATPTPPSNRAGGAVNNRSGAARG
                     GGIGVSAPSKTASYARESAFIASDSLAHIAASLSSKGKLLLLYMQWRFSGFVTTSTDR
                     AVASTGGANVLSGSANAASSLLSSAGLPTLFTSEGDNDIAASTAAVTPCSTVDCSRLL
                     CDTVAQTEQLLHRVRLLLAYTHAIRARALMALEESRDDAVAQVIASFASTAAADPDAR
                     VPTEQERAFLQS"
     gene            <193386..>194363
                     /locus_tag="LMJF_13_0590"
                     /db_xref="GeneID:5650088"
     mRNA            <193386..>194363
                     /locus_tag="LMJF_13_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681751.1"
                     /db_xref="GeneID:5650088"
     CDS             193386..194363
                     /locus_tag="LMJF_13_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650088"
                     /db_xref="UniProtKB/TrEMBL:Q4QG95"
                     /translation="MDLLHFISLVIDLRDYPGYATCIRATEYPGLALCEYNAVAGMRY
                     TVPLGYAASAVYFYLYHRPRLSFADRSLTKLHHYFYPSAGYSTPLGIIGGVICGAAEC
                     VQGLTPAALEATAAREKAAAVMAAEQYSQRHRAVKERLKAEQSFASKALAWLQLCEDP
                     VQAELARMGLGEDSIAWETLLVPQGYLWTQLHSVVHDPARYRGYEAPVATGAAVPTSA
                     DERLSQPSGGANTPCPSPSGVLSLSRAYFTKPQVDAVVSRIGTLRTSPEEDRWMRSAG
                     RCGAYGVFGMLLTWNSGGALFRAQMGLGLGVVIAGLASATRLDEVFAHL"
     gene            <195186..>196079
                     /locus_tag="LMJF_13_0600"
                     /db_xref="GeneID:5650089"
     mRNA            <195186..>196079
                     /locus_tag="LMJF_13_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681752.1"
                     /db_xref="GeneID:5650089"
     CDS             195186..196079
                     /locus_tag="LMJF_13_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650089"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:Q4QG94"
                     /translation="MPSALRCHSTTAADASAKAKLTSPGAPLTHVLKPIPTSGAASSF
                     SVTPSAVVLHTSYASLSAADEVGHDGSCSRGVDAGDGSTRVAHFTATPSYAVTNVAAF
                     EQLIAKALRLSEVTLEAAATEAAPPAPSPSSPVLATASSRGSAREAPITLIADHTVRE
                     LLVLLAEAEGTLAPFTACKARVDKFVYGVYLPLLKYGTFSFFAAQLVVYFNWIFFVFD
                     WNLVEPTTYFLAYTGVFCSVVYHYYRCSGDGSTWKDVFQHLARRKAEKKYAQVQLDVV
                     GMAQLQRRITLIRKELARMSV"
     gene            <197103..>197927
                     /locus_tag="LMJF_13_0610"
                     /db_xref="GeneID:5650090"
     mRNA            <197103..>197927
                     /locus_tag="LMJF_13_0610"
                     /product="actyltransferase-like protein"
                     /transcript_id="XM_001681753.1"
                     /db_xref="GeneID:5650090"
     CDS             197103..197927
                     /locus_tag="LMJF_13_0610"
                     /EC_number="2.3.1.-"
                     /codon_start=1
                     /product="actyltransferase-like protein"
                     /protein_id="XP_001681805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650090"
                     /db_xref="GOA:Q4QG93"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QG93"
                     /translation="MASTANASVDGSCPAMRDAADEALWAKLDEVQKLLANRSDAKEL
                     FTKYTVLRSVVGEVKPVFADSVRTRVKVFCEEPSFAAPEECDDFEPVSLHVVAYLNYK
                     LFMEEMKELMVQARLLKSIGMEGSGLRFQRREQNIVAPGNEPRTGSSSKPSAQVSMHK
                     PSYRPATLIPVGTLRLRRVSKASGAGKLTEVVAKIERVCVVKSARCFDVGRTLMRAAE
                     KIARDAFHVRWALTYAQLSSKDFYTKAGYTPKDGRACMDLHMPHVVMVKCLVDASM"
     gene            <200158..>201438
                     /locus_tag="LMJF_13_0620"
                     /db_xref="GeneID:5650091"
     mRNA            <200158..>201438
                     /locus_tag="LMJF_13_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681754.1"
                     /db_xref="GeneID:5650091"
     CDS             200158..201438
                     /locus_tag="LMJF_13_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650091"
                     /db_xref="UniProtKB/TrEMBL:Q4QG92"
                     /translation="MTHMGRAADGYQRLGNNYPQVTPSSHFAAASPDPVLATPIQTRP
                     LQGNPFHPLLWNGSATSSTGAAGVQASLSRKSRTRLTSGVTAGSSSGPLSSTLSLSTP
                     LSSCASAAASGEGRFQRRVSRDRFGACSTPTSSSTTAQVLQLQRPAQSPMPPLSSSPP
                     ASVGLTAAAARGAVTPANLGRERKVAAVNYNALFQQELQQQQRQGSDTGAWPTPSPSP
                     PSGALQYAQLPPSASADVHGTGAHSGSGEGVSEALSSSVTASSVQAGTAEGPLPPDVR
                     RIIAQSCTSSSSSSGADTNAIIDAAEQQARRLISTGRRVKVYREELTTAEEERNDLSA
                     AVEERRLVRSVLQSEVDDINARIQALLQERALAEAQLHAQDDAAAREARKLTEAQDRV
                     TVLRKTIEGIVEETSAARLMLRQIVPSLHIENYY"
     gene            <202956..>203864
                     /locus_tag="LMJF_13_0630"
                     /db_xref="GeneID:5650092"
     mRNA            <202956..>203864
                     /locus_tag="LMJF_13_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681755.1"
                     /db_xref="GeneID:5650092"
     CDS             202956..203864
                     /locus_tag="LMJF_13_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650092"
                     /db_xref="UniProtKB/TrEMBL:Q4QG91"
                     /translation="MQSDFDNVETELRDIEETFTTGRMNAFGSASTQDAFVHELKRIA
                     EIETQVFYRTCALLKSSHTNEHQLVTNMYASAQPPPQSQRSGPATTSPSSNLGDGSFR
                     ANSSGLESSMYRGPMNQRSQSSFASTVAGGLSGAPPSNSNIHSSSASRRQSRQGWENV
                     SAGSPFPGVGDGGASSGAAPHIHRSEWGNEDGFADKAFEDVAAHFEELESQFFSLGDY
                     LREISKHVIRLNDMSKQVNNGVNYGANGGVTGAPAAAANANGSSNNTDMLQTVGSMGR
                     QDYPGSFIDPTSIGGGSGYGMDGPHS"
     gene            <204363..>208388
                     /locus_tag="LMJF_13_0640"
                     /db_xref="GeneID:5650093"
     mRNA            <204363..>208388
                     /locus_tag="LMJF_13_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681756.1"
                     /db_xref="GeneID:5650093"
     CDS             204363..208388
                     /locus_tag="LMJF_13_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650093"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QG90"
                     /translation="MCDTKTSVGSGGGSSSSSIPDQLFHIFIATLSPDKAGRQSAEDA
                     LAQLADKDPHFILHLLELACHSPTVCAHAFGRGLPATASALLASAIRFRNEIGRSDWN
                     RNPRCSDEVRQRVRDHVVSLQCQPHVSEAVRRQLLAATIEVVNADYPERWPDLLPQLT
                     GLVSQSMTALRGLFDCNTSGCQEIDGDVIHMMLLQLKGTLGVLRGCCKIYVDPLKVDA
                     DEADGFAGHLAPLLLSLMELLSGRWQHALTALAGHGAATATSSPSLTTPFYFSAELEE
                     LSHCMRLSVKCVFSLFESRWPACLCEVSALDYLYASCVVTPIQAFQQVVLPLCRARLV
                     HALHHPTETGMTVTQLRGDHFSNFQQSAMFTLLKWVMNIAYKLTQEFASPKSCERRCR
                     TVAKHFTAQYLQPTVEAALALVRWHAGPPLALTSKAYILALEVLTLAVQHKAVYASVL
                     HPSAEELMTVLLFPRLAFTDEDEELWSDNPEEYVRRQANPAGDIYSAKVVSTSLLMSL
                     AAGTKKFHDKSLFLSLMTFLLNQLQAYVGAAAQATSNDAHLCTPAMEAARRVDAALYC
                     LYQFKKILLATRFGDDKLEYVLSTFTVPVTQYSLGFLRARAVLVLSTFAPSLEWSSPL
                     AYQQALQPVLCLLNDSEAPVRVQACVCFSRLVCHPFARDVINPCIAELIQHYFNVMRM
                     MDNEAVVRTLRKTISFYKNTLSQWALELTEMLVTHFAVVLERVTAKYNALESMTPSTA
                     QTTGGGEKDELFLDNDGFADVLMAADELLEALTTLVKALPESTATVAARHAAADLLAK
                     VSGASSSSSSAAPPCPSTEALQQDIFVQIQLRVAPMLFVILGHQGGSSYGFMDPALSL
                     LTTLIARSPAIASPMWKVLWCLYQLIIRGGAVDYIQQLLPPIDNFVSVEPVSFLYGTL
                     AELTREPLPAAVPAEEAAKTPAQLVLAMCEAVLASTSLREREVAAVPKVLDVLVQCSW
                     AASAAAASTVAFAEAAHALVQYVTQLSLKTAGTRPQQSATFRVLLANNIFSCLIADAP
                     AAVAVLHGLQVTRPFLEQYVSLLARSVSIEGSEEAMLGLMRGYDRSLFVYAMVSCLRA
                     LAANTIAAGAAELRSGLEGVVQCGVLQQLAEMETTNGTAELRVHQRRIAKLSGKPVPT
                     AHASEGASAEEGEDEEEEWDSEASSEEDDDGEWLQDDDDGDDDDDGGEWGEVDADSDS
                     AEGFLGREGAGHGQSRNSRFQGMLRQAQALRETPQQSHRKKAVDDADDADMDDFEEEN
                     LLDDEDFSSPVDGINAWAALVSEVERTDVAASGSASVVELLRSAAGQAQASSIVRARD
                     LTCELQVARQTHRALLDQVKH"
     gene            <209413..>211236
                     /locus_tag="LMJF_13_0650"
                     /db_xref="GeneID:5650094"
     mRNA            <209413..>211236
                     /locus_tag="LMJF_13_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681757.1"
                     /db_xref="GeneID:5650094"
     CDS             209413..211236
                     /locus_tag="LMJF_13_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650094"
                     /db_xref="GOA:Q4QG89"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QG89"
                     /translation="MAASASPSTNNPGLHNYMIRTLLAGGFISILTCFMAVHFYYASA
                     ALLDVVVLLLFFFFLSFFGLSITSLVLSAVVGPGELPSRFSAARMERFVREELQCAVA
                     KARGRIGGGQAGTTAEPVREAAASDRNSSRAVVAKVKVEEPNWNDVDEAESQQLANVV
                     STAAILRRSSPTAEEEALERAAVEARLCMYTEDGGSTSRLSAGDTAGTVGGVRQAEDN
                     SDNGEEVSAEDNSELPPYMTEAMQVRRQRKVRRGLEIVLVSHAARKVLKAIDGTDMDR
                     KQEEMGFLIPGANWCRFCNFYQMNDTRHCKVCNRCVYRSKLHCVCCGQCIGYANSKYY
                     VLFLFYLCLSLVMADVLDLYCVSRGYTFFFKASGDANSIFYLVFVYSASFAVVGLGLL
                     VQYLYAAGRGVGLLTDLLRQQRDELQAAQARNNGERYQPVLSERTMHAAEEGSASPMQ
                     ETLPFSWRIAMETVGEGLPLLLWLWPTPTLPAAKETDDPPGFWDAFKEAIRLRLRSVA
                     DEDDVFSDEDVLGDAHAAGAFTNGAARSAAGIAPAAPQLSTASTPLPLRSRMQYHANS
                     TDVVVVAPVVAEVPSADSPTYVNTSAPPAAKVAPAPKHEAD"
     gene            <213302..>215416
                     /locus_tag="LMJF_13_0660"
                     /db_xref="GeneID:5650095"
     mRNA            <213302..>215416
                     /locus_tag="LMJF_13_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681758.1"
                     /db_xref="GeneID:5650095"
     CDS             213302..215416
                     /locus_tag="LMJF_13_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650095"
                     /db_xref="GOA:Q4QG88"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QG88"
                     /translation="MSVHPAVQSLCEQPIDTIGLTAVSAVASALGDVSTATDLIQRPE
                     QEKALHDLLKKCMSILNNSGKNSALRLACLECLYVLSQPPIPAFRTGLLCNTLNSVNS
                     SVEEMLARTGPSEAESSSSAREMFTVLVFRFTNYDTKVARLLLQHMCDGDVGTMMQTL
                     LRVMVQHCETCEWPLLQAALQSLYELTVPTTYYATGKDGAAEPSFDSAATATGSSLQS
                     FTVESFQDRIAVLLTEMRNHRLLEKLLASLRLSWHESTHNRSPPSLAQGCAESVALGA
                     LGCPDVAHTVTSASAEQQMELLNWLSAFTLLCRALDNMVEFCRDAKLAREVRARLLSD
                     PSCHDWLASAAVPAVIAAIQVWMSDDGASATPAAISDGSAGPFATAKVKLSLLTAAVT
                     LLRLLRFALYKPAMGFTAALLSSMGCLAAQVQRGEPHLRLQYGGMQVMLLTVECLVNM
                     NAVAVTSPVNLSESYRGLLRTIAADKTRCTLSNCSSDVSSDHGAVAERQPDALMPVAE
                     WFILCVREEESPFCDIDSGNASVALLHECFASEEARLQDAADRVADLAALESQLAMMQ
                     NFLLLMTLTELLSGLPDGGLERLTQPGPRRRNSATDAEQKPPNNSDSSSRRCKLSKKK
                     VSHHPAAYVCDLTGKLMREPVVLKGGHRFEFDALQNVILQVGHVDPISGESIDEDVEV
                     NIPLQQEIAAYRVKRASEKGGS"
     gene            <217491..>218918
                     /locus_tag="LMJF_13_0670"
                     /db_xref="GeneID:5650096"
     mRNA            <217491..>218918
                     /locus_tag="LMJF_13_0670"
                     /product="putative lectin"
                     /transcript_id="XM_001681759.1"
                     /db_xref="GeneID:5650096"
     CDS             217491..218918
                     /locus_tag="LMJF_13_0670"
                     /codon_start=1
                     /product="putative lectin"
                     /protein_id="XP_001681811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650096"
                     /db_xref="GOA:Q4QG87"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4QG87"
                     /translation="MTAARAVPRLTPAQEHRGITAAIGHHSFAPPLLRQYYGDGEIPH
                     WVISGSSVITDEYVRLTADQKSQTGHLWNTEPLDMDAFEVVVGFRVYRPMGGFGADGF
                     GVWVAQPPRYDGPLFGRPSTFNGFGVLFDSYDNDNRRDNPMVSLVYNDGSNTKHFDSE
                     NDFMGDSVASCVFDFREIPEPNMATMRMVYFKGELQVYLSRNSEAAETECLKVTRLPM
                     PKGKAYLSLSAQTGGVSEIHDILFVHLSPLAEAKYDHDVQQTTVPANGLHDARLYDNE
                     AMNNRQTSEVPTATHPPTMVPQEAQPAQQQQQQQHYQEAQPAQQQQQHYQEAQPAQQQ
                     QQQHYQEAQPAQQQQQHYQEAQQQQHYQEAQQQQQHYQEAQPAQQQQQQHYQEAQPAQ
                     QQQQQNQPAAQATADIGEKERQRIEELERRLEELQGRNGYRATRHIEDEDVEELDGDG
                     EDRQRRMRRVRRARTPRRNRVDQDE"
     gene            <219784..>221508
                     /locus_tag="LMJF_13_0680"
                     /db_xref="GeneID:5650097"
     mRNA            <219784..>221508
                     /locus_tag="LMJF_13_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681760.1"
                     /db_xref="GeneID:5650097"
     CDS             219784..221508
                     /locus_tag="LMJF_13_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650097"
                     /db_xref="GOA:Q4QG86"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="UniProtKB/TrEMBL:Q4QG86"
                     /translation="MGRGYSASRSKSGRPTLRMKRSRSMSLHALKKNMDAHEAAKAAN
                     GVSTEASSLSSAAATEVPRKALKVVRQRRAPSSLLSSSSSATASPTPAAAKATMKAAS
                     TKVKSADGGGRTTTTSAGPRSQSAAFRRNLEDLEKQFDAAMEASEDEDETVMNTTTMT
                     KYKECGRVVDAVLDQLAAACVPGANTKVLCDTGDEEIVSRLKGLFVKTKGADGRRLAR
                     GISYPTNVSVNEMLCNDSPYRLEDGTILKDGDVVKLHVGCHLDGYPVSAARTVVVTTR
                     AASAATEGEEEEAQRKRGSPAATLSSRSAVGNTIEAARVSLLAMMHALRPGTLNADIT
                     DVIAAVGQHYGVQAVEGVLSNRSKRWVPDGIDCIIARRVTSEDPHQDVADCEVGEHQV
                     WCLDVAFTNNHNYRITLSEKPVTLFRRTPADFHADARVRQANETLQEITDTHFCFPFH
                     FKSLENPLKGKLGIHVLEKKGMVDKLPPLRTKHGYVTARFSATVAVTAKRVTVLCGAP
                     PTASVAMPPVMRSTVSESTLAAEVLAVLRRPYEFADVRAVVTAKDARGQSSPATKRMR
                     VEALENEE"
     gene            <223904..>226777
                     /locus_tag="LMJF_13_0690"
                     /db_xref="GeneID:5650098"
     mRNA            <223904..>226777
                     /locus_tag="LMJF_13_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681761.1"
                     /db_xref="GeneID:5650098"
     CDS             223904..226777
                     /locus_tag="LMJF_13_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650098"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q4QG85"
                     /translation="MHALNASSPAFIPYQYLQQQQQCGNAGDNAAAAATQSVFSFTAT
                     SSLVYTGNTGGGSSVSSPLAFAVSSNAGHSTAMLSPFSPSLAAKQDSLASSATFASVA
                     SAAGSGSAFSTQPSHQLRGAYARATAAAAAAAASSALHLQHTDPYSSVAAAPNSAIPA
                     GAAAAPPHTQLEPRQRCATRKTPVVASSTAKAVYGPSVPVFHSQFINIATGSTSMTPF
                     ALLQEQSDGDDVDRLSEACDDRHAGAETAPEPATTGATAAVPRSPSTLAQGREEAEVQ
                     RVRQASNSASQQPLQRRISAATAAVLASQDARLAERSQRYAEAGQLLYKPASAITTAA
                     LSANGASSQRPSNKDASDAATAKATAKAHRHTSAFATATVSETETTTHETPKRRLPTV
                     STATVGTSNGNKVRTAVTSSIDDGASTMKRLHTCLASTDERTEGDRTGSVMGLTGSTR
                     RGLPVCGDYNDDEGQRSDTVTPTTTPAKVLAAESSPFVTAAAASGDASTGRAHRRSVS
                     REDSAVAHSESGLSESTRHTRVVHQQHSSSSSSNAHLQRAMMQLIAQIQTNNNTKGHA
                     SSSVAAATAITPHKSSIQNAALGETGATAATPAAFKTPEVERVPSARPSASKNAAIRN
                     ITTIIHTPNTSSAHRGHSSAVTKTTITSETSRHHHSAVETSAPAKDSRGAAPKGAQRS
                     LTSCLEAISPQRGESARNSSNAARAELATTTSQAPLSSSSSAPFMPSGTAGAMPVPRS
                     QRRGTKQGSSSATSAAAAGAAESRSPAAQANNYAVVIEGHMQRRVTAVSSTVLKRGVC
                     VLFEEDRGIDMGRVVQCDVLDGDGAAGTLATMASATSPLSRKDRPAPVLRPATAEEEY
                     RWLYADVKEAEATLEPCREAAARLGLPVKVVAAVYQFNKAKLTFYYESPTRVDFRPLL
                     PSLFSRFHCRIWMARLETPEMTAAASGGVEEGAHTHLQSEKSA"
     gene            <229839..>234146
                     /locus_tag="LMJF_13_0700"
                     /db_xref="GeneID:5650099"
     mRNA            <229839..>234146
                     /locus_tag="LMJF_13_0700"
                     /product="putative kinesin"
                     /transcript_id="XM_001681762.1"
                     /db_xref="GeneID:5650099"
     CDS             229839..234146
                     /locus_tag="LMJF_13_0700"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001681814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650099"
                     /db_xref="GOA:Q4QG84"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QG84"
                     /translation="MSSASCSSLGKGSSSTRNHRRLEDARSPSPEGPRATIAATVSHT
                     SASAPDRAACNGDIFVVDVASGDHFHITTALKGPFHPLTSVTHRALQHTVRNLLLASP
                     NTHTGDSTTQPRPPLLLLLDGVPLGDSDALTLPNGAVVEVHRDSAASLPRPVALLPEQ
                     GMPLQSTSAVSARSARLSALEAVKSGPAEEENLWRVQSTAPATTVPFPSRRLPPRGAG
                     GASSNIGLPSDGDNVAGTRDSASPYALMRTSGTAASSESRPRGAVTLVSTFHASAHED
                     CVVSRQLILSSSLPSRHGGASVSTRSSEEETTSASRQVPSLHTVNDTQPLLHQRTSTY
                     SSIGGRPRAHQSDAAVRGATASAAGPHTPSSASSTLTPLPSTAFTSPAFSQDSPAATE
                     ESLTHRRHALPSSSRASAADDRPSSTPLRPSRAAPSVEPSPTSSASALVSVALQNAAA
                     SDRGSEAVPASALSAPPAEHSQLQTSAPLPSSPPLQLTAQEIYDTQRSSIAAAAAAEQ
                     RRLLTRLQQRCQVLEEEKKALLPARLGALRAQESAGRLRALREAQEEAAAVEVDAVRA
                     RLGQHREDLLSHWLRVLQHHKDTQYAMPSALLRQLEAEGEALTLHCLSSIAGYHTQKA
                     RLQALQWQRVLKEAEVARLRWEAQVRQCTVEEQRGCLRVVARLRPPSERSWLPASVLA
                     SAEAGELDGGYAVRVLEGPPDAARGPQQIIEPVPCVVEVTDPPRDLRRRYALWAAYNA
                     ANAGSQQRLFEDQLQPLLEHMCRTGQNVAVLAFGAVGSGKTCALFGSRAAQVPRQPVK
                     TAHKGVLPPQPHRVGGESASAEVFSDFDFSGSRSSRSHSEGDEVGRMPNGVTTVGAPG
                     RRGITRCLDPADAAREAQVLESLAETEAAKRRQRSAERHAREERGWRERAGIEEGDGL
                     LPRAVAWLTAHLRSESPHGKASGPVVESIVFSMYEVYNDHVYDLLPTPPPSAAGTTEP
                     DSKASWAAWPRWNAGWLPAPHIKNSNPENLTELQLELLPPSTDGRGAVRDASATVSHL
                     LPPQPAQPQWRVKASEMEVRTATEALQAIHLGLDRRRSAATLRGAQSSRSHLFLHFRV
                     KVQRPIMPAKSSSVATQWASATAAASALEVAGIGALIGNAAASADATGAAGKPKGYDF
                     LRAALATPSEGATSAKPAAPASSLACVAELLFTDFAGSERIELSGVTGDALKEVQYIH
                     SSLSAVSAVLTALARAHPRREHQGEAEAAARRPGKQRGGGGAPPLAAAALVQRWGAMA
                     HCPGVTLSRSPPVFLQPRFTKLGGDRDTRQRGGHEGSLALRRRVLPLMDKHVAEEEGV
                     QWWRRWRAAPPHVPFRTCKTTQLLQSALGAPCKLLVLACVQPCSVSEVVLPASLHDRK
                     GPRTRAAAQSVFAHQAPVMLSEVHATLAFAERIHEASQDGGKAKRAQWRTRGDGVCE"
     gene            complement(<235432..>236730)
                     /locus_tag="LMJF_13_0710"
                     /db_xref="GeneID:5650100"
     mRNA            complement(<235432..>236730)
                     /locus_tag="LMJF_13_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681763.1"
                     /db_xref="GeneID:5650100"
     CDS             complement(235432..236730)
                     /locus_tag="LMJF_13_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650100"
                     /db_xref="GOA:Q4QG83"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q4QG83"
                     /translation="MASTGKLKVPETAEEAKELVAVMRQLPDNRVCFDCPQKNPSWCS
                     VTYGLFLCMDCCGRHRGMGVHITFMKSAELDSWRPQEALRVALGGNSRAKQFLKQHGN
                     MDPKSFYTSPAAALYKRMVDKAVNGFMDNGQLPSASPVPQLASEASPQPGNCASPTFF
                     GTAAPAGSSLSPTPSASPDVTAQGSPVTVASVVAISSKPTGLGTKKLGGSGAALGAKG
                     RKKGFGGIARVEGTIEESTRPVPEELLYDREAEQRKAAEAEMERQRQADLAAAAARAV
                     DPSMLGRGEPHAPKVPQAPRQTGFIGKSAENVNGDLFDDTNVPTTTPAPPTRQPYGVG
                     GNKATNVSAFAATARSTTPTPPPMSASAAPRAGPDFRGLGNQAYVPEDTYSSSSGMGA
                     PRTASDALWHVTEAARSLQQSAAQATGALGEAVKNFLDDL"
     gene            complement(<237790..>238968)
                     /locus_tag="LMJF_13_0720"
                     /db_xref="GeneID:5650101"
     mRNA            complement(<237790..>238968)
                     /locus_tag="LMJF_13_0720"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_001681764.1"
                     /db_xref="GeneID:5650101"
     CDS             complement(237790..238968)
                     /locus_tag="LMJF_13_0720"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_001681816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650101"
                     /db_xref="GOA:Q4QG82"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QG82"
                     /translation="MSSASIVALSLSLSFSLGLLRSLGSARHIRYGHPHTNTSAYGGR
                     HPRMQVMAAAARTYRHIVARELSTNFRAVASIVEAPFPTVLHPKAILVKNKYLGVNAS
                     DINFTAGIYQPDVRPPFACGFEAVGEVVDVGSGVKDLKAGAAVVTQSYGAFAEYQVVA
                     RRHAKPIPRVAREYLPLDLSATTASIALEHVLKPQPGERAVVTAAAGGTGQFAVQLLK
                     HVYGCSVVGTCSSPSKEVFLTNTLKCDGVVNYKAEGGDTAAAFLRCYPRGVNIAYESV
                     GGDLLEAVIQSLAPRGRILSLGCVSTYQCGSIEAACPSRKPLPLQLLAKSASLSTFFL
                     PHFAKYGQLHFDRLCALHEQGLVQCCIDPTTFEGLEGVYDAIDWMFEQKNCGKVMVEL
                     "
     gene            complement(<239798..>242335)
                     /locus_tag="LMJF_13_0730"
                     /db_xref="GeneID:5650102"
     mRNA            complement(<239798..>242335)
                     /locus_tag="LMJF_13_0730"
                     /product="ubiquitin-like protein"
                     /transcript_id="XM_001681765.1"
                     /db_xref="GeneID:5650102"
     CDS             complement(239798..242335)
                     /locus_tag="LMJF_13_0730"
                     /codon_start=1
                     /product="ubiquitin-like protein"
                     /protein_id="XP_001681817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650102"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QG81"
                     /translation="MRIQVRGTAPYNSDDVVVLEGLTVAELRNSLMVRFNIDAATHSI
                     RLLYRGRLMQDANSVTSYGVEEGSTVHIVVQPRQPEGGNNGGGEEHSAAPNQQHQFTM
                     PQFSFGTAGNSGYNYVSGGGFSWQPFASTIASSISTAFQQHQQTAAQGASMPSATPPA
                     SDNSPHMTFSYEMGSNVPRSDGTAAAGIAGGSGSDAAAAAAANPAVAATVNAFTSQLP
                     WLISSVLSNSLNGNAGAQQSQQQQQQQPFTAGATPAETVGETVAPAGPAPGGTGAGAS
                     ADAAAPGQREASTPSPAAPQPPAAPAPAPAAAAGGAAPQPTFHFTTAASPPRMDVFVG
                     NAAPSMSPPQYPQQQSTVVHIHVHCTPEELDTMPERLQRLSTQIPVGHATLQADTTDR
                     NSYRQPTRQEQQQQQQQPRTTTAFQANNTSASSASDTQTPWINEAMSTVLATLGMPQL
                     MQLAAGNYNVLANLRVPLQEQVRRRLNGTDESPAAVVHVVQNEARQLSERILSMSAVQ
                     NLMTQQTAAATSAGRTVAEASQRVEMFRQELPRYLEHFYVSVMQHLSRSSANAAEWSR
                     DLRNIVVRYVGMVLSRSARWFEGGSGALQTAMANIMQTLLQSSGVQQQYPMLQAFSSM
                     LSPMLQSLLGQWEREYDQSMRRSDDSLQFEQDAPQEPTSPPQAQVKAPAASTFDCAAT
                     APSLIAESVSDLLTAGNADTLDGAAHMDDDFEDLAKELMEDADNDAPQPAKKAVTPKS
                     WPLETPSSDVSAVASQTRLASAVEEWEEACDVPHSVADRVRAMATRYTEARVMQASPN
                     NTAESASAPQAPPPLHAGGPQNSSTREHSGDWVMWEANPYGNSASGR"
     gene            complement(<243258..>246194)
                     /locus_tag="LMJF_13_0740"
                     /db_xref="GeneID:5650103"
     mRNA            complement(<243258..>246194)
                     /locus_tag="LMJF_13_0740"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681766.1"
                     /db_xref="GeneID:5650103"
     CDS             complement(243258..246194)
                     /locus_tag="LMJF_13_0740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681818.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650103"
                     /db_xref="InterPro:IPR007632"
                     /db_xref="UniProtKB/TrEMBL:Q4QG80"
                     /translation="MAASDKKAKIERQQRKRASAAIQTFLSDAPCSVTTRTSVVCAAQ
                     PFSSRVDVSDGRTLPPHEEAPLLLGQRHELTAPNASVACLPDADRGPSEMPRGPTKNE
                     LAAVAADARQQLGQPSYVALTARQVAAAQRWQQSHNYDHIVKDLHERLGVVKPTPHGT
                     REVNNALAKPLEVAADVIDKVMALRQAAMAEMVARLRRMLSEANITGAPIIPAASLGA
                     SGSPCPSCQYCIELTSEETIKEYLVAALQVLLSERVVAPMAGRCGPTSVMSSALSGNA
                     TTLDSFRAHPSRAHKRPAEAGAPSRYSVPQCFRVELVPFALHKVSIHVSVHRNLAEHF
                     FQAHARQQEHLRSLLIDPPFPQAYAEWTDAHRQRLLHRVLGDLLHGGATPVVPADLET
                     IARFPAHDSATRDALWCSVWSACSLTGWLTISEDAVASYLGEEVMFYYAWMNHYARWL
                     LGAGLLGVLVSMLSSLRPAPDTAAAAVLVPAASSSSITLRRTVQHCLDVALLPLFSTI
                     MIIGSVLCIKMWERRCSALCMRYHLFQHERKDELRHDFCGTPGADPVTGGPQLCYPAW
                     YRLTAAQSLTWGIVALFMGGTLGLMVCSLNLDGMVTDPASRLAIPFLRRLAVDGGLLD
                     KTAHPIAAILPPLAYSVCIGALSFIFTDLAKYLTRMENNRYRGEYMRSLTLKRAAFEF
                     VNSYGKLFFIAFGRCRVAELSAHLRSMFYVAVLSRMMSHTVIPFAVTHRRRVVCRLFR
                     ASGGDASSTPSGASPSAPASLRRSAHGGSSDSPLDEADEMLDLYDIHMDFIEMLIQFG
                     YILLFATAYPLASFVALLSNIIEVRSHLFKMCYVMRRPVPRLGVQQNATWCGIMRGCV
                     IVAVITNTFLLAITSHQTVRWFPEYFAATGTLGKQRTSGRVELRSGGSAAAAAAANLN
                     RGVSLAVAGLERVPNKGRFVVFYCVVMEYVMCLIAVFLLWRIPSTPREVRNYKTRKLY
                     ERASLQ"
     gene            complement(<247792..>248448)
                     /locus_tag="LMJF_13_0750"
                     /db_xref="GeneID:5650104"
     mRNA            complement(<247792..>248448)
                     /locus_tag="LMJF_13_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681767.1"
                     /db_xref="GeneID:5650104"
     CDS             complement(247792..248448)
                     /locus_tag="LMJF_13_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650104"
                     /db_xref="UniProtKB/TrEMBL:Q4QG79"
                     /translation="MFHRHSFYEKGSSAPRDGAGAGADGTQAHGGAAGGSCNNGGTSS
                     SSTASSQQQREQDERLYGMGSATAQQRRQVRQQWEKSFFGRLHYEEGMHDRFSEALKS
                     EDAEAFRQSIAGQSHADLFPHWPEEEEAPLSEFKRLRPSLQLHYIVNRLSSGERRIRY
                     SVDFGGLLMMPQLNLGEMMVKEADTLLRELGWMNDEVAMRIEEVQALASKIKFDFDLD
                     "
     gene            complement(<249403..>255594)
                     /locus_tag="LMJF_13_0760"
                     /db_xref="GeneID:5650105"
     mRNA            complement(<249403..>255594)
                     /locus_tag="LMJF_13_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681768.1"
                     /db_xref="GeneID:5650105"
     CDS             complement(249403..255594)
                     /locus_tag="LMJF_13_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650105"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q4QG78"
                     /translation="MATLKVTVHEARDLPIMDRATGLADPYVVVKLDDMEHTTDIAHL
                     TRNPVWEHDVRFDTADLLVLQEDPLEIRVYDHDIISRDDIVGMVLLDCNSIIYRANPV
                     VSGWFPLLDSGAGLHGDIRLTIRIKFHAAENPLAPALPERYVRRLDPRVAERSSSLAA
                     AVPGGNGGHAQQANSSPRTNETSVSFSMVTSAPGLNAATTQSSCVAPTSSSGNHVASF
                     EHGPRGRVNEPCRASASSVNVNKNVSVGLSAADSGHHHHRHRKHRSTSRKLTSERRSS
                     KVPWHAPSHNVSGGTLEAGADVPSLAGASFSLANNNVSAAPMNSSANFARYDPSVLFA
                     GPSGATTTEAAVAMAAAAAVESPAVPLPLPSPALFPFLVEQDLDPLRAARVDHPTLAA
                     EEEGIFVFSVWRLDPAVFRVESTHSMMEELIVKADPEHVRFTNLRSSRSINDARVIQL
                     FKLSGKVRRQLARKVVELQCNAVLGYVEEFDMEPNGIIVRAYGTPCVVSRVKYVDQRE
                     MEALLRGKSRYIRSSMMAAYQGEFPSASMAAAPPRSHSPALPPYGLSPILSNGGVDGN
                     AGGTSTPATPSGPTQSADLIALSNTMAALPLPLPTPNASSTPMTAHDHLPPPMSACTL
                     RLGTSAQQQQQSGQAVAAASWASTPLSSKEAVAPTAVQSPRSTPETYVSAMATGDEVD
                     GSGVPLLSLDNGGGGAGLGAAAQASALAGAQSANSTTRHHSQTALTLATSAQRLSPPF
                     SRSFVASSVDATIPMLPDALVQQQQPSHANLMMRSGPTDTAVATVAATPATAPPMTNA
                     LIAASGAAAGGGPPARVIISMLTVKDLPAGSIHHIGGYICARSVKIVSRVKSRQIISQ
                     ERDAWWMELREELRANARAFHCNTVLGYEEETQYHEDVVLLSLYGTAVMLDMSAASLR
                     AGPEHLFSWQKQRLASKRNCALLHLYEGSRRKGGLGFLAGEVGDLLMHYVCSICHNKP
                     VPDVLLAACTLPVELNCEAPPRLVQVAVSKPKANVKGVELAMAVSQALPFIEFALHKQ
                     LLFNLRLQQLNACFSLRVSIVVGHDAIIGMLTGSGCRLAGLPVPRLPRVTVVDQQIAH
                     KESVVKLRDVIASRRRRRNTAHSSSSRSTSSSSSSSSCSSRPAAAAQSSAMPGADGAV
                     PAPAVAAAGLRGGGSRDDVRGIGSAGTKASSAALTVRSLSTSSTSHTDSSSSSSFKRC
                     KRYRRRRRRHRARGKRGRGNRGSSSPSRGPSRSPSETEALPSTTSGIESLHSSQSREA
                     AAAPAQKRRRHRRTRHASTCAPAVAVAGAAAAGASRRAGATPGSPSRGATLPKSRSPS
                     PSAVTSSSRPYSSSHSSSSSSSTSSRTLSTSPSKASLHSWVLTESSVTDEDVYAPADE
                     WRTTSGGVRTKARDYVVKIDDVEEADMMLGMVDATNFEDGVLLTLPYVPDSANAFDWQ
                     KRIVLYRRYSRASTLPVGGGGGTGAAALMGSVNTSGGLSSYGVTRSRSVLGASVMGSS
                     GAYQNCSDPASAAASGGDGMSAGGGGAAAGRMALTTRLLNEYCADAKRAFVHRACRMA
                     MRTGQPLRLCVVNLRVEMMFVPNSADLQLRLEGCVMVASSAGAQQLRQLEDRAFRVCM
                     HYTMESLSGLRQYQQQQQQQYPSQATQSNHGGASAAGQRPAGATPIMTANAVASGKAT
                     PYLRWKPNTPVLSPLMVDAASNNIVTTSLGGPAVAAAAAMQTASSQNPALPSMPQPLA
                     AYTANSMCSMLAMSSVLATVDSGPAYIDARRLFTTSNAPFTMPYVQDITVPPPRVWSG
                     VATAVSEDTAAPVRHTSTYAEYRDSRGSRTNSLTRRWNAFVRATGQSIKSLVDRATGG
                     GTGDRRMQQQQRQWLSSSTVSDASVRAGEENSRSLMSVGGTASNPSSMTAAARDANYC
                     NPAARLPKDISQLQMFIPVVLFTPLDYVAGRSIVRYLGRLSQHFIREDYDTDTGDGLN
                     MFFQRAETEIVCVVQALVRLMGGNALLKHRIVYHEICDSDGSGRAFLFATVTGDVVQV
                     SDTVYWGKHAQPQRQQKDGSARTNEKEVATGDFSDDSDSDGAGSRKE"
     gene            complement(<256468..>258126)
                     /locus_tag="LMJF_13_0770"
                     /db_xref="GeneID:5650106"
     mRNA            complement(<256468..>258126)
                     /locus_tag="LMJF_13_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681769.1"
                     /db_xref="GeneID:5650106"
     CDS             complement(256468..258126)
                     /locus_tag="LMJF_13_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650106"
                     /db_xref="GOA:Q4QG77"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QG77"
                     /translation="MFCRDTLCDTTPAVTDFLNGLSAVASKSPCSGDGALSDGHNAQS
                     RMPVMGHVFLTGLLCVSRLARKRQLLLKRLKQSALPPRASATPSMEDVAVQSPSAAAD
                     AGDTVFVRLVLSLLGHTLMKQATTAPCAASPGDNASPQAAPLPWWPATSAPSENAEDV
                     VYDVQCVGNEDDHAGDNVGFSEEHAPGVGHMLFTASTSVHCRIVLRSHPVAIFSPAMM
                     SELALDAEQRASVASRTWCHGGAPGTDSSEAVDAEADAGSCVARALEVFDACVRDHEE
                     ACLRQIAEIVGSLQRLLEKPATEVQSPGGLASTGSPSDSANASASRLGGCASPLHEWT
                     IDVPIYGVVLYIEDTHATRLERVRRLTTPLLQAATGCGNAAGGPLGPVTQVLSKLHTW
                     CAAWTAASSTSSTSPGASSCTPGIRTITLMHVTELRQLVDSHLKNSQTAAARLPGPAN
                     PATVGYDVSQALAAPACVVHCQLGVSRSPSVVMLFYMDVLAPQLRAAASAAEAPLNIF
                     HGLLNALVQARHRVRPNVCFSAQLLSLWRRLMQLDTPASPTRVV"
     gene            complement(<259441..>261141)
                     /locus_tag="LMJF_13_0780"
                     /db_xref="GeneID:5650107"
     mRNA            complement(<259441..>261141)
                     /locus_tag="LMJF_13_0780"
                     /product="putative protein kinase"
                     /transcript_id="XM_001681770.1"
                     /db_xref="GeneID:5650107"
     CDS             complement(259441..261141)
                     /locus_tag="LMJF_13_0780"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001681822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650107"
                     /db_xref="GOA:Q4QG76"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QG76"
                     /translation="MAQPLPLSTILRHPLASKRCMMIFHQNGEETMELFELLSRYEAV
                     GPIGQGSYGYVCSARDNDLVERFQAKPPEEYEDASLTLEEREEVYDTNTLVAIKKLRQ
                     LFENNQPRMWLCATREIQLMMAFQHDNVMSATDFFIPLGGVEMMTYDSILQLQHTFDG
                     VYVVMKKMDYTLREVLDSTIVTAAELAPGYETWLRRVKLLMANCGKVNADVRSTSSPV
                     PASCLNAQAGAQGEDQATAALHNSTEQSRSGGRVDVGDEAGAPVCCPLTTVALHSLTR
                     DYRKFILYQIFRGVGYLHLCPVIHRDLKPENIMLDRSYGTRITDFGQGRDVGLNATTD
                     YVQTVLDNCTQWYAAPETLTVAINSPMGFIDHDSFHGVDVWSIGCIAAEMLIGRPLFY
                     TTSMGGKSQLLSIFRVLGEPSASAIESIAEYRDKETRELFMNSIKKLVKNAPPSNTIT
                     PPLAEFLRSPYGDEDEDEVGLIIDCLRWDPRERITIQAALQNPFFTKDGYDPVIDPED
                     TAKRVPSVRPEDISEPVSGRAFLWNLFLERHPEVKELWNSLVAKHEEELKVKKAAGNT
                     "
     gene            complement(<261866..>263947)
                     /locus_tag="LMJF_13_0790"
                     /db_xref="GeneID:5650108"
     mRNA            complement(<261866..>263947)
                     /locus_tag="LMJF_13_0790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681771.1"
                     /db_xref="GeneID:5650108"
     CDS             complement(261866..263947)
                     /locus_tag="LMJF_13_0790"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650108"
                     /db_xref="UniProtKB/TrEMBL:Q4QG75"
                     /translation="MTQCFKCKQAIGTVVSRDGPTKLYCPDCFLAYCAGAVRENAFQQ
                     CRVPSDTPLAVAVSGGPNSMMLLRELGQLRYKTRDQIRRQHLTPQRQAPAQGGKSRST
                     PTSSPPARSTPLASSLILLPFHLCEDELVLPLPPPLSSSTSSPSSLHAISGRHEAVNR
                     VRSAMEEQFATLRKYVQQQPPRWVYHGEVPCGHKRTKKQQNNPTAAERTGAAHAGGAN
                     IATPELSHRGGGSTSAPSPQPRPQRQAGESGETAAATARLFDDSEIRLFRYSDLLSGT
                     YLSELRYALHVSRLSLSDREALYARVRQQTLCRAAQRVCQEHRQRNAAAAAATAVVVG
                     GVAHEEGIREDAAQCSEEQAPFDEHVSLEGTNSKTRSHLLLGSNAVRCATAALEALVT
                     GAGGEGVVHGAGFRGFTHEVVCLRPLRAMLPKETIMYTRLCGIAGSYTPALCTGTATR
                     SVHRTLEQFVLTMMTSYRTMIFNVLNTVQRLEVHPAAMQELLRGIDDASACHTHVHGE
                     GLAEAGSTQSAGKTTRKALPARTAQLNRTDMCLAAPLHVRRDLGGVNVNEADIDSVIA
                     MCCVCGCPASITSCYRGQNANTAVRQLEMLALNTTSAMTPRTSGASPSTVADAASASE
                     ASPTTTGCFLCYACQGLADAWPPSVFGRDSTTENDEQPGNDSTTAAGAAARHGAIAST
                     AALFRLCALFY"
     gene            complement(<264699..>265376)
                     /locus_tag="LMJF_13_0800"
                     /db_xref="GeneID:5650109"
     mRNA            complement(<264699..>265376)
                     /locus_tag="LMJF_13_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681772.1"
                     /db_xref="GeneID:5650109"
     CDS             complement(264699..265376)
                     /locus_tag="LMJF_13_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650109"
                     /db_xref="UniProtKB/TrEMBL:Q4QG74"
                     /translation="MLRRTGCCLALFSSSGGSAPRSKRPHSSSGADASAPEASAAAAG
                     VYLPWTARPWAVTYRVHYSQWKFVDTVFAHLATVTPAVLNDRAEEQGVRDVLCELEEP
                     VVALRRQQARQARQLKKQEKASAASATSSPSQLRASALQHTATTPPASPSGTAPSDMA
                     ADDAAAPETACTLESLANGADVPATQEAVDSSTTLLDASKKLKGSRKSKRATRKSATS
                     AVVIYEL"
     gene            complement(<267966..>275942)
                     /locus_tag="LMJF_13_0810"
                     /db_xref="GeneID:5650110"
     mRNA            complement(<267966..>275942)
                     /locus_tag="LMJF_13_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681773.1"
                     /db_xref="GeneID:5650110"
     CDS             complement(267966..275942)
                     /locus_tag="LMJF_13_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650110"
                     /db_xref="UniProtKB/TrEMBL:Q4QG73"
                     /translation="MKRNGHAASPTPRSFVELKPARSAASKHRSSSVTVCGKEGSPTL
                     PLVLDTDGIRGDNLLHDSDQTPCDAAAAGSSIVANSTPRVTKSSPTYPRHEQQPLLLP
                     HGQGRGNSGVSGKSQEPPICFFESPARAGDGAQRTLQHHTTASDNDDARYPQAEISAS
                     SPHSNTGVPASVLSPSAAAVAAGARAAGAAVPFLFSLKLPSATVTHLGVGRANGTGVG
                     QSFDSLSESVNSACGGSLLHGRNRIIGMGEAAAGSGPSSPLKVEETTGAGVDSEHRSH
                     HHRRQRGPGEANANVTVTTPFLRDVEPLPASEACTRNRLPSGTHIRRRPRSVVRQHTG
                     AAGTASVSNGTPSAMLLGDVESASSTYGPLDGSVSGSNALATSYMRQRGAAAAFVGGS
                     ASRGGAVNRVGTGRTRDVLPQGTRSGTVTGGAVAAGHRRRADPSPAPSRPPRSRRTRA
                     GASSSTFAGSSSNAAVGGTTFSPSSPTQLGWRAGYQPSIAIQAPKRMLSEQSSPGAPS
                     PLNFSLERGSFFLAGDKDSLAASSNATANHQHPITSSYASNRSDRSGAHSTGTHVAAA
                     STKPPSGRRQGSLARVLAPVQHSASASHVEEHGASSPLQDYAKLATTYMKLCAEVGDE
                     PNMDWVAGLSLMKGGERQHDVQPPPTTLGTTDAKECSTNHSQRVPSALNGSLAVSGHF
                     LRSGPQQQQQHTPRGGVRPRIVTGAATSSLFATTTAVEIPAPPRTSSVSQRASTPAGR
                     RTKSPAARRGASSASSPSTVPMRSGSVGRITSVNRPSIFGSSTQQLQHTATGGEDTPH
                     AQGGNAAAFASTAVGVEAAAMADVYSQQVAKYCAARLQPFADNMKSVQEQRAAVTLAL
                     QSFVRVAHASLSASAAAANASASTEKSGGEEAGRRSVVSVRGQLHGGHSNRGLGSGKG
                     GAMTSTTNSSTSTTPRKPSISRNSTASSLANTATTATAGHMSRRASAAAAAAARAASL
                     SDALQTLQAAVVTLLSTLSDGVALAQVPANNVVSPVKSVGGGSASLGSQAALMASGTI
                     TNDTPCAVVCPDESTSGRFDKATPPAAQAGSPVLASSVGMAENLFPPPALTFPNAGSM
                     HASQSQSSAVGPSTTAAAAVRVDPAVSTSAAPPRFVEFLRAQRREVAAQLDELCGVVR
                     HALGSPVTAPEAAIAQRPTVSSAGGTAATRLVWLEASNMLNTPFFVPPKCLSSLAIDM
                     AGRSSDDAAAEKDAAVITDVEAIVTSPTLGAALKSSNAFVFPKSASSATGNKLKSSKL
                     SSSSGGGSVTGRSSVSSTPRARANGMVMPYSPLFTFTMAADDDEVGDGSVEEDLQGRS
                     TSARSTEGTAGNACASVEWYLLRCVQPSAAAAGAVAYSPRLGAEREHTSSRQNSTFNW
                     STTELSSSLGSAHGGGAATVNVRTKRTIGKTGGKRSTSVGTGKSGRTGGGGIYQSRPA
                     LCTSQKAPSTSKPAGPSKPRKKLSTASPAQQGPAQQEKNEHLQLQRQLVKAWTLWTAL
                     QPLAAGRDDVADAGAEEPLSYLLPPSSASASVNAPAVVGGSLCDGTPAEETDASTPPM
                     MSAPTAAASPVAVTASPTRKEESPESEDGPISACQLPLVADDEEAVAGGNPLQSPPPP
                     PPPGTLHPLSSHSDGGHLRFEEHKEDDDVPYRECSSVPVRVAGSMPSLSSLQGVPRRL
                     NMDDTALLTHSDGDSNHALSAKSSPATFLYSSTEMPQRTAPSQSLASCVDDASSTSAS
                     AIASARAAATDTHMAAVCRISMWWAVLCCHRHAVAQRRTAHLLENAAQREKVLAARRN
                     ALVRSWVCRWRLRRYMAARKHQQQALASVAPTAAEATEEDNSEKTRRTVAGKDKAAAS
                     TTTTAVSASRERFQRAKEQRKAALASAAAVTSSTARLPSSSSISSSSGGSGGGANGAA
                     SSTPIRIPSLPLAASGVSTFAIRDYHGESSSFTVSAMHRLLDAPPSLLYATCMVALRY
                     PTNAPMAYLDNSGGGSAANQCLNASEERQKSEAPPAMDERYGGMAASDQLERWRRSWQ
                     TMRGSSVTCPLSGNDCNDDDRAGGPLTAQQRRWIETGLLYIRFRHLRHYVCGKYEALI
                     PASGGRGLVDEVLSSSSGRYGPFSLDATLNSATRSYHSSASAAGKTVLPVPLTMRYES
                     IVDPNELQHAKPVVKPFHRPFEEWGMAYNLTSRVFCAAAIYAWQLIFSHTPFDDAKQR
                     ELPTREEQQARLERVDDRNGIILDCYGVRSEREWLREATKDLSFVGQVYLPNYDRDDP
                     EQQRESRDNYDFVKNFLFQCFPSINKLIDIPDYLVGAGLFFVLKEVFHYTKDSPSTKR
                     MHEVLPRLVVVEGQDHIAAVTPATSALAGDGAAAAREDSSTAAAVALDLPARDATQLS
                     PVPPREVTHDGDGVKGLSGWQRAALQRYEQLRQLHHLSYGILAQEKTAVAVGSGAGAG
                     GSQDKATRSKQYQQQRRSRSPVAWTTSIGGAAKDSAKAAGGSGDDGSDSANTTSTKTA
                     LDDATLPLRRCMANGPAGSLTPMRATPGSAALGSSVFTSPAALHDGILEKSKSGAGER
                     RASSSAIAVPARDASVQLVRVPHRLLRPSAADVQFVRDFEEEVSKSIHGIIRAWNGNS
                     GGTSLDLSDVRAALTAGAALHDALDIAYPRHFLVKLSETLSFQLFGLQLSLGNCEDLD
                     SMGH"
     gene            complement(<278551..>279309)
                     /locus_tag="LMJF_13_0820"
                     /db_xref="GeneID:5650111"
     mRNA            complement(<278551..>279309)
                     /locus_tag="LMJF_13_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681774.1"
                     /db_xref="GeneID:5650111"
     CDS             complement(278551..279309)
                     /locus_tag="LMJF_13_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650111"
                     /db_xref="GOA:Q4QG72"
                     /db_xref="InterPro:IPR008381"
                     /db_xref="UniProtKB/TrEMBL:Q4QG72"
                     /translation="MGVDVGESAIGVDAVARPIGYGPFSAAAKARLAREKAHKAVETC
                     DSAAAAASATVMKNVSLDTNLYLRLSLAGLPHPSQLQEWAYTSPEWRLAFVRLYRTIL
                     RLHNKAVAVSLRTARRQGSEAALSAATGMRATSQTTVAGAAVAATGADNSLAEDKDDY
                     FLRYLLTPDQQEFGNRFVQEEFARHTDADAVAASIFYASWYEYVLQLASGVTAREMTE
                     KEKRILTDEQKETLNSLRSAFLDLRSSQRPKYMP"
     gene            complement(<280349..>284059)
                     /locus_tag="LMJF_13_0830"
                     /db_xref="GeneID:5650112"
     mRNA            complement(<280349..>284059)
                     /locus_tag="LMJF_13_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681775.1"
                     /db_xref="GeneID:5650112"
     CDS             complement(280349..284059)
                     /locus_tag="LMJF_13_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650112"
                     /db_xref="UniProtKB/TrEMBL:Q4QG71"
                     /translation="MSRTFEDNGCELPSSAAQRVYVNNMNTLQATTSLPERTPYSLLE
                     RNTEAPGSSTANYVGSRLEPISSPRGGRGRHGAAGGLQQSRPTQRAFAASGSPVEQQR
                     GAEPLTANGEVVHANLQGVYNRIMRRLQRQLNYAEVSRASLAEQYGVDLQMACEGDQQ
                     VLTAADTAPQRSTRYRCRTSPSRQPTSTPSSPIHPVPGESEANTVRRPNPRLFTGCHV
                     STNTTKVPEYDSTGPRGEAPISTRACGRSSSRLIQFKVDASSRTSGAVGGIAAPAAMG
                     MSDASGAAAPAAEEESRLERDIAAQPCPLPLRLVIQHVLDTLQKKMSLAEGGSLKDCI
                     VFSFESRALLDRLLKEIPLYSQYSASQDTATVAGAAQQDMALVYQKLRQKPVLLPRAG
                     YVEDPVTGAIHGQILGGGAAQSESVRALAAAATPTAAVSLPAIVNASRSFNPGGAAPP
                     GAFTVGTGAMSDVQLPSGYGKSSRLNDATLQGGAAAGYGDPQHQHQLLRDHMRGGSGA
                     DGGSSTSISDAVSAQNSVTAMMESAVASVAPPPAFEAAHRATRLVSVGTVTEENNLTT
                     VPKADYAALQQRLEALEVQLADAQMHRSALADHLCEELQYTEKKKRVLQYLRETLVRE
                     CTMLRSQLRLASGRVQLLQQQQHSPPQSLRGVMVSSGANDAHNEGPNASVFGGTTRMY
                     KQLGASTLSPTTLSLSADVHGQQHRQYLQRPLTHRMSFSESIGSVYGGTSGCGRGRLA
                     TMQRHASGGCTSLGASLSAAPPGVGVPAAGVSSLAVVGSCVATGVTADRQQPNDLEAV
                     QSLLDLVLLAVEEDVVLPSHKLQMVRSAQADIEAVKNSFSKDEKRQLDELRNKYNERQ
                     YAVKKNMIMRTAEHNYLIEEQKHEVQRLQALTDTTRVRAILQQHVSDLRTELQQMRMY
                     ITEQIHFFKTVMQNTAQSLLRRSVLADKTLSENLILTNVVSASREMVESAGALLMPML
                     TNEYRCGYHPWPLKLRNTTDPLAHIIHLRYGAGEVIRLRDSLNVFAQLYGALHRYISR
                     QIVLPDSTRPSAGKPLQHLCAALALNPMSHTEVVFAVRHAYDTEMQLCKRLARYNLRL
                     MWNAYLQRVYTNRSVAALAEAFLNPRLAALPIAGRINVLAKERAALLQERVKVQRERA
                     ENAKSTYRLWQEKEIDIMEGYPTPQTQRNRLALLTGDAAGGSNAMGVDVGGNALGGTM
                     QGHSNMATMGRSSRALGRATTDRSEGAGAVAI"
     gene            complement(<284901..>288107)
                     /locus_tag="LMJF_13_0840"
                     /db_xref="GeneID:5650113"
     mRNA            complement(<284901..>288107)
                     /locus_tag="LMJF_13_0840"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681776.1"
                     /db_xref="GeneID:5650113"
     CDS             complement(284901..288107)
                     /locus_tag="LMJF_13_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650113"
                     /db_xref="UniProtKB/TrEMBL:Q4QG70"
                     /translation="MDACGWRAPGRRSKPFSRGNSRAPSYTQDGERARRDGRATSSAS
                     ADAAASALRQQCETTRFLARLLAGLTLQWREVMTDLTEAEVPFNISDAAAAAAASKLG
                     ERALIEHHHHHRRRSFSPLQPRCRCCSGSAVAKSASKSYLTEERRFGVQAREAERALL
                     RCREQRRAPSASLSDPCEGRSRHCVSGADASTLMRCLNGADEKGGGALRTDGRLCSTA
                     TNWHCLTPATQWIPYLLKDDAAVPHGTSTGDRRDLCESSLLYASPHRPRQYSNARMEQ
                     DGRDGEGVYVGSDMGADAQLRRAVLEGAARSVEVIILGMRQVCEVLSATAVTTVSNSD
                     TDGSGRRRFHRGSHRSSSRTGPLSARSDSASRARSAEANQVSAHRRRRKSHEAHTQQS
                     SGVAPPSIFITSAASPSRSQRRSQCAGDTPFATASAPAAVGSVLVCPAPPASERVYIY
                     PRADRSATVLSPLRHRPYSAMTADVSATAPLSQWNRKLGWRATGATVPVGVKTGVAPA
                     TKSAASMDALSSLSDPSSAPTSPAQPTALQTASPTTRSRLPPSPLPSSVAAVIVRRTS
                     QVRWAALAHEEGEARLRIVMAHGCRLMRVLRDHYERLRELEWESRRHSLATKIGALAG
                     EQGAETVRAPAPRTAARVSTRASDTDDVADPVNSPYLTPSLSFPSVSTVPAHTETSSD
                     VVMSPAAQIPPARNGGRDDEREGTPTAAQPSASTTAAAMVIVNTCTPSSPPQRQQPVW
                     EMSSATHSRAIAARYSAAASHASRLPARRRPASHLPPVVLHDSSVAGAVTTSSAAADA
                     PKAPASVLASASHPSAEQWELRSSPHVRPSALLQQLRNAAAVVDEEEKYAERTPSMAR
                     HAHKHPTGGSSCPLLSPLEESAEEAIAPNASSDFDSRTTAASTSDKQNVSCSADSSSS
                     SVTYIVEENAERHVPSSTTKIAVGFMATAGDRAHLAAASRGPPPPPRVGANEAHLGNV
                     EDDAPPSPRSDGAAPQNLAIAVELFPVGDTDASTACAPLSRKQLIFSPSPLPSVPNMN
                     DVGNANMTTVDVFEVATVTDEADAASFSSVGSFHENGV"
     gene            complement(<290110..>292887)
                     /locus_tag="LMJF_13_0850"
                     /db_xref="GeneID:5650114"
     mRNA            complement(<290110..>292887)
                     /locus_tag="LMJF_13_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681777.1"
                     /db_xref="GeneID:5650114"
     CDS             complement(290110..292887)
                     /locus_tag="LMJF_13_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650114"
                     /db_xref="UniProtKB/TrEMBL:Q4QG69"
                     /translation="MSSDDGLRKTEQVEVPPDVDTDFDIYAAPAEEAQAVEEQEPADA
                     DIYAAPAEEAQAVEEQEPADADIYAAPAEEAQAVEEQEPADADIYAAPAEEAQAVEEQ
                     EPADADIYAAPAEEAQAVEEQEPADADIYAAPAEEAQAVEEQEPADADIYAAPAEEAQ
                     AVEEQEPAEDGVDAAEDGAGSTPMLQARAETSDSPHAAAPVEEVGNTSEHEDAAMTQD
                     GKLPAELLDSKKDEHGSVDAVAGADTAATHSSITTDDGVQVDAKVENASDRAGLGVDN
                     NEGEKGMDRSDQAVEDSAAPIPAAVAIPPPDASARVEMAVPPAAGTDLDKQDRASSPE
                     TTAGLMKPSPPPHDLPRRQPQQQVCQPQSQQQQQPAVVLHCSGTTLTPSMSPHATTGG
                     VDGVYDLPEAERIAMASALLTPSTALVVFRRGHENSHVNRMDRGSYSRYLLSTDHVSP
                     LVLEETFHGTKSTVGAVPRNTLTRFSRGNVSDPYVDDSIAPRTASERKQSPGAAASAA
                     SSARRSYQPPRSVFSASRQTMSDSFGGTAASSTNLRREIDMLGDAHLPEVNTLRQQRR
                     RDPRHGKSTAEQHDYIYYNHRSKGFYVPHDPPADTLMLQYNHLYGFGDGTRFAPVAPP
                     PSRESGSAGALAGMTVHRGNPHAAPPRTFAETRGCAFPFTASQRQHTYGGTAYRRSRI
                     TASTRAMSSSSGHENQPQRAETQKGSSSLRTAKAVDLGQLHCTQRSRQRTIEEVMADQ
                     PQRYLCGAEGVRGALVQDIERDIEDGKLQWEEVPPAMQKAMVSATTTAAAAAQRKQPT
                     PLVNVPASSTLSASGRRPNRVESLAMAPSALENVMGQLRAVPAITAASGGEPGARGGA
                     AAKIMSTAPPSPAADAARATSPEPVTGSAASTSRRITVGSVAAAASLPAISRLNYTPQ
                     PTKRSNPSAFV"
     gene            complement(<294197..>295534)
                     /locus_tag="LMJF_13_0860"
                     /db_xref="GeneID:5650115"
     mRNA            complement(<294197..>295534)
                     /locus_tag="LMJF_13_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681778.1"
                     /db_xref="GeneID:5650115"
     CDS             complement(294197..295534)
                     /locus_tag="LMJF_13_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650115"
                     /db_xref="UniProtKB/TrEMBL:Q4QG68"
                     /translation="MFFFDLCTRPLCCPDRPPSPPLVPLCGAMVSRVTPFIVFLNIIH
                     SPSLSHDGDAAHTQARPATRVRIHVNEYELKETHPHPAHKHLRVLRARHSTLVYCATM
                     AQPSGDEAITSKSFSGTAKGATPHETISIAFTHSQYATPCHDHTVPGSTPGHRLRRLG
                     RRHQPADILRNHLSHALVAHSSVVTTAKSSGGYYHYCCSDPWEGNADHPAPLGGNYVL
                     HTKNGGKRHFDEPTGFLSEPVWHPSKRVILPPQEHERPPATQRRGRGVYNTTDGWIHP
                     DAEEAQARREEEAVRQHSRGGKAQVARPPDHTLEELSMWVRTGKGSGVGAAGPSSEAE
                     EAAATAAANGREGKRHLLPHHKTNTPMVSAVAPLTGPPPPKVLADYNDSQVLPAIGQG
                     VSMQRCTAAEADALAQRQREKRVQHLLQTMKAVAAESETRAADIQAVRELPNW"
     gene            complement(<296601..>298187)
                     /locus_tag="LMJF_13_0870"
                     /db_xref="GeneID:5650116"
     mRNA            complement(<296601..>298187)
                     /locus_tag="LMJF_13_0870"
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /transcript_id="XM_001681779.1"
                     /db_xref="GeneID:5650116"
     CDS             complement(296601..298187)
                     /locus_tag="LMJF_13_0870"
                     /EC_number="3.4.24.64"
                     /EC_number="3.4.24.6"
                     /codon_start=1
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /protein_id="XP_001681831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650116"
                     /db_xref="GOA:Q4QG67"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q4QG67"
                     /translation="MLRRVVAPAPVSATAACAGQARSIYEYKFGQTPLTQPFGGTSRL
                     PPGPSSNPAPVAPGKVEITKLHNGARVITHNLGGPSVSVGAYILAGPAYDPPSAPGAG
                     AMMHLALTTSNYNNSLFQLDRNIRSVGAAQSHFEKHKHYIGIRIDARADKWKSAASTS
                     SFSQRRQLQNQKQAEQQFSLNLVQDNIFTCIAAPRFHEPDVERFRDTIDNQVEELRWQ
                     CPAEYAKQMLETVAFYREPLGNPRFVPAMSNSIISSSVLLEQYSRYIVPSRVVVAGVN
                     VDHAALIAEYENTPFPHSASAPHHARAQPCVVNWKDEASQYTGGERHDHEDRPKVMGT
                     KPDMDPESIIAVGWLAYGKDRKMVKDHAASMVVGALMDIGFSGCMRCGAPDEMHEHTG
                     LRAFYNPYQTAGLIGFTAKAEPQAAVRMVTDAVKMVRASQASVADSMLSVAKKMAKTQ
                     FMVQTVDTIRDYCDYLGTCLAVDSDSTLATSVEEVVDAINSVNAADVKRVYEKMFSNK
                     TSLYGHGEMLGFPSMRQMGL"
     gene            complement(<302319..>304415)
                     /locus_tag="LMJF_13_0880"
                     /db_xref="GeneID:5650117"
     mRNA            complement(<302319..>304415)
                     /locus_tag="LMJF_13_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681780.1"
                     /db_xref="GeneID:5650117"
     CDS             complement(302319..304415)
                     /locus_tag="LMJF_13_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650117"
                     /db_xref="GOA:Q4QG66"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:Q4QG66"
                     /translation="MSGQIFLYISNGRTLWVPRHTASPTETKPVCMLNYVTPMELSRS
                     FYLFDYAVQVVENAQMAAMNPNAKTPNEVLAAVNDFRRVCAEDQNFLLQRCYNSPAQH
                     QQQQQQQPQQQPQQQQQQQQPQQVNAYPTPYSSTPAQQQQLMMSSATASGYGGGSNNA
                     GATGGMDSAALLTQLLQQQRQQSRMISCGNTSGQGYQDNGAGGAYGYNTNDGRNYYGG
                     DRGRGDRRMHGNAYGNNMGYSQNMMMQGGMPRPQQPMMMGYNSMNPYGMDQIMMYGGG
                     PGQMYPNARGGSGRRSNNYGDPMMMMAQQPGMYGSRRGMGSHSQSQQQSRMGATVRNE
                     PEPINLDGVTVPEEIKTVYMNPAQQLVIATMPGPHMTVWLREHPFPTDLQDKKFVFGK
                     KGICLMLKASFEEVKGSKPVELFPKQICTHFFIYGYCSRPNCFHEHHNEDQLRELIAA
                     RHVQLKAMTKAQRHQLIDEIEQKEKDGLAAAAAHREEREKKRAEAAAEREARRQQRQQ
                     QLSQQGQMYTSSSAPNTQPNPSQDIGSDNEDDDATTQGGAGSSQQQPSANASLANMMA
                     NSPSQDHQAVSAGAGEATAEASKTPAKSDVAAKLGITDSDDGDDNDGSSSSASGSSST
                     SNTKAKADVVEASAADEDEGDAEEEHDDAEDEEQQEEEEEEDAKVKKSKAKKPAPKKR
                     GRAAVPKKPTKRAKKQ"
     gene            complement(<305384..>306418)
                     /locus_tag="LMJF_13_0890"
                     /db_xref="GeneID:5650118"
     mRNA            complement(<305384..>306418)
                     /locus_tag="LMJF_13_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681781.1"
                     /db_xref="GeneID:5650118"
     CDS             complement(305384..306418)
                     /locus_tag="LMJF_13_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650118"
                     /db_xref="UniProtKB/TrEMBL:Q4QG65"
                     /translation="MFKQRDNEYHPPMTVDPSGGGVTTSAGVFGEVGMGNVASPFLDG
                     PAAVAGSRKRGRDIRSLDRFRAVVYGEDGFRRLHAMVARNPVLMYPPDGIEAARARVM
                     VRKAELQSQLRSALGHREHNRNPADNGDDDVFALFEARRRAESDVHPATEGEEVPRQP
                     ASEHAPLPSSLASIRQDEELATYHHKQLDSYLRLLYEFNHATFVKLPMEDTLRLLSRC
                     GKEAVAHIVEYETQVRLRRQSRIRDLNELRQEQAALEERRLAIDDAEQARLVQSAELR
                     QAELDLELDNGVVKAEPPDDGSADEDVKVILETSSSSVHFASLPAGDSPEENMDGIVM
                     AVEDEGIQYT"
     gene            complement(<307110..>308969)
                     /locus_tag="LMJF_13_0900"
                     /db_xref="GeneID:5650119"
     mRNA            complement(<307110..>308969)
                     /locus_tag="LMJF_13_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681782.1"
                     /db_xref="GeneID:5650119"
     CDS             complement(307110..308969)
                     /locus_tag="LMJF_13_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650119"
                     /db_xref="UniProtKB/TrEMBL:Q4QG64"
                     /translation="MPRNRSSGDDGGGGGKRGGRYAAVVEKGENAWKREWSSFMSGVN
                     LKRLRDGTSGVTLKASADIERQLVAREAAPSSSSVAGEHDNGNDVEVNADGIPLGAIA
                     SHASFSYLFSSPAERRAERDARERAEAERRQAHKRELMAKKDPLSVLSKHQRAMHNAE
                     QRGLQLDGMTRKERRSFLHLTVTEAQRKAEEQSREFKLHDLMDEKLAWYQQGPHPIDL
                     IAEKLVRRKAEKKGKQLGLKYNYLAPHPSWLAKRAQRRRESLLVGLGKRLIFLERVTG
                     EDKDDATTVPSSEVMVTDPLHHLTVPLSEMGRLLGQHGSASLSAAAAAAADADALVTA
                     AAGSSSGDDIEDVKGADEEGAQHLGGEVDRGHRGDVTAARKKAVSASSAASSAGGCSS
                     ASPGKRASGEAGDDGVGNDAAQMRLPDVVVLQDPSRIATSLVRTVARDRTTALAIQQI
                     NRTTNFLSSGLVKGPSLRPEDALPGNGLSPRGLGAAPAAAALTPSPKSSMVAASMQDS
                     AANSTKGAATTSRGASAAGRGRRRVRVADGEEEGGERRRHRRGADVSAGESQTKTSKP
                     TASPSPRPRGARPPPTHTHELRDITSRSGPSKSQGGQVSSSKTKRQRANSRYD"
     gene            complement(<310582..>313077)
                     /locus_tag="LMJF_13_0910"
                     /db_xref="GeneID:5650120"
     mRNA            complement(<310582..>313077)
                     /locus_tag="LMJF_13_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681783.1"
                     /db_xref="GeneID:5650120"
     CDS             complement(310582..313077)
                     /locus_tag="LMJF_13_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650120"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q4QG63"
                     /translation="MSMYEEDEPFDFGGRSGGVVHTGVASLDTIMQSLNKRYEVYQRR
                     RTAMTPFGSPGDPSILVPPASHSILDDSTIVSGASVNGGGGVSGGGGAAASQPHESPK
                     ESIVFPRAQPAPYWEERELYIVAEGLCCCLNGGINYRLLCEQYQRALEVLLTLVREDL
                     RLCVSSEMELVPGGMAKSFLAKFKALLQESRRMLGEAGVNISPRLETVIEQLPNGSSI
                     ISGSGGASHASLNAGHNTAAAASSNRGATTPAATSMAFCAGRTPNSSMMSNGRPTGTS
                     GGGESVFATPPTAANHSGNLPSLYAQLYHSVPPYRRPPSVGMRSVNAREGEVDGGIAA
                     AARRRPPMAPPSRPHLASPDNGYLQLGHPCGGSGDGLSRPQQQQQPAASSSSFGHFPS
                     AGACSSTPNLANIVDNPVEGRGSAGGESVSGVDVRSSHEDGGSIKRGGVGCLNSWFSG
                     AALTPRTSGKASPITPAGRPLQRHAPPQLAPATVKQRTVTESTSPVPATPPSDGDVPG
                     VHGYSHTAVGDRIVGSSSAVKMQAELLAAEAIGEDANGTFAAPAPVHGRLRQLEALYG
                     EFYAMDGMALLIDALGVVFTREYDQGTARQPKHAFTAFQQDVNGKVMPVLQSRESLQL
                     CITDLQPLRSSYLASCLAHHVRPNNTVLDDLKNIDNDRSVETMHLEGLHLGDRGVVAF
                     AESVLPRLYRLRWLDLSNNDVNDSALEPLLRSIRYHPSLEHLNLSRNPLTDNALPFLL
                     RIARTLPRLSVLLLQSCAMKPATRQMVEAEVAVSGTCTVPVAAYRCSSQAPIRFSSVN
                     IAVKRATAASEPLPGPPSGLPRLAPPRGERRPR"
     gene            complement(<314878..>319449)
                     /locus_tag="LMJF_13_0920"
                     /db_xref="GeneID:5650121"
     mRNA            complement(<314878..>319449)
                     /locus_tag="LMJF_13_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681784.1"
                     /db_xref="GeneID:5650121"
     CDS             complement(314878..319449)
                     /locus_tag="LMJF_13_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650121"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q4QG62"
                     /translation="MPRQLPTLLQEQQARSSPLHVASVMSSTAGRDSTVSFRKESRAS
                     VSAASIASARRALLSPCAGIPALVPSPRQRPQHRGNGAAAGPSKEAAPVSRVLVPAVE
                     AVAAATATSFIPLGTALTRNSVAATAAAPSSHLEYVGLGPSLARDSYLPPVQGSHAHD
                     SEGAAADVLALQAATTGLFVRHIRLSSLPDAAQDDADGDDTGTAVPRGGDSGDAASPI
                     ASPTLVGTVPVKSAALLETGVDDRINPFVLNQLIQRSHRRARSMAAAAGRRSAHRIGQ
                     LQDRIRKPTFLKTTAASPRLGGGATDIAVDSAAAELRYHELPAIQEASEACYTAAPGN
                     GDTGGGTTSTAATQPDTGTPAAAGTKQVFNLIAEYNNDLDAEETAQAAAPGMSFTEHV
                     HIAAAVSANDSALVRQLVGHYCARAEAVSPTRTSTRAAVVEAPTRANMRSHTTLKDKN
                     AKSASGATGGGADEGGAASSPFPFTSASPNFSLLDAVMCVSREFVAQRSAAGVPGQST
                     SALSERRRCLLERLTSLDRTRIPETWWVTSLQYLGRLAPATGTGSSTATSAVTAAKTQ
                     RASSVTASIFATPMTENCPSAPPMSSSNRAGRSGGIASPPPAEGDALAQLAGSGSEAG
                     TGVRNGLKKVAVMQAGPVSSGTLCGSEGQLVLGTVSPHNTIFPAPRPVERSQVYLLAE
                     VLDRMLRDPSHPQWLALLADPQVARYVLGDGDDIESDNGQRRGSGHDTLDADLWGTPG
                     EQRLFAYTDAATHVLEILDTGLAELVRQVASYCLERGALLDLLRQSTMDIASAHVHVL
                     RQVKRQAHADALAAQTLRREKARLQQELEAVQKALVELQSSHAELCARVEPLQHKSDR
                     LDELMARVAAKARRFETFRHDENAALLQVLKESMTQSAGAALDSFFKEMHDLQARHSG
                     LEEAATTQLNGVTGDAAGHSSGDGAASPKAAAAAAAAAEIPSVAAARSQALEQQQRME
                     QLYTESYRLLCGLQDMVTATNTLCGRLYDKMILADVSPTAKVATSRWASVARAVGAFE
                     RDKRHRQRVCEVFMEYCTSYRHKRAAHADLEAEREGSAASSGVSHGGWHTHSYGEAFL
                     VNDKETRCSESVEGSDDPLLAHGRPSALLSFTEEATSDEGPRRPNNSTTKGREDVDSD
                     QAAFAAGGAREQLQHEVVMTGAIITREDLEAMKATDCTVDEVNALFRKDFDMHKYLRG
                     SWQQYVLERQQQEQQGAVAVNTTTSGPGRKQTTVESTYMLRLPDVLQMLSDVQATLGE
                     VTVRMNATAKSAVLEAGLQPPLEPPSHPEQPCPLCSRRDTCELERHRRREAMSRIARD
                     LQRKMEAVEAKSRAAFTERDEALGEVRRLKMELQHSATVTPARGPTVIEVQQQQGMQP
                     ESQGHRQQRHTSSQWQTAADSTVTAPSIQHARAWNLGSETSSPHSSSSSAMTGVTGRS
                     ENSADMSTLILSQADKCTVPPIVGGTGVGASLSARQSHISFLGNARVDESFTTVSYEE
                     GDHVDHPSIPSKRRSTAEMPKNTTGDAPQ"
     gene            complement(<320275..>321102)
                     /locus_tag="LMJF_13_0930"
                     /db_xref="GeneID:5650122"
     mRNA            complement(<320275..>321102)
                     /locus_tag="LMJF_13_0930"
                     /product="glycosyltransferase family-like protein"
                     /transcript_id="XM_001681785.1"
                     /db_xref="GeneID:5650122"
     CDS             complement(320275..321102)
                     /locus_tag="LMJF_13_0930"
                     /codon_start=1
                     /product="glycosyltransferase family-like protein"
                     /protein_id="XP_001681837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650122"
                     /db_xref="GOA:Q4QG61"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="UniProtKB/TrEMBL:Q4QG61"
                     /translation="MLRACRRWHAIFDACYVLNLDRRPDRWAHVQQQVKRARLHKFLK
                     PGVEVTRVSGIDGRELDVAGLHRDGVLTDRGYQRYQLPTEQKLYGMDLTKGAIGCALS
                     HRAVWQRVVAEHRECALILEDDLEFHHQFSRQFAARWSRVPADWGIVHMGGLDLLASG
                     KAPRPYIADGIRLAYDGHRELTAYVVHAASAQRCLDLSLPMTWQVDTHISSCLADDAA
                     AHDKYIADPKMYVFQPSLVIQLMSFTTDVQKTPTDNPSLADAARRLREFVGGGTSVR"
     gene            complement(<321882..>324038)
                     /locus_tag="LMJF_13_0940"
                     /db_xref="GeneID:5650123"
     mRNA            complement(<321882..>324038)
                     /locus_tag="LMJF_13_0940"
                     /product="putative N(2), N(2)-dimethylguanosine tRNA
                     methyltransferase"
                     /transcript_id="XM_001681786.1"
                     /db_xref="GeneID:5650123"
     CDS             complement(321882..324038)
                     /locus_tag="LMJF_13_0940"
                     /codon_start=1
                     /product="putative N(2), N(2)-dimethylguanosine tRNA
                     methyltransferase"
                     /protein_id="XP_001681838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650123"
                     /db_xref="GOA:Q4QG60"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QG60"
                     /translation="MSVRSGQFNYDAVARESPVGFTKITEGTTAVLEPPPKKKTCTSS
                     AAPAPASNLSDEEADNQLVDQAVFYNPAQVVNRDLSISVIEVFSRLRLTEPRRRGGTN
                     EGITILEALSATGLRAIRYYKEITNVRYIIANDMDADAVDCIVRNCAYNGVPVQYPTL
                     MANMPAAAIELYAGEAEAEKGESATGASPRVGVRAGGAILPNLDDANDLMFRLAMNSN
                     AHPGKRVCLVDAPAETSATASLRPLLQQELMDVVDLDPYGSASPFLDGAFRCIKEGGL
                     MLVTSTDSAILCGNFADTAHAKYSSMPYKAAHCHEAAVRTLLACVERVANRHQKFIVP
                     LLSLHIDFYVRCFFRVYKQPAETKLSACKLGYQLQCSSCSAFWVRPMATARQPRPSRQ
                     ERRRQRRALAGRVNSDADEAEEEGKTAEGAAEASRAHARPRRLSKRVRDGSDDDEAVA
                     HDVDGVRTEVYPASPSRHSHPKITPLTLQQMPSAASATSTTAATACPVCGSSIVLSGP
                     LYAAPTQNCEFLQQLLALLHERASEGRLNAEARITGLVRIALEELPDCPLFYLLPDVA
                     SYVRVRCPPTPCIVGALARLGYRCSQVHCAAAGLKTDCPPEVLFRVMLQWKTVQDTLD
                     PVGEATIEDGADKSKKKAPAASTAPRSLLVTPLAEADFTYDKAHDFRGRVTGVAKFVP
                     NASGWGPRRRHRGAAAVPEAVECGNGEDNDGGSGEA"
     gene            complement(<324889..>326340)
                     /locus_tag="LMJF_13_0950"
                     /db_xref="GeneID:5650124"
     mRNA            complement(<324889..>326340)
                     /locus_tag="LMJF_13_0950"
                     /product="putative actin-like protein"
                     /transcript_id="XM_001681787.1"
                     /db_xref="GeneID:5650124"
     CDS             complement(324889..326340)
                     /locus_tag="LMJF_13_0950"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_001681839.1"
                     /db_xref="GeneID:5650124"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4QG59"
                     /translation="MDYNVSTAAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRS
                     IAMAAGMNEQEVGEEALLKQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPET
                     HCFLLTQPVNTPAAQRERTLEIMMETFHAHSLYLGTSQVLSLYSYGLTTGLVVDSGKD
                     VTHAVPIHEGYALVRHVTQSPVAGAALTRYLGGLLREQGYALGTATEQELLNGAKEDL
                     CYVRPRAHVQRGAVSDIYTPASGTSAGVSPAAASAASRRSTQLTGGIKGSADSASSAT
                     ATTAVTAKESFMESAAEKHLDVDGGLTPTAVMGATEDFLLPDGQRIPLAAERYDTAEV
                     LFNYSLLALMDSNGKDSSTYEPRCKVRTDMGDLFRPSFEKGISWLPFAAVNNCEAALR
                     PQLYANMVLAGGSTSFPGLKARLESEVRQLYRESHPSEAVVPIQVRDMPCRTYSTWLG
                     GSMLAQTAVFQHLVVSRKEYEEEGARVIHYKSL"
     gene            complement(<327191..>328888)
                     /locus_tag="LMJF_13_0960"
                     /db_xref="GeneID:5650125"
     mRNA            complement(<327191..>328888)
                     /locus_tag="LMJF_13_0960"
                     /product="putative serine peptidase, Clan SJ, family S16"
                     /transcript_id="XM_001681788.1"
                     /db_xref="GeneID:5650125"
     CDS             complement(327191..328888)
                     /locus_tag="LMJF_13_0960"
                     /codon_start=1
                     /product="putative serine peptidase, Clan SJ, family S16"
                     /protein_id="XP_001681840.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650125"
                     /db_xref="GOA:Q4QG58"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027497"
                     /db_xref="UniProtKB/TrEMBL:Q4QG58"
                     /translation="MRHLQPLSNTAAPAPGSSLAHMKTQQLAREEEEKLRARRVKGVI
                     VLVEQFLLEQGYHQTLHALQQESRISLTQFSAADNIDLLSVVQEYEEYYAFKCQRAPK
                     LYRVRGGSSDDADGVGGVGSESGERMLSRARKGAPAPRAATSSSSPPSLSSVGKPPPH
                     LRPTNLARALSHVQANGDSGSANGDKRAVALNGDTSALGLSLQGESAAAHTSAREGEK
                     GRRDNGRDGEGSDDAAEDPLGSLMSRRILKPLPPFPTSELSELAATILREILDVDPSV
                     RWRDIADLENAKHLLREAVVMPVKYPGLFQGILRPWKGILLFGPPGTGKTLLAKAVAT
                     ECRTTFFNIAASSVVSKWRGDSEKLVRMLFDLAVHYAPSTIFIDEIDSLMSARSSDGE
                     HEGSRRMKTELLTQMDGLSKRRGGEVVFVLAASNVPWDLDTAMLRRLEKRILVSLPTR
                     DARVLMFRRLLPNSFASDADYEACAALTEGMSGADIDVVCREAMMRPVRKLISQLEAA
                     GNDRNAHARLPSEPLRPPAATLEDVQASVACTRSSVRVADLDKYDVWTREHGSGLST"
     gene            complement(<329896..>331764)
                     /locus_tag="LMJF_13_0970"
                     /db_xref="GeneID:5650126"
     mRNA            complement(<329896..>331764)
                     /locus_tag="LMJF_13_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681789.1"
                     /db_xref="GeneID:5650126"
     CDS             complement(329896..331764)
                     /locus_tag="LMJF_13_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650126"
                     /db_xref="UniProtKB/TrEMBL:Q4QG57"
                     /translation="MAQIPSAMRPPSKASTSAVASLLPPCCQPIYQQRRCYASRSGEE
                     KGNADKGTQAAAAAVSTTPGTATAEAVRYFAANEQNADAAARAQGSVKQQEQLSAAAA
                     NGGDAATSGIRTIGIKLTEDDELVRAFNNFSKSVNGCTQEEFLIGAKQAYYSLAVVIS
                     AFLEHGQPLAGRTESTKMIAAAHEAAKLLDKEFKPESRCDAAATSLASKAEGDGTDDS
                     SSSSSKTKLQESLVRNVVSTIVSLIPVSRHLAESIFKIWLLHKVKQVNLSSIASPADY
                     VLDSKLVIFARLGKARMYFNSDNVGAEVDVTFSNDYLRKLDPASVAGSGAAGSSQMAD
                     AAGKVDEDDFDTGMIQVHTDTDANAHRTTAEEHTFVVNKATRTLTPTGSTAASTAAAA
                     AAASTDAARRSGGNSASAGAGGASAADSAKSSGTASRIQVTCVKTTDFLRKSASAATV
                     AATAVRDEAAAKTAAPNESSGEEEEEAHSVYIKVNGNMLPPIPASAHACALLTVDVVV
                     PPERYAYNFEWFYKRIVGYENEYERIAAARVFASNSPKPLASFLDFFMRMVTGKPVEF
                     MFSKAIGRMIGIPDDVSQTPPATRKLMCMYMDQSYKWVLADLVTLAPVMETKLPKA"
     gene            complement(<332811..>337778)
                     /locus_tag="LMJF_13_0980"
                     /db_xref="GeneID:5650127"
     mRNA            complement(<332811..>337778)
                     /locus_tag="LMJF_13_0980"
                     /product="putative AMP deaminase"
                     /transcript_id="XM_001681790.1"
                     /db_xref="GeneID:5650127"
     CDS             complement(332811..337778)
                     /locus_tag="LMJF_13_0980"
                     /codon_start=1
                     /product="putative AMP deaminase"
                     /protein_id="XP_001681842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650127"
                     /db_xref="GOA:Q4QG56"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:Q4QG56"
                     /translation="MMEQQWHDILLHNDAGDAAFHKGAPLLLEALQIIGDVQSISAAT
                     RLGLHLRDAEQNSEMDQLVSTFTDKHMYRERAAHATAAAPLLKALVDFFQVCTPVSEA
                     AAAVTPSLVAVPELDGLLVPSAVWRALSQTVAVPPQPQPHSAPPAEVATSPSSGDAVI
                     PLASELRSHPLFSYKAFLVRLDRLSGLISDGEVFSACEPRIKVLQSRFSLYRAYNGGR
                     EDEYHPTFGGGDIKRAPKCDLRRVETCVSAASVVQFIEELRRDRPSYPLYTEDTIGEA
                     HAKGAAPGDSDSSTASDTVSRISVEEAVRRFFGSGVAMSERVLTEEGLCLRPSYAADS
                     EDRWLSLQQLADSGDNTRAVHASRLLRPVLSTSGGADGEGELLARLLQPILARVLTSG
                     TCYDRLELELTVSGKDVEELPRLARWCATSGLLESCPGLFFRFHVVQDVYSAGTEGVP
                     QQRGHHQQHATVAEGHGPSSASSSRASRSLFFGDVLHNIFSPIWEAYLAAAGAVGSGT
                     DAPPPSTERRVAEMQSLLRRTTGFSVSLTNAAAVQEMPPTSSPSCQFPLPGSNSSGSE
                     HATAATSLTPPDAFFVYHVWRNVQLVNVFLFASGEQEKPSTAATREAAAAAAKPAWDT
                     RPAFTFTLHGGANSRTLFGESVLGLLLADAVVNPSTAFEWSPLTYLFMLSQRHIILTP
                     SRNRCSSAAVKHTLNTTAVPLAVQAGLHVSVATLDPLFYDTTNDALGEELKELAKQRG
                     LANADVTEMCLRSLEASSGCFTRVEQRHLFGYAWPHAQARYSQFSATQVSPLRLHHRA
                     CALEHELDVLFAAVRKGSSSGSSATTTTTTARLRAVCSRSDEARLRAVLFLPSAADDG
                     SDPSATVYRRAASASTRALELEHDPALLVRLPSYQAHEAVMQYPRILISGPDRVGPSA
                     AAKRLMAAMATREAYQQFVIRPEYVQRMQTPSPYGPDKKKGSQCNSTEALVLKWRDGV
                     LNVEEKQPKQHNSRVGSVSASSPSALPTWAQFQKDTRMLRRLASADPTVAKYASKRLD
                     MLESKYRLHAALTNDDEEDYTITTATATAAENAEGDSTEARARAAPTSRRCVVQPACG
                     DAHNCVKVDVHCHMASGMTAKSLLQFMQRKIRDHPDDVVGVDSKTGAPITLVEFFDEV
                     LGEQLKPKPSAVAQGDNSTAVRRAAPVFAAEGDEVVAAASAKAARVAHLLAGMPVAAL
                     QVHAGKATFHRFDRFNHRFSPMGMTSLRSLFLKTENFMQGRYFAELIRIAFKQNELEG
                     GTFTENRLSIYGRHKDEWDRLSRWLVFHGLSHRTNSWMIQVPRLFHLYQRSGQLRSFQ
                     EMLTNIFEPLWHASLHPDKYPYLHFFLSHVSGFDSVDNESDREPDQTIDIPPAQWTSA
                     ENPPFAYYMFYMWINITTLNLYRAARGFNTFQFRPHAGESGDPDHMADVFLLADGIGH
                     GINLDKRPVMQYLYYLTQIPLAITPMSNNTLFCRYKDHPLPNFLYRGLHVAIGTDCPL
                     IFHRTEQPLLEEYGTAEALWNLSAADICELAANSVRASGFPASRKREWLGPLYHLRSV
                     AGNDVARSHVPQTRCAFRYEAYMEEVTYLQNRAAREMSCRAMRTPLEEEVDIMDAVGI
                     SRGELLERRWNGAEIKEKQRCRPLVLAGVDERPARVAKTHDASHL"
     gene            complement(<338616..>340088)
                     /locus_tag="LMJF_13_0990"
                     /db_xref="GeneID:5650128"
     mRNA            complement(<338616..>340088)
                     /locus_tag="LMJF_13_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681791.1"
                     /db_xref="GeneID:5650128"
     CDS             complement(338616..340088)
                     /locus_tag="LMJF_13_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650128"
                     /db_xref="UniProtKB/TrEMBL:Q4QG55"
                     /translation="MARRDRVPRHKSHTHKRNKNAKLSPFQREQKRAKMANQAPTAQT
                     MGSLDSIPHSQRHIFEYLQEKRSRQQARRATLEKERQTHDVEACPSAASSGSGGKSKE
                     AHAAAEDGTTKTAAATVVTTPAALMPKKPKKHAAFASLNEELSASVGAVLQPPSSRHG
                     RLTAATDKDSSSDGPRSAEEIIARKKERKHKRKQEARRARVAAQLQAMEEELDKYAKT
                     ANGGGKRGRKKGKGGDGEEAETADDVRERVNFAFERKLQSMKRKEEENASQRKAAEVA
                     AAETHRHSGNGEARKRRRETSSEAGEHANGHDDRGDGEGSDETAPQRQRKHISFNPDV
                     EDRAAEADASRVKKRGAERKPRDFYELVDVVRYGERVEAPPVFDVVPNRNTAVSRLAS
                     ALEREVDRRVHSGVNAAERHRLLAGGGRLAQQKRLARLGLAAAITHTTCADGTATRMS
                     KEEEFKVLRERVMATYQRNRRKEVTERKGVDMKHEFPLFA"
     gene            complement(<341060..>342448)
                     /locus_tag="LMJF_13_1000"
                     /db_xref="GeneID:5650129"
     mRNA            complement(<341060..>342448)
                     /locus_tag="LMJF_13_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681792.1"
                     /db_xref="GeneID:5650129"
     CDS             complement(341060..342448)
                     /locus_tag="LMJF_13_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650129"
                     /db_xref="UniProtKB/TrEMBL:Q4QG54"
                     /translation="MKGSASTKPGGSPSTSRTAHPARANTSGNASTSGKQPQGPRAPV
                     HAKGKPKRGGAEAEATESDKVAYTVIITNVENDFGKLHRACLPYYCGLRSDYEGTLDV
                     ERLLHEGGPQSRRLIGAVRGCSYAVRCRTETRSAEISLYGPANADFAPMQLTKAPRRP
                     STPAADAKSMAAPTTSSSEKLAQKDTTAPAEDVSEETALANVGAVEQLALRLRRQHYF
                     EEHLPVSVHLPGRKADEVLLRIDKGSASSDADGTNATGVKNEEANGVAEDADADRRGS
                     AATPVTASASREKRQRVVEEDRNADAPSLQRVKAEAPDGDEEGTEEDSATAHERGKTT
                     ENDVDRRADNGGRRSRRLTKSKSATIIAQFPRRQKDFVTAVAALSSRVPLQRVRGRLR
                     DLPGFLSCWSLYERHLRVVFRDAESLFKAKQLLDQFELEPGLRVSLIFSDPLSRTNAE
                     YLRAQENESVNE"
     gene            complement(<343317..>344300)
                     /locus_tag="LMJF_13_1010"
                     /db_xref="GeneID:5650130"
     mRNA            complement(<343317..>344300)
                     /locus_tag="LMJF_13_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681793.1"
                     /db_xref="GeneID:5650130"
     CDS             complement(343317..344300)
                     /locus_tag="LMJF_13_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650130"
                     /db_xref="UniProtKB/TrEMBL:Q4QG53"
                     /translation="MRYRQCQHHFTDRDQQAKAFINCNDVLSTSEQEEVIAYFARSLR
                     GSGQLLKVIVCLQAMLALVYMLLLLSGSLLIDVSVDMAATASLVQLAQQHKQGSPESA
                     IPALEPAAPSQAPLEALAALEAEQRAAQRKYVHEYMNRRTAAGVGVRSGGAMILLSTL
                     VVLYSVALLLWAGYSCYVACRQLTVNVEDLTRTEPQDLHRRRHEEGPSAAAPAAKPRG
                     ALRHLRRRVKADPAVALYAAAAFASLGSLFWVTALVHRQRATQRAYADLGLQPPSVLS
                     LQQITNAALEYVLAVWQPLFHLGIGLLVRSMLDTRDNLVALSKLKYCFEKV"
     gene            complement(<345389..>349300)
                     /locus_tag="LMJF_13_1020"
                     /db_xref="GeneID:5650131"
     mRNA            complement(<345389..>349300)
                     /locus_tag="LMJF_13_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681794.1"
                     /db_xref="GeneID:5650131"
     CDS             complement(345389..349300)
                     /locus_tag="LMJF_13_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650131"
                     /db_xref="InterPro:IPR021047"
                     /db_xref="UniProtKB/TrEMBL:Q4QG52"
                     /translation="MYYGSRVRHAALLVIFGLLVIIAVLYDNVFDDVENSHAAELQEM
                     RAEAHSVETLLFTSRASHGRAAPLALNRLEIPHVANTFVSKYINRTVAPRLSDVRDVR
                     TLTSTEFFEQMQLWRRPGSRAKQISKLVDLLTENERVTARAEAVRQRQHKSKTRRSVK
                     SLFSFLSGGGKGHSHDDDDAGSGAADDVVKVRYPSSLVLHYHGSSDSFSLTSNNVQLV
                     PYPLVPPPVTTRLSEAAPLPPPHADVIGKKEFTGEGAAERTAAAAASDKDTNPTTTVT
                     IPKGKVRYAVPHRTTPHTPTHGWDHFYIALNLWKNEEVLPDLTEALIVFLEEEVKPFF
                     DLATSVVVSIYSNISPDRTAELIATLLIPRLHAAGVRTVYATTEGACLGYVERQSFHE
                     RIEWMACIRNKALEPLYEKGMSVFESLQQQQQQQQAQASADGLVVLFFNDVIFRPQDI
                     TVLLESRAEAQVAASTRPHGWVSSVTATNHEPADAGVQDDDGDLRKHPVGTASTPPSG
                     STSAATGTTFDMACGMDFYATFYDTWVTRDRLGKPFGAQMPYSDDHATQEAFYRIFKH
                     ERTGDHAPEVSAIPVKCCWNGVAAIRGRFFLAPTPPHRLDFPVQGAAETTARTPSATS
                     SAPAAAGGARSEAAAHPPDVLQRPSGAVYDRIGDVHDLLNTTTLVHYYTRVLARRLQS
                     VCVLWSLMRREIARLADIPFYKPETCDSSSSFESLLHTVDYEMRRPSAVSEDWMQLRL
                     QLESRTLLLSTAPDLMRLEESVVNPESEGDVESAAPVALRVEEDSVYYRARHLSVRFR
                     HAFTPSYGATVAGHAVVRDEVCLASECLLICQDVMHAALLQDRRAPIILLNPHVRVAY
                     NLEDFHHVAQQKWFFEHPHVYWVSTLARRLQLWWSSSSSSSVQDKGAGAGGSHEFGIA
                     TSAMDDWLNTASAAAAPGTVMRGTQKLSVQDGAGRVTATGLIDIPTLTRMDCQKSAEG
                     SIRVAMGAFFPIVRLVQFLLAALLLRWLCWQVHVDLLVAALSVEGGAARAYSVEAQWW
                     QALYCAVWYSSLVQQLRRLSGGVAAGERDAGDNVAGEWEGERAVSGRGFGRARHPVTS
                     SPRALLQQLHRLQSHHVVKNSPARLCVGAVWRAAYFVAQKLVWLLSSLCCVRFWFGWC
                     RTPLAFNTPTGCSGIKARQLWPHRRSASPAKSHYPREPSRAVVSADVFQAGPAVTGEV
                     TGYTVTRRSEGTARPISGTVFIPRSCTASGGGGNDTEVQRQHHSVSQAATGVASATPA
                     SVTENPMNSTHRQYELTHGSAAASNHQMRSRNVSYGGRSWL"
     gene            complement(<350294..>351394)
                     /locus_tag="LMJF_13_1030"
                     /db_xref="GeneID:5650132"
     mRNA            complement(<350294..>351394)
                     /locus_tag="LMJF_13_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681795.1"
                     /db_xref="GeneID:5650132"
     CDS             complement(350294..351394)
                     /locus_tag="LMJF_13_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650132"
                     /db_xref="UniProtKB/TrEMBL:Q4QG51"
                     /translation="MKSTRTTAKVRPACLPYSTTMRSSRQTSSLLSRVAHSVGAVVAK
                     ANLLRQSPSREAHRPSGPAEGLRPSSSSAKPPVLASGDILRDLAFFTQASEVGFFSTH
                     PSLCAQVFGVVPGDVFEVGGGCAVTSSSVVDVDAGSRMAREAIVVVGARSGKLWVWAY
                     GDEAARVLRVPSSTTSAMLSSAVEVRAAIVEHYQLRQLVHPSRRQCSAGGGKAMEQDA
                     QVEFARTVCEAFQSLCARAHEEVQRLYTPDQLAFLQRAPDLYAAATKRVDRVASSLDD
                     ASPTAGVNSEPQRQQPNHPPDGSSSFLPRSIYSDIARHAQHAAAVVLLAPRVSLVTGA
                     VGWVGEGDVVLADSLVSQGGCAEASLSASVVI"
     gene            complement(<352320..>357488)
                     /locus_tag="LMJF_13_1040"
                     /db_xref="GeneID:5650133"
     mRNA            complement(<352320..>357488)
                     /locus_tag="LMJF_13_1040"
                     /product="subtilisin-like serine peptidase"
                     /transcript_id="XM_001681796.1"
                     /db_xref="GeneID:5650133"
     CDS             complement(352320..357488)
                     /locus_tag="LMJF_13_1040"
                     /codon_start=1
                     /product="subtilisin-like serine peptidase"
                     /protein_id="XP_001681848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650133"
                     /db_xref="GOA:Q4QG50"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR017294"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:Q4QG50"
                     /translation="MMMEVVVALRLLTIHVLAALLLVLWSLPLAEGPWPLSVQAARRS
                     TDAHAERPSIHPRKYYLGKYGTRCIRNLTGLVVSEDAAERLACFSGRGVRVAVLDTGL
                     CAGITESSRNSVTCTSVVPGVACEDAGCAHGTRSVSVLAGQLSVSTPLPRESLKETAW
                     RNRETHLALADQFIGLAPDSTVRVLRIFDRQGRTNRRHLARALDLLLREAEDGEAGRL
                     HSTWNTSSAHIRRRDETVDVISLSYGSKDYHSSPQVQDRLYRLMHEHGVIVVAAAGND
                     GVRFGSVRSPADMPGVLAIGALRVEGHSRSAQTTQASRTLGNLAGSLAAGGGHKSVAH
                     FSGRGPTTWELPFGAGRAKPDLVALGQHVWAVQGVSAAAFSAAAPRARSASSALQLRS
                     ASGTSIAAPIVAGVVALCLEAAWSSTSAVASAQNITGGGSVLDVRQNRLSRVSHSLRV
                     REAILRTAVPLEEAAASLPTWPRPAPTTPLHSDSSSTASAAHPRRVLAGVPLLELYAG
                     YLRLSRVSILSQGAGEVQPLRALHAIVAKAAASSAIDAPEALRSCASFAIPTCVRIGY
                     RIPRCSSNSGDMSTSQSCQPPHDPDGKAHGDSRLPGRPGMSRAAPPAAYWWPFSDQAV
                     YPGATPVLLNISLHLCPPSSSAATDQGARDAAAAASGEAARRGSTTHDHVTYVITKVS
                     GRLRAREGHPSRNSSHQNDACPLLLFEGAENRHRVGSTSPTRLLNLTARSASPPAACT
                     DGEVVGGEATVTGPRHTQAGVCSFAKRRSTQQRWMQHLLRVATELTVVASRSPTRANV
                     VEQLSPPPTSFSLSVAVSSPASAHTHLCYDVARETVAVWRKKGKRSPPSVKGAAASWR
                     SADNNDGHDKQHTKDGAQVPADRDRCVPLFHLFRMLSVEGALHIFTGGSSSQPTLTVP
                     FAVCVVEPPPRVQRVLIDTSLDWFNPTTATSNLFIAGDDPHESDTDGVDAALRRGRQR
                     QRHERAYAEASGGDHPYTNLALLYLYLRHTLGMAVETFPLLHMSTITTSIAANGSSPL
                     WPPAEHTFNASHAAQRAPAGALAHVGTLIIVDPERPLTHGMRRLLTRAVLGGGADRSA
                     DGLDVLLVTDWYSADLAAQLHWARDKSLDNAERSSRISGTDAADEVAGVDGDRDAVRE
                     LRALRQLENGSTRGLAGSSHVPSWNRWLSEVTVASGSAANSNDCNGAAPLGSEGLLDG
                     KSELPFELSENIVIDGVVVVDAAAPTGRSEPGGNASASHGGTITSAKVVALRSLGQLN
                     AAGVLRWRLPAQAAAQRQAGRAAAVGASKGVHESNVHSSGHGTCRIGHASNTSAVPST
                     QEGEAVICNVMPGWVQQQRRLVKRTIVSTRDSSAPAAVVEDGWEDVPVAKGDERLVRI
                     GGLEAVDVSTVAPAATDASEAIQSLTHGVLGFLTLPPSSTHVVTASANRFRPGRIAIF
                     TDSDCLSTSNHHAQAALDELEALLYPPSTSPSSPVTTCATWDCLARTPDGQRLLQAES
                     AQSSVCVEVVKELLLWLHTGNLHRWWDSAQLQCEARRWARARHRSTADTTPGADSVGV
                     DRKAANFDEVLGTAPERAHVGEVVGRLWASLVESTERDAASFLVEGPEDETRFQRDYA
                     AHQERTAANVMRALMVNYHGDWRAHLLDHNVSLSSTGAAGDSFSQSLRPASGRRSGIA
                     TAQQPEEHVSLIESLLPLRGMLNALRWLQHPMVLGQLMVSAAVVMSVWLCRAGG"
     gene            complement(<360040..>360759)
                     /locus_tag="LMJF_13_1050"
                     /db_xref="GeneID:5650134"
     mRNA            complement(<360040..>360759)
                     /locus_tag="LMJF_13_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681797.1"
                     /db_xref="GeneID:5650134"
     CDS             complement(360040..360759)
                     /locus_tag="LMJF_13_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650134"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:Q4QG49"
                     /translation="MASAVDSSTASSYPLGGTVSKALLIVTPAFARRQDFVQYLKYKL
                     YDAGFIVVREELRLLNSETAEKIAIELDRSLVPPAVVPPAQTVADGAPTSPGFPTSLL
                     PAAHDLVGTAYIFVLARTKCHELLQSFIKTQLCGKDADDLDAFRGEHHVQGRKLPLWT
                     SLTANGAKKSVALLFPRMLAEDVPTSAVSREYVQANLKQALVPTLTALAKQKPENPLR
                     WLAMQLLTNNTQAPPMISNPS"
     gene            complement(<362615..>363541)
                     /locus_tag="LMJF_13_1060"
                     /db_xref="GeneID:5650135"
     mRNA            complement(<362615..>363541)
                     /locus_tag="LMJF_13_1060"
                     /product="putative NADH-cytochrome b5 reductase"
                     /transcript_id="XM_001681798.1"
                     /db_xref="GeneID:5650135"
     CDS             complement(362615..363541)
                     /locus_tag="LMJF_13_1060"
                     /EC_number="1.6.2.2"
                     /codon_start=1
                     /product="putative NADH-cytochrome b5 reductase"
                     /protein_id="XP_001681850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650135"
                     /db_xref="GOA:Q4QG48"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q4QG48"
                     /translation="MVGVLVIIAFGMAAFFAFMFTRTTKVAMDPTMFKHFKLIKRTEV
                     THDTFIFRFALENETQTLGLPIGQHIVLRADCTTAGKTETVTHSYTPISSDDEKGYVD
                     FMIKVYFAGVHPSFPHGGRMSQHMYHMKLGDKIEMRGPQGKFIYLGNGTSRIHKPGKG
                     IVTEKVDAYAAIAGGTGITPILQIIHAIKKNKEDPTKVFLVYGNQTERDILLRKELDE
                     AAANDSRFHVWYTVDREATPEWKYDIGYVREEMFRKHLPVPDMLGNDSVPQNVGIKKV
                     MALMCGPPPMVQMAIKPNLERIGYTADNMFSF"
     gene            complement(<366515..>373243)
                     /locus_tag="LMJF_13_1070"
                     /db_xref="GeneID:5650136"
     mRNA            complement(<366515..>373243)
                     /locus_tag="LMJF_13_1070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681799.1"
                     /db_xref="GeneID:5650136"
     CDS             complement(366515..373243)
                     /locus_tag="LMJF_13_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650136"
                     /db_xref="UniProtKB/TrEMBL:Q4QG47"
                     /translation="MDSSRLLVPLTLNLSGIDKVSGADSAGARHVYGSTAVSTAQVNK
                     LRESVFCEAANIAGAEEVLNAPAGELECMASGFLSISDYVFVAESLKTLSVRMLMEVG
                     VSDRGAMSGGASAPLRRIVVDHHHPDAATALTASWVVMRDALVARKHGSVLDHTSAVK
                     SRDGGATIVRRATGISGCASSTTTALPQRDNCGDAERAASASKVNRLDDAETTDTCDE
                     TAPHLFNTEEADWSGDDDDIGSVKTGMGVVSLSGASLATHTVAGCDEGLGSESDETTE
                     MDKTVTETGKGAAAPTTPPASLPMDTVAQMANLSGVSSVTGHVPDLVPFPHPPSQPLA
                     EFTRVPAPPPRPLSMSDLTAIAEQDDVVDFYLQSLAKRVRGIESKLRVMNPSSVLRFF
                     LTSTLSRADSSGMSVLLPATTSVPARLPGCVDGSSAADPQSSGTWISEKEIVLPAMNR
                     AEAQAAQTREDALAAMGGDLVKLFSDTKNITLRYMLIFAESMPLGINSRLNHDYLLPT
                     AAIPENYVGCGVHARRKKDFFVSMTERVALLSGHHSFRTPEALLLGISQLSSLASQMM
                     SSFALGAVLGCVSRWRELHKSGHTTSDEVVETMEQFATAYCTGYKILMNDAFPALRKQ
                     YPNLFIASSFAVKEESSGGTPPMLTVAMSMLMKLLFLFAGGRESIRADDRRMMADALR
                     EEQQRRAERCTPTAAPHTPPVSSISGAAMPPVAAATGRLSEFVATTHPWHERAGSPPR
                     NAPSLPVPVAVDATGDFSLVCSEGNAGDARKLGDDVALAAALQVPSATLIVDMGALLM
                     SGPLAAHRSTAALVRTARAVSCVWRVLFQAAGLLPFGRACPVDMAKWLPLFPLYALST
                     GAKHVMLSIHARAAGQTPLNFGPVLREDALQSAVDCIQDSARVQDEKKPSVSVLGATT
                     SEWSLHLSPTAIESSPASRKGDMRWPSTLTLGSPVVPVIAAAEKPVAPVSAQRSYHLH
                     PSFAVASAQSWSGTLNEDPFHAKPTLRATPGIATEQRQDFYELCARQSAAPFLPGVNI
                     TNQVHAFPLPGGVAMLRVEKLADRSPATVQRLKTYHDRLALIMSWRRVSLSRSHSCAP
                     VTEVAAATATGQSGNACTTTTVVDAPVHEGDELTIRWGNPPKGRAAGTAMRVQASFCN
                     PRGFTNRRSSTAVQNISASGTAQTASAVAVFSAQELVDSNESHARAHGNHYPTLAAAI
                     RRKRQSLLFFATAFSSAAPPSPPRSQKTSRAVSLETVVAAVPAVEPTEECLPDVHVPT
                     LQRCRICLILATANPSEFLVVLNTPNSIASSEAVSLRTPSVVGVLHHRRHCAPFTREV
                     SRECAWTNPEFAQNASAGVLAPGAPPLSWTPSRLSEVTPTMALQVPVLLGWLLGQSAG
                     NEEIFTLPLPPLAFRILGLAVQLELPIDAVLLTTADMSLLHPDWTSMKLCEQLLQELR
                     ELHFRQETQREEQAAVTLASGAEGKRTVGRGILDHLCISGSPAAALRQHQRKKELIDV
                     SLSIMWNIQRDGTVAGHGFWAAVLQGMRQTPLLDTPLFAQCSSRTVREVLCGSYDHLD
                     EDFTFRKSFMLLVEDDARGGGSSAAGGAATQLRGDRHFVRKSVLRVLDELTLKEKRLL
                     LRFITGHSLRTRRSQMDTLRLVLQSGFARAPLRCGKAKPPGCMPSGSGWTHSSGVTKV
                     NAGVVRAETASFTGADEDHSHTTTSSYLTASAEAVARACVDATLQLLPVAHPSEKTLV
                     FPNYFDALIMGSYRKRVLGADLPAFTHASGTATTSEPRSSMRDSWGAAAAAAGGHTVS
                     CAANSVESCVSVPASVNGNVAAPFFDSADVQLAWTQLTVGQQETLRRRYRELLRHRVR
                     AALYVYLLSNADTVEEAWELGAQMGFASRAVHGGTASATAAEPGGCASREYHDDAGGG
                     TFMRCDDGTVVFVERETAENHDGVAGDVHSFGVEDDLDVDLLETDDMMLATASTEMTV
                     DAAAHAALEERGGGGTDPATPGSAGHAGQPKRPLLPSDQLRSSVGTVHSALWGDSTTK
                     GDSLNGYCIAAAFRFPEDSADDVGEAQTAAAGVEVVSGCGDCGIDPEATISSATLTLH
                     NHGARADVARELARDATQASHPAPPASSGASAEAAKCPTSDGESLVFMAVAPPRHPSL
                     LKAGMITPLWEAQMAAAAASGRSSSMAFTDAAVQGGAHKPSAAVKAAGAKTAVQAATN
                     GGSRDASMKATSTADAAVTAHGVAGLSGESKDARVRSAIDSYIRELFPDDAP"
     gene            complement(<374229..>378566)
                     /locus_tag="LMJF_13_1080"
                     /db_xref="GeneID:5650137"
     mRNA            complement(<374229..>378566)
                     /locus_tag="LMJF_13_1080"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681800.1"
                     /db_xref="GeneID:5650137"
     CDS             complement(374229..378566)
                     /locus_tag="LMJF_13_1080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650137"
                     /db_xref="UniProtKB/TrEMBL:Q4QG46"
                     /translation="MANKARDIIRGIFSPRQGELECVLSGFLTRENYALMRRFWVPFL
                     TTELRDKWYIDAVMLSVLGRNHWQSWGQPKEAACVALSREEVLQLNRKRRECYDRLRE
                     RLAVLSGALMEKGDHRGKKGDRETLLADNHCHEVAVAGVSAVESDGISCSGKVGTHKS
                     PDASLLGRTSAPKPDQHSVPGATTTVQRQEPLSVLLMRLQTTVSTSFDCFDLIAARIP
                     AAIVSSLTNQYFSSSTPVVYEQVAYQEKKIGDLDVLSFFVSIEARRQLLNGRVPADMN
                     RNATSNMKGHNNGDPGDFVPFAREEKEDPIQTTQQLYSAVCHAGLVVTTACSSMVLTV
                     LFHLADVLRERQAFRENKAKAAQLGVALEQLIGHKAAPVHAYSEKAVEKLEALKRDVV
                     TGEMSLTVLAKELVLRFRSENRAKIEKLRDCYPDLFAYLEMAATPEERQDFDVMRLLS
                     GIALKLMFLTGGGQRSIVADDRRVPAGGNRITDDVALSAMLEVPMLNLICWIGCMMGM
                     PIMSSHGLLAPQHQGKRPLTLVEMDECCGAMRVLFQAVGALPCGNACPQNIKEWFPLF
                     PFYAVNSEGKRVLLYLYTAQVTAIQRVPLTLQKDMTLLSFATALTRAIGGGVADISNY
                     FFEPNFTVGHSPCNTDSNSDMASEDATQRSASASEPMLPSMSGSGASWSESPAFECRT
                     SPSVSPSPTTADGKACRDEHRSSSASSDASSACSTLMEENLNIDVYTCMNPQMQLYVR
                     CSTEATTHRHGVTELTPFVSTTFYCSTRDIEADRPDIAPAIRHAVPKLLPSEGLLTLR
                     WTSGEPLLTFCPGDLVSVMAERVATSAAGGGDATRVSSSQQQEQLPTSSAPDFTSATP
                     RVSEGNGALDALMSGKEGAIGAADDNSGNAAAARARTHLATIDEPEKHSSDTVSSLHR
                     HAGAYNPALEDDSMTMSSGDCAVLETAHAYQGVMHDVLGLHEKVSRRIGVQWKVLEVL
                     PCSQLARQSCRMNGSNSSSAVAAAGKQDESDKHNAYYREVVLHVTAPDMLLAVPLRIL
                     TIGHERASMSAFTFVDPNDDTVCWSNPNLIASILNGDKSQDGGKSSRPALADVMAAEA
                     NELMLPAAVAAAVRGGHPVPNGLPCDTEEALHSIYYSIGVLLGNAITNGVHFTAPIAP
                     LAFLLMKKAIMSGDYSFKNFMWLEPADGNLLSPTLLLSSAYEILNMTDHQYVAFLHMR
                     ALGNPDSHIFPVVHSLADEIREGKASLQQQEQQQEHSQASSSKQQQRRQGSESVKLCL
                     HQRSRDATNASTPLDRSLNTPRTPASVLGYLESIQAYNRTGSAFYRSHCDMSNDSGGG
                     GSCVHSFLLGAHVPLRDAIQEYREQVQRQQTKAMNSSAPPLVRNSRSNDQLHGRLPSR
                     REYISLYLANDLAWSPVRRDGHGAKNKELWASMARGFMASSLAKSPLMTRCCSRVIRE
                     VLCVPRTAS"
     gene            complement(<383248..>384564)
                     /locus_tag="LMJF_13_1090"
                     /db_xref="GeneID:5650138"
     mRNA            complement(<383248..>384564)
                     /locus_tag="LMJF_13_1090"
                     /product="putative proteasome regulatory ATPase subunit 2"
                     /transcript_id="XM_001681801.1"
                     /db_xref="GeneID:5650138"
     CDS             complement(383248..384564)
                     /locus_tag="LMJF_13_1090"
                     /codon_start=1
                     /product="putative proteasome regulatory ATPase subunit 2"
                     /protein_id="XP_001681853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650138"
                     /db_xref="GOA:Q4QG45"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QG45"
                     /translation="MGQNMPKPPGAGKPEKWEPPVAPEIGKRKKKRGPDAATRIPKVY
                     PNRACLLRKYRLERCKDYLLLEEEFLRTINAQRDAQSNLEEGAMGHYEAELKRVEDIR
                     GTPLEVATLEEAVDDSHAIVSISGTEYYVPLMSFVDKEQLELGCSVLLHDRQHSIVGV
                     LKDDVDPLVSVMKVDKAPEDTYADIGGLEQQIQEIKEAVEFPLSHPELYDEIGIKPPK
                     GVILYGVPGTGKTLLAKAVANRTSATFLRVVGSELIQKYSGEGPKLVRELFRVAEEHS
                     PAIVFIDEIDAIGTKRYDTDSSGTKEVQRTMLELLTQLDGFDSSNDVKVIMATNRIDT
                     LDPALIRPGRIDRKIEFPFPDEKTKRRIFEIHTSRMSLAEDVDISEFIHAKDEMSGAD
                     VKAICTEAGLLALRERRMKVCQADFIKGKENVQYRKDKSTFSRFYL"
     gene            complement(<386516..>389743)
                     /locus_tag="LMJF_13_1100"
                     /db_xref="GeneID:5650139"
     mRNA            complement(<386516..>389743)
                     /locus_tag="LMJF_13_1100"
                     /product="putative leucyl-tRNA synthetase"
                     /transcript_id="XM_001681802.1"
                     /db_xref="GeneID:5650139"
     CDS             complement(386516..389743)
                     /locus_tag="LMJF_13_1100"
                     /EC_number="6.1.1.4"
                     /codon_start=1
                     /product="putative leucyl-tRNA synthetase"
                     /protein_id="XP_001681854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650139"
                     /db_xref="GOA:Q4QG44"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:Q4QG44"
                     /translation="MSTARRDALVAIEQEKQAYWAAEKLHEFDAPAPGEARPAKYLTT
                     FPFPYMNGKLHLGHGFSLTKAEFASRFQRMMGRRSLWPFGFHVTGTPIAACAQKIAKE
                     MQQYGNPPQFPAELLEDKPKTPVVKEPTEALGQHKSKRGKSGPAKPQWLIMRSMGIPD
                     SEIAKFADPQYWLDYFPPIAMEDLKHFGCHIDWRRAFMTTERNPYFDRFVQWQFHILR
                     RENLLNYGKRYCVYSPRDGQPCADHDRASGEGVLPQEYTLVKLIVQNPLSQPCFAEHK
                     DIIGDRSVVLPGATLRPETVVGQTNCWVSNKFNYKGYYVRNAKGEDEVYIMTARAARN
                     IAYQNFYVNGQVGTDPEPLFEVEGTNMVGIPLSAPLAPYTTIYTLPMATITEAKGTGV
                     VMSVPSDSPDDYINFTQLLSKPDYRVKLGIKDEWVVPFAMIPIIDIPELGTEGAKLMC
                     EKLKINGPNATELLEEAKKVCYQQGFYHGTMITGPYAGVKVSEAKVKTHRDMEAADQC
                     IRYYEPVRQVMSRSGDECVVALCDQWYLEYGKDDWKKVVQEHIKTMDMFFPGVRNGFE
                     ETLNWLADWPCSRTFGLGTYLPCDASHTMIIDSLSDSTIYMAYYTIDRFFNVGADGST
                     DLCGKVDNPYGLAPEMFTNEVFEYIYHGVGDAATVAGAVSMPIESLKLMRNEFEYWYP
                     VDLRCSGKDLIQNHLTMFLYNHAAIWPADESKWPRAIFCNGHIQVDNEKMAKSKGNFI
                     SLREAMDMYGADATRLACADAGDSMDDANFVRETAAGFVLKMTTLLEQAKETVERTDL
                     RSGDYNEFDKIFNNTMNTVITRTEGFYHRMQFRMVLNTAFHELSNEYSQYKMYCDDLN
                     VHAQLGRRYYEVVALMMMPLAPHTMEHLWQSILQHEGSVVTQPFPKPTAELDYSLIVA
                     SRVMTTTLKEIRSQVIKNAKKRGPVEEVIVYTRREYTDWQRQALEILHELYQANGNTF
                     PEDMAKQVVARDPKIMSKGLMAFMSFVKGNVEKYGVQAMSTQPVIDDAVILSNVTHNL
                     SRLSGVPVVRILSAEDETYKEHDAARRKCLPGEPSVALPPVVKSE"
     gene            complement(<391385..>392932)
                     /locus_tag="LMJF_13_1110"
                     /db_xref="GeneID:5650140"
     mRNA            complement(<391385..>392932)
                     /locus_tag="LMJF_13_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681803.1"
                     /db_xref="GeneID:5650140"
     CDS             complement(391385..392932)
                     /locus_tag="LMJF_13_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650140"
                     /db_xref="UniProtKB/TrEMBL:Q4QG43"
                     /translation="MSSTRARKDPLRRIGNGNAVAGGLDMTRVGILSDRELAFFQRLA
                     YTGSQAAEQQQRDARKQEEDRRRELSKTRTAGWTDTIEARHDQFVQAQQDAKDAAEAR
                     QKVLDELYAKQLEEEHKAVIARQALEHLKEDPRGRHLRSMNMLHEALKARKEQVAYKQ
                     MLQREDEAQNANAQREFQLQRWGDQAEELHKKLKARQRNVEEKNANLETVLFQIDQRR
                     QERAVQQQDRKHIDQEAAEERAEQQEEAAQRRARELENGAYNKAHSRPALTRSEKLQT
                     RVAENVKDEAALRAEEEKVDSIKRWVMERQQNKLAAFEERKKAGLRRYLDEAKQENLP
                     TYRTQDVFEKGESFLQKLYDGDVKQQEKQHEYRLEMEQQRLEMEEQKAAEARGDVVGS
                     GDGADGSTSRRHAAATTAAGFLNKAEEMAYAEEMRRYPEQLRAKEAEEAAARRAEALR
                     IERIQKLQAAEKRENARRAVEARREEFRQQQSQQEADDARYRAYIDSVVPADMDPILY
                     RKATQLH"
     gene            complement(<393980..>394249)
                     /locus_tag="LMJF_13_1120"
                     /db_xref="GeneID:5650141"
     mRNA            complement(<393980..>394249)
                     /locus_tag="LMJF_13_1120"
                     /product="putative DNA-directed RNA polymerase ii 8.2
                     Kdpolypeptide"
                     /transcript_id="XM_001681804.1"
                     /db_xref="GeneID:5650141"
     CDS             complement(393980..394249)
                     /locus_tag="LMJF_13_1120"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase ii 8.2
                     Kdpolypeptide"
                     /protein_id="XP_001681856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650141"
                     /db_xref="GOA:Q4QG42"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:Q4QG42"
                     /translation="MIIPVRCFTCGNVIADKYLLYLDLVSQGVSEEDAMNAFHLERFC
                     CRRMMLTHVDMTDLLLKFNPADTNVLGTASVAAAAGEDDGAVGMP"
     gene            complement(<395497..>397275)
                     /locus_tag="LMJF_13_1130"
                     /db_xref="GeneID:5650142"
     mRNA            complement(<395497..>397275)
                     /locus_tag="LMJF_13_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681805.2"
                     /db_xref="GeneID:5650142"
     CDS             complement(395497..397275)
                     /locus_tag="LMJF_13_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681857.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650142"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q4QG41"
                     /translation="MDSETESSSKLQRQLLELLRPSGRCTTLRVSQIASILGVEGEKQ
                     YQHLLDLLARSEFALYDAEQQTVRSLLAPKDNLEDDDEAALLALSDVDVVGGGVRGGR
                     VGSTPLSAGYRQHRSNSRHSYRGGGGNAAASGYRSDSGLATANCSVALLSRRRAGGTW
                     TKPGQRGLEDAASYPGPVGRVGYICVADELHLGKLEAYYRAQGYYTKFDFDVLHVRFA
                     HPSFVNVEAGAGDRANAPAGQRDRQRSRHAPAAQRSGDLVVHGEDTGSSPPPPPLLER
                     GTAAAAAQRFGESTSASSQGYGALGSNTRSKAAVNSTLAQVGEGGEAAAATPNSSSSV
                     MHYFDLFVFPYGAVVWWGFDQRYFKIVENDYMLPHSAIGHCMTNRYTTQLVNENYPVW
                     CTFHLVARDTLEVDDNFKARLRFDHFVIPYRRGELATGSVLMLCASHALAQSAKIDYI
                     ELQVQGLADSCSPLPRELREKGAVSITERRLLQLRGEVLSYRLMLKSGSDLLDEPDFF
                     WENSYLKPVFQATKEEYEVSERVEALDNKLDAANEILSMLAEDFSQRHGARLEWIVIW
                     LVFVEVVIGVLELLVDVRPWFQSHAR"
     gene            complement(<398421..>399632)
                     /locus_tag="LMJF_13_1140"
                     /db_xref="GeneID:5650143"
     mRNA            complement(<398421..>399632)
                     /locus_tag="LMJF_13_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681806.1"
                     /db_xref="GeneID:5650143"
     CDS             complement(398421..399632)
                     /locus_tag="LMJF_13_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650143"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QG40"
                     /translation="MQRGANVRPIKLAEKVFSTKTVCPTAASQLYVAHGLLGNSGNWA
                     TASRHLVEHSALKDKLRRAIAVDMRNHGSSTHSSDHTNAALASDLEALVLREQQELDR
                     AFCDPSSCTTRNAILIGHSMGGLTVMGALLRRANEHHLLTSLVDHCDDVGSTSSYGAW
                     PAEHRRQCIAGMRAVNEEFGFASSQPIAEVLFNNCRASSSLSTGSGNASRIPLLGRVA
                     GAIIVDVTPTMRLGEQRSCADNVKETLERMTQVRLDEIHSYKDATAELIRVGMADEEM
                     RAFVATNIALDPKDKSKPAQWKCNLPVLAGDYGSFQPSITSWFTSSATTMGPASSAAA
                     PRLCTLPVMFVFGGESPYNEPDHRQHISRFFSNATQVEVAGAGHFVHYEKPKEFTDAV
                     APFIASLISQP"
     gene            complement(<400934..>401896)
                     /locus_tag="LMJF_13_1150"
                     /db_xref="GeneID:5650144"
     mRNA            complement(<400934..>401896)
                     /locus_tag="LMJF_13_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681807.1"
                     /db_xref="GeneID:5650144"
     CDS             complement(400934..401896)
                     /locus_tag="LMJF_13_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650144"
                     /db_xref="GOA:Q4QG39"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q4QG39"
                     /translation="MPPTDPREWAKKVRAKTPQLLEVGKPVPKAVLSFGGCGFLVTYA
                     LGVALYLQQEKKVLLANSFLLGAGSGVLPAVALACGPQAVNLERVRDFVVNNRFIVTD
                     EDKRIETMAAGINQLLPKNAVDLVKGRLALTIGFSNKDPGYMTQAKENVYFGHHIAAW
                     TDFEDLAQNIIAATAPNTQKPCVFRGADNVLRGTMMSLSSELDQYCRHVYIHGYAGYR
                     YNKNQARHNIMFGRHGYVGNTHFSFPKQVLLAFAPLVGGDVRKDELLEAYDVGYNDAR
                     RYERWEEDPYYFAKADRSPSDDFNFRNLRANLFGGKSASERFEL"
     gene            complement(<402660..>403268)
                     /locus_tag="LMJF_13_1160"
                     /db_xref="GeneID:5650145"
     mRNA            complement(<402660..>403268)
                     /locus_tag="LMJF_13_1160"
                     /product="putative calmodulin"
                     /transcript_id="XM_001681808.1"
                     /db_xref="GeneID:5650145"
     CDS             complement(402660..403268)
                     /locus_tag="LMJF_13_1160"
                     /codon_start=1
                     /product="putative calmodulin"
                     /protein_id="XP_001681860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650145"
                     /db_xref="GOA:Q4QG38"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QG38"
                     /translation="MQKLSETVQKELKEIFDLIDSDQSGVISLQELRKLMAALHLKPT
                     EQELEEVFEETCSLPSITKASAGSPSTSSFPLPPSFIAAAAPHDGSVVNNSHSDINAS
                     SEVTAAAASARTVTFPQFATMMARRVESEYTAKQLRNAFQLFESPDMPEGFVSTSVLA
                     HALATYGSKKLDKEEIDRLIAAIDPNNTGRVNYYEFVDTVTA"
     gene            complement(<404063..>405688)
                     /locus_tag="LMJF_13_1170"
                     /db_xref="GeneID:5650146"
     mRNA            complement(<404063..>405688)
                     /locus_tag="LMJF_13_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681809.1"
                     /db_xref="GeneID:5650146"
     CDS             complement(404063..405688)
                     /locus_tag="LMJF_13_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650146"
                     /db_xref="GOA:Q4QG37"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q4QG37"
                     /translation="MTLKLPISAITAATRCYSSGLHDGEGWRRSSSGSGHADRILGDV
                     AKRLSDRQDGREAADADGAAARGSVNFRPFQDAGWDAPPSSSSAFSATASPDPPPPQS
                     DPTAASERAALDQRRRLFAQCSKLADVVQEELRAEVARDMQDGVAAVPPLAPSGWRVL
                     HTTGSSYFTMSRLKKGFYVDSRSGGRRANDDGDSPLAASDTVPRYRSVHDLVTGGGRP
                     PRSAKRDDATAEREMWVLHRGRYTAAQDGQAAPQRNSPAGDEGDSRQHGGSRRRDAVR
                     YARSDMHITLFAPFRSLDLTLYNPRVGICEWTLFDVLIRKERPKAATVAASSRSSPLL
                     SATLEGQQEVWDEGRCMFLRLAYANGELRVRSLQFVSHKLARALEEHAVFGKGEPLYL
                     EMLRRVPMDVSFHKPSQRRGGSSLERKAQPSTVSAASPVNVFDAPEPTPATPAAAAPR
                     TASSFNSARVLTSQFDRSGEYARTFAYAGPYMTELSKELREALSEYIMMDVGITNEVA
                     EYVCQMQFFLEQEEYVGWLAQWGQLAATLKQTL"
     gene            complement(<407224..>407580)
                     /locus_tag="LMJF_13_1180"
                     /db_xref="GeneID:5650147"
     mRNA            complement(<407224..>407580)
                     /locus_tag="LMJF_13_1180"
                     /product="outer arm dynein-like protein"
                     /transcript_id="XM_001681810.1"
                     /db_xref="GeneID:5650147"
     CDS             complement(407224..407580)
                     /locus_tag="LMJF_13_1180"
                     /codon_start=1
                     /product="outer arm dynein-like protein"
                     /protein_id="XP_001681862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650147"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:Q4QG36"
                     /translation="MADYEPEDNLEQNSTLSSESIQEDISSLLRTKLAGEQWNPAKVD
                     GWVEDIVNSILTELAELKKPYKYIVTCVFMQRTGAALSVGFISLWDNTKDGMVHVPFE
                     NDSFHCLVTVYFLKND"
     gene            complement(<410233..>412365)
                     /locus_tag="LMJF_13_1190"
                     /db_xref="GeneID:5650148"
     mRNA            complement(<410233..>412365)
                     /locus_tag="LMJF_13_1190"
                     /product="putative adenylosuccinate synthetase"
                     /transcript_id="XM_001681811.1"
                     /db_xref="GeneID:5650148"
     CDS             complement(410233..412365)
                     /locus_tag="LMJF_13_1190"
                     /EC_number="6.3.4.4"
                     /codon_start=1
                     /product="putative adenylosuccinate synthetase"
                     /protein_id="XP_001681863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650148"
                     /db_xref="GOA:Q4QG35"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /translation="MPVRRYGGRYNSSSPGVSNALNPSRTAGWPLSPSPATGSKPAST
                     HHDPVPQEAYYVKDEADARHQQQAPLREPSVEVEVEIIDDEPPRGSQKPLSVAPCTAN
                     ANNSSGGSKCNAITASRYTFYTNAYQKSVYEALRSLRPLPELQEPRRVKEYAETSLKD
                     SLYRIVEAHDVIMVAGAFFGDEGKGKTVDAVARHPLCTCIARVNSGENAGHTVYDKAG
                     RKFVFNLAPSGLLLPGKRNYIGPECVMDPVSFMEKEVIQLIDAGIDYRDRLFIGNVCI
                     VTPYHKLLDLLGSAANSSTLKGMAPVHGSKVMKRGIRLDHIFNDDETLRKRLEKDMDT
                     YFGLLKVKNLSDADVVRLCREENSDGVVRVPDYVIAFAQAEDKVEFLVKLYRDRVRHN
                     PGFPARCDVTYELHAALLRGEKVLLEGPQSYWLSNARTKFWESTTSADTTAAGLLAAS
                     QLNFQKFKSVVLNVHKAPGSSRVGIGACPSSFVPQDYFSAQNIKTLRDLPSATCAHFE
                     AVQRTLFRDGFPHSNDKARHNGIMAPVEYSDETGTYNIGVAMAIASAQHHGECGAVTK
                     KPRVCGFFDCVLHHEVNNIQGPYLTISALDRGDEYDKVGVTIAYVYYSPEGKQVDVNG
                     HVYKNGDIIRAGDPVPSEPALYHCHPIVKLIDGWRDNPIAAAKRRRNAPLPRGVCELL
                     SAIEYFTNCKILSIGNGPNGDDIIYLRQ"
     gene            complement(<414640..>415197)
                     /locus_tag="LMJF_13_1200"
                     /db_xref="GeneID:5650149"
     mRNA            complement(<414640..>415197)
                     /locus_tag="LMJF_13_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681812.1"
                     /db_xref="GeneID:5650149"
     CDS             complement(414640..415197)
                     /locus_tag="LMJF_13_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650149"
                     /db_xref="UniProtKB/TrEMBL:Q4QG34"
                     /translation="MLRITPSRYASKVTAGNAKNQAGSPRQKAKLFHVIPGTPVTPVE
                     KLKEQRRRFGQDRYSRQPEYRPGRNVRMDPNTFTLYATTKGVMTIRTSRINPSYKWLD
                     VEPDIQKVYRSRCMRAALQARGKASMMVAGNVHYRAELDHVTEPHWRERVMRVPKATE
                     RFQDPNYFTRGLVPSLRPLSRYSYE"
     gene            complement(<419847..>421352)
                     /gene="NT3"
                     /locus_tag="LMJF_13_1210"
                     /db_xref="GeneID:5650150"
     mRNA            complement(<419847..>421352)
                     /gene="NT3"
                     /locus_tag="LMJF_13_1210"
                     /product="nucleobase transporter"
                     /transcript_id="XM_001681813.1"
                     /db_xref="GeneID:5650150"
     CDS             complement(419847..421352)
                     /gene="NT3"
                     /locus_tag="LMJF_13_1210"
                     /codon_start=1
                     /product="nucleobase transporter"
                     /protein_id="XP_001681865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650150"
                     /db_xref="GOA:Q4QG33"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QG33"
                     /translation="MILNFSSLAELYVYTTCVLLGVSMLMPLNALASAPAYMLDYYKY
                     ATRDPNAKPNSPIFWNHILTFYNVASVVTQALVGPTVLTPWARKLSLSFRFFMALTLM
                     MVEVFVILVIPAGGVSQVGAMVAFFIVTIAAGVGKSYLEATCYALVGTMPPKFMSAIM
                     FGCGFSGVLSSTLQCIIKASMEDTYDSVLRQAYLYFSLALGFMAVALAMALSLRFNSY
                     AQEHVGEYRAIKRANEAAKGLNAEETNKAAREEMNGALSSSSKRQPFSTNPVAQGSEI
                     YGDLIDEEAEKARCKAEGAGGSDELSECDEVRAVGRQAGDTCSDSNSDDRNLTTSEQL
                     QRTRAWPVAKFIWPLMASCFCNFFVSLLILPSLIIPVDRTDRWFATIAILLYNCGDAT
                     GRWLSSVKLLWPSHLVLFISIGCRFIFIPLTFLCIFKYIPGHAAPHVLFALLGLTNGF
                     FGAISMVFGPIDTRLRTEGQRVMAGQLMGVSLLAGASLSALLAMAIVPFLP"
     gene            complement(<422931..>423752)
                     /locus_tag="LMJF_13_1220"
                     /db_xref="GeneID:5650151"
     mRNA            complement(<422931..>423752)
                     /locus_tag="LMJF_13_1220"
                     /product="putative 40S ribosomal protein S4"
                     /transcript_id="XM_001681814.1"
                     /db_xref="GeneID:5650151"
     CDS             complement(422931..423752)
                     /locus_tag="LMJF_13_1220"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S4"
                     /protein_id="XP_001681866.1"
                     /db_xref="GeneID:5650151"
                     /db_xref="GOA:Q4QG31"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="UniProtKB/TrEMBL:Q4QG31"
                     /translation="MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVI
                     IRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVVEIPKTGDRFRLMYDV
                     KGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN
                     VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATR
                     AANIFVIGKDLNNLQVTVPKQQGLRMNVIQEREERLIAAEARKNAPARGARRARK"
     gene            complement(<425611..>426432)
                     /locus_tag="LMJF_13_1230"
                     /db_xref="GeneID:5650152"
     mRNA            complement(<425611..>426432)
                     /locus_tag="LMJF_13_1230"
                     /product="putative 40S ribosomal protein S4"
                     /transcript_id="XM_001681815.1"
                     /db_xref="GeneID:5650152"
     CDS             complement(425611..426432)
                     /locus_tag="LMJF_13_1230"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S4"
                     /protein_id="XP_001681867.1"
                     /db_xref="GeneID:5650152"
                     /db_xref="GOA:Q4QG31"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="UniProtKB/TrEMBL:Q4QG31"
                     /translation="MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVI
                     IRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVVEIPKTGDRFRLMYDV
                     KGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN
                     VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATR
                     AANIFVIGKDLNNLQVTVPKQQGLRMNVIQEREERLIAAEARKNAPARGARRARK"
     gene            complement(<428139..>429875)
                     /locus_tag="LMJF_13_1240"
                     /db_xref="GeneID:5650153"
     mRNA            complement(<428139..>429875)
                     /locus_tag="LMJF_13_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681816.1"
                     /db_xref="GeneID:5650153"
     CDS             complement(428139..429875)
                     /locus_tag="LMJF_13_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650153"
                     /db_xref="GOA:Q4QG30"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="UniProtKB/TrEMBL:Q4QG30"
                     /translation="MHQKKRKTRHTRTLRPCPLHGSSAKVTVDRLSSVMSHLETCMHL
                     DTQPALHTRKLCSCNAVLALGRTDAVTTDTPVSDTSLFGVILLNSPANTEEDFASYIR
                     FFERHRGRVTPASWAREGEEEADATPVSRAPQEHCPYFICADGAYAALKKYCTQHDIS
                     IAGSGSGSGTAEQGAFIASRLCDALIGDLDSLPATHAMLLADAGDAEIVLAAAADAEP
                     PRRRDDGQGTNSGDKRLVFHDNVNSIPVTLLEKVRRRRDAYRHREVSASSATPAEPFV
                     LLPVACQMSTDFTKCVALLQRLRALDVGMPDSLNGVDPLQGFDQEAPLAAQSPDVTSL
                     ASDCVALLPEALSTAEMQAGEDRQEADRCRCLLESVTPSAPFTTKQPAQGLETRVLPN
                     IAVLGALGGRIDHEFGVVCCLLCYARVFHIMVINKYNVLFACWPDGVTQLVLPPLWSS
                     SGPATRETAVPYMCGIIPFGFVREMETAGLRWNVVKGRPEVYDGYTQTNSYRLAFDGL
                     VSACNIVTSPVVTIDVRPLHCALGPCCPGSVAPMKCSCDPDAPSINPPTLFTLGLPGV
                     CPDYPADAPASL"
     gene            complement(<430849..>431502)
                     /locus_tag="LMJF_13_1250"
                     /db_xref="GeneID:5650154"
     mRNA            complement(<430849..>431502)
                     /locus_tag="LMJF_13_1250"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681817.1"
                     /db_xref="GeneID:5650154"
     CDS             complement(430849..431502)
                     /locus_tag="LMJF_13_1250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650154"
                     /db_xref="UniProtKB/TrEMBL:Q4QG29"
                     /translation="MQSHPPAPTPTPSSFATQLCEVQHTRPHDRPGTHLNNLQVQRKE
                     AATPVRQSANHHRHTRTHFGKRAKMSGLEKKDIISTPVPFPTIPIHAVPRSKRSWVQN
                     NWWVLLTIECLVLFAAFAALLAYYLFYVRTPGKRLLEDKVGKDGLSHYSSEFSSRSSS
                     AELKESRASKCSTTTKRSFAENAAGGTADSSKSHRSMPEVVSAQSQHSKTTGSHKRD"
     gene            complement(<433720..>434298)
                     /locus_tag="LMJF_13_1260"
                     /db_xref="GeneID:5650155"
     mRNA            complement(<433720..>434298)
                     /locus_tag="LMJF_13_1260"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681818.1"
                     /db_xref="GeneID:5650155"
     CDS             complement(433720..434298)
                     /locus_tag="LMJF_13_1260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650155"
                     /db_xref="UniProtKB/TrEMBL:Q4QG28"
                     /translation="MSLEQQWQRQQLLPVLPGAVDSLSADKLLLVPPRNGDVVAAVPR
                     VVELSIMDDAIRYALQRILLYGVPIAANMVIRDLDYELGGSLQPLNESWPQAYKWAVV
                     LIIVFSIICFAVVGLVLAYIVFERRRETQDKLKRKGHSKSDDDAYSHSEHDAGSLPQG
                     DSYAVEESSDSSYDSFDDEEEGDEWSSSSDEV"
     gene            complement(<439153..>441732)
                     /locus_tag="LMJF_13_1270"
                     /db_xref="GeneID:5650156"
     mRNA            complement(<439153..>441732)
                     /locus_tag="LMJF_13_1270"
                     /product="DNA/RNA non-specific endonuclease-like protein"
                     /transcript_id="XM_001681819.1"
                     /db_xref="GeneID:5650156"
     CDS             complement(439153..441732)
                     /locus_tag="LMJF_13_1270"
                     /codon_start=1
                     /product="DNA/RNA non-specific endonuclease-like protein"
                     /protein_id="XP_001681871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650156"
                     /db_xref="GOA:Q4QG27"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:Q4QG27"
                     /translation="MLPRRVALACVGLSSLSLCFLLLSMRGSLLPVLLSPRAVCFRVF
                     GAMVVVVGGFNKHLRRSTRMESVPAKPAAVQPSTLGSSCDCVAPAVSLPSLFFLFPQC
                     CAQAARRLLHDCTYFAAGPRRGARAQPTPTSSLSSPAPSQPLKLWLTCATAAVAGTCG
                     AIVGARLSPWLSRRAARLYTQREAKYRNPLWLLPSPAAAPWPGSWWWRRLWRTSTHRS
                     VSETRRLDYGHAAEWLAACTGCRWLPQRLSRPTLLKLYSPARHSRQSSADRNTAAEVQ
                     WGTRMVNKGTHPLAKRSAVAAASKGSTTSLAASALFSIVHFTRAPLHQWQPLPQHAVD
                     VFVSATCQNTENRRSATLAAASPLLCLPRQGFALLYDPVARLPVWCGYYLTRETVDRA
                     RRQNRCITFFTDRSLKKTTRRVPAELKARGHDRGHLAPHASVAASPQAAIEAALLSNV
                     LLQHRQINRGVWRWLEAATRAYVRHLPLADVPHAVAMQQHRVRRERSTGAVGAGAAPP
                     SEAATSTQAGPTPAPPRHGAGCKRRRGRPPKSASPLFASPARCSSTCGQAAKRSSRGG
                     SRRGLPRDSELIARLLAAPGVGSGTGSHLRLQGDGVWGCVARTLRCCREWWRWWWPHC
                     SGAAFHRQREREVAVNVGPLYYKQTNDVGQGSWRGSGTATGRTPAIAAASSDAVALPL
                     LCCSRSRQAIQRRGPGNAASPPTRPSPPPPPPPQQSLLIPDAFFFSLWNVHTHEHVHL
                     IVPNHPDAASIRAFTAVVAPRRSTAAGAAASRWPSDDLETALRSLVVSTVELEQLFAE
                     SLVELRSRCVSAGVTDATSRDSMRNINRAASSVALRTHFSLFPVYRQRWMWRHCGSGG
                     GSR"
     gene            complement(<444335..>445318)
                     /locus_tag="LMJF_13_1280"
                     /db_xref="GeneID:5650157"
     mRNA            complement(<444335..>445318)
                     /locus_tag="LMJF_13_1280"
                     /product="putative XPA-interacting protein"
                     /transcript_id="XM_001681820.1"
                     /db_xref="GeneID:5650157"
     CDS             complement(444335..445318)
                     /locus_tag="LMJF_13_1280"
                     /codon_start=1
                     /product="putative XPA-interacting protein"
                     /protein_id="XP_001681872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650157"
                     /db_xref="GOA:Q4QG26"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QG26"
                     /translation="MVDTSSSAPASASPAITTSAAATTPVVILVVGMAGTGKTTLVHR
                     MQHYAHTNGIRSYFINLDPAVTHTPYNVNIDIRDSVRYGEVMKNYRLGPNGAIMTSLN
                     LFATKIHQVVSLLEKKEEMLDWIIVDTPGQIEVFTWSASGQLMADSFGAVFPTVLLFV
                     ADTVRCVSSPQTFVSTMLYSSGIMLKQQVPLVVVFNKTDVVSADSVIAWMRDNDALDE
                     AVTNPHRSNRSRRAVSGEPGDGEDADWRGEGTRIGAAALGSQDALLANQGSGYAGTLA
                     QSMSLFLHEFYEDLPYAAVSAASGAGMSELAASIERGKQQALEAKAERSAH"
     gene            complement(<446764..>449550)
                     /locus_tag="LMJF_13_1290"
                     /db_xref="GeneID:5650158"
     mRNA            complement(<446764..>449550)
                     /locus_tag="LMJF_13_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681821.1"
                     /db_xref="GeneID:5650158"
     CDS             complement(446764..449550)
                     /locus_tag="LMJF_13_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650158"
                     /db_xref="UniProtKB/TrEMBL:Q4QG25"
                     /translation="MAEAVDRCLTAAQNSERDEEGCRNSGSPYRECLVTPTRTAAAKA
                     RQHPVTVAAPQARPTFTTSLASSPRSAKMESSSRGIDKLPQQRQQPVSPGSPSSHALS
                     STAVPVQHLYRVPSAFYAHNSVTSSAVLSAARSHRGRGDTFTGLASPRIFAEDSTHKQ
                     VRLPPEVSCSPSGMDTLEERARRAAELHASCGIREEAETVLPWSTGNRSGKAGWSLVP
                     VSSSLLTVQVARGHRISRHPSGLGAEERSPLDVASVRLVPGSKRWRRPERMGSSADVR
                     LDQRLSCTSSHDGGGGAAVPMRCLTSPSASSSSSVALASPQSPATALVSATAPARGIS
                     ATRLPAPSPPFNALLAAFGPAQSGIAALTAGVIDPPLTTPTVPPTRPPAWLRPWLSHA
                     LSRTMAAHLERDADTVTAAASSAATSTQGLDSFPPVAQATTATASAASGSAQPRTLRS
                     ALLLIFDGLERFEADLAEVLLGGPKTHGSSNFFQGVDVRDCRASFAFSPSPPAGAAAS
                     GVFDGLVEQLRRLTRQWCEVLSQWPCEAATLGYVEWWMVHPAWTDLVTCDAAIPATLS
                     ASSATPATTDRKTTAGRRTETSHDGERQPPQPQPQESAVVLQGILAAAVTEGMRTLLD
                     ALVDAFVRAVSELLHSTAVLGPPRSASQTTSCPDLQAEVAAAGFAKAQHTCLALLHLL
                     TSLYVSPPRVLQQLRTLVQADVCCGTAVTGAAANSDGKTTTRHEDEGSPASPSSLSTA
                     TAAVVAGEDRQHQPHPHPHPSPSSLSTPRGGPPGSPSVSRVGVSALDTSQLRSRACQL
                     HYQLLYAVCRLCNELPMLWQPQDDTRDAEGDEESNGVRASSAAYMHLSPRRRHHGECE
                     RVKLTLFSTAARLAATVSALLLHVQLPMKGDLLCVASRLAQWRATLLRSSCMSEREYA
                     AAMGHLCALMAQAT"
     gene            complement(<451354..>451944)
                     /locus_tag="LMJF_13_1300"
                     /db_xref="GeneID:5650159"
     mRNA            complement(<451354..>451944)
                     /locus_tag="LMJF_13_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681822.1"
                     /db_xref="GeneID:5650159"
     CDS             complement(451354..451944)
                     /locus_tag="LMJF_13_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650159"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q4QG24"
                     /translation="MLRTSLVARRAAAEATGAPVSYRHREKIRLYRSLLKGAHSFPMR
                     SRRDVITEEVRSTFRDPNNEILSEKDIDYRLVLGWERAKSIKTYAENMHWFHSRDEVT
                     KEMMYFSEERDRKKAAEMRRFNQVGDIRCKTEEVTDFKSTYYNVHPDYHSKIGQKPLT
                     HSRDVWRARGQYGSDVGGPRQKFFVRRFKAMFPQGW"
     gene            complement(<455170..>456432)
                     /locus_tag="LMJF_13_1310"
                     /db_xref="GeneID:5650160"
     mRNA            complement(<455170..>456432)
                     /locus_tag="LMJF_13_1310"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681823.1"
                     /db_xref="GeneID:5650160"
     CDS             complement(455170..456432)
                     /locus_tag="LMJF_13_1310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650160"
                     /db_xref="UniProtKB/TrEMBL:Q4QG23"
                     /translation="MQLGGPAASHHVGGARHCRLVVLSVAVLLVVLFSHGVEHAQGFA
                     FVPVVNTFARPEGSGHKIESRFVCQERGGYIAGEPTAAAHTAVIEAARGAGAGTEWYA
                     YLGASTDASPASECPPPLTEHIPGSGAGSSFSCYWRWNQGRWTETDDNPALPLHISNA
                     GVTFYIGNYFGEPTSPSVDVYGVQGGFPSWFNATAPKKSQLRPSSMFGRDLLAVGNGD
                     TSTWSDNKASGGYTYAGFLFSSIYNSSRWKEESQRASQAFFWAVCQTQGPSRVMYELN
                     DTSSSVQNNWWAIFFSVLMVLCLVVFIVTACCQDNEGMDEPPEDAPEWAQEEANQATC
                     TKSFVSTRSFVQQCSQHASGDDDEDMENWVQEFDTRQGSMCGASHGAANQMPPNQYPN
                     PFSNPSSADTEGVHRLCHGDKKTTGHWM"
     gene            complement(<459621..>461015)
                     /locus_tag="LMJF_13_1320"
                     /db_xref="GeneID:5650161"
     mRNA            complement(<459621..>461015)
                     /locus_tag="LMJF_13_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681824.1"
                     /db_xref="GeneID:5650161"
     CDS             complement(459621..461015)
                     /locus_tag="LMJF_13_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650161"
                     /db_xref="UniProtKB/TrEMBL:Q4QG22"
                     /translation="MRSCAALPLAALLVLLTLSGMAEVAQAQGLPGLLTLQMKGYMSY
                     SASSLSSSGIEVTYFTTEEVCFDAGGVPASDANTLLSNEVAYWMTVNGGGRDSTIYTG
                     SSAAPSLPNTNCAELVPGDTAPNSDNCYYRWRYGFYDMYSYNGEPGTAYWVGLYRRKT
                     GSSQILNQFQQFTWNPDHPADKPYPRGYFGGAASYDTATNRLLRMDAPLLPKNNDPYP
                     TGKYMMVCEYQLYPVRPPVTTRMPQPQFVNGFKTLTWAQLHWWLIFLIVAVIVLVILF
                     AIVIYCCCTSIKPKEELPLFQMVIRERVGKAYVVSDQPPTMTQQPYAVPGLAPQQHML
                     SPEQEVQRRQMRYGRGFNPNQQEDTEDATMGATGIYSVGERRQYAGGTQSENPVGNLI
                     QRNFDEGESTLPPEGPQSGMEEKDEEGAYQEPSAVLSTRRSSRRNRGRSISQTFGDVE
                     MPQAGEIDESDVNL"
     gene            complement(<462983..>464458)
                     /locus_tag="LMJF_13_1330"
                     /db_xref="GeneID:5650162"
     mRNA            complement(<462983..>464458)
                     /locus_tag="LMJF_13_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681825.1"
                     /db_xref="GeneID:5650162"
     CDS             complement(462983..464458)
                     /locus_tag="LMJF_13_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650162"
                     /db_xref="UniProtKB/TrEMBL:Q4QG21"
                     /translation="MGGVAVAAATAGSVVDGNGQAQQAASLFLRDVKHVLRWHAVAAG
                     MALAAIPVVYQVARMVAHRYRGELVNLAKDAVQREELFNGAEADGVLIDPAEEGGVSI
                     SYKSNAKDSREADGDADDDASALWARPSRSSSPQPASIFALRVGRRHSWVVSSFAYEV
                     LAAQRAPNAQFVRTCSRAAVCQYGVVVLRAATTSCLVSVASFIVLYAGCRSVDYAVPF
                     GAAPAVDGAKDLSPRSLLRAFATDSLFTTAAPPSPAVNSTYGLYSFGVSAAGVWSRLF
                     PRFGAVQTLWQRLAGFAQPLHAEWRDGSATLSSSLPLSSQHALADSVWASLSPRGYFI
                     VSLLPRLPPRIAAGLSWLVRDTSTAVMRRFYAASSPVSPKAKATAPTAAAAAPPTPST
                     SASTGAPAAVDPSTPALSKRRRRRQPTRLIDSPVVQMAAVLVGDITFAGIVFLATSYA
                     NSSSPSADSPRWPLVLNNANTRYDIYCWAQAVRSTFSVLGI"
     gene            complement(<465658..>469824)
                     /locus_tag="LMJF_13_1340"
                     /db_xref="GeneID:5650163"
     mRNA            complement(<465658..>469824)
                     /locus_tag="LMJF_13_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681826.1"
                     /db_xref="GeneID:5650163"
     CDS             complement(465658..469824)
                     /locus_tag="LMJF_13_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650163"
                     /db_xref="UniProtKB/TrEMBL:Q4QG20"
                     /translation="MSRRALFASDSDDDSADVFRLAAAGAGDRAMSGTSGSSLAKDPL
                     SAGAASQLHPSSLDSDRRSTAAVQLPESSKLTATRQNLSQLFCAGPTPLTMRGMSSSP
                     NQPPAMQAAAAGNVANGASVDTDSGATEATAFFAPRFDYDGNGATGAAGGAAAALAAA
                     TGEAAAGLITAEHAVVQAYRDSLYSGTCMLALCVPLGTASAATTSAALPPSAALRRHL
                     REQQEAVAASKAATGGPTLLLISSNRQVLCRVALDATDAVFSSDSLRLRQDAAQPQYL
                     TFFDIGCTGICGGSSAERFAAGGGGSGCWWMCMFPDRDKASRFLISTYTVAQYAAALA
                     QRTGTASAPVPSVRTLPALPPSKRDKAAASAAGGAPDMVRPDVPATICWQTWTLRRVS
                     RETVYCVLGSCVEAVPPSAPRTVAATDGTLWDAAAAALVGMRTGESRLVFLTPEDTRV
                     RQSKSRTDSRRSDRPGRSAPQLALNTSAVIYMTCLQAASSPVGTPAPSTPTAARDLAP
                     PLPPPPPPAPATAAAATRVSVSASLPAAEPSQAPGADDALSTNALLQQLLLHFLQQQP
                     QQPLPSASASRQGASPQVWESIECALARVQVQLGSVYEKLDRLDIEATLQRNNAELER
                     VMRRVVGRAPQEEVAIEDALKNREELLASIERHRHKFEEANANYQRALEAMGRLSDRA
                     QALERDLRLQQDIWAQQRKDEAEQMRLRLVERDARHRDELEIVSEERYAAGRSDGHAA
                     GYREGRQATLLEVEGSGTGGDGGGSVVMQWREKLMAKDQEVIALQTALQDAKFRHDRD
                     RRQLRAEIDVLTELNEKLQHLQANADVRVPEETVQQQCKRIKRTLNAVYNQVEEQLLQ
                     LSSLERRSQPGGRRSLPTVDEGNSIEGEGEALDADGSGSSGVVAVDDVLAIVTVAIRS
                     EAQVAVTEIRSDGAQRAAANAELRARTLARRSGQYTTPALYDGHRPSTSSALLVGCGV
                     EEEAGGLKVEPSSLAKRASTPPPLPPVHTAASQDALAAVAATLLPKVAQAASMKASAA
                     EGAAEATFHGDGHLCEGTAVARATASPVAAEEPFHSKTGTQWGDGGNGGAGSVACQPY
                     SAPAHADPGATAAASVLSSAADRKGANFRDVGADSLHSALSRSTTAPIPEIERDLVEA
                     RAGKALRWNVGDRADGGGRAFSSAFIAAGGAADDAAAARASAALWSSPGVGDEVQRVP
                     TPNATAASITTTSSTPTRMDADSPFTMNRAHVALEVEHAADTEKAPMPRCSTDSLSPL
                     STPAKQGRMATRLPADAPALPPPPLSAPHSECDDGDGTRLGDTAIGDSPSASMREAAC
                     VREPRTDASQQALPLVPPVLPNDTPLVGAAADRATPSCDAQLFSSPSTALRDWQGSRL
                     FGSPPSTGGE"
     gene            complement(<471477..>474917)
                     /locus_tag="LMJF_13_1350"
                     /db_xref="GeneID:5650164"
     mRNA            complement(<471477..>474917)
                     /locus_tag="LMJF_13_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681827.1"
                     /db_xref="GeneID:5650164"
     CDS             complement(471477..474917)
                     /locus_tag="LMJF_13_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650164"
                     /db_xref="GOA:Q4QG19"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QG19"
                     /translation="MPRVSVFLSYADSFVGTRLLRQFQQYPSHYDIYGCVWDAAAAEQ
                     LNAAASAAQQQLQQPAAKKRVGDVTGEDNSVLEESYTSLVPGVSARAHTALPLEESGS
                     LEVEDSHLAAGVDGVTATVAGTDGREKPLKLHASCTFFSRLDTLAVRSALLACDWIVL
                     ELHQAQTVLEVVQFLQMQPSFERPKRLVLLSSLMTWYATPSLEEAEAAAGDGDDEGDS
                     PGADGEEDVEAPYPPPPPRFLESILAEVQDRSRHAVVDAMRGDASAAKDEDNSGGDGE
                     DEDREAVASGASAEVLTEDQYNRRVPHLQYLNWRDAERATAAAHHANGLPLDTFVVCG
                     GLPYGGEEDVLEPLFRLAWSAEPEKEDEHAATSATLPIFGSGHQRVPMVHVQDLACFV
                     RKLLRCPADALPFPERRYLFATDGSNQNSWQGIVSAVNRMFGGRCAMHPVAPESYPLY
                     RDVERFTIDLRVEPETMRIIMARTEDAEEGAESSDAAASAQQQLPLPNTWIAEGGIRR
                     HLRAVADEFTAAHHVQPHRIAIAGPPLVGKTYLARRVARYYRLPRVSLDSVVLDYTTA
                     LKELRSRVESTKTAVREAERERRLGLKRRRLLARQQREWDAQAERLDASLAGTREGVG
                     SPGNNEQDSVEAADLASHGSYPAGSSANRANNYSEPGEAPTGTGADACVATVAVHDDD
                     EVVATELALTQAEEEELDTFVSEWWAEQPQAHAWISKIAEMERVLLLRLHQRPPTPEV
                     NPKKKAAAAGGGGGNAKKKGNKDAQKTREEEEEQQQLKAALQHAPFQPRALALMLRWR
                     LAQPDCQVQGFVLDGVPTTLELARLVFGDSEDEQLQPPLTEEEALRPRYANEGGAPAT
                     AAAGAPDDGHDDKEAGAAEAAPPKEPASDARLPNHVIVLQASDTYLLSRLKAMGAASE
                     EGAVNVCGNDDATRPVDVEAFYHALQTYKREYVDMPYSVLSYWECAAATTAPLLSTGS
                     AMGEERRAEVHLVTVEGNEPLVPPLPPMSAYAPPQLSSTEKLLGQVILGRPHNFGKSL
                     EEIQREAVRQRCLLAEEENARAQQIAAQAAAESLECEQESEARSVAEERLLALKQADV
                     AELEARKRPMTNYLQERVLPLLHKGLLEVCATRPADPVDYLAEWLIRHNPHDDIFCDL
                     "
     gene            complement(<476555..>479068)
                     /locus_tag="LMJF_13_1360"
                     /db_xref="GeneID:5650165"
     mRNA            complement(<476555..>479068)
                     /locus_tag="LMJF_13_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681828.1"
                     /db_xref="GeneID:5650165"
     CDS             complement(476555..479068)
                     /locus_tag="LMJF_13_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681880.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650165"
                     /db_xref="UniProtKB/TrEMBL:Q4QG18"
                     /translation="MDCVNHVTSDADILPCKSDVILSKTSSANFTVGTRPLLASHRRL
                     LCMNVKQTNMLRVLNRHGKHNDTTIKAAAVANLVSTERITGHPTLFYAVGGRDLAIIC
                     PTTQANGDISVSLVESKLDEEGYASTAGESQRLYVLGQQDVMEVEESTGIVKSKIPLT
                     PKTTVKYPVIDYHQASQLLLVPAKSTHLDLISTRTRKSVLGRVWEPHEDTVPTFACFF
                     QHHAFSEESGKELLIVTAAQGNREIRFWAYQSDTQKFALKQQLSLSYKGEPKEEYDIS
                     VTADEEYITLCSRTRPYAVVIETHHTLFKAYRVTSWRMAGPALCSTTSVGKVTESAQS
                     KSVSYELFITIRTETGFVQSMPNSSRLAGASNLAVARGDSVANWFPSLAAGGAGAGRD
                     ATGVSAGVGATGAAITPITAVSSSLAGEIKTSSMSETAVASIVRSQAQKFCEQVKVID
                     ADLVSMQKSASDTMRLLQDSRYRTEAQNSGRTFAIRNRARLEKITSTAPSPASMKPAA
                     VPVAADAAGSADSEHGVLTAGERELVLSIRNFVQEVQGGSAAAASAALKALLSKQLRL
                     AVERAANEAGKLEIPTSVTGDFNTLQSVQEYRRVVNASITRISTATKRYQELNRTTVE
                     ASSAQTATCLAQAEAFRQKLSSALRSMKEEVAEVKVALSQCQLSSKAAEEAAAPPSPD
                     AILARAVGQAKEDDWKGAFTTILASNDISILLAFLENEMCREQQAVLTSPKTLTLPLF
                     LSLCLQLTFEMPLHAGAVPLRLQLLSDFYVEWDDWLRTIRLQAQKDSQQALVYDVVKR
                     ELSTVLEALEAVPREQLDRKSRNKERLVHKLISQLLTDE"
     gene            complement(<481459..>483552)
                     /locus_tag="LMJF_13_1370"
                     /db_xref="GeneID:5650166"
     mRNA            complement(<481459..>483552)
                     /locus_tag="LMJF_13_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681829.1"
                     /db_xref="GeneID:5650166"
     CDS             complement(481459..483552)
                     /locus_tag="LMJF_13_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650166"
                     /db_xref="GOA:Q4QG17"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:Q4QG17"
                     /translation="MNFGACPADIEDDEVVASFNVYASPALVNQAHIFQYPLRRRQRP
                     YEATEIKLFSTSGTVAEESEALLAQGKGSSVLQPGSRLTMKCSLDTFGSPSFRPLPEF
                     APDMLGQMELQRHHTFNYTLQSQPFLPQSNYVLGYITLEGIHLTPVSTIQQFTPALSI
                     PESSTGAVRVTEAFCSQSNSTAMPGFAAADRIQRELRRQRSRVLNGEADTAQEIQFFR
                     DDSVESSAMRSRLCSSTLERITGNLNAASEPAEVENSLFPPEILQSGGISGGDEAHPS
                     MIIHRFANCKSVAEQTNQLLQRCHILTLQRLQNIVVPYTSNEVVKTMSTVPEAQLVEA
                     LKSCAVWLHGVWVSRYCDQFRGSVAALREVILARFYQSEDGSVARADFNAWITTSAAR
                     RSIKEILATVAVLNTDEPDPSKRRWRLKYVPEDRAAREANLRDFKAKFAAEEASQHEA
                     WRRRCAQVMAHIPYINAGRPVSQLCLRPRSTPPTTGTAASATLPYGSPNAAQSIAPSV
                     SSMTSGHSGSGVTASASPFSSPAPGADLGFKDADIAPIRHYIRELFAEHGVINKQRVK
                     DLVIKAQEARYPHATKAMLSTALQQCLDKFTDATWILKSAGEPIVDYYRPAILYVVLE
                     LRQFEMAALMKRLEEVVRARGLTSPPESAALRGRIGGASGTLEAVVQRVVAEVAEFKA
                     GGRLWHIKGGNLMNE"
     gene            complement(<484577..>486343)
                     /locus_tag="LMJF_13_1380"
                     /db_xref="GeneID:5650167"
     mRNA            complement(<484577..>486343)
                     /locus_tag="LMJF_13_1380"
                     /product="putative endomembrane protein"
                     /transcript_id="XM_001681830.1"
                     /db_xref="GeneID:5650167"
     CDS             complement(484577..486343)
                     /locus_tag="LMJF_13_1380"
                     /codon_start=1
                     /product="putative endomembrane protein"
                     /protein_id="XP_001681882.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650167"
                     /db_xref="GOA:Q4QG16"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:Q4QG16"
                     /translation="MGLSSLLTLAALVCMLCMRAASASKHTYLGGDEVKVFVSKMHPH
                     GNTHETYSYAFVPGCPLQEETSLTLGELLAGESIFTLATDIRFNHNTSNRFLCKRKFN
                     AYEANMLAYAIEHDYRYDLTIDELPVWGAIGNKIDDNHLSIFLHQTFYIGVNGNEIVN
                     VTLETSSPAKLEINTDYAFKYSVVFEPSSVEYANRFSTVFETRYVGSRTRLASLINAS
                     LIVLLLLSLIALILSRTLRSEHAKMEREAQFRFEEQDIIDESGWRCLYADVFRVPRHT
                     GIFCAILGCGTQLLLLTVFAIFLSVVSNHRISMSHNLVTFSVFGYACTSGIAGYVSGY
                     QFMGCGFLAPPMASKWIRAFHVTFFLVPVIYVTAFFPTWFIAMIYGTTNFPYFAGVIV
                     VLFVWVFIAYPLCLAGVLCSRYVFRRTERRRNIPHVNQIPRLIPQPPRKLLAPCYLLL
                     VSGILPFIVVFVEFNFVFTSIWSLRPFHLYGFLTITAIFYIVVTACVSVVATFVLLST
                     ENHYWKWMSIGFGASCAAYTFGYAVFFYLFKSSMHGLFMFLLYYAYCFVIMMFLALIG
                     GTVSYFAASYFVKAIYAQAKND"
     gene            complement(<487532..>488737)
                     /locus_tag="LMJF_13_1390"
                     /db_xref="GeneID:5650168"
     mRNA            complement(<487532..>488737)
                     /locus_tag="LMJF_13_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681831.1"
                     /db_xref="GeneID:5650168"
     CDS             complement(487532..488737)
                     /locus_tag="LMJF_13_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681883.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650168"
                     /db_xref="GOA:Q4QG15"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR024884"
                     /db_xref="UniProtKB/TrEMBL:Q4QG15"
                     /translation="MAESMQSKPSFEYPKRAAIGSYWSNRNRDEKHFKNLGPASLSSA
                     SAGKVMQWMLSHTCNGVPKPKGGYDAFGKIWYAPCNMAESVAQWRASMSNDEAQPAKN
                     RVYWIGHSSQLLCLSNGINILFDPIFSQRASPLSFAGPSRRFPPAATAAQLPPIHIVT
                     VSHNHYDHMDKQSIKAVAARFPDAHFVVPLKLDRFLREWGVPGASITTLDWYEACEVK
                     GVRVGCTPAQHWGKHSAFDDNEVLWCGWCVGWQPGQQQQPASTCEKPTLISFSGIEPS
                     SEALVEAQRTWNRYKKYFFAGDTAYNPDVSTSIYAHFGPMDMAALPIGAYSPRWFMAR
                     AHIDPEHAVQIFKDQHIQQAVAVHWGTFELADEPLDEPPQVLRKTLKDASIDENRFQI
                     IPMGKFIEF"
     gene            complement(<489201..>491174)
                     /locus_tag="LMJF_13_1400"
                     /db_xref="GeneID:5650169"
     mRNA            complement(<489201..>491174)
                     /locus_tag="LMJF_13_1400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681832.1"
                     /db_xref="GeneID:5650169"
     CDS             complement(489201..491174)
                     /locus_tag="LMJF_13_1400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650169"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QG14"
                     /translation="MPLLPPHLLEALVAECGETTLPELAHLWKRETELAQAAACGDAL
                     AARAIAEGGRAPLNCVGRRLLHRHAREEPVTVMDHLGTLFASAASSGDTSVAVSMFHP
                     VPVGITCLPHPSAVRCTKLWEGSAFTATPSRSNAGEESDTPLQGALQRWHDAVHAAEP
                     TAVYVFTGDDAGLVRLWRVDVVARSYTLQHVLMCSANMTGMLSPLSPFAREDNSKKVP
                     SRDADRVVHCLEVDELAGRVFAGTEGGVYVWAINALPWRGAESPSADALAAHHPLCWD
                     EERQAPLPCALLRYEASLRRDSDADNILPTASSANSEKIVEYRASRLANHHVWVLPAS
                     LVQSEIARAMERGGSSAGLVSRWKPKHGRMVTGGAAVGVVWNTVKLSTAAVSGRGATV
                     GDRLTDTVVPVSFEGGELRNGLRVPLSCVVPVVYPLAFLRTPGTACFALRVLAGNRRL
                     VTSCADGRVCVWTCRPDKDACTAVAETYVPQLVTNTRQEHRGLGRHVCVLRTPDVFVT
                     CSYDDGLVKEWHVYDEPEALLRCARRFTLTPYSSEGGRVQQQQQQLADAFTNMHKPKT
                     ANAAIAGGNSDEVSADDGEDGDVVGGISCAAAYPAFGALFLVGVFESVIQTYSLTEVA
                     GCEPPRNYVYNGHKTVRLPASMAEDVYHKLPAK"
     gene            complement(<495278..>499507)
                     /locus_tag="LMJF_13_1410"
                     /db_xref="GeneID:5650170"
     mRNA            complement(<495278..>499507)
                     /locus_tag="LMJF_13_1410"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681833.1"
                     /db_xref="GeneID:5650170"
     CDS             complement(495278..499507)
                     /locus_tag="LMJF_13_1410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650170"
                     /db_xref="UniProtKB/TrEMBL:Q4QG13"
                     /translation="MQRQSSTKSGCRNASELSPVRSSAYEMRNRESPPPMRSGSPLSP
                     SAIFVKRAVSNGRPHALSGRTNHGGDEEQKNDEGKKRGSSGSARTTSRGSATGSTPAI
                     ATTCAALLVSDVPDPSSLAPSSVPPLSHSSISEISSAHNPRSVSPGDSSSRQVTGMHK
                     SLLVFLPRVFRATGMPPPSATTPVSASDALVTPLSSPTAVAATSPMSPEGVALPNQLT
                     YFSIGGSRRRNSISVPTSPFQVEGDRAEDSFMEDIVGGAGERWLVDTHHRAVPDRNSH
                     AGARLERPTASGNVTATVADSVDRTTTRSSRNAHHASEDDGTASHANSAASTRSSSSP
                     PSSPSHTARSSAASRSSAAGVAASAASAASTPVPTSHNVPAPPPISTAPQGSRSAVNA
                     GNRSLSTDHAHHSLIIAPPPSPLVSPVAISVAGGRAGETTSPANRGGAALSRCDSQSP
                     SPSLRFGTHDPYNTSAIVATPLMSGVPRTTSFTSYRSPSATTTPIGPGIVHMRMRNTS
                     ALANGSAGGGSGGNAADSGASFLYCAVANSDTMSVKSSMTGVSRGTHDGIMLWAATGG
                     PSKLPSSSTWEYFLHDPQGPYGGCAAPQTARYAHEEAPASTPTPSCAVGDNAVDASSE
                     AADQQYGSEQTPSEQPYDPQHDYSLQQHSVQRHQVQRADRYAPSYEQRQQQHPHPHPV
                     HEITGQCQPFEPQQQCDHERHEQAYQSGYPHLRPEQQHQHKAHNYPQQHVNSQQQEQH
                     HRHPYSPAFEPHGLYAYQAYAGQPQQYPPPQGPYSYASQPPPAHVHAPRPQQQHDHQR
                     QQPPQQAYHTQHSYGGRGGNAGAAAHNWSGPRKRVAQDVLPGFFSVDAIQLGDQTHLV
                     SDRNGVPHEPNEQQQQLCHEELHDVPPLARGSGVDHTPPHRETCHQSCGPAAAPDFDN
                     RGSSLAPTAIPSAPVVQQQQEQQLGRSSSVYYDTTPALSAPGDYSSGSRAGAEFTTAA
                     PSTFPYGSDDDDDEAMRIHGGGMYGSQPRHAEQHEGSASVMTVGGMMVAQPPHMAAPV
                     VSRTPNQRTGYAVNNRGGSSSGPSNKSILLNSNVSGGVNSVEANESGSFRSANSGGGA
                     DIAHVYNVDNSIDICGGPGALTPTLLGAGPNVPVGVRCSDGDIGASATPTRAVYGGYL
                     HHPSAKNYAMGYTDMYVSQPERRTTGSAAATSSSQDGANESRSTSNVLFAPPLPRSAG
                     AMDGGAATHHQPSHSRAPSLQESPITRQCQQRHPTLSSSAADELQPMKSRDDYLPHIS
                     SPSRRRSSIPSVNQPSKYGDMRSPQQQQFQVLSHVPPQLRNPSEGSNSSSNNTGYAQA
                     SAVRSTGAMSGTTAQGVSLSGASLLNHDTGKAAAALSPYPYDARPTKPEREAWERAEF
                     GRVDPGVVPSSIQTFGTSTPTTQQRQHPQKQ"
     gene            complement(<504800..>505519)
                     /locus_tag="LMJF_13_1420"
                     /db_xref="GeneID:5650171"
     mRNA            complement(<504800..>505519)
                     /locus_tag="LMJF_13_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681834.1"
                     /db_xref="GeneID:5650171"
     CDS             complement(504800..505519)
                     /locus_tag="LMJF_13_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681886.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650171"
                     /db_xref="UniProtKB/TrEMBL:Q4QG12"
                     /translation="MRSALITSILEKVENEVRQRLRNAAALASPGPSSAADPPTSLSL
                     LTPEDWSAVRRSLREDATLPPIAAGATGEVESTSASLQPAAASELLQYVQMRCAELPM
                     RLQIEALLTRRYEHLLRQHTRELVTLSEHITLISRTPLTLAPAPRGFSELTPNLAPLL
                     AEEEMGPRLERCKARISELEAMARQDAEAKVRCCQRMVLLSEFVRALVRHAMAHVLKG
                     EEESKSNAAVVTKRPRTEQHV"
     gene            complement(<508554..>510455)
                     /locus_tag="LMJF_13_1430"
                     /db_xref="GeneID:5650172"
     mRNA            complement(<508554..>510455)
                     /locus_tag="LMJF_13_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681835.1"
                     /db_xref="GeneID:5650172"
     CDS             complement(508554..510455)
                     /locus_tag="LMJF_13_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650172"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QG11"
                     /translation="MSVPDLTAEELAYYASLRLEDPDEAALATFLADLEQVHEDHPSD
                     TGAAPSSTVASASGKRGALLTSSRVPACERLDSSDVEGVPPQRRVASVDRQQPSAYAA
                     TGLAIRQISAKLFPAPRSATTDSGTRYGVTQVLEKDNLVGGVAGIADAALQTRCVELP
                     ARQLTSIAPVQCFLNATHVYLQHNALADLEGVELLSQLQVLVVHHNQLTSLAPLQQLE
                     CLSYLDVSHNNVSSSVDVLLRDELPCPSLKSLNLSNNPCWSRCGEAVSDGDGGERHRA
                     YVQQICTACPLLERLDDVVVDDGEEVMQHSDNSTESDVKDVAERRSASAAGAAPSQAG
                     GITVRRVHNSVEAARAASSRACVHDIHTRSSLAPPGSLVSGEAELSARPPRSAQVNKA
                     RLLEEEQARLVHQLFLRRAVGTAPGSAKAVDTVSTSPLHSNRSSTGSGHFHPGDAATE
                     APTEQKANQPADSTGDVSALYSTRGDILHLYHSLQFTQEVSQARLQRDVAAHWDDVSR
                     VLQTVQALQQDRRRRIQQRLQEQTSAYTDSLIMLEKESFTKDLDRYRNSDGSRRAAPA
                     GIHAAASAPAAPPAVDTPNGITAVAHTSAAVDGNCASKASSTSTHPPEKPKGKTKKGP
                     SVPKPPPRR"
     gene            complement(<511015..>514821)
                     /locus_tag="LMJF_13_1440"
                     /db_xref="GeneID:5650173"
     mRNA            complement(<511015..>514821)
                     /locus_tag="LMJF_13_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681836.1"
                     /db_xref="GeneID:5650173"
     CDS             complement(511015..514821)
                     /locus_tag="LMJF_13_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650173"
                     /db_xref="UniProtKB/TrEMBL:Q4QG10"
                     /translation="MYSDKGDSRSSAHADLSLAPSGGPWRLRDAVLAEAAAKAWPLTF
                     LGTLEQLLEMANVVAAVDAHVRECAPALAHHASRGPAEMHGAFTHDVTEMCGDVQDAS
                     VALEATAARSLERLCSVLRQLSADFGRWVLQLQEYLLVVCEGAAAASHLSEHQPPPPL
                     AENVGAALYENEEEAPKAGGGRQYTFRTGSYIASSAGVAATVLPASCSLADLVAAVRE
                     NITPLQRYHVLVEESGCLDGLASFDTQSPASRPAATTGAAAASGAGEEAPPRWLSCAL
                     LAARLLDTLIIQASAFQDTSTMDLYRLYVMTLLYTAWPYVLLCTAAIFGFVRGIDPPV
                     WRRQLPRLFRSSFSHVRIGDASRRFPTDVLSLLLNCVGYYNSDRVAASAAAGGKGKDT
                     AQRTSEPSSSSDSRSGGSVDAARVPGPRQAGAGSSGRRRGDVSEQHVARAALTSARAF
                     VLRSLASFTRRHKQIALSRTPMHPRRTAAARTSAGTTPCQLGHTKSMKEILHYIMYEA
                     GDRQGDEPGDGDQAGSGTVAAVVAYAQQNQDVRRRVAQVAAPSTAVAAVDATGSSNAG
                     GSAGALHYVYFPTTIPLGFASMLAEALPGQQQWQQRRGDCRVPSVSDDQGCLAPSLGA
                     SALGQRRASGGSEGIGRPCSLMWSDDGNATAALDRNNDDDGGGSGDEGSNVLLRRGIS
                     LWTLAITESNTTPDVRFTNVLAGEEEQYLDAADTGSKAFGQGGQAQRKRRSHQLWINV
                     TIPCARWITTALLIPIGVAVQRLQERRLRDLFTLSLPAAAGGGGGCLLSRPLHAPVQE
                     AQQQRQSTDTTAPVERPPSGSLAPLDVLAGRGLASRTATATACSFIQALKLLIDVALC
                     RDQERLVHGFLERLYREPRWWVRHAEDGGAAAYDRLGTAAPVVSAIFADALRGKRFSE
                     LVRLSVLPARVGAAAATAASTMTAATLTRPGQQSGRGEEGNSSPSVAAGMLDVFASFQ
                     LDLTLPDAFQHILQPRDLSVYVQPLTNTTERSYQTYFWQRRQRLYVEEGDAGVGKASP
                     AAAAASGFNGVAFADVWSYVFGYKCALYYARITLREHKKRLHQRDTQDAQVAQAMGLP
                     GQTATQHLRYVSRGLGTAYYTLNFAVEQLLSFTQNVAMRVVYNLERLLAKSMSSSPEL
                     LSCMELCYQLDALLLELSIVSFPARPPVALNVRERGMQSPATEVVRAAVQRALEVALD
                     PSRLPVSHINSSTRNAVEALVTAVFAAAENHPSTLATHLKPLVVRLTFNRYYGTEEEI
                     RSFHFR"
     gene            complement(<516711..>517361)
                     /locus_tag="LMJF_13_1450"
                     /db_xref="GeneID:5650174"
     mRNA            complement(<516711..>517361)
                     /locus_tag="LMJF_13_1450"
                     /product="EF hand-like protein"
                     /transcript_id="XM_001681837.1"
                     /db_xref="GeneID:5650174"
     CDS             complement(516711..517361)
                     /locus_tag="LMJF_13_1450"
                     /codon_start=1
                     /product="EF hand-like protein"
                     /protein_id="XP_001681889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650174"
                     /db_xref="GOA:Q4QG09"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QG09"
                     /translation="MGDVYPGYGCPQAPQGYRANPMYDGQQPASYPATAGSLGGGAYA
                     PPQYPAPPELVSGFQAADSDHNGRIDVAELNAALSSAGFRFSLGTTEKLLARYDLDRS
                     GSITMEEFADLHEFITAMQQGFRQCDTSGDGRLDRREALEAFRLSGFVLGEQTFQAVM
                     RKFDRQHRGSLGFDEYIELSIFVAQVRDAFAYYNRDRSCQVLFNFDTFLGTAAAIW"
     gene            complement(<518675..>519379)
                     /locus_tag="LMJF_13_1460"
                     /db_xref="GeneID:5650175"
     mRNA            complement(<518675..>519379)
                     /locus_tag="LMJF_13_1460"
                     /product="programmed cell death 6 protein-like protein"
                     /transcript_id="XM_001681838.1"
                     /db_xref="GeneID:5650175"
     CDS             complement(518675..519379)
                     /locus_tag="LMJF_13_1460"
                     /codon_start=1
                     /product="programmed cell death 6 protein-like protein"
                     /protein_id="XP_001681890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650175"
                     /db_xref="GOA:Q4QG08"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PDB:1Y1X"
                     /db_xref="UniProtKB/TrEMBL:Q4QG08"
                     /translation="MAYPYNAYLGYTQPPTQYGQPPVVAGAHGHLPVTTPLPYNAQSA
                     YGGAQPPMPTSTGVYAPSARHMNDNQELMEWFRAVDTDGSGAISVPELNAALSSAGVP
                     FSLATTEKLLHMYDKNHSGEITFDEFKDLHHFILSMREGFRKRDSSGDGRLDSNEVRA
                     ALLSSGYQVSEQTFQALMRKFDRQRRGSLGFDDYVELSIFVCRVRNVFAFYDRERTGQ
                     VTFTFDTFIGGSVSIL"
     gene            complement(<520365..>537275)
                     /locus_tag="LMJF_13_1470"
                     /db_xref="GeneID:5650176"
     mRNA            complement(<520365..>537275)
                     /locus_tag="LMJF_13_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681839.1"
                     /db_xref="GeneID:5650176"
     CDS             complement(520365..537275)
                     /locus_tag="LMJF_13_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681891.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650176"
                     /db_xref="GOA:Q4QG07"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q4QG07"
                     /translation="MDQLSSLYVRMASGAHSQMHNPSSVMGFVDQMQSRMEKSSVPRK
                     NYLIDSSTPHSDTVIAESSALKPSVGWVTLQVTEGIRRGIHEWGIKIEHHGESNDGSG
                     LMLGIVPKNFTKYDTFISQGGGWCLSRAGKLYGHWRRTDSGGGVLTFGTGDRVVLTLD
                     YDAAVMTVRVGDKTVVGELSGLTMEVFPAISLHYRHQHVRFDHHAVRETAEQHLPWLQ
                     RQAFPFAPAFLPLSFSEVQRLPLNSYLFSNLFRHHASLEWSSAMADTAGGGDAGHPAI
                     SAPGASGKKRNAAASLSSSSDTLAVARHAEQRAMRLYTSSEAAAARLTVLSRAFAAVR
                     RYAAVVPGKSCFLAPHVTAEYLRQRLYSAAREPSLGSGGGSALTTSGGLSSSGASAFR
                     FADSAGYDATLNCGAVIVVHLFIRAVSSGQEVAVSLVHSFRDYLLSLPIFSLVEYDGC
                     ASGNGCSGGGGGARGAPFSGGNYGGGGGARSALAPDTVQLAVDHIVKLVESALKVAEA
                     ALNTAAPSSNGSSSGTSAGKRKDSSGDGPVVTPLTSALLEVAVVLALQRGLVSEVLRV
                     SRYLLRVPSGIFSPPLVHWLNRHAAGLTPQQALPDVGRALKRACEDPSAFIVTPVDPM
                     TRVLSVAYGIGATLFVHTADGLTKYGPSAATPYVLVVETRQPTAYCVGAASSSLAVTH
                     THVLLLTDLMAPAEVALVVYGLQLDTHQVLRWADMHGSWPCTLNAHPQLVSTTEDRVL
                     VVYEDHQQQAPSARVLNGAAAAAGTPASAAANGGVAHSTAGQSLSAAAAKATSAEWTV
                     MMQCYNAATASSLTAAPLWARALHPAAAPAGLCLNRCLALRKPSLVDLGSPEEHLTVA
                     GGQVTVELWVQFLDKEDAATLYQHGDRSTSGEVFLELIKSEGAYCIRGGYRHEMRGSC
                     LVSAPLPPTAESRPFHIGLVFNGRWRLLFDGEEVAGNRQGPHVSLDSPKQRWTVGANC
                     TCLLTGLRVWRLGRTAREISRDYRRSLVGDEPGLVVQLFFNEKSGNVVFNYVHNVKAC
                     HAVCIGAVAHKACDTHPWRSYGSGALGGSSAAAASAFVASTATASGAAVPAAASSSDV
                     TPVCARLHEWRNLTISTCCATRHALIVRTPISDDGPYALREGGHVLMFFDLAAGVAHH
                     SLFFLTSRSPVRHMMRADPQGRLWELFEVDVGLVKGEQEASYLLSLLGNPGAAPQRPR
                     ERVLAVAPLPLMEDEEGLDNLSTLANEGEDEDGDGAEEVESRDSLGSTTTSEINPVGM
                     DRNTTDSQRSSEAAASQATQTLSRLSSFTALVAQPSSVVTYGTVALWLLKLLALHAES
                     EPGVDQTLFSPLADDVGSRCVTEVRLILGEHFRVVKSNNARRAVALKSSVSWVVVAAA
                     LRVLLRLVRRARAFGLHPTPLGLTVVREGTERDGGDAADGLQCSPTHASKATMTLLLR
                     ELHASSLRRRASASMVRSRRSAIGHPGSSIADDGDGFSTDSFTLLGLLGDIINEDGLT
                     LPPDVVPLARVITIEGVELFLPDVRHRAHLLRDLLRASSGVSSHLPPTAAGDAAAASP
                     LSVTAEERVPAMEVLLDAVAQSFTTVLAAAPLLGVDDDSAGPGSAASLTELCGTLRTL
                     LEESSVQWQRLWAVNTAIRSVRKFSAFATSLSEAIASLQLLLLSACQGSRWEVALTLM
                     YASGGGSAANRVADATRVRDGGGQGDSSNSGNGATANGVAGSGVGGVNGGSAGVGGPD
                     SVAAAALDLQRLCFSQAAAYHPCVRAYYGALFDGTEVCLSLCVQQPAQQLSTGSTSKT
                     AERASGGGDSGAPLSAMLSSLAPTFVNAPLHTALSAIPLVLAAEDAEWFLKRLEHLLV
                     LCETLLERVELLTRPDSGTDIFASTTNVSSPLLPGSGSASSARRLVCSLREALFYASV
                     WVAAFLFNSTAVSSASVKADAVRRRLGLLSVTTTPTTQRQTAQLTGHAPSVATATSST
                     TGAPPSSSTADDAACTAVGEELARVWEHPLLEGGLWSGTVATAAAAPQHRAQFVSRLI
                     KNTAYWTAKQTMLDPLASKSHPAMGPLITAMAAAALHLSAVPLQHLPPTQVEELMCTV
                     MRKLSRPIRTELLSRREEDEDDGNSAPPSPSTPSPPSLSRPESLRQTLAELQRRCEVL
                     LQARTCTELWTVEDALFCIPTERAAAGRSLGSGKAAWANSPLLPEASAPSSSAPSALG
                     ALRSAWSSYQLRRMRFRAHAASHPSWTLHEATQLVTSVVLSRQITAELLRAALQQREE
                     LAALRRTGIEHIFRLVQRAPHSAESAAKLLSAQGRGAHTHYEEGISGCGSAHVDHIRR
                     TLFDLLRWSIEEMPTQLGASGSAARDGGGAPLSMTSTATVLCSLLDRSWRPRDFAFFV
                     QLRVVPTMMETYVTLFVSVKRADDEEAAEVTSGTRSSGDTFGLRRPSTAAVAMAASNS
                     SASPTDDGATAIDSRAGSVEMRHVNLAERQNRDKVMAAQQARRTSKSALMSTFTLNRA
                     GSTGGGGGVSHGSAGPIGGGTGDAALQHTAVEAMQAKVWQCFKSLALQSTAMLTPEHI
                     ASLSRVEQTSVMTFLADMLGAMETELRLCRDMLSRAVKDTPTLLAQASDAAVLEPLVT
                     VQDQVDLLLSFLSVVSGTLCSASLSVSVSAPVGHTTAGSAPNARSASGDGSPSARDGT
                     ALFLSCTLSTVCATIAETLLELVFLDMYHARAVSADAGVGCVVRDAAACARVAALLLC
                     RCQPSAIRGITVAPGVWQEMYDSPAFAKMPLPASSSLNGGHPCMQKFLDLSVYALATT
                     GLSRTTQHVLLAFRRLLHQPAWAAELRGFASSYQDVVHAYAASVLSSRSGGSETVGAA
                     GKATLTGADDGAAGTSSNLSTNTQARGREVHAVHLYVWSAVLGGQLLVPPTSPGASVT
                     FLDEKDGYQAVTACVVDVEAMAPTSVGPGGMPAKAGTSSSAQCVRPIRGSSHFVLRTA
                     ATAAEGEKVRGVVVVPTDATGHNGNTEEVQLSPNQLFLPAWENAIVVPSYAGLVDDFL
                     APALRLCVPLVSEKLDTAAGFTGFELTYFITLFHLTAGVARARPDLGRQLIQCGAMKP
                     IRQYALQGVVRLPFPLKALREFGALVAVRAAEATADRICAPADNTNNAGGSVSSVAGA
                     AATGRAGAPSLAAALAAVSATEISRVSAGSRSPFSSPVSTQHQTLPGVSEALLESLRS
                     VSPGPSVGYPATFLSGLPQSSATAASSSGFPRDSNEYGLSRLARSLGVFGGAYGGAAI
                     SGASSQQPMRTTCASVANILSGGSGITSTTARIPPRTEVGSGAPMFLSFPMWPAHDVP
                     PCGAARSGAAGQPSVPAAVEITPSRAGVHFPVWEDGFAIELAVLLSDGDMYPAMGDAL
                     SVPCSWPRPQLAASGGATALEFPLLTLYTSADGGSSGAVAAASSDADLFPFLQLSVRE
                     NSLNVVVRLPPSTVGAPDGKEVLRCSARRTLRREDWYHCMHVSVMCNAQSLALSRNGE
                     MTSVEWGGAAGVGRCAEAVLRQEGAIRKVVLGRAATGMSSAPPREVDGPMALIGGLRL
                     WSTSVLRTSLRVVAELVARDRALQSIGLHENVCYLDLKEGTGAVVESADSQKQFRGVL
                     SGGVRWAAEPLPLGFYPSIELNSGNVLDGVTAPLASSMRVPRVAMAAFVDSLSSFYYE
                     RFGGDVLWSLLTLAARYATVTALEVGTSPAYALHCLADTSVTSSASAIAARSDMAFDP
                     RQVLDPAQKVPHQLNRLFQLHDSGYLPNAHERLIHAVVQRLVAVLAAAVPEEEEKTDK
                     SSVVARVVGGFGTTAARAASQLCGLVADTAYVLRQLRRDDGEIFVIEVPPPGQAASAS
                     AAITPPVVLPLAFTNGGTGVLTFDAKYRNMEQATVYKDVELKNVIAKYPDGQGGWPLC
                     TLTATETPWAFLRSVPTSTSHRLAADSKPYSPGSMPSSSIVTVTTKSLKPAILHAMVK
                     AVCDALRSLAGASDQGHRRGNGSAGSSIAERAAACLFDARVVVSLIQQSSARSSEDDC
                     VHFVHILATVMRLWRDMPEVQPYDQVPLAMAMSHLNTPLCSIIQHMNSDSDIGSFVSL
                     STGTYSPYVQSLLGLLVSAVHADCAWAGRSYVEQLQGRWRRLWGMWQRAVVYRPLQLA
                     DSKRRGRKSAACAGSTGKGVRTALPSGGRCDRAAEEVATATTAGSSAFRALFLAPPSS
                     SSSRHQLQGARPSVEMPHVDSLDASVAIAGSSTTGHGTTESPELVPSDGSHAGEEDPV
                     NGGSSVYNAAASSGDRSRAPPLVVELVAMQSVSTRPAEIGSSSPFSSATESHDRHPQL
                     TQKYPRRPYPSGVSRKGNGLWVVRATCAGKENGEEQNPFAARDGAARSVTTVRSSVGL
                     TTGVFYWEVYVANISRAEHSAATLAGGTKLPSNILVGVATERCVPTHSSSSATGSGAQ
                     AEARDGFLGSDGESWGFDGGRAMRLCRGYAVESSPRSRWKVDDVIGFVLDLRQNKLSC
                     LHNGRLVSEFSDTFLSEEQRATRVAVFPAITCTGEASCEVNFGATGFASTPPPGCLPV
                     DLSIYISEEACRVWKVVLADEVSTPLASATAAAATCAGQPARLLPSPVIPLVGKHLTR
                     FTQGRQGPLDVVLLSSDSNAKLVTSRECKTDDAASLLFGSVAATSGRWYFEVVLSTEP
                     TFSVGWHACKSLEEQGSGGRGGAGLAGLIGSAATGAAGGSASNRDAAIASPTSPGGVQ
                     LWGDGPSWLFDAGRMIARHNKHQVSLARRAWKCGDVVGCLLDCEAGTVSFSVNGEFLK
                     AAHGSGAVGGGGRGGGNVAGLGGTRGNSEPFEATAAASASSTQDATATALFSDVCMSE
                     THGLVPVILLEPKSSLVCLWNEEELLFPPTEGGDFRALGGARAVHDALVEMIVVPDGE
                     AAARFRMHPLHDRGDAVRQPRKEEALSKPVDAVALQKLLYYASKVQELHPTSLRSYTM
                     PSLYGVHGAAQSLESPNASVSPPRDLDVNAVTPSRAVSQRHQQRDLCTASGLDAATLQ
                     PHLMALLLFGHLSTLLYPLAHPGALPATVEGAPLGSSWAFNELQETLRACQRYAPPWA
                     SLRALQWSLDTSNGAGNAVRLSVNRRKALTVVQDSTASAVRRLRDSLFGQVYQLLASK
                     PPEFFITSKKLWTVSFYGEGADDVGGPYRECLTQMSAELMSTSLALFLPSANMASELG
                     EVRDSYVVNPLCAPPLELHMYRFIGRLMGGCLRGGEPLSLYLSSALWKYLVGEAADDT
                     DMARIDMATLNALGYVEQLAGFPSPSGALGGSGDSDDAVRDEELAELCPRGFSLLNDA
                     GIVEELVPGGEQIPVTVASGGLYTRLVREHKLYRTGAAQLRALQQGFHEVVPLCSVSG
                     LKWYELEELVCGQCDYDPDALLDAARYEGLSPTDVRVRFLRSVLRGFTRHQRALFMRF
                     VSGRERLPPGMHLKIMPDDAPRVAPIPPMTPDRAAPSLQSVSPHCRQRVATSTSHDTT
                     TAVMTPQPPPSSEQRCGTSFVRHNTLAQSRPSSNTRTSTLPPSPPQLGFTPPPPRAVS
                     RMVPPPALQPGQLQPVRGSGSGGQSHAPVSLLSPLGTQERCRQQESKGGDGMIEDGVD
                     SSLCDDTRLPQASTCFYWLRLPCYSSTSVMAQKLLFAIEQCVDIDADFRVHDTDVAQQ
                     EVGPSLARVSSDEDDLFEDFSHLR"
     gene            complement(<540534..>541010)
                     /locus_tag="LMJF_13_1480"
                     /db_xref="GeneID:5650177"
     mRNA            complement(<540534..>541010)
                     /locus_tag="LMJF_13_1480"
                     /product="putative Ran-binding protein 1"
                     /transcript_id="XM_001681840.1"
                     /db_xref="GeneID:5650177"
     CDS             complement(540534..541010)
                     /locus_tag="LMJF_13_1480"
                     /codon_start=1
                     /product="putative Ran-binding protein 1"
                     /protein_id="XP_001681892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650177"
                     /db_xref="GOA:Q4QG06"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q4QG06"
                     /translation="MSKADENGNELMEIEEVAVSDGGAARFAAVDVKSGEERFNVIWQ
                     DSGKLMRFDEGENQWKERGQGTAKVLQRKDNTSKYMFVFRREGVGKLAAQHYLVKGMK
                     VTKHKQGEKILVWSAFKDFTDDEEGFPENFVMRLSSKEAADKALAEMMGAIEKSSV"
     gene            complement(<541897..>544224)
                     /locus_tag="LMJF_13_1490"
                     /db_xref="GeneID:5650178"
     mRNA            complement(<541897..>544224)
                     /locus_tag="LMJF_13_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681841.1"
                     /db_xref="GeneID:5650178"
     CDS             complement(541897..544224)
                     /locus_tag="LMJF_13_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650178"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QG05"
                     /translation="MRVPSLPIIIDEFPALAGSRSHSGSGSGSELFFLTHFHTDHMKG
                     LSSAWTAGLIITGTITRQLLLNKFEGLRGRVLGLPFWCRTPVLSAAGAAHSETDSTTA
                     TAVPVVHVTLLPAFHIPGSAMIYIETPSGVTYLHTGDFKYTEAAAQMSSLRTFFQSHR
                     VDHLYLDDTWLHLGHTELKSWPALTESPLVGHRGVGIANSGIRVLSKLLDADQVEEAI
                     EAIGRRMDYQRQLHAQWVQQQSQCDSNGTAEALTPSSSSSSASAELSDARLPFIVRVY
                     LHNQFGKELLIQQLAARLRTRALIDDARYARLLTVVEALEEERDDLEAFEGADPARLD
                     GAAPPLSAEELAWRASGGEAARYPYDLNCFVSCSQAQQQKQQQLWARWRYDRGAMSPQ
                     QPQPPADHSVKRSCGPPLIEVVRNRASIEPATLQAASAARGGTPYYGVVISGWARLQS
                     QTHGPAASGQVWQVPTTLHSTPQEIVDFVALLRPLSVTPLHYRPSRGEVVMQRLGPYL
                     RVPFVNNHDTGCGATTAATAGRDAVALRGGVVRWMPYLPAYLLLSQMGGSDSRSGLGT
                     STLLGMLGARDAAAVCDNGLDALEEKPPRGFRIRPAGLPLPSSKAAVAASRSGGEAPG
                     GCDSHTAAITASYFFAPSPTTTTSLPAQGMADVSGKATNPTDTSVSSRVRADGLRIST
                     LLPSWRLSHLTQSYLSTQQSGGKRERVDVEMDGQSMVAHRAERHAATATKIESGERAA
                     KAANDHDKDCPAVLLSSSATTGLLSLSDIADNVLA"
     gene            complement(<545633..>548866)
                     /locus_tag="LMJF_13_1500"
                     /db_xref="GeneID:5650179"
     mRNA            complement(<545633..>548866)
                     /locus_tag="LMJF_13_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681842.1"
                     /db_xref="GeneID:5650179"
     CDS             complement(545633..548866)
                     /locus_tag="LMJF_13_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650179"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4QG04"
                     /translation="MYKSPATTNQRGRCFPGKPRHKPKPGEQETSASEKESARPALTS
                     STPSVGTRSSGGGHGESLTAPFSSTPSTSGETGQTHTRRSLSNNSIQSGGGFGYLRAT
                     TATPELAPSPASTNTGLGSSADTFSRAPAPTSSPKELHKDTKAWPPEQQPLTKTSPPS
                     FPNPSTPAESSLARLRALAGLTPLRVSSHDPPTLSSSLYRNEESPLRHSCDARSELGS
                     SGPSSASSSRVSSPYTPDLVRRLSFLNCTSAQTTLALLQRDRLKRSRSGARKPSSPPI
                     APSYHNEEEEKAGQQSKRPPAVQTVNGTANSAGRNPFLTPLLGLADLRASASTLYRNE
                     EDTDGGHRLGTESSSARSTKLLLSRLRVSSPCPTSAAECGSSSHPYIASKDGVAGGGS
                     VVGGAPVPHKLPTGSPWKSAATLVSPRPLAEASPSPGTGVPQAFPISSRLAQLRERAS
                     TSPTSLPPTATVGASVASWTGLAQAPLQQPHSLVNLSRLRRLANLQQPHPQLLAQRSG
                     ITLSEDRESGPSTPPEVALKAALERTRQHRVLAEATAARDDATPTPPAAIDSDEPYLD
                     PVEAQERAARRHKSENILPSHESGAKQDCNHAAAKVSVRRASPRKGAVSTTAKKESAA
                     AAVVLKGHLGKGTRGNTCHASIVMPSTAAKDKIGTTAVEGAVKCASSPVRAKQLMNKL
                     RSLAAPVPVGETAGEKNPKAVPNPFLGSAVAPPVHSLRECLSQQPSPLAPNKADKAPL
                     KRSVSSLPPSWSTSSPFAALASPSLHAALTQASAALLKERGTAGSTKGADGVSDDEEH
                     PSAPSSPSFASVSPHYSYPSMMTRSATAAAAAAVAAAVKTTPATTAITTTSIAGATRV
                     SSKTNTRTATARSCKSSTDMRCFVFDTSSLLDSEPGVMNLILETSFIGIPFTVLDELD
                     RMHKDRGGSAKGDHVATTSTAGVNSTHDREWRRQRAHELRNWIAACLNKEAQSRLWLQ
                     KRTEIVREYDRHATTNDDRILGYAVYLSQHEAAKVLFVTEDKFLRIKASSELGKAYAY
                     SEVRKLVGMPPLPTASSMASQGRSGKKEKTAALERQEGRLEISYGDR"
     gene            complement(<554524..>555825)
                     /locus_tag="LMJF_13_1510"
                     /db_xref="GeneID:5650180"
     mRNA            complement(<554524..>555825)
                     /locus_tag="LMJF_13_1510"
                     /product="putative phosphoprotein phosphatase"
                     /transcript_id="XM_001681843.1"
                     /db_xref="GeneID:5650180"
     CDS             complement(554524..555825)
                     /locus_tag="LMJF_13_1510"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative phosphoprotein phosphatase"
                     /protein_id="XP_001681895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650180"
                     /db_xref="GOA:Q4QG03"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QG03"
                     /translation="MAERSSTLVINEAKTKNRLSDSLRSPTDRTREHLISHRNFSSVL
                     ESAADCTSASSTPDLQEEEDVQHKRALDLFSATPHSGEFSPLIEWLLRRGERGDVGAP
                     TASQKDGDEYTQASFFNEDYIMNLCAAATAVLGKEPALLDLEVVAHDTLVVVGDIHGQ
                     FQDLYTSVLCQQYDRRRCNPEGRDCRFLFMGDYVDRGPHSLEVVLLLLALKVEYPTLV
                     YLTRGNHEEEKTSRVYGFLTEATSSLGAAAGTAVWSAVNKVFLDLPLAAIVQTLYMRF
                     FVTHGGLSPGLQNVEVICALERHNYSCGNITAAEDDLIAGLLWSDPTNEVAMYKRNPR
                     GCGFLFGPSASNRFCADNNFDFICRAHQVAMEGYMWTHNDRVLTVFSAPNYCGVNRNK
                     GAVLLIKGYSRRPIVQQYDSAEKSEAAPARKTDFAFADMFA"
     gene            complement(<559736..>562573)
                     /locus_tag="LMJF_13_1520"
                     /db_xref="GeneID:5650181"
     mRNA            complement(<559736..>562573)
                     /locus_tag="LMJF_13_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681844.1"
                     /db_xref="GeneID:5650181"
     CDS             complement(559736..562573)
                     /locus_tag="LMJF_13_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650181"
                     /db_xref="GOA:Q4QG02"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QG02"
                     /translation="MSTLSYQQQYQQILADLAEVQREDVYVSAVRVPMDAKARHAYYA
                     QYWLSLYVRYVRLARQMAVIHDTELQPQRRGDVRTLLDSCLGRMLEARHNIVEHCGDY
                     VALDDTLEEMKLSPEDLEPPLPTYLLEDRREVLLQERAYVLSLQQHYKETVPEVAPVA
                     LAAAAHSATLFAEDPTKALPPFPTTVEKAASTAGGDLAPMSVEEAVRILQLAERGRQA
                     RQRAKIQLQLFRQQQYAAAHGTELQSLTGKDRAAIIVQKVALGYLQQKRAKERYRQEQ
                     ELLGMTSTAAIRSNAAKVAASVHHDDRKARQRVNQAELLQKTLEMNRQLKSQEGPKTL
                     EVMLDEVLMHMAYARLDGKAKDGIMDVPAVEDGGTLTLLGRSTGKAKSAGASVGAEAS
                     GSEKASFNGTGYSSRSVSRVSESVAANTATAQGGPRKSVRRPGDDDAAASASIAAPPS
                     VFLDHVSATTERYNTLWKEQFHRTRVEKDDLDQPYDEALLRRELVDGPRGILQDLRQC
                     VDQLVMMEVNNLKERLEAEKNAGKRKRGGRKGKKAKAAKKPKLRDPTKGEDLESYLNT
                     TVYENKLQLPPPDVRLSSFVGPLGVSAGPLDRLLRTQTVDKEIEKKWKRVLRGWNDDV
                     QHAIGMPKDKMEALFRAYVQQSSWLKDPSAAEVRAAVTDYAVLPLGSQVVHDLAPHPT
                     GLLLYGAPGSGKTLLAYAIANESGARFFNLSPANFLTTKGIAKIVQVVFYTARMKGPS
                     VIYIDRIEKIFPGKGGKRGKKKDGELTRGKKLKKELLKGIASLQPTDRVLVVATSAEP
                     WCADTAALCNIFQRAVHLAAPDFATREALLKTFIKARLDTVHSTAVTSAAEASIAEAV
                     RHVSLLTDGFSAGQLRDCVTQTLTAHRMERLAHNPIAAEEFVPALAVTTGLNAAQVQR
                     YHDFQASLPVMMRRANAVEDFKPSEDEAKHR"
     gene            complement(<565727..>569020)
                     /locus_tag="LMJF_13_1530"
                     /db_xref="GeneID:5650182"
     mRNA            complement(<565727..>569020)
                     /locus_tag="LMJF_13_1530"
                     /product="phospholipid-transporting ATPase 1-like protein"
                     /transcript_id="XM_001681845.1"
                     /db_xref="GeneID:5650182"
     CDS             complement(565727..569020)
                     /locus_tag="LMJF_13_1530"
                     /EC_number="3.6.3.1"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase 1-like protein"
                     /protein_id="XP_001681897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650182"
                     /db_xref="GOA:Q4QG01"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QG01"
                     /translation="MRNQLPCWRKRLPTRIFSEKLSKSFCCFSAEADVDEDDEVIVYL
                     NDPESNAQFNYPSNFIRTSKYTPLSFLPVSLLLEFKKVSNLYFLMNVIFSLIPGVSPL
                     SPATSIAPLAFVLIVAIIKEGVEDIKRHQADNRANSILAQVLRNGKLVSMHSKDIHPG
                     DVVRIKNGEEVRADVVILASSVEEGQAFIDTCNLDGETNLKARRALEATSALCEVEAI
                     MNSTAVLHTSKPDPGLLSWAGLLEINGEEHALSLEQFLYRGCVLRNTDWVWGMVAYAG
                     VDTKLFRNLKPKPPKSSNLDRKLNYFIIAILIFQNIMLFILASMAVWWNNKHRETPYL
                     HFFIDFRKDITLWGYRYLSYFILLSFCVPISLFVTIEVCKVIQARWMRVDYLMMEYMN
                     NRWRHCQPNTSNLNEQLAMVRFIFSDKTGTLTENVMKFKLGDALGNPIDADNLDECIA
                     QLRKEAESKGLGPLQEYFLALALCNTVQPFKDETDDLGVVYEGSSPDEVALVETAAAV
                     GYRLINRTTKSITLLLHDGTRKVYNILATLEFTPDRKMMSIIVEDSDTKKITLYNKGA
                     DSFIRAQLSRAPDVQGHIENVDIPLTEMSSSGLRTLLVCARDITRRQLDPWLAKFVEA
                     GKSLHNRSSNIDKVCLEMEKDMRLVGATGIEDKLQDEVPETLAFFLNAGVIIWMLTGD
                     KRETAVTIAATSTLCDPRNDFIDHVDIGHLNPSDPKAIERVGRDLDVLEQHIALKGTH
                     KERRCTLVIDGPALNIAMEHYFDQFLRLSHEVNSAVCCRLTPIQKATVVRMFQKSTGK
                     TALAIGDGANDVSMIREGRVGVGIIGLEGAHAALAADYAIPRFKHLHRLCAVHGRYSL
                     FRNASCILVSFHKNITVSVVQFIFAFYVGFSGLTLFDGWMLTFYNLLLTSIPPFFMGI
                     FEKDLPEDALLERPKLYTPLSHGEYFNLATLLRWFIESLITAVVLFYAAYPTLIHQDG
                     SHQRYTGAETGTLVFSGLILVIQARFILQIRYWQWLQVFGVTMSIFLFLLLFLVYSAI
                     PSIFSDTNFYYQALDLMSTAKYWFFMLFYVGTEVVVIVSVMTFQKNLFPTLRDVAERQ
                     YAVQKDEKL"
     gene            complement(<571159..>572622)
                     /locus_tag="LMJF_13_1540"
                     /db_xref="GeneID:5650183"
     mRNA            complement(<571159..>572622)
                     /locus_tag="LMJF_13_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681846.1"
                     /db_xref="GeneID:5650183"
     CDS             complement(571159..572622)
                     /locus_tag="LMJF_13_1540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650183"
                     /db_xref="UniProtKB/TrEMBL:Q4QG00"
                     /translation="MREACATFGEPTLPELARECYRFVAELILGKAAAADIGGYSNVH
                     HTRWQERHIIAAETVVEAEQRSRQQHQRSPAEHLISQLARLCPLLCSKAGEDGLCGDG
                     GTQTLAGSALAPPPRSNASAVIVERSPSWQSGTAASPPNWWDSAADALDALFDAVDMY
                     VESTAVSPTFTMPALSLPAAALGGQSLSQIEAALTEESCIMAGLLLHREVRPRSGPCY
                     ATVVSPMLVVLDLDGTLLRSPLSSISLRAAQVATTAEVRALFVDADFLGAFCEAVTQH
                     GHELAICSLTEGTADQWATCLSVAEAVVCLLSCVLPPTRDYLTSTDDVVCLPRSVAGP
                     GKLYHLQELQQRRNARDEEQRLRRSRIHPQQQQRRTYSTCAEAADDASDSLRTGLSPL
                     PPQTPSVHHDAIVGGLWNPSTLLLPKWLSTDVVLIDDDRENCRMAVTQGYHATPCAET
                     GMSASWYAANPELQVLLGIPASEVVPHNGARSRWTSL"
     gene            complement(<574541..>578071)
                     /locus_tag="LMJF_13_1550"
                     /db_xref="GeneID:5650184"
     mRNA            complement(<574541..>578071)
                     /locus_tag="LMJF_13_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681847.1"
                     /db_xref="GeneID:5650184"
     CDS             complement(574541..578071)
                     /locus_tag="LMJF_13_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650184"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ9"
                     /translation="MEQSSSPPASPSPSPVVLPTWRVGHAVTSSSRCCTAYRGRYVVY
                     AATDNSIALVDVLAEHPSSLSAEARWRYAMRLSVLASPDERISFVVGHPEKDLACVGT
                     AHHGLYVISLTNPALTEATRLPRTVTGDCTYGATFLFSEEANYLAFSSLLHSRPLDQT
                     PHRLSLWSIDTKALLWRGAMGPLQSMCSLAFGLSFAACSAGKIGLFSVQYTAPAAAGG
                     AEAPADGQAPKHRERNRLMVLSRHCSTVEELYDVEYTCCVASPVEGEETYLALTSSGF
                     LVAFDGSTGSVVRWMDCKVSSATALCCIGKESLMLTGSITRLFQAETWEFQGKVKWQD
                     VLGATPSAGSDDAGATKEVHEGSVVTASGAHVFTNGASAGNGVLVLFHEGSAFSLYSM
                     EPRTGTQRMSLRRASLFTPPILVPATPAEIWHMNSALWCWWTPQALMFVSPPGCTLVT
                     AFGNPSTCATLHPATGVVVLFDTARHAFVAYGHPPGTPAELGSTATSADESILSLTSS
                     PTGDVVYALATSTAASGPSGLQLRRYRCCWAQMRKGGSRALQLERIKINGSDSVPAGT
                     HALVVYSGGDVATSGPESTATDADRVVAVQRTSITALGSNAEAGDRASAPPTYTHADA
                     IQHVVPCQGGLVVAGAATSAYVEVKGASRWVVKLLAEPPAAQAVEKDSGANVCAVATV
                     VRHRPDIVVVCRGSRLSVWQLNSDSPLLIATRAISTLVRAVCSAEDKENAELLVWTLG
                     SGCFDLYKLGPLRRAAALHNDAEKLLPPPKEVGKKSSAAPSSSTSRPPASSAAQAFNA
                     AQRRPARTPLAPAAKARGVPKTMSEARRQRRTASASAPSSRELCDRFDELTGFYARQK
                     RDSQTGEHARTPRSAGPSRRPHPSIIAAAEASVPSSQDDSVPALSHTPRDRQTETLAN
                     PPATANLAVSAVDVSELTVDSQVLRAGVAAAAAAGVNEEFCVEDANEGSRNGSASTSL
                     KSTGADEPAACPDSPPQRRNAQRGSSGPPSDAEDVIIRSSTSSGGAKPSFLPLYLKHQ
                     EPPAVAAKPHLSPNGSNSSTTTTEQFTVQARHLRESLLHLKELLEHSDLLDSASHASF
                     VAAEEAELDELPDLLTTVAAQLQLRHVRRSGESAHANASGVSSAAGGQKPTPDAYAAV
                     AAELARIQVQNARLEEQNRIILTQLRGGPH"
     gene            complement(<579355..>580452)
                     /locus_tag="LMJF_13_1560"
                     /db_xref="GeneID:5650185"
     mRNA            complement(<579355..>580452)
                     /locus_tag="LMJF_13_1560"
                     /product="putative ras-like small GTPases"
                     /transcript_id="XM_001681848.1"
                     /db_xref="GeneID:5650185"
     CDS             complement(579355..580452)
                     /locus_tag="LMJF_13_1560"
                     /codon_start=1
                     /product="putative ras-like small GTPases"
                     /protein_id="XP_001681900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650185"
                     /db_xref="GOA:Q4QFZ8"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ8"
                     /translation="MILPRYAYAHADMDQKQMQKLLLMGPGGAGKTCMRSIIFDNYLP
                     RDALRLGITISLDQSQVHILRNLFLNLWDCGGQHRYVTEYLNRQKEYIFRYVGVMLFV
                     FDINSMCRDSHGGIGGLGGVGGESSSATTDWKLPEMLEYFREAMRFIRQYSPKAKVFV
                     LLHKIDLIHKDIREEIFQARKQEILNCIDSDNGMNIEFFGTSIWSDSLYLAYSSVVRS
                     LVPHRDVLVEMMRGIAMACDAAEVALYERSTFLCLTHINRKAAADGSKALFLQGDGEL
                     RTTEVSETVKHFKLSCMNNTTSLGGLSITTETFTALLCPFTECTHVLVVSVDPKVNVE
                     LHRLNVNAARRRFEQFLDSDEPTACAMREVL"
     gene            complement(<582769..>584529)
                     /locus_tag="LMJF_13_1570"
                     /db_xref="GeneID:5650186"
     mRNA            complement(<582769..>584529)
                     /locus_tag="LMJF_13_1570"
                     /product="phosphoprotein phosphatase-like protein"
                     /transcript_id="XM_001681849.1"
                     /db_xref="GeneID:5650186"
     CDS             complement(582769..584529)
                     /locus_tag="LMJF_13_1570"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="phosphoprotein phosphatase-like protein"
                     /protein_id="XP_001681901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650186"
                     /db_xref="GOA:Q4QFZ7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ7"
                     /translation="METSLPLAISHQTKEEGDSVSSVHVLRPACFEASAITSGARGTI
                     AAGKGSSNTNVDASPNVARVVTGSVEYYLTDCSPHIQGIHSPVLPTYSSNKPATSACA
                     TPSGCLVVPVPGAPQEAIPTVNSPSVPTVSANGRLKVSSRLGNISTGPCHVDAAGSWA
                     ASNCLLKTLDNSGNGISPLLLAPGNSPHDCGADPRLLISESSSTIADELENDKPPLSS
                     TGKGSEAKRFFGATPRSGEFSPLIEWLLRRGERGDVGAPTASQKDGDEYTQASFFNED
                     YIMNLCAAATAVLGKEPALLDLEVVAHDTLVVVGDIHGQFQDLYTSVLCQQYDRRRCN
                     PEGRDCRFLFMGDYVDRGPHSLEVVLLLLALKVEYPTLVYLTRGNHEEEKTSRVYGFL
                     TEATSSLGAAAGTAVWSAVNKVFLDLPLAAIVQTLYMRFFVTHGGLSPGLQNVEDVAS
                     IDRHAYGTGDLSKEAHDIVDGLLWSDPCISTGLFSVSSRGCGWDFGPAASSDFCSRNK
                     LNFICRAHQVAMDGYFWTHNDRVVTVFSAPNYCDINNNRGAVMVVSGEANKPSFEQYD
                     CCDERDWPCLDSCFPHASFF"
     gene            complement(<592602..>593018)
                     /locus_tag="LMJF_13_1580"
                     /db_xref="GeneID:5650187"
     mRNA            complement(<592602..>593018)
                     /locus_tag="LMJF_13_1580"
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /transcript_id="XM_001681850.1"
                     /db_xref="GeneID:5650187"
     CDS             complement(592602..593018)
                     /locus_tag="LMJF_13_1580"
                     /EC_number="6.3.2.19"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /protein_id="XP_001681902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650187"
                     /db_xref="GOA:Q4QFZ6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ6"
                     /translation="MVEVPRNFRLLEELETGEKGTGSNQNVSVGLRDTADIFFHYWNG
                     TIVGPPSTAFEYRILSLEIYCDENYPKVPPHIRFLSKVNLPCVDPDGTVNRERFHVFR
                     SWDRRTTMEMCLSELRKEMAQPQNRKLVQPPEGSMY"
     gene            complement(<595796..>598048)
                     /locus_tag="LMJF_13_1590"
                     /db_xref="GeneID:5650188"
     mRNA            complement(<595796..>598048)
                     /locus_tag="LMJF_13_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681851.1"
                     /db_xref="GeneID:5650188"
     CDS             complement(595796..598048)
                     /locus_tag="LMJF_13_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650188"
                     /db_xref="InterPro:IPR009852"
                     /db_xref="InterPro:IPR026581"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ5"
                     /translation="MSRVSVLAGQKPKPKESFKFLRRDEGRLSYSAATAESPSKNAAN
                     GADGANINRERRDSKALREAIAYDMRNAKSHDPLGEVVVAVPRKAPPPTRAVSAPPPN
                     TNASSGTEKPAAGAPPQRRQPARAANPKKPEWVDPEIPPSPLLQAPTHTVVERPADNY
                     FETSYSDSHSGGAAALSSGIGRSVSRGSDTNGADLGRYGGLTPRSAAMGAPRYASLKY
                     EESSAAPLSGQDRNYFRRPLYTRDPALGSDAHSPAGSRVREEDELIASLEQEIKAAQK
                     ERNHYADARQQLDREKQRFESYRYGARQQMEDERADAGDRRSREQRDAQKDLRATEER
                     FKNVSALLVAERETNRRLSQENDSLRTQLEDLTSTMREAHRIHKAEVARMRRDIDSLT
                     RRNAELLAMAKEQQLQCLEGASASPSTRQSSSSPFSVSLDPSAQRASSASCEGGYDED
                     NDAAAVGERRASRAAPLAVMDFTPRASSREAAAREKRNRQMQNRMQAEEQAMEERKRH
                     REQYIAGRKREEQEEKTRHRVAVDAAAAATACRRSEEDDLRKAATAAEKVVEERKMSG
                     HPARTPRMQSGALSVKRRPSVSAVHAPVAPKRHHVPTREDLIGDMEEFPTEKFCDDDV
                     VSQTALGDNSNKKEVLYRSGKREIHYANGTVKVVLPSGHTTLRFTNGDVKCTFPSGKS
                     TYWYDAAQTMHTQMPDGVQAFEFRSTGQTEKHLPDGSKEILYPDGIYKMVRPDGSDET
                     FYPDGEPMEE"
     gene            complement(<599546..>603199)
                     /locus_tag="LMJF_13_1600"
                     /db_xref="GeneID:5650189"
     mRNA            complement(<599546..>603199)
                     /locus_tag="LMJF_13_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681852.1"
                     /db_xref="GeneID:5650189"
     CDS             complement(599546..603199)
                     /locus_tag="LMJF_13_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650189"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ4"
                     /translation="MPNLASVRVTPVLPHGAYESKAPHRTGASYVDVISSTEREVMEQ
                     CLQEQLAVVANLVVDQVEQRTGQQLDALHVTYADKMKSFSEIVLNSIHDELRQLRVVR
                     ERQGAAERGSPSAAPSHSPMPIDAEAVARLVSARVAEQLTGATLPSSTTPTPPPSSDM
                     AYQLTRLEESTAAHFEDLQRRITAVVASRDAPAVTSAPAELRTAVVEAVQKAAAEQQE
                     KLSNLINDLLAEERLAARGSGGDAAANAIVDMRAIEESIESAVQSATNELRRTITSEV
                     KKLEKSKGTRGEVTAGSATDADMAIEIEKVFDAVQSTQSRLAAVDEVVGDIFKEQAAT
                     RDALRVMQEVLQRRLDELRGTVATEATASTPSPAAAPVNGVPEAAQQKITEVLEQLRR
                     DVSATSSMLEIHNDNAQQQLMTVAQVVSDSVTAAIQQHTEEALQSAMTTVQEQLNALR
                     EAGEAASAAASAAPPPAAAPPSAPLSQEVLTDAVEAVLSPRWAELSVQVEKMNTANKL
                     AIEQQLLHIADSVSTSVAASLQAQLEEMRTSAESQLKTEHAAKEQGSVSIDTSPAATA
                     ALIEKTTHELTTLREELLQALQAQVGKTPEVNLTPMYKYIDSVLTFMKEELSLQETNL
                     TAKMASLAETVTAAVREQQEATASSASLAKLQEGVQAVRESVEAGAAKAAALADVPPP
                     AAPGAALSDIRELLSPMDTALEAHVAALRRLEERLDEVSRTADVSSVLTRLQEASEQF
                     RSASAAAAAAQTAERDTLQVLFQDHFTSLTQSLEGRDARLIEAVRGTATSAEMRAQLS
                     SVQDSIQSTAQAHKEELLTALRESVSGSEKGQTQRTDALLARMVAIQEAVQEQHASVQ
                     LLQPSPALIGFSAEQQRAQARIRTATRDRLRRVTQLISDLALVPANKSASAAAEELQN
                     ELAGLRQLQEEEAALVRETSTTGTGPVTMQSIVQAEVQRVQEEMQKGIHELSSQGQLL
                     QRDIAAAVQSLVAKIDDVGGNTSGLPSLADIQELLDATMMRIASQQNEEGVRASQLVE
                     AATSRSVVELKTAVQTALVESVSAAEKRLIPSYHAKVESTLRTHLTTHSTEIKTVVNN
                     VADTASAAVQRIESIAQDMASRHTSAVQEHATSQDTLWPHSSSVQPTAHVPLWWLIAN
                     PLLVCAMVLFSIYYVFACLLLAFVPKPPAEGNVAGDRVTSAAAMAVATGSEIANSLSK
                     MPRKGGRYVDRYM"
     gene            complement(<606966..>609152)
                     /locus_tag="LMJF_13_1610"
                     /db_xref="GeneID:5650190"
     mRNA            complement(<606966..>609152)
                     /locus_tag="LMJF_13_1610"
                     /product="putative MCAK-like kinesin"
                     /transcript_id="XM_001681853.1"
                     /db_xref="GeneID:5650190"
     CDS             complement(606966..609152)
                     /locus_tag="LMJF_13_1610"
                     /codon_start=1
                     /product="putative MCAK-like kinesin"
                     /protein_id="XP_001681905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650190"
                     /db_xref="GOA:Q4QFZ3"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR021129"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ3"
                     /translation="MESQLKQLLVQGGLEHTVQGFIDGGVTSVQQLKQLTMQDYHSVG
                     VIVMTDRRKLFELIQFLKRDRANGSGGGMTPAAPVASMASKSPPPATEPASRLQAPTQ
                     APALPARIPTPSRRATPTEAMQRRERERLAEQPRPMSTQRRDPNTDEGENAVRPAAAP
                     AKPVSRPVSRVGASSPSPFGRRATGEGGNAQRRRASRITVVIRKRPLNASEQADGLYD
                     ILATDPDNNHIITLLEPRQKVDLTRYIEKHRFTYDKVMDDRKTNRDVYEEACKPLIET
                     VFEGGCATCFAYGQTGSGKTYTMLGKDKQEGLYLMAAKDLWSRLSRGMGINVSFFEIY
                     GGKLYDLLNERERLACREDSRGVINVCGLTEHRVDSTDHLMEIIDYGNTIRAAGSTGM
                     NADSSRSHAILHITIVNEKNRFFGRFTFIDLAGSERGADTLDSDRTTRLEGAEINKSL
                     FALKECIRALDQNHRHIPFRGSKLTAVLRDCFMGNSRTVMIGNISPASGSCEHTLNTL
                     RYADRVKELKKDKSSHSAAEEIMMGQMPTEHVETVGISGSFAQRRAKERVITSSRSSS
                     QTRTREPGTPNQKMVNSFHRHGDDSSDNTLRSNRSFGSRPVTSSSPQKKSYHRPTPTH
                     SRGPSGMSSAMPTPVGDDSRYDSGDSLDAEEDNLILAHRHHIDCMMELLKDEMTQLNA
                     AENPENSMSGYCRRVDAILSSQVRRIEELRRQLDQYTRHAGAAGRR"
     gene            complement(<611146..>612855)
                     /locus_tag="LMJF_13_1620"
                     /db_xref="GeneID:5650191"
     mRNA            complement(<611146..>612855)
                     /locus_tag="LMJF_13_1620"
                     /product="squalene monooxygenase-like protein"
                     /transcript_id="XM_001681854.1"
                     /db_xref="GeneID:5650191"
     CDS             complement(611146..612855)
                     /locus_tag="LMJF_13_1620"
                     /EC_number="1.14.14.17"
                     /codon_start=1
                     /product="squalene monooxygenase-like protein"
                     /protein_id="XP_001681906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650191"
                     /db_xref="GOA:Q4QFZ2"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ2"
                     /translation="MLYFFAAVLCAVSTLLLLNRTLSRLRLSPARTSYDYDVIIVGGS
                     IAGPVLAKALSDQGRKVLMVERTLFTKPDRIVGELLQPGGLNALKEVGMKECAETIGM
                     PCHGYVVVDHKGKQVDLPYRKGASGVSFHFGDFVQSLRSHVFHNCKANVTMVEGTVNN
                     ILTEGLSFSERAYGVEYTIAEKYEVPTKPFREDPPKTNPVAATVRKVATAPLVVMCDG
                     GMSKWKSRYQHYTPAYEYHSHFIGLVLKTVRLPKEQRGTVFFGKTGPILSYRLDDNEL
                     RLLVDYNKPTLPSLEKQSEWLIQDVAPCLPENMREQFVRVSKDTKSLRSMPMARYPPA
                     FPSIKGYVGIGDHANQRHPLTGGGMTCCFRDAIRLANSLNGIQSLRSVNQEEMAAIED
                     KIQAAILNYARYRYTHSCCINLLSWALYSVFSSPALRDACFDYFLCGGNCVTGPMDLL
                     AGLDPNVGSLFFHYCCVMLHGVANVMMRTGAYSESGKQLSNLEKLTNVASFFVDWERM
                     KHAAYLLGKSTQIALPLAKSEFYSMWRFVDPTSPLANISKRIKTMVYTKQFNGKQRKP
                     VGL"
     gene            complement(<615033..>619766)
                     /locus_tag="LMJF_13_1630"
                     /db_xref="GeneID:5650192"
     mRNA            complement(<615033..>619766)
                     /locus_tag="LMJF_13_1630"
                     /product="putative mitochondrial DNA polymerase I protein
                     D"
                     /transcript_id="XM_001681855.1"
                     /db_xref="GeneID:5650192"
     CDS             complement(615033..619766)
                     /locus_tag="LMJF_13_1630"
                     /codon_start=1
                     /product="putative mitochondrial DNA polymerase I protein
                     D"
                     /protein_id="XP_001681907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650192"
                     /db_xref="GOA:Q4QFZ1"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ1"
                     /translation="MRSFPARQNPFAPTLVADDPKALLAKAQYCIFTLAYDPAQQLYA
                     VYSATTNEVAVMQEELLWKAAMWVDERIGDDYIAGLLFGNDASTDVKSAATLLSNKAM
                     KRLVLAPDTWGITFLAFKAQQDVVKGVDMPLGLEHAAFLLTQRQFNGTTVDPQVYDVG
                     AGAYMPSDVLKSNGAARSAVMGWDVLLHVHRRFGTPGSRKALNPVEQIVRRVVKAVNV
                     FVVDINVRVGKGTITEGHTMIVTIFDSQRRSQSVHMIRSLAEETAKLNALTTLLYGEG
                     SSSISLFVPTARTKSSQLVAFARTCRPKSPFFVAEVSSLAPYFGGHNVAKGVSEEEDP
                     RATWNLIRQNCFPENHLRKDEEKMDRYLHRGFTALANKLFSERLHKVSPVIMSAVNSI
                     PAQEESATAFKRLEEMAAEAKKNPVPQITTASFLNKVNINDAEVVFGLQQWRRKIYDD
                     QGRLEREKKALGGLRRYLIVDLETTTIRRYKRIANPFTKENYVVLSGARDYKGNVFMP
                     RRYFDRSIAMRYDDPSVTSQNHLVEKSSKDSLFLPPLDEYDVIVGHNIKFDMLHIWRD
                     VEFRKFLRRGGKIWDTMYGEYLLTGHEVKLGHGAGLEDVAKSYGGQTMKLDAVKRAWA
                     EGKETYEIPYSILTEYLHGDLENTELIFCKHMERALEQRQVIICCARMEGLLCTTEME
                     YNGLKTNVDLAQRQSNELMTKVSELRRQLEESIPHEIPHDCRKFFNWSSNQHLITLFF
                     GGKLTLSTNARESKPLTGELFARHTLFLRPEHFPPSAYPNGVFLRPPVHVLGIGDCAI
                     MAGMPSEKGTRLFRGYLEAYMRQAGFRKSSSILESLRRDATTVSRSNADKRGETSALA
                     NLLPRRHLFLFAALTPSGTEGIAKLFVKNPISGESVTITEGEKAEQLERFVIVQVAKY
                     TEMIMPIDDDASVKDAAFAAAHVTILARDGGFSFMHHIRSDAGLTRYMEAHAGYLDAA
                     DPKLRYNISIADTVAILAYYKHQYASDLHATLGGSRRRGSSGGGVAADSLGPVIPPKA
                     LPKVGKRNKMGIAEAFKKALLQESLMKPEEWCNYYIDIFLHIANAALQHEALSTESPK
                     LRKGKKDAARADDDLPVLLRQRRAFVGYYNSLPDAERKRLALMCLVGKTTSSVYDCFA
                     IPCAHDDIVKVNIKGRLAQYIPNELEAEQVMRRFRSSTTRQLQVGEDTLSYFKSNHND
                     SAASVILELRALEKLIGTYYESTDGGTGMVSLVHSTDSCIHHELIHNKTNTGRLASAN
                     PNCQNIPKEDKSSLRDMFISRFGDKGMCIEADYSQLEVVALAVLASDEQMLEDLRNNV
                     DFHCKRVTMMRPDLKYTDVLQRAKKIKEPEFVKLRQQAKIFSFQRQYGAGVRMLSQST
                     GLTQDQVRMLIEKENETYRGVEVFNKMVTLSANSYDASLQNGVRNVRGHQFFKGMFPV
                     LTGSRYVFTESDVPEGMLRERDAVRKSTNFSPTHLKNYPVQGFAGEIVQVMLGVLWRH
                     FLANNNYNGLAVLTNTVHDCVWVDCHVSVYRQVAKDVELIMDGARTVLNALYPEMQVT
                     VDFPCDVVAGESMGALRPIMEETTL"
     gene            complement(<621117..>622934)
                     /locus_tag="LMJF_13_1640"
                     /db_xref="GeneID:5650193"
     mRNA            complement(<621117..>622934)
                     /locus_tag="LMJF_13_1640"
                     /product="putative mitogen-activated protein kinase 7"
                     /transcript_id="XM_001681856.1"
                     /db_xref="GeneID:5650193"
     CDS             complement(621117..622934)
                     /locus_tag="LMJF_13_1640"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase 7"
                     /protein_id="XP_001681908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650193"
                     /db_xref="GOA:Q4QFZ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QFZ0"
                     /translation="MFNEAAVPFIQTARDNGLLFGGSDAPAMIDYTSEHGKSYHVRGS
                     IFEVAPHFEVLNGIGYGAYGVVCAAVDLRLVASSVYYNEAMRTIEEEGRIVTRQRRGH
                     DAPVYFRTRAVLDEAGRGGPVRVPHLYSEPFKRRTLARGEVSPFVAIKKVTKVFDDLV
                     DGRRILREIKLLRYLQGHPNIVRLMEVGRPPAPTGASSSAAFDDIYLVTDLMDTDLGA
                     LLRSSQEIAMDQLRFIAYQLMKVLVYVHSSGVIHRDLKPGNILLNGNCDMKLCDFGLS
                     RGGVPAWPHERTLTAVATAAESSAKELEDWGLFCWSSSAARGASSAPHAAKQPPLYSL
                     TDYVVTRYYRAPELLIMGRYNHAIDMWSAGCILAEMVLRRPLFTGANYLSQLALILET
                     PGLRGVPQTPEEAAALFEGGEEGKHFINDILFHKTARRRDPLTLSDQVHSQVLFHSTL
                     FGFKVDVPISLGILIAKLLSFDPRKRPTALEALRDPFFWPLYDSRDEILRCPASDPSV
                     AREQIDDIAAYQKAHPCVVVDESPVFTWEFDHRITSAQALRGLFEEECQISRDVQQQL
                     ERQQRLRSSPVVKCSERRTLERSLFSGASDGSSGGDGAH"
     gene            complement(<624630..>638624)
                     /locus_tag="LMJF_13_1650"
                     /db_xref="GeneID:5650194"
     mRNA            complement(<624630..>638624)
                     /locus_tag="LMJF_13_1650"
                     /product="putative dynein heavy chain"
                     /transcript_id="XM_001681857.1"
                     /db_xref="GeneID:5650194"
     CDS             complement(624630..638624)
                     /locus_tag="LMJF_13_1650"
                     /codon_start=1
                     /product="putative dynein heavy chain"
                     /protein_id="XP_001681909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650194"
                     /db_xref="GOA:Q4QFY9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY9"
                     /translation="MAKGDKDDAPADKRVVWIEQRITNALKLKPAESKKLLESEENRA
                     QMSEFLDTADACHLYVYQASTGAFVTRIEAPEELKKKGLFFSKIKREKIADENHMKEK
                     ITFGDFSPDVLNSLSAVTRNVYVQILKGDKRNTATVPDVAIGELMGDTNQLLSNLLVM
                     QGLSQGKTFLPMPPIQFPPRIDDFVMDKETLYLLEGTVVSWTGQIKAAIASSPEELEE
                     AAPQTGRYPCPLDEIHFWKEKSENLAGLEEQLYSVKSLKILVLLKRAGSSYYAAFSQL
                     MAELKDAAHESRDNYQYLKPLIPEFEQMSMSAASHVPFVELSKSGVFKRLFHFLYLLW
                     TQSGFYNNPARLVFLIREMGNALIEMAADHVNVAEFAEGLEKKEVIERLSSALAIGGE
                     FKALYFQYKSHVSSVARPWKFQNAALFSRLDTFLERCHDLLDVIETALLFDKMENMKI
                     GGTKGEHLTSEAEEIKQIFDVSLARFFSVDYDLLDITNTRFDADYDDLKCVIHGLEER
                     LSSILVTTIDESSAITEVFKAVDTFDGFTDRTPMQQEWLKKQSGVLEGFHRDLIKVQE
                     TYYAGEAAGVYPNMPPLASTIVRCKALLDRINESHSRVVDLSSTVLQGERGVEALQLY
                     GKLKELLQSTIHEKFERWTAQVGTLRSDKLRLPVLSVDANKRLSVNFDASLVKTLREV
                     YYVEVLNSYESSGVGQFEVPRDAEAIFTKRDVYRDQALKLEYLCTTYNNLSSSLRPHD
                     ERPLIEDELQKFESFLSCGLKDVRWEDEDATNAFIEEALKQVTAIDTAVSTLHCNVQQ
                     MKNSMNKYKTDDTLFPLDAATGAKTMSVVELRKTLGDYVESRAAGLRDRNDEIKSLMQ
                     NSLQALQTLKEASGGSVVSSTDAVWQDYLAYVSSVARECLAEVAVTSLTNMRNQLDPV
                     WLADHDGIPLVDVKLSLSKVTADNPTSKSRFDPALMTSDSEETSVWQMLSDTIAGIID
                     SYSLIDPVHGSTSYTEEMRQDEHVQALVEEIQTLFQQNVMACEEYRHAYDEFKSLWET
                     DRKKVFAKFIETDHHRNGHRPSVSMEDATAAMAQGQKPAEYFGVSLQEFDRAITEYTR
                     IRSRLTAIEDRHTEGSVLIDVKPLRVALRDLSRRWKEMYSDYLLDKIKADLSQLYEFI
                     KEADKGLEVEVLDGDVDALKSVMRWIRDCRKRNTEVMGDDETGETGGMFLPIKAAIGM
                     LKTHASTSPDAEAELAKIEKLEELRKPAPEQWVALNKKALNARAQNSIVQDREAEKIK
                     ENVAAFEQELNYEVDVFHQNPLFTYAIQPSEVYNAIDSVYAHFMVVENKAKGLQNLQD
                     LFDLAVSHFKGIRECRQELALLKQIWDLNFHVTSQFRDWMRSTFKDADVSYFEDEAKK
                     ISKQLQLQPMKVKGWGVFKGVDETVRNMRTSLPLCDSLSSPSMRPRHWEELVRTTNQP
                     GTIDPAAADFTLEKLFALGLHKYSEDVASIVEKAEKELRIETNLSKIIVAWEKLQFTY
                     EMDAHLDCYLLGSVDDVVEQLENDSNALSSMLSDRFVEYFYEKVLSWQKDLGLVDTCT
                     TKWMDIQRQWQNLFPIFVLSEDIKEQLPNEAKQFSEADRVFRLLMSKAHLYTNPVETI
                     CSGKLSEDIGRGEALEETLNYIQGILNRCEKALADYLETKRKLFPRFFFVSDTDLIDI
                     LSKGSDPRAVIVHMSKIIESVDSFTFDNNPYPNAGAEEVWEMVSIQGERVTLTESFAC
                     DGAVESWLEGLVQCMKRSMKVHIREANAGYLEKPRNEWIYQYPCQAVIVASRIWFTTE
                     VHQAFTQIEEGNDMGMKDLLKSQKSQLDSLIKEVLLDRSSTERKMLVHLITIDVHNRD
                     IVQSMVDDRIDSVDAFSWQSQLRYYWDENKGSEIRIADADFINGYEYIGLCGCLVITK
                     LTDRCYITLTQALRLKQGGAPAGPAGTGKTETTKDLARNMGIACYVFNCSDQMNYITL
                     GQIFKGLAMSGSWGCFDEFNRISIEVLSVVATQVGSILNALKENKSRFRFVGVEISLK
                     RSVGMWITMNPGYAGRTELPENIKSLFRPCAMCVPDLKNICEIMLAAEGFGDAKDLAL
                     KFVTLYRLNKELLSPQDHYDWGLRAVKSVLYIAGALKRGDPDLPERNVLMRALRDTNM
                     AKLSKDDVYVFMGLIRSLFPNLDVPKKNKPELVAACKAVCKEQGNLPGENDIFILKCV
                     QYEELLHVRHSVFILGAAGAGKTECWRCLQGALTKLHQDEWKAKAVSSCLNPKAISSN
                     ELYGYFTPQKEWRDGILSTIFRDYAVESKKKKNMKWIVLDGIIDAEWIESMNTVMDDN
                     KMLTLVSNERIPLTDSMRMIFEVSHLRNASPATVSRAGVIFINESDLGWGPFKDKWIA
                     SREKREGVILDNLFDKYVPFIFEFWKRSMRPIVSVMDINVVQTLCFLLDGIFKTMEPE
                     ELAKNSNPFEVYEKYFVFAAIWAFGGPLPSSDGRIDMRLNFSNQWKKEFPSMKISDAG
                     SVFDYYIDKTKDDGGAVLFDWKPWTELVQPYTMDADIQLSSVSVQTADTVRMSYLMSL
                     FVDNAKGVMLVGTAGTGKTNLILSKLRSLDNEKVVFRVVSFNARTSSSGLQGVMEQSL
                     EKRSGRTYGPPNRKKLVFFLDDMNMPTPDKYGTQEAVALLQQHVGYGFWYDRVKIVQK
                     EVVDVRYVGAMNPKSGTFTILDRLLRHFAVFSTNMPDRADLVSIYGQILQAHTKPFPR
                     DIRDTLTTLLTNATIELHSNVAKLFFPTAIKFHYQWNMREMFNIFQGVCKSNPKLHKS
                     SLQLVRLWVHECNRTFRDRMADDADMKRYDALLQEVIMRAGFTDVKAKDVMEEPLLWA
                     PFHTTPEGLENVYDETNYDDAGAYLRKKLADYNENYASMNLVLFNQAIEHVCRIARIT
                     SNPRGNAFLVGVGGSGKQSLARLASYINGHDIFQILVTSTYDISDFRNDMQELYRKCG
                     VRGYPFAFIITDTQIVSVEMLVYLNDMLSSGNVPELFNQDEREGIIASVVNEVKASGV
                     ADYSNPDVCWEHFIHKVRSNLHIILCFSPVSKNFASWCRQFPALANTTVIDWFLSWPE
                     QALRSVAQRFLSEIDLGGEEMTQNIADFMAYCQIKVTETCEEYYAQEKRHAYTTPKSF
                     LELIAFYKDLLARKRKENSDQTDRLVSGIDKIKEAGAQVQGLQEVLQRESVEVEEARQ
                     KTAALLETVGREKSVVEEQSAIAAKEESKTNKIVEEVTSFEKQCQEDLAKAQPLVQEA
                     LAALDTLDKASIAELKNLGKPPEDVQMVAICVLVLTSNPRSIPSMKQRSWNECKKMMN
                     QVDRFLTELRNFDVNNIPQVCIDQIQVYINNPSFDPDIIRNKSFAAAGLCKWAIGMNR
                     YHAVRCEVRPKEERLAEAQQRLVSSRAALKKIQDKVADLQAKLGALVSQYDEAVAEAD
                     AIEAKAKKTQMKMNLAQRLVSGLADESVRWGATIEKLKEAAKLLVGDVLLSASFVSYI
                     GPFSKAFREQIVEQDWLPEIKKLGIPMTEGLDVTMDVLTSEAAVASWNNEGLPSDRVS
                     TENGAILNNCMRWPLMIDPQLQGIKWIRTREEKNGLRVVQTTQKGWQRTLQTCIEEGL
                     PCLIEGLGEFVEPVLDGVLSRQTFRKGGREFIKLGATEVEYNPKFRLILQTKLGNPHY
                     GPEVNAQTTLINFMVTETGLEDQLLAVVVSQERPDLENKRGMLIRQMNTMTIELQQCE
                     NGLLYELTNATGDILENVTLVENLEATKKKAKDINASFAQAVVTQKDIAQNRLRYTDV
                     AVRGSLLFFQIDQLWRIDHMYQYSLEAFMVVFNKALAGAPQPENKKDVKKRVANVTQS
                     ITENVFAYVSRGLFERHKLIFSSLLTFTILSRCNEINLKQLDFLLRGKKKTGVVRPET
                     VTAWCTQPNWDAVQALAEVEGATPSFSLLPSDMAENNRWFQYCELEKPEVEKMPGEWK
                     NLSNFERLLVLRCLRPDRLTAALEMFVGTTIGRFFVSDQAVDISVSYQNSSTTTPLFF
                     ILSPGVDPVKAVEELGRKLGYTYDRENFYNVSLGQGQEVVADRALDKCFAEGGWALLS
                     NIHLVEKWLRTLERRLDTYAETYTRVAQLRKEIAERKAGERSAAAGGAGGGDKEQHDD
                     EAAEDKSAPSHCESGEGETDEDIGDGEDGAEAGSGNAAGDKNNMIVVTDDEIEFDGVK
                     GHPDFRVFLSAEPSNVIPIGILQRSVKLTSEPPTGIRQNIVRAMSNFSDEPWEKSAKP
                     TEYRCIMFSMCFFHAVVVERKKFGPLGWNRAYPFNAGDLTTCMEVAANYIEDRPKVPW
                     EDLRYVFGEIMYGGHITDDWDRVLCMAYLQSYLIPDCCDGLQLAPGVAVPAPASYQEY
                     MQWLTTSDDFPAESPLLYGLHPNAEINYRTMQADVLFKTINELQPKKHSGGDMLSPQD
                     IVQQKIDEIRERLPEPHNLQDLSERLEDDRSPQQHVFYQESERMNILIETLRASLEEL
                     NLGLKGALSMSTAMQELFDQIFLDKMPERWARVSFMSQRMLGSWVENFMARNEQLVSW
                     NADLQTPKVTNISLFFNPMSFLTAIMQTTSIINSFDLDQMALVVDVLKKSADQIESNA
                     RDGCYVTGLAMEGARWDGTAGCIEESRLKDLYPKMPIMQVRSLPLSKIDRRDQYECPV
                     YKTQARGPGFVVGFYLKSKQPSRKWVIAGVGLLLDVVE"
     gene            complement(<639718..>641334)
                     /locus_tag="LMJF_13_1660"
                     /db_xref="GeneID:5650195"
     mRNA            complement(<639718..>641334)
                     /locus_tag="LMJF_13_1660"
                     /product="putative chaperonin TCP20"
                     /transcript_id="XM_001681858.1"
                     /db_xref="GeneID:5650195"
     CDS             complement(639718..641334)
                     /locus_tag="LMJF_13_1660"
                     /codon_start=1
                     /product="putative chaperonin TCP20"
                     /protein_id="XP_001681910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650195"
                     /db_xref="GOA:Q4QFY8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY8"
                     /translation="MSNLAYINPGGKQARKASALDINMIAARGLQEVLKTNLGPRGTM
                     KMLVSGAGMIKITKDGNTLLGEMQIQHPTAALIARAATAIDDITGDGSTGVVLTIGEM
                     MRQSERYIQEGMHPRTITEGFHIARDEALKFLEGNIIEIPNEERREYLTNVARTALTT
                     KVNPGLSEQLAEAVVDAVYAIAEHGKEVDLHMVEVMHMRHRLSSDTRFVNGIVLDHGG
                     RNSDMPKYLENAYILTCNVSLEYERSELTTGFYYKDPAEKARMVEAERKMTDDRVRQI
                     IELKRRVCTKENGRTFVVINQKGIDPISLEMLAKENILALRRAKRRNMERLVLSCGGE
                     AVNSTDNLTPDVLGEAGLIQEYTLGDDKYTFVENASKGKSCTLLVKGPNDHTIAQIKD
                     AVRDGLRAVKNAFEALAVVAGAGAFEVALHDHLMKFADNVSGKQKIGIRAYADAMLVM
                     PKTLAENSGLDVQECLITLQEASRTARKGGKWVGLRIENGDVIDPIAAGILDNVIVKR
                     SLLESTGDIVAQLLLVDEIMKAGRRGAGGQ"
     gene            complement(<641839..>642159)
                     /locus_tag="LMJF_13_1670"
                     /db_xref="GeneID:5650196"
     mRNA            complement(<641839..>642159)
                     /locus_tag="LMJF_13_1670"
                     /product="putative 60S ribosomal protein L44"
                     /transcript_id="XM_001681859.1"
                     /db_xref="GeneID:5650196"
     CDS             complement(641839..642159)
                     /locus_tag="LMJF_13_1670"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L44"
                     /protein_id="XP_001681911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650196"
                     /db_xref="GOA:Q4Q3L3"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q4Q3L3"
                     /translation="MVNYPKKKVMHCGDARCNAHKSFKVVQYKAGKARLFARGKRRYD
                     RKQSGYGGQTKPVFHKKAKTTKKIVLKLQCSGCKSIRQVVLKRTKHFELNDKKKTGNK
                     DPTW"
     gene            complement(<642886..>643704)
                     /gene="P5CR"
                     /locus_tag="LMJF_13_1680"
                     /db_xref="GeneID:5650197"
     mRNA            complement(<642886..>643704)
                     /gene="P5CR"
                     /locus_tag="LMJF_13_1680"
                     /product="pyrroline-5-carboxylate reductase"
                     /transcript_id="XM_001681860.1"
                     /db_xref="GeneID:5650197"
     CDS             complement(642886..643704)
                     /gene="P5CR"
                     /locus_tag="LMJF_13_1680"
                     /EC_number="1.5.1.2"
                     /codon_start=1
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="XP_001681912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650197"
                     /db_xref="GOA:Q4QFY6"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY6"
                     /translation="MSELKIGFLGCGSMGECIMAGLLKAKALGPENTFICNRSASTNE
                     RLVSLYQVKSVSAVELAEKSDIIMLGVKPYGIVPVLETIKEKITPSKLVVSMAAGVPI
                     ATIENHCPPKTKVVRVMPNIPSYVGEGVTSISGNSAVTPDDEAVVMKLFSAIGKSYLV
                     AESAIHGVVGVAGSSPAYVFMFMEALSDGAVRGGIPRAQSYEMAAQAVLGAAKMLQDS
                     GKTPSALKDMVCSPGGTTIEAVRFLEKGGMRSSIIEAMIQCMEKSKEFERMYSE"
     gene            <645551..>647374
                     /locus_tag="LMJF_13_1690"
                     /db_xref="GeneID:5650198"
     mRNA            <645551..>647374
                     /locus_tag="LMJF_13_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001681861.1"
                     /db_xref="GeneID:5650198"
     CDS             645551..647374
                     /locus_tag="LMJF_13_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001681913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650198"
                     /db_xref="GOA:Q4QFY5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY5"
                     /translation="MFDIREKDVRLEVLSKSPVRPISETHRFGLLVLGLFGMICGSFG
                     SYTFNLVSGSLQERYSLSQRDLSTITTAGTVIGNVMLPYSFLYDYIGPLPIAVLSSFV
                     FPLGALLVALCFQGVIVGNLVKLCVFYSFMNAGTSFFDLSSCITILSYFPTTRGPVVA
                     LLKTFIGLGAAIVGSMFQGFFGGAVQYFFYFLMLFAIIVGVLGILFLRLPAYHLTGYE
                     EAHLSRAEKEQRLATKAQFLKQKPPMWRFYYGFVLMVVLIGFLPLTVALVDYLDLGRK
                     EKLAFATITTILAAGFFVIAIPPEVFQCARRILPAHEHVETLKKAETMPYGNSNDADK
                     PLPFPNPAVMEEDVDTEIDYIAPQYQSSFVKNLLSVHLWALWWTSFCIVGAEDVIINN
                     SSYIFGALAGEQTSTSTRTLLTVLNGVGSAAGRLLMSYFEAWTQNRPAEKRIPLTISL
                     FIPTTSIIVTIVLFLTLPKQALPLPYVIAAVGNGFLAATTILITRTIYARDPAKHYHF
                     CFLAAAASSIALNRFLYGEWYTVQSEKLGNSLLCTRRKCVEMPLIVLLGLSCSAFVSN
                     VVVHLTYRRYSERVLAERRRLREENFPKSKPLDEGTPGMTL"
     gene            <649061..>650434
                     /locus_tag="LMJF_13_1700"
                     /db_xref="GeneID:5650199"
     mRNA            <649061..>650434
                     /locus_tag="LMJF_13_1700"
                     /product="hypothetical protein"
                     /transcript_id="XM_001681862.1"
                     /db_xref="GeneID:5650199"
     CDS             649061..650434
                     /locus_tag="LMJF_13_1700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001681914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.13.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.13.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650199"
                     /db_xref="UniProtKB/TrEMBL:Q4QFY4"
                     /translation="MDIWTAELRRAHSWLLADDTYRNSAMKPQRLLGHLEGDAVVEML
                     KFAPGDLRLTLAAVSPKVRLLAELLESRLPRTLRLLLDDATVMHELVSYAAGASFLQQ
                     LDAVAWWIEKCGIPVSVRGDEAAVTLLTSSHVRPILRGLSLSLLVRACPIPVDVLLRL
                     ERIDMCGEAFASLVADPSQMAQLRELHVARCTSAALLRLYQLPSLRTLSIESKIDVEP
                     VGNENVAENPQHNLGVDEIDMHLMASARSLQHLRLSSSGLSVVSGFDCCESLATVTVV
                     NCERLLSLSSLAHAVHLRSISISWSGVRDLGALAACPCLERITFDTCRAVESLAALAG
                     APRLREVDVFCSGVRDVNGLASCPYLETLCVTACRFVTDLSPLAGAPRLRIIDASFSA
                     VRNLHGLGTCPSLEVVRLDACIAVHNLNPLADAPRLKYVFVRGLDHAALLYPPSLTPK
                     IFPAAAG"
CONTIG      join(FR796409.1:1..654595)
//
DBGET integrated database retrieval system