GenomeNet

Database: RefSeq
Entry: NC_007257
LinkDB: NC_007257
Original site: NC_007257 
LOCUS       NC_007257             714651 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 16.
ACCESSION   NC_007257 CT005255
VERSION     NC_007257.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 714651)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 714651)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796412.
            On Jun 1, 2012 this sequence version replaced NC_007257.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..714651
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="16"
     gene            complement(<1696..>2376)
                     /locus_tag="LMJF_16_0005"
                     /db_xref="GeneID:5650720"
     mRNA            complement(<1696..>2376)
                     /locus_tag="LMJF_16_0005"
                     /product="anti-silencing protein a-like protein"
                     /transcript_id="XM_001682026.1"
                     /db_xref="GeneID:5650720"
     CDS             complement(1696..2376)
                     /locus_tag="LMJF_16_0005"
                     /codon_start=1
                     /product="anti-silencing protein a-like protein"
                     /protein_id="XP_001682078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650720"
                     /db_xref="GOA:Q4QF20"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="UniProtKB/TrEMBL:Q4QF20"
                     /translation="MIFIASLLFHPSLRFLARKLHRRLPAFLLAAFTPRLRGKAPMTT
                     RVELRKVQVVDPNPSKFDAPIRLHLVLDVFEKPPKDAIDVTFTWSPVWDFPVDQELDE
                     MEVGPFTTLGRHEFTIESDPPNVADIPDPTGPTALIVSLKYQGHEFLHIGYNVTVTCE
                     GDLPDVFTSADMLTRHIGKCYPKLRDISWDAPSPATASPSDSDADSTCDSADGPCKRA
                     KRETEAQS"
     gene            complement(<2714..>3838)
                     /locus_tag="LMJF_16_0010"
                     /db_xref="GeneID:5650550"
     mRNA            complement(<2714..>3838)
                     /locus_tag="LMJF_16_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682027.1"
                     /db_xref="GeneID:5650550"
     CDS             complement(2714..3838)
                     /locus_tag="LMJF_16_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650550"
                     /db_xref="GOA:Q4QF19"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:Q4QF19"
                     /translation="MLSISAVQRRYRLFHPVHQTVPFHFNPVQSIFPLIYENNLLAKP
                     RLSWKDYEGRKEFDADHPLPVVGTRLNERTTTHKWSHWDQYINPQITQSWMYLTQTPE
                     YVGPRSGHNVIKMGWMKIGGSWKYSRSYNDARRGFAKGQWQERKMTPRFMLAPRVSAG
                     GPRNRYEGKASFSRLSLSKLLWAVDTGRLNPNETITLYHLRNAKVIADREVVWPGMVL
                     LAGNVERVPYPLHIELQNASAKAIQLLEEAGGSFTNVYMSHEGLYQELHPEEFPTFME
                     QELPERKGLENFATNSRKRGWLAQWYEDESRYAHPGAGRRTAHYIRPPTDRDFPATIE
                     EYELAKHHQKWHLNQPGSATVLPWHSLNTADMARRSAGRL"
     gene            complement(<4388..>5032)
                     /locus_tag="LMJF_16_0020"
                     /db_xref="GeneID:5650551"
     mRNA            complement(<4388..>5032)
                     /locus_tag="LMJF_16_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682028.1"
                     /db_xref="GeneID:5650551"
     CDS             complement(4388..5032)
                     /locus_tag="LMJF_16_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650551"
                     /db_xref="GOA:Q4QF18"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QF18"
                     /translation="MSTGTISAAALQYFESKGIQSILDEAMHDLVLEMPADPLVFLEE
                     AFRRPTPLHVIITGPPGSGKTTLAAKLAAHYGITHVAATPAAVGDMAMPADVLGELKT
                     LQKDGKGWVLDGFPQTRADAIQLQTSAMSPQQVFELQVPLAVALERAIITAAHASKNI
                     EEATAIAKNYEHYDVRRLEVTTSYQHCYRGIDATISAEEVAAEALKAIDALQLL"
     gene            complement(<5529..>6626)
                     /gene="PRMT6"
                     /locus_tag="LMJF_16_0030"
                     /db_xref="GeneID:5650552"
     mRNA            complement(<5529..>6626)
                     /gene="PRMT6"
                     /locus_tag="LMJF_16_0030"
                     /product="arginine N-methyltransferase, type I"
                     /transcript_id="XM_001682029.1"
                     /db_xref="GeneID:5650552"
     CDS             complement(5529..6626)
                     /gene="PRMT6"
                     /locus_tag="LMJF_16_0030"
                     /codon_start=1
                     /product="arginine N-methyltransferase, type I"
                     /protein_id="XP_001682081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650552"
                     /db_xref="GOA:Q4QF17"
                     /db_xref="InterPro:IPR010456"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QF17"
                     /translation="MQHQEDYASSASKDDQYFESYADLSVHKVMLRDRPRMDFYKALL
                     TDRSVVEGKVVVDVGSGSGILSCWAAQSGAAHVLSLEASSLAKLQQRIFADNGLSDRV
                     TVIASTVEELVAAGVEAFLNEHPCVRLHGGVALVVSEWMGFYLFHECMLPSVLRARDF
                     FHDVNAALQSSLAVSMLPSHGRLLVAPITLKPYYAETFAAFWDSVDGVSLHALGKLDF
                     EEHVEATSPLVDVMPPRSLLHDGVVFWEGSFDTLAVDKLASIVAARTFDFSTSVTTAS
                     ARTSLHETGRFTVEGFTLWFQVSYGDAILDTSPLAPPTHWKQTTVLLPREFRDEKTVS
                     FHCLDEHLELTLRLTAEDLAQRCYKIEFELN"
     gene            complement(<7324..>8523)
                     /locus_tag="LMJF_16_0040"
                     /db_xref="GeneID:5650553"
     mRNA            complement(<7324..>8523)
                     /locus_tag="LMJF_16_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682030.1"
                     /db_xref="GeneID:5650553"
     CDS             complement(7324..8523)
                     /locus_tag="LMJF_16_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650553"
                     /db_xref="GOA:Q4QF16"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="UniProtKB/TrEMBL:Q4QF16"
                     /translation="MMSHRRGGHAALVSLLLPLTSHRFCVSPSHVLSIASCAFPCTHS
                     CCVQQGVHPSHLPACLPACRRPRACFVSALCRAHEHAVMFSYNNIIEKGEPLNKEIID
                     HVLDHVTEFPTPTMVSVGDGKADCIVLENFLTHEECDQLVAACEKVGYTFWLQKNHHD
                     ADGEATCDSGSKAVRVVDTIEANFPHLSAKLYERIARVVSLKPKCFSEDMPNAEELFE
                     RELAGTWVPHALSENLLFGRYHPGGHFMPHVDGATILDLNTRSFYTLLIYLNDCLHGG
                     ETFIFAGEQCNVMYLDEKENQYRGNATQRVGAVYPKKGSAAFFYYNLLHEGAPVLEGH
                     KYICRADLLYHRTPTIFTSEADEKAFKAYQEARLAESHGDAERACQLFQRVRKLSKGV
                     ASIFQIE"
     gene            complement(<8836..>10809)
                     /locus_tag="LMJF_16_0050"
                     /db_xref="GeneID:5650554"
     mRNA            complement(<8836..>10809)
                     /locus_tag="LMJF_16_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682031.1"
                     /db_xref="GeneID:5650554"
     CDS             complement(8836..10809)
                     /locus_tag="LMJF_16_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650554"
                     /db_xref="GOA:Q4QF15"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QF15"
                     /translation="MSLTALTAKRVRRTWEPEEKAWHDDALELPWEDVRPELHKASIF
                     ALKNVFFFSHATPVQALALRVLTQAGTSAVVEAPTGSGKTLAFLLPIMERCVRSCETY
                     VALHQRPPLFRYVLGVIFSPSRTLAEQTFVVGRSLAARYPFNIQFVLCDGVVQKPAAV
                     LQHLQRGARGAGTILVTTPKDFDQLLPMLEEAQRTPLNPSSDDSADFPAPQDEAMQQR
                     YVSRRAQANTDAEKGSISRDSVRFYSTSEARFVVVLDEADLLYNSPDMRNTVQQFVAA
                     YGRTRDPVSPSPRRRKSAAKKRPVPEKETGPAGARLWMDFAFVGATVATSPSLKVYAE
                     KVCAECASTLHTLALRSNDDFVSQLSNRFVVCDAANFLPYFVQLMNLHASKKHFVFFN
                     NFRVLLFVQRLFYVLCQGTRPLLYIPKVFVMYEGMTESARIDQYNQFLTHVSRSNEAR
                     KPKKAISDAEKKNQVFTSGWKRDGTVSMGTGAVLLCTDVAAFGLDVRDVDYVYHFEPP
                     ATVQSYIHRVGRVGRMGMKGSSILLLPCNADSTPMESARERKMDSTRFHTVTNTKKPT
                     AQLHAPCISADSLPEERRAYVAELGKHSALEEYTLPPFAPITSTLRNYITQDEKLLKL
                     AKRAAISMCEAPQGEEEKAWFHPRLAVRALLLD"
     gene            complement(<11782..>14661)
                     /locus_tag="LMJF_16_0060"
                     /db_xref="GeneID:5650546"
     mRNA            complement(<11782..>14661)
                     /locus_tag="LMJF_16_0060"
                     /product="putative peroxisome assembly protein"
                     /transcript_id="XM_001682032.1"
                     /db_xref="GeneID:5650546"
     CDS             complement(11782..14661)
                     /locus_tag="LMJF_16_0060"
                     /codon_start=1
                     /product="putative peroxisome assembly protein"
                     /protein_id="XP_001682084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650546"
                     /db_xref="GOA:Q4QF14"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QF14"
                     /translation="MTPSTAYLPMTRCIFRALTDEGYKAVMGKPPGTYSLQSEIAQNH
                     TSLHLHQIVTGTDAYPSLHVVDLLPSTHCSLSADTAVTMVVLPPAPIVGETADRDVAG
                     EAYHDDAPAACVAVRLDNSLRGSTALATPRTLENLLLDDEAIVKVSGGCHNCVFVVNE
                     LRSTPTDSSSGTMMTVGPELFRNVRAAFYSHPSQVLMSSAQAVDYSNTVLYLPVDAFQ
                     PVEDDSGELLHTSAAAQTHALTKIVLCPAVNDAALTELYGLHYPDLCALFGAASAAAW
                     EGRLVSTGDVLYLEKDTLHAVAQRLEGVDVLESVARVLSHKVRKWSGTWVDENASCRH
                     LLAVRVARLERSGTAVPFGVLRNCGGEADAVEVALVHQRNSHVWEPTPVWAPSPAHGL
                     ADVQVYARLCRELRRVVTPSLEGDVHTFVVRGVKENLPREFVECAVAAFGLPCLLAST
                     EAMEEAELETLTRTFLGERCGAATVLILHNAHTIADLCPHFLSVLDELSSGARATVAG
                     GPPPGPRLLFLLCESIDAVPPMIAARATNADGVLECGNPSEEDRAAFIAPLLQWSCAH
                     HRVHASVLLSPKTLAGWTVGLTYADILSLVEACVRDAAQCARCTGEALAVVSDVSCES
                     VVQSYLKSHGYSMVSTKLQPVRWGDVGGLEEAKRELREMIQLPILHPEVFEKGMKKRT
                     GVLFYGPPGCGKTLLAKAVATEMGMNFISVKGPELINQYVGESERNIRLLFQRARDNS
                     PCIVFFDEIDALAPARGAKGDAGGVMDRIVSQLLVEVDGVGQKRSDGTASGDVFIIGA
                     TNRPDLLDPALLRPGRFDRLCYLGIPSTREEQLFALKALTRKFDMSADVDLSAVLEPL
                     DFVYTGADFFALCSDAMMFAVEDALEEVQQQITTHALAETAAASTPDAAPPPATAAAE
                     EERKPITVCMQHFLRARAQLKPSVTKADLHKYEALKRTFDKSTKG"
     gene            complement(<15211..>16410)
                     /locus_tag="LMJF_16_0070"
                     /db_xref="GeneID:5650547"
     mRNA            complement(<15211..>16410)
                     /locus_tag="LMJF_16_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682033.1"
                     /db_xref="GeneID:5650547"
     CDS             complement(15211..16410)
                     /locus_tag="LMJF_16_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682085.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650547"
                     /db_xref="UniProtKB/TrEMBL:Q4QF13"
                     /translation="MDASDMAQETASSSPTEVHHTTSLHHTERGALLRQLAEVQRRME
                     QRLGAVNVELEYLEAFRSGIVSEMRSESSPRRRSVTVLAPRDGGKRSREEVAFVGYAM
                     ASPRHRGEVRALGFDPFREAGLYVSSNNPVVRVAPLSLSKDEKVRQEVEYILPSYISV
                     GVARARGLPFAGAARLFESLAAAGLDKSDFALSSTSAGRCLSVHKHPDPSDVEALCAA
                     VPEERVRALCRDSMGDAGAIASCLYTELAQQATQRALILPAMRLRNVMLLRLPPYRQQ
                     LLLEATTWTLRRCCDCRDRDLTENSHVQWCKVLHSAAPETQACAYLKRNAYATAYSQL
                     LQGLSTVSSVRQGYLVAVLTVCGNFFDLLDAGKLPLQRRTSPFLFHGAYAAPNEGQTS
                     LSPAVCS"
     gene            complement(<17818..>20028)
                     /locus_tag="LMJF_16_0080"
                     /db_xref="GeneID:5650548"
     mRNA            complement(<17818..>20028)
                     /locus_tag="LMJF_16_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682034.1"
                     /db_xref="GeneID:5650548"
     CDS             complement(17818..20028)
                     /locus_tag="LMJF_16_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650548"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:Q4QF12"
                     /translation="MGKGRDKRKKNEDPAKATKRAARQALKLQKSMRKENGEEAAEGF
                     NNEEAIEVTLKRIQKQEGKVKTVEEVANVAPPTPRVNVVLVPHPERDSELILFGGEFW
                     NGETTEAYNDTYFFNVKRNAWARLSSALNPAPRSSSQAVVYKQYLILFGGEFVSQSQS
                     QYLHFKDVWRFNCRSSEWEELRNLKGGPSSRSGHRMVLWKRNAVMFGGFYDNAQECRY
                     FDDLWLLSNLDGAGHWSPVKTAPMTDLPHARSGHSMSVYQDELFVYGGYSTQKFNRFK
                     KSEATVHHDLWMITLRQEKALACSEGPLPVWTKIKLGGIPPPIRCGVSCAFKDKRLYL
                     FGGVVDIESPGGKMVSTFYNDLYVFHMDTKRFYPVVLRRVAKRAVAAGKRDHLDDLAA
                     QLSALDLRRGEASSEEESSSTSDEEDDDRTGQPGTAAASQEMKESYETNRHGQILPHR
                     RMDSAMVVVGNTLYLYGGQFESSKKEITMSDLFTLNLNKLDTYQPLLSQDLSAAVWLG
                     KESESDAASWESGSTVVSAVYDLDHDEDDDDGDDEEDGADGMGRRGVNFGNMPREPVL
                     DPEDEGNEAPEAIPAELAMEVTPSVAGVADAVAGITRTGKKGLKVHKEQLLAQLGASS
                     AVPTPEREETFTAFFARTSSFWMSTARESVEGRCTDRRVTKEATEFAKQRFYEARELL
                     AQLQLVEDREREEVKFFRERRLRKEREWEEYEEAQRRLEENSDHEEDDAHDEDD"
     gene            complement(<23116..>24099)
                     /locus_tag="LMJF_16_0090"
                     /db_xref="GeneID:5650549"
     mRNA            complement(<23116..>24099)
                     /locus_tag="LMJF_16_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682035.1"
                     /db_xref="GeneID:5650549"
     CDS             complement(23116..24099)
                     /locus_tag="LMJF_16_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650549"
                     /db_xref="UniProtKB/TrEMBL:Q4QF11"
                     /translation="MAHPCLQQGGRTAAAKASQTLCGHTFSAEHHHFLCAIAQTRGWA
                     GRVWVPVPVVERLSLPLADSPFTPVRLESSNGSVCVYHSSQFVEPLDVLRERWKAHVR
                     GLENAEKDRNAALLASRAAPDALPLSTNGERFDSATEECMLRIMGSRANASRYWATEA
                     EAKWLYRAPFTDAHLSNPGNRVVSHANELCRPMALYNVEGTVDPSRFTPLTCRRYDPV
                     NYAGRFYRPAVAVRMKSFALQYNCLHEQQWITQHRAMRLGLSILPHIPPLTFSLDMPL
                     FLINIGATHRTSAPASRVSPAIAADCIVTSEDVLETPERQCERCLLLPSLS"
     gene            complement(<25119..>27215)
                     /locus_tag="LMJF_16_0100"
                     /db_xref="GeneID:5650555"
     mRNA            complement(<25119..>27215)
                     /locus_tag="LMJF_16_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682036.1"
                     /db_xref="GeneID:5650555"
     CDS             complement(25119..27215)
                     /locus_tag="LMJF_16_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650555"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QF10"
                     /translation="MSTESAMSEVHTDFRGCSLLPDFAAVADVSERTGVGYLQYSNGA
                     IYEGEWLNGERHGLGVCYYPSGNIFVGQFRSGLMEGPGTMFFATGECFSGEFRDSTIY
                     KGVYSRQGREICGVWKDGNRVSETHTKAPEVLQRARAALFATIVKQVNEYLWGAASNP
                     TKLVLSASPEGAALQAPLDILSSSTGPNGTPTAPPQHLTVMPSFDAGNQSFTSVRYRP
                     NASLADGEAKSSAHGIVTQYGSPATVFACAAPAPNEIFSVCRFTLRCFIFLFPFLSLP
                     WVPVAPLRITSMHEEREFVVSGAALRSDFDAPSFSMYIIALGMLCHIVAIILVASRVP
                     LGQVQDGKLTLPEMVVPCVLWLLVALVKASYISFFRFPHGLERVDRRLTPKLSALAAS
                     LVDAKSSVCIFTYDDDGKGKVMNRHYKYRWLLFGVVLGLIMSFSAPATRCGYGHNMFG
                     SNGFQKTAALLAFFATFLFAATLTFSVLKITDMQREIRAKLHVLTNLAFLECRCLMSP
                     SKHASMAFDLDESFNAENVFSGFPGWYSLRSLILYASACANHRARTAAMRVFWFALVC
                     VFIVGIADTLLMIQNNRPRDRYYSTAHSYAFFTFLFWGALLHRYLYVCVSTRRELQHH
                     LYIMDIAGLYHRVKLSDSEAGNIIQQCRCISESNDTEPEIFPVMIYSFVVLLTVILNL
                     AAMTAICYQLGRAIYR"
     gene            complement(<29371..>31851)
                     /locus_tag="LMJF_16_0110"
                     /db_xref="GeneID:5650556"
     mRNA            complement(<29371..>31851)
                     /locus_tag="LMJF_16_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682037.1"
                     /db_xref="GeneID:5650556"
     CDS             complement(29371..31851)
                     /locus_tag="LMJF_16_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650556"
                     /db_xref="GOA:Q4QF09"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q4QF09"
                     /translation="MPEEVVLMMDLKGVLTSSPFPAARRLAENMMRCVFERASSHIIV
                     KRIQERPVPFLAKKYSNFFFTVAKFTERTRGLKGAFERLELGELNRLEFITAFREEIH
                     FMLLALSKQNPEELEAMNIAFPKKVDALKKRFPLLCDPVVQVHIRELLDVEAFLCTIE
                     KVSPRKNVLNLLHYLRTKSQQEIRLFAIGNAWEFEGQYRRMVTAMKYSVADSVPFAYP
                     VICPVEYGESAGSYQNSFQVTGLFDGYVQSYISHKRKPYPDIFMQALEEVRTSRVPTG
                     EALRYDMKPNIFYFDDVEAHCEVARGLPGNPFTEVLLIEDGACDVYKDVVRALKMVAE
                     KDPFWAEVVAGVEKDIAPMFRPSRTPDGRPTSWVTEELHNYSNNLLFVGPPPNDLCSP
                     VSTLEKDRYRMDDEDQERILFYCAQHLPHLFPLKIPPRPGASMNLRTQPGLATSAGPV
                     LFEYVEGSRFFESYRLTLRTGSYILRIQPRGPSPYGSADIRREYETMAHLYETSPGLQ
                     IPTPLLYCDSYAVCGRRFFLRRYRDGENINAISQLIQPRIRRPYSLRRVSINVELRPK
                     LFYKQAIAVLSMLHNSPLPPFMKQAEEEMRRTKRHKHPLLAMVQESIEMYKLALSKSG
                     TAGRFGVQLRSATVEELSRGVLACFDQTQLSHQMIPMPDRLVALHGNFNLSSVLFTHR
                     SLEGRAKYPPHLIGVVQFKFTRLGDPLVDVASASMFCFLRQPEGIYDASHDIQMIFPS
                     PSDLLEMYCSARGYMLHLDRRRRDDIFKVYLASLCLQQATMLITDIVSSTISPHAKRY
                     SDSRSIAQADQLAKRGIDVLHSRTAAKL"
     gene            complement(<32655..>35015)
                     /locus_tag="LMJF_16_0120"
                     /db_xref="GeneID:5650557"
     mRNA            complement(<32655..>35015)
                     /locus_tag="LMJF_16_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682038.1"
                     /db_xref="GeneID:5650557"
     CDS             complement(32655..35015)
                     /locus_tag="LMJF_16_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682090.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650557"
                     /db_xref="UniProtKB/TrEMBL:Q4QF08"
                     /translation="MRVARTHPPRVCGIGTLPSTSAALRCGARCIHRHHSPDRSYSQE
                     IQDRQNAFRWSAHHVFRPHQHFTYDPTSWSRPLEEKVKKSRTLSLVERVKTTAEHVAE
                     RAGYIATLDDVTDCRISKAQKLAEPASEIDVPDYFFAARDASTRLQPATVSVNSSTSS
                     SGWTAVSLQELIEEVQRLQSLLHSPRYTGNASLQRRARQDADFHTTLWQLYERLRDAR
                     VGETVTLDACVFGWFLLTRNLEPLIEAVARAHPQEANKDSSESSDEAAAIRDVFAALR
                     TVVLQPMAEGRCLFKAATSGELSLEALIEILSIATLPFVRRCAEDDVLESQTLVRYAE
                     CISAAARQRALDVAADPDAAEHAAAQEWLDPPHLAAWATSLKRLQAHEVPILGTVSGL
                     EVQVEHAADYVTQLLETITGVTPGGHVIASLSRPQPRTQKAASQMRQDAAPKPVCLDA
                     TAAPHGVQNPPTESGDAVNILVAATAVLHLSHRTPGTSVAREEGARRIVRACLRMLTH
                     TPNYDLCPDDVVAWASEVLDAEHLMHMDDLYCAAHGGGGTAGGSGTAALRFLLLLSRL
                     SYGSVVHRGALGRMVLCLCRWPEPAHTSSKESSEWRRLRGVVMRGALCVLQVPDLEAG
                     AAQQASEETTTWLEALAFGEYGGVVPMTLWRDAALSLFPHLCYHAEGSTSASSPSPPR
                     VGSSASRCRPEEAQALCVLCSRYVAREKTGVSAPANLRSIFTARCIAECLAVLLGNPA
                     LPDALLRSADAWDGLCASLPESVKVVATCMQEVVRLDAPPPKVLSF"
     gene            complement(<35840..>36466)
                     /locus_tag="LMJF_16_0130"
                     /db_xref="GeneID:5650558"
     mRNA            complement(<35840..>36466)
                     /locus_tag="LMJF_16_0130"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682039.1"
                     /db_xref="GeneID:5650558"
     CDS             complement(35840..36466)
                     /locus_tag="LMJF_16_0130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650558"
                     /db_xref="UniProtKB/TrEMBL:Q4QF07"
                     /translation="MGSTKPDFSYALQQLPQPVGEGAGERLFFYAHVQRRNCKAAVKA
                     QCSDDTADLYRPAMGLLAKRMSTRRALLDAVAATPRVPSVQRDEPAAIQSSTSALPRC
                     WQKFLSRTAERERQRLARLRNLKLQVVESAVEECTFRPRLSPQTSRCPARDCDSSGAA
                     PHATSSTTVINGEERSSHARTEEWAATLAMFEVEMQALQNTLVRFRPT"
     gene            complement(<39616..>40122)
                     /locus_tag="LMJF_16_0140"
                     /db_xref="GeneID:5650559"
     mRNA            complement(<39616..>40122)
                     /locus_tag="LMJF_16_0140"
                     /product="putative eukaryotic translation initiation
                     factor 1A"
                     /transcript_id="XM_001682040.1"
                     /db_xref="GeneID:5650559"
     CDS             complement(39616..40122)
                     /locus_tag="LMJF_16_0140"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 1A"
                     /protein_id="XP_001682092.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650559"
                     /db_xref="GOA:Q4QF06"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QF06"
                     /translation="MPKNMGKGGKSFKAGNSKGNMQNQKRDLTYANPDEGEEYAQVKK
                     ALGNLRLELQLAGGSTVIGAIRGAMVRKVWIGQGDVVLVAKREFNENDVVDIIHRFTP
                     AEVRLLVKENAIPRDFRSAEERDNNGNTDYIFVNDEDDAQNDDDDQNAIDRNEVIMDD
                     PLAALDNL"
     gene            complement(<41561..>42265)
                     /locus_tag="LMJF_16_0150"
                     /db_xref="GeneID:5650560"
     mRNA            complement(<41561..>42265)
                     /locus_tag="LMJF_16_0150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682041.1"
                     /db_xref="GeneID:5650560"
     CDS             complement(41561..42265)
                     /locus_tag="LMJF_16_0150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682093.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650560"
                     /db_xref="UniProtKB/TrEMBL:Q4QF05"
                     /translation="MHSRTARSHPLSTLGAFASHPFLRALLHGAMPLKKEEVCGKPNQ
                     YNLNTLEYDWRELPDTHVQVPPPQPRVRDYTALVGYGAAGHRVNPITHQPLPSPGAGF
                     GVVGAVSPTPLPSPSRPAQEAMRRAPSPQVHHGNRDHVADLLGGGDGGAGQRPARESQ
                     PRALPPPLVAEESPQALPYPSSGVNGRGGTVHGNAAASPPGPYSADTFNVAWSHEDIK
                     RAVHTNSLEAHRSYLR"
     gene            complement(<43180..>44097)
                     /locus_tag="LMJF_16_0160"
                     /db_xref="GeneID:5650561"
     mRNA            complement(<43180..>44097)
                     /locus_tag="LMJF_16_0160"
                     /product="putative 50S ribosomal protein L17"
                     /transcript_id="XM_001682042.1"
                     /db_xref="GeneID:5650561"
     CDS             complement(43180..44097)
                     /locus_tag="LMJF_16_0160"
                     /codon_start=1
                     /product="putative 50S ribosomal protein L17"
                     /protein_id="XP_001682094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650561"
                     /db_xref="GOA:Q4QF04"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:Q4QF04"
                     /translation="MLRWSRLLRGRPPPVMGHAKRMRFAGVDDNPSVTHKPWDTSEPL
                     MADYGWERGKLPKFRARSPFHRQQIARRMVTELIRKDYVIVGGARAPALRILADHVVE
                     LAKAGDTDSRQQLAYFLHDPLMVDKAFDEYPRRFRDMNAKYAMMTRLKGRRRSDNVAM
                     YFVEYKNRDMSDNHKGEDYTAGPERFFLPPRIIETEKGIQRPPHMQMAFDRWASKFKT
                     EEFHHWWRLRHAKLRYWGVRNVPHPSDVDPLWTEKEEEEWHNEMLANTSDFEDFDLDD
                     DSYEAAGEGGSQGGSSSLSGIGPEPQKKY"
     gene            complement(<44602..>57909)
                     /locus_tag="LMJF_16_0170"
                     /db_xref="GeneID:5650562"
     mRNA            complement(<44602..>57909)
                     /locus_tag="LMJF_16_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682043.1"
                     /db_xref="GeneID:5650562"
     CDS             complement(44602..57909)
                     /locus_tag="LMJF_16_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650562"
                     /db_xref="GOA:Q4QF03"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029636"
                     /db_xref="UniProtKB/TrEMBL:Q4QF03"
                     /translation="MAGKDFDTSLFLKFLFSVIFLFLCCFALMLYIDKVVALLLVFML
                     RFLVLPRNVRLSFSGLHIAPLQARVLFRGFSLQTENVSLRIVDGYFTFAFWGFWFRHP
                     RWARLREYMIGEALIGTRCRVRQNLHYVKGTIVAFDAENKKVSVQFDEHNTNGSSVDE
                     DEDAAAGEDRGAAEPSPKLAGSASSNLRRRCAAGEFSLSMNSMESQNVRGRGTATSMP
                     LGPRGSRWKESRFSPVIVPLLGQHSDKEARMHPEGLGDEVVKAVDVKDVYIRSRAGLM
                     QLHLNGVRLCVYNATGKYLDLARAATAGERAFENRTRESRKASNESSAEAERRGNLSS
                     AGPRNLQGAARKGLSGLLQAIGRYVLSYKEAELEAQGRDDAQESFELRAARKLQEHNI
                     LTTSFAQKFFNFIGCVEIEICAAQLDIGSAASSHPYFLHFTFQQGEGRVFLTKDSCPA
                     LDLYRSVVELTLREVDIRMAQMDSKLSKTQVMRNATLLERARLLVSGVAVPYDHMPLE
                     TTASSELIDDYGIFMDGKNKGTVHLVFYKDAPNVYAGEAVSRGALPTTGVEVLIDAPV
                     VRYGPWLEYCRSQLWQYFLPPNYLPLQELQFEVGKPRPNAGFELLVMFLRATTVEIPF
                     KRRSIVPSPPFGIRDSKRKGMIAATIGEGAQYIQPAFFLLPKEEKQIFQGLFIAKSVT
                     VWTNCVLERETVLCNAESLQFFLDRQDDRLWNGRKLWNILAKLSGAKLYWYMVCVDYF
                     LDLINDWQFSACMYHGVPLTTEMYNTVNRVVRDCIPNVKRFEVFLESLATVYLNVNTR
                     NVVYADDPNDFAHNIMAILTMQSGCFNIVLPSDQYQLSFENEAARPMEASAREVKAYL
                     SLPASHPLYDQVSSETPWAYAESFSMQGLFTMLVPNQSIPLPRNNLDTITGRTHYHSF
                     FNLDLELMNLRGTLMGTHIKALLNCFENTFLDNTFTVAPDELFWLLAKLQSHATTGKN
                     KRKAFKEFLERSQPAGNDVEVCVTVRLVDVSATATTSSMAFAPQVNLSTGLVTFTYAK
                     QFAVTDTAVSLTPLTVRFPDRRGNFPRNSKSYIVIGAITVGLTKHFGRMPLKPKVHEA
                     MEIHVGDVSLEVAAEQLVMLVEVVQTVARHFAIEDAMMEAEVAEALTTAELSAEKVIR
                     CSPLRNTTGVFQKGMRRRHVGQSSVPSICRSAAVGDEVTMSTGSLFGGPMGDYEGKHA
                     DDDGNGAVEMREWRSAQRTGRLPTSHSFPAASEGSGDDGARDWADAGSAVAVDVSGQA
                     HDEPISLLTASAVRGACAGGATATTNNGIGEGDCSLPILHSYESDSGRSSSGKHRRGF
                     KRRRRLFSGLSPASSSGSDDDRGDQRWRPFASQVAYDVALEFAKFREECNKADDDSRD
                     YGLFFFLVDVGTVAGVVRIGEDGYASVELPLGVTVAHSTVNDGNSNKRMSIAMKDVGV
                     QLLLNRTSEVAQSYFPSLQGDASAGEYLEVLSLRTSVCMRQYVAYPFDKSLANHRRRQ
                     QQFVEENDYEHLISFPFNKTSTQCPATPVRASGLGSAAMAPETPRGGEEPPWASRGQS
                     CPAPVAETATPPCSPLPSATAPPSTTNDLNSLLQQASAASSAPPTARDWMPPKLPLTL
                     ARGDDGDAAAMPPLPHTFTSDTDKLSLPSSPNSQNTMVHTHLAGEADDASRLQSTFPS
                     LSTTFQTVDKDNQMSNRFATCVSVPSPMFSSGVSSPDIDSFFDASSSGSLSQERAMNR
                     AFAVDGGVSSTSEATRAAYRKNSGDGGMGTGSPTDAIARPGNNDRGARGRCEARTSPS
                     GGGAASSPAASSSMTAPHFFYRTFDKAKSDDQGICAVDYWPPQRPSNTHRVRDRTRFH
                     ARLPIVGFCLNANRESRAPPFFSYSKRQMLQREENLFAWARCIADNRERSQNNSTSRH
                     LHIAFLDPLTLLVTPEAAVLASAATQLVLRAHQSLRGRRSDPSTLESPGAAPSRAAQP
                     LLLRPHAKKSKARTQQQRWLWESNIVSVAVPTVEVKLLTRLSVPVENLPSEPSVTDGV
                     YTSTIVVRNLRVLMAQNRPPTGEDTEAKASQRMSVSVKVDTVAAITQIEWEPMGREGN
                     LAVKVPGFWYNADKDTLAVVFLTQVAGKVKRDLWRGANGGASNITVSDVAAYVTRDFA
                     DYVQGLMCLVQDVTADVRRRTRVDERFIFPTSQSTTALNLDPSTVPRTALVSAAPAAS
                     GVFSCAAGFPMREAPHTRKGRVVQGKGFVGHLAVTLVDTVRSGQHILVNQTKTSRLDI
                     HRPFCNFVVVTPNLPRDRNVHVQGFGEIDEVSARVFPSLLHILHPRTARRSLGILTAA
                     AGSPKSINSRTPSVQPSVVTTAGTMVLVQSSADASATVHCSGPIGAAGPASRPLAFIY
                     DGTFTVHQLDLRAQQSETNYVQLMGKDLTGCAESRAEGVASRECVQTEALTESISETL
                     KERLRYKAKKARERAKRSRYPAPPETTEQLQLRSTASFFAQEVQVHYVADCLMESISH
                     DLKSPLHDAADSQSMKTSKVFTAAVTDVTLVAQFSQQVNLKGDQVNLHMMVHSAVFQS
                     PHCVRAADTLHPQVHALISSWRHALHAASRTVRPGSTVDKLGSAIILRRGSMSSSAAE
                     RGSAKPQQSRAVTFQVQATRITGFVGLAQGIVQKFLLPQISCFTKTSSNGRTDLKLHL
                     HPFTITSHNTPLEDYSVVLPHVYILYAYDTIKMLCSVTVGTIAITITPLFINHSLLTY
                     EKLIHDVAAVIASPKVHADDEERLATEARSPLGPTDATLRRDSSRATWSSSPTTHVPG
                     GGWSSRSGLSAGLSSVSPTDGNPSLEGATARKDGPRDRPRQGIQSPINADEEVRGAAT
                     EAAAAAPRPPMCKRRRSFLFLLQGVRLSYLTSMTTLRFTIRSLNATADTTEGDTRHVL
                     HWVVNATNTQVALVDRDDHDQMVATYNSLSQHSRLASRETHGSSAVYATSRTSSSGRA
                     TDVANTMKAAHPLSGFLWGSIALSFTLSSGKVDDNRARAALQESTSLGSYSEELQKAL
                     LDSFTTSTSKWELAVFEPLVLVRFGLDSLIKQCVRETEEDIRAMKEATYEADLTASTR
                     LRQHKRFQRLQEEKQRIDRFIKRAEKERCRKLRTMTERVVHDVTQRRGIFPTDASEGD
                     ILLDFFRIRRSHKMVASVSNFMVVLPFGDAAYRSVLEEMPGTFACGKTDRHIHTASCL
                     SRRRFIPSFALKMKMNDVSFICNFEVVKNIVPVLVPDQHHRVRNDAMFVHAGRADQDY
                     TTSLLFHGRLLALNSHLYFSDGSPLGKSAKLLDLLRDTPILGGQGVLTSYAAEEHRRS
                     LNSISVVSVEAPLCIEKKNNTLHVGAVVDVSEPKVRMSSRILSIVRELSQEQTALPLQ
                     VHRRVRRRGETPSPPPHLSRNTSGGASSVARGISGDSPSARIGAEVAAAQPELKRPLS
                     LHLDVTGRLEASELAVFCYSNPEKWCAQSCTAAAGAAGGGGARAYSSPRSLRTTSSPV
                     ARRCVSFDTPSSQNNRMRAARDARAVANATAKGASVNRSNHNPPRSESGDGIDFYSDE
                     RFLIMSVPLPGVTLRAIMRRGRRDASEDVDVVRVEVRAGTIELSPSITALAQEVEMCA
                     RTDEQNRVERNQKIIAFVQSMEAEVPQLRVPLHCPLVEVLVPMPRAYESVLSQVRLDS
                     VAWLRRTDPSARTQTPHGESGGSTGAKNFLNSAVVAVGRNKSHGIVAVHVSITDLRLI
                     FNSEPVASTHFMLYLDQGGTINFVLECFERPDPNERFVNKFPDASLVVTMRSVRAECQ
                     TKLEVKSLEVTLPEAELAISRRSGHIGVVDSVSVYLPFNVEGSEPNLTARLQHMSQLF
                     LVVKLWSITTSETLKTARRLFERRAIPNKFSAQAARARRVRQVVKTTTAFQDKLRMAT
                     DHRTLVYLGLSRAVCFFDLGAGSTHSFTIGSANVVAEYAKRANGCTVSLLLGRISNTS
                     IRSEGVLSGGMMIGDVMAKAFVIQNSDDTEGFVRSPEQRTFREALLMQQVHVNFKERQ
                     LKDIFECKVGSFHGNSMDGIGEEEYTTTDMDIMLQRGTLGVTPSTVPAFLSFVRNISA
                     VVAEQRCIAETRMKETTLPFPAFQGVAGGVSSALTGLQKPMPIICEHSTDSRSRSGSE
                     LSVATQRMRVRIPFMGNTILRVPCGQLRVGLEKTTVLLGAIASGEAAVGCVVLSFPKA
                     RLSFAECPCDDYTAAKKVLVIESHNVEAYRPGTPRVVVMGFQGVNYFEFYTRQALGSA
                     EVGFALTLRQTHPWTGNPRFRDFEEMISLIKSFTDKKNAAVFQHFGRLDTATLSSNTS
                     SRTPRCDSGNNPATAAAGAGVDCSRDSSLKVVGSSSTIGPTAAAAAGDMRTLKALRSS
                     TFSPQLRFGGDVSVNTEVILNWLGVTEKMLPHVVHTALCDKLEKVLYSLSDLASERVT
                     HREEDKSVVVVPTASGGAVPRGFTDSSSILPSASGPRRLDL"
     gene            complement(<60412..>60888)
                     /locus_tag="LMJF_16_0180"
                     /db_xref="GeneID:5650563"
     mRNA            complement(<60412..>60888)
                     /locus_tag="LMJF_16_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682044.1"
                     /db_xref="GeneID:5650563"
     CDS             complement(60412..60888)
                     /locus_tag="LMJF_16_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650563"
                     /db_xref="UniProtKB/TrEMBL:Q4QF02"
                     /translation="MEDAPRTKLSSYVTPHDAVQAQPAQHGATVVRSGSSATEGGSIH
                     FFSSVQKKGGAFTASERETYAQLHRSRAIPNVNRGRNADNVMGSGVSAKSVARKYADL
                     EKDREALAISQAKTTVAGSKRSRFALDDSPSEDSGDDEDDVADAEATANESTARST"
     gene            complement(<62847..>63944)
                     /locus_tag="LMJF_16_0190"
                     /db_xref="GeneID:5650564"
     mRNA            complement(<62847..>63944)
                     /locus_tag="LMJF_16_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682045.1"
                     /db_xref="GeneID:5650564"
     CDS             complement(62847..63944)
                     /locus_tag="LMJF_16_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650564"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:Q4QF01"
                     /translation="MRRSHVGEAQRRQALAERRFRGHRIRRGLEELGDLDAPKKRKER
                     SDGVAALTETGDASPAERATTATALDDCTTDSATAAARTTPAIFSTVFGADWGEWAEV
                     KRVVFDMNATAAEKRSALETIHVWRHRARKERELPAYVESTEVLLDAMLQDEEDALKD
                     GPLRMCYGAAISRVVHVMTGSFASGAADTYRKRASEIGFPEEAVEVRQRVAHGALPLT
                     SELRWVCGLVLQFLFTQYWLEQERQVYLMQQEQGTSLSEASALRKPRQRQPARASTAT
                     LAVETSVSAASLPPPSVTIDDMKALLHDLESDADGDGESTEGGGVADKGNEAAPVTLS
                     PAGPAPTAEGAARRDTSSGASTATIAGWRLS"
     gene            complement(<65892..>66794)
                     /locus_tag="LMJF_16_0200"
                     /db_xref="GeneID:5650565"
     mRNA            complement(<65892..>66794)
                     /locus_tag="LMJF_16_0200"
                     /product="mitochondrial ornithine carrier protein-like
                     protein"
                     /transcript_id="XM_001682046.1"
                     /db_xref="GeneID:5650565"
     CDS             complement(65892..66794)
                     /locus_tag="LMJF_16_0200"
                     /codon_start=1
                     /product="mitochondrial ornithine carrier protein-like
                     protein"
                     /protein_id="XP_001682098.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650565"
                     /db_xref="GOA:Q4QF00"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QF00"
                     /translation="MSLWNDLVAGTAGGCAGVLIEHPFDTIKVLLQTYGGTRYAGYAD
                     CTTKLFRQDGVIGFYRGVTARLVASGFEHAWVLATYKWTLRLIGAGDRPTLPQILLGG
                     CGSGVAATVCLTPFELVKCRMQADDSKGQRRYRGSLDCAQQVLRERGFKGLYKGGFAM
                     LCREVPGSVAWCGTYDTLKSWMTPEGVPTQSLPLWKLMIAGGCSGVAFWTAFYPSDVV
                     KTRIQVDPAYEKLSLWETMTRVYQKEGLRALYRGWTLTAARSFPSNAVIFGVFDSCNR
                     ALSPEPPLMADVLSTVSGRGPTFS"
     gene            complement(<70710..>71861)
                     /locus_tag="LMJF_16_0210"
                     /db_xref="GeneID:5650566"
     mRNA            complement(<70710..>71861)
                     /locus_tag="LMJF_16_0210"
                     /product="mitochondrial ornithine transporter 1-like
                     protein"
                     /transcript_id="XM_001682047.1"
                     /db_xref="GeneID:5650566"
     CDS             complement(70710..71861)
                     /locus_tag="LMJF_16_0210"
                     /codon_start=1
                     /product="mitochondrial ornithine transporter 1-like
                     protein"
                     /protein_id="XP_001682099.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650566"
                     /db_xref="GOA:Q4QEZ9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ9"
                     /translation="MTDAIIHLTAGTVAGMTGVLLDYPLDTVKTRMQVSRCANVPRRY
                     SPTAVMAASSLSAAAPATYWQCVSQLYQRGGIRSFYCGLSVPLAAQGAEAAVVFSVYN
                     VSLQHFLRKEQLQHQEQERPRLSGSPGDHKARSHRHQQMHGKHEQPQQQPHVSVWSSP
                     AHWKASACAGLAVSLILTPVEMLKCNMQMESARPYWRRRHTTVRGLARHLVASQGLRG
                     LYTGVTGTMTRAVLGNMAYFVSYEQCREWLAQRFAPSRSDGEAAPIWHSMLAGGISGC
                     CYWSIAYPADVAKTKMQVCPTARQQGFTRTLASLYHSGGVEALFRGWGVTVVRAFLSS
                     SIVFTTHEHSSSALRELSSVYRVLARDSAAASASSAACEPQEKLISHRY"
     gene            complement(<73026..>73421)
                     /locus_tag="LMJF_16_0220"
                     /db_xref="GeneID:5650567"
     mRNA            complement(<73026..>73421)
                     /locus_tag="LMJF_16_0220"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682048.1"
                     /db_xref="GeneID:5650567"
     CDS             complement(73026..73421)
                     /locus_tag="LMJF_16_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682100.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650567"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ8"
                     /translation="MEHALLQVVHLYPPKTLLRYDSAAHTEKLRHQPHLYAASSCEDC
                     EIVATDEQVGAYTDLLDFITGAQQECYTLFGEDDARWSVDDGGEEERSAGTLDSASVR
                     INSSEWSEGDGDDAHGNGGAPQKRKRSHA"
     gene            complement(<77948..>78475)
                     /locus_tag="LMJF_16_0230"
                     /db_xref="GeneID:5650568"
     mRNA            complement(<77948..>78475)
                     /locus_tag="LMJF_16_0230"
                     /product="protein tyrosine phosphatase-like protein"
                     /transcript_id="XM_001682049.1"
                     /db_xref="GeneID:5650568"
     CDS             complement(77948..78475)
                     /locus_tag="LMJF_16_0230"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="protein tyrosine phosphatase-like protein"
                     /protein_id="XP_001682101.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650568"
                     /db_xref="GOA:Q4QEZ7"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="PDB:3S4O"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ7"
                     /translation="MEVNATLIDCCDPQKPSRVLFHFLILDAPSPSNLPTYIKELQHR
                     GVRHLVRVCGPTYDATLVKSRGIDVHSWPFDDGAPPTRAVLDSWLKLLDTELARQQED
                     PSVPPPTIGVHCVAGLGRAPILVALALVEYGNVSALDAIALIREKRKGAINQTQMHWI
                     TKYKRRHQGAGCVIM"
     gene            complement(<80980..>83271)
                     /locus_tag="LMJF_16_0240"
                     /db_xref="GeneID:5650569"
     mRNA            complement(<80980..>83271)
                     /locus_tag="LMJF_16_0240"
                     /product="histone acetyltransferase-like protein"
                     /transcript_id="XM_001682050.1"
                     /db_xref="GeneID:5650569"
     CDS             complement(80980..83271)
                     /locus_tag="LMJF_16_0240"
                     /EC_number="2.3.1.48"
                     /codon_start=1
                     /product="histone acetyltransferase-like protein"
                     /protein_id="XP_001682102.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650569"
                     /db_xref="GOA:Q4QEZ6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ6"
                     /translation="MSSDSDTEGEAPSGTQSHAHWNRIEHKLANLPTLERLMQESDPN
                     DFSSADVEEASRFVRDIVATAPQCSTDIEKAQRQLQRKYRRVFKKSLLLAGYKHLLRE
                     SMKAANDVNTLVQPHQESCDSSGALTAAAAAAVLPDMEDAVSPPPPSAPGTLPSPSLK
                     TSVVCPVLERYLVFKAPRSQSGVLVVTVFTSAYPDGQNFSCQWNCYYCPNEPGQPRSY
                     LLNEPGVRRANRLEFDPYRQFEERVRSLVAIGHPADKVELLVLGGTWESYPHPYRERF
                     IRDLFYAANTMFDPPRAPRRPPLDLLQEQLLNESAQCKIIGVTLETRPDTINPEMLVE
                     LRRFGCTRVQLGVQHTDDGILTLVNRQSTREDTANAIKLLKDSCFKVDIHLMPDLPGA
                     SPTVDKAMFDDVLDSPYLQADQWKIYPCQTTPFSVIEQWYKDGKYTPYGLENLIDVLL
                     YAKARVHPWIRINRVIRDIPVDYVLAGVEVANLRQLLAHKLRERGERCCCIRCREIKG
                     DSAVTEKLKSATPQERRYEASEGTEVFLSVEMPTDDATILGFLRLRLNIRNWETPFAE
                     LLPCALIRELHVYGNLLPTYVEEAGRSHTPAAQHSGIGQRLLQRAEAIAREEGYSQIA
                     VISGVGVRGYYKRRGYRLLAAHRGCFLVKNLDVGDGLTGAPTTDPQDEPLEFSLERDE
                     ALLQRVTANRTAPASPIPGGVPPPGVVTLAAVRTQAVAWYGQLRTSVAQWWSARKRCR
                     GEETEWQQRSDEEGRAEAAARTL"
     gene            complement(<85421..>85951)
                     /locus_tag="LMJF_16_0250"
                     /db_xref="GeneID:5650570"
     mRNA            complement(<85421..>85951)
                     /locus_tag="LMJF_16_0250"
                     /product="protein tyrosine phosphatase-likie protein"
                     /transcript_id="XM_001682051.1"
                     /db_xref="GeneID:5650570"
     CDS             complement(85421..85951)
                     /locus_tag="LMJF_16_0250"
                     /EC_number="3.1.3.48"
                     /codon_start=1
                     /product="protein tyrosine phosphatase-likie protein"
                     /protein_id="XP_001682103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650570"
                     /db_xref="GOA:Q4QEZ5"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ5"
                     /translation="MDINGTIVDCKRNGTDEVIFRFLILDAPSPSSLPTYVKLLQRQN
                     VHHLVRACGPTYNAELVEKNGIQVHGWTFDDGAPPTRVVIDSWLDLLSLEAGKTPPET
                     IAVHCVAGLGRAPILVALALVEYGNMAPLDAVGYVRERRKGAINQVQLNWLMRYRPRH
                     HQASDRSLVCTNCVIL"
     gene            complement(<88106..>89593)
                     /locus_tag="LMJF_16_0260"
                     /db_xref="GeneID:5650571"
     mRNA            complement(<88106..>89593)
                     /locus_tag="LMJF_16_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682052.1"
                     /db_xref="GeneID:5650571"
     CDS             complement(88106..89593)
                     /locus_tag="LMJF_16_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682104.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650571"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ4"
                     /translation="MKQGKSTMERLRDASHVSDLPTIIKLIMKRNIDIKKPDAHGRTS
                     LHYACMNDNKVLISYLLSRGDIDVDLKDKDGKTALQLTPETSRSDMRLLLSKMMANRQ
                     AREPQSALKGVEANEQMLDDDLRESDTVSPATMRKIVVCLVLPLLFLIFYNGIVFAVQ
                     FIAVTLCFYYLAVAYFVSEVAIRPPWYHHHPGASALTMKGCPDYWQGWIYDPKTDFGL
                     DYEDVEFSSTDRYKLRGWYVPPPPGKAREMGIVLVHGGGRDRRSWERHVPFLHNAGYG
                     CLLFDFREHGLSSGNMRGFTFGIKERFDVVAACDLMQSKYGYKRICAMGTSVGGSSVV
                     MAAAIDKSIDVVIAENAITTSATLLDQQMVMVLSGYFAQNRYSVELFRLFRRCATFWL
                     NWRIGNKPSKHCQALHCIAKISPRPILILHGMSDTVVPMRHSEILFETALEPKQLYLC
                     EGAFHCGLYNTKPDEYEATVLGFLEKYGAASPPPLPSPQESKKDQ"
     gene            complement(<90265..>93402)
                     /locus_tag="LMJF_16_0270"
                     /db_xref="GeneID:5650572"
     mRNA            complement(<90265..>93402)
                     /locus_tag="LMJF_16_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682053.1"
                     /db_xref="GeneID:5650572"
     CDS             complement(90265..93402)
                     /locus_tag="LMJF_16_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650572"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ3"
                     /translation="MLVRSSSSRASKPTRHTWMALMMDECATMAPLHIAVFVQRTFED
                     SCRVPAKGSAGQTASIANSDTQSSVVAHWSSSCASSSPRTVSASPSGSIAGSPAAKAR
                     AWAAVARLLCESGDWVRAAAVVDGLPLSVQWTTRHKAARDEWPLPPSVREAWGRAPDA
                     LAVNQTAANQATAATPLSSTPAKTAAGPVQSFASQPCEALAACRTAELVRVAYSLSRP
                     RAIDAASTLLADTPAASLPGLKSEQQALVAELRRRGAVLEVVQCVVNWQRRHLALTDA
                     EEATTTTATSADTRAGTFDGLRAVKEVLFPFAPTRGGGAHQLSGAARAVDSAFERRSS
                     ERSGRPPLYALAHLQVIRQVAASHPIILARCLCDRTVVDRLLCHAGEGVVAEVALLLM
                     KRIAGVGSDGADRGPPVQAPLGEGEGVGAQFTKESAASTRWPRPHAANPNVSAAAGPA
                     LLLSQAASKPAPCEDVAAAATCWRALAALLFPLHPYIHAQSKTGKEKFLSALLAALDE
                     TKHMIAADRVHSRPTSSAAGCGVSVSLPAQGGTRVHRGCRMPVVLSDKARYAIKAAVE
                     SVCSPLLSHEPQVRFIRLHMFGQLAKALGDLGVPVPNALAQCLFLCMADTVGPPLSLG
                     ASDASSDSVTTYLSCAPSVRWLHALAMLEAAHRASAYRISAAHERAILSGLQSISITR
                     TWTSALRTVAAFEMRYQLMPDERTLPTLLLNFKQQSWQDAFRVLRYVPGGEADHASPS
                     ILRDLQLVALKHASWVVPLRLMTHLQHRQADGFMNYLYCLCAAARSGRTELALHFFRS
                     LRHGRGRHSASLSLSPYNELTVAVAAVAMLDYDQAEALVSFSARVAAMRAAGDTAAVA
                     VEAAAEPGSPLLTVDGRRMTQAAHACALLALHRHCDLASFLQECTATSLPAVLRRVVV
                     LHCLLGLGHLHAPVRLVFDVIGYQGSMLPANAVPRPPGADQSPEKVFLTAVAADQQRD
                     GTFETRQRGTAERRQRLYIPVAHQRRQKKALATAWGRFMRDQEAALPPHVTHLVAESM
                     VEEGVGAEYLTAALL"
     gene            complement(<94461..>103085)
                     /locus_tag="LMJF_16_0280"
                     /db_xref="GeneID:5650573"
     mRNA            complement(<94461..>103085)
                     /locus_tag="LMJF_16_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682054.1"
                     /db_xref="GeneID:5650573"
     CDS             complement(94461..103085)
                     /locus_tag="LMJF_16_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650573"
                     /db_xref="GOA:Q4QEZ2"
                     /db_xref="InterPro:IPR013662"
                     /db_xref="InterPro:IPR014821"
                     /db_xref="InterPro:IPR015925"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ2"
                     /translation="MATKENAGQNMLVQPLRYGSLISLYKQSLDGYVVATSSSEAPVG
                     LQRDTPETPLRHEHTVLLLQRGDPAEANVNRQPDSDVVKYGQTIRLLHYAHQKYLSYH
                     AERYAAGMKGNHHVLLETRRRDANVRERWRIMPRYRLRVEGEPVAAGDAIILQAVETE
                     RYLNVAPNVDEEAADNWFLEVSVGESIQGFLIHLYDGDCAASRRGPPLRCGDCVTLLH
                     TEEHKYVLADPVKQQCVLQTPDSNLAEGSEHTVAWYAASKEEVSYLSLFVIEGANASK
                     GGALRMRGAGDAYRFKSLASGLYLQCGEVAAVEPTEGGGAGLGRGARQASYALSLTPH
                     ARSAGTLFQLHCTSSNAEEFLGNGGRVFLSCVNSANQKVWVVAGGPVAAEGEDVRHSE
                     VTIASLTHGVRTYGVVTLLGSGFKSMRDGLEIRRLQPIALEELHMIRRLLPPLQRYVR
                     EMACGVGSPHHVRQAREKVQQLQQLCHRPADPDAENVSEELMNSGSAGGGRGGVLNPE
                     WQSKVFQQGVGELVLLVVRASLQCPYVHAEKLGSLGMVYPQAGCNNGADSVAAASSFG
                     AAAGGADVASAPSAASASGGLSLFVPMRYSELGDLVDACFELVGVLFYNRPRYAAALQ
                     SYADFVMECTRYVPSALRCLAAFYKDNPALVELPMARHRLEFFLEMLASRGYNPDVLH
                     ILRRFACCGGEGMVEAQRVILDYFTQNREMTQRVLCPMKWMPLPEELETTRIAQMPRA
                     QATSSALATAVKEQKGLVAEGGPTCVELADTLCQLSAALFTDTREASVAGTVPEGECN
                     ASIGAASRQAPLSTASILPPCSPAAAAPELSTSVRAVREMPMVGIPNLLFEEPEFSDS
                     ASLATSTQYRAKGNPLSQLLQKAVDAQDVNGTTYFPLEGLLAVMPDWPEVRDTLVPYL
                     AAQIHLLAALAYGEGHARSRPFILEWVPRAVLVELLQSEVLPRRLHGALVELFAKVMV
                     DADGALNIREQIQNIWCVVSLPGGGCSATGATSAAVASSCQMAMHKVPRELEVAKGFV
                     VRYMTATRMSGDDSVAAEYLAALNLLDELVNAGAFQLSEYETLMRLLVRCVDPSCDAQ
                     HTVLEMQPVQDCKSRVLQLMNLLIDVLLVREALWLVDCFRMWRRPTRFSQLTHINFAA
                     ALPQRSTEKWRATDGGGDEADEEQDRRADVACDCDLDGVYNEEEREPREELIPIAEAF
                     TALMELANCSRSSMLQRQVICIFFRATNFLEELYATASRVQLLTSEDSIGFYAAINRT
                     SIVVKQLAKASFRRTNTIALANSALDALDDLLLKPKSGTVAEKLSMMQQVGVPLQLIR
                     MLERVSVPVSAASRQLVVKTVAILQTMAQSPRVCDELREAVVGAAPLAYQNTNYISLL
                     RTLFVAEDDGRTEMPTQILADVVRCLYREHAALTAIEFLSDWMAAKRSSVHVMAQRQQ
                     QVWRAIVSDQQAERCIQLRRSWCSNQGHKLRERLLTSDDCYAVTGRTRTHLDLCRLLY
                     LVANKSEFVKAEAVRQEVFGQNSLDALLQVTTDVLVPVYFRYPYVQLLQALVLDDACA
                     VPSLLAHRDFPDFVRLCMMDAARYLQLLGGRCALDEVSEELEQREGATLRCAPKNEAE
                     EEMEEALFGAGMYEDFFFGPLCACTERVCARYRSCTSQLSNRVRSQLSVVVNELVDAM
                     CDVLQLFFNMEDGILRGAPHSAAGLPSPTTAPFPEVPWSLAHFTALRQCLRVAKDSGF
                     SGTARWRGGPFSRLCARLAAYVEAAAKPPNPATAAVSGESAAVVTPGVVLKGGDSCAW
                     NSHIEAGGGAHVLASKWMDYLRSVLADDARMAEKNRLISGAGILLRCGARGATFMRIL
                     FTVMPSLQHPNIVHVLTLTRQLVVLMPNNPYDDSVLLPLVAQESDVPHITVTTPVQSR
                     QTFLARWAGDASLEMPLPLVALVGEFLGCDKADVQRAALLAGCTLLLQGHRGMQECYR
                     AFCRRSANNRLLCMLRHHFLDFKDRLQTYHYALSSGSSPSEARHYLTQMSNCRLELKL
                     LQLLCSGQHAPLQTYLISQPVSNISVNIVEALVELLSMAPKTANEVTSDFMVQLLSTI
                     AEALQGPCAANQDMFVAYNAADYLTLLLSEFDASPYGDAAFTAVEVVLPAVSWNEAAL
                     GGEREGTSPAATLEERRRRCHSLLQTMALSTLLAMIEGRDDSRLASKLVSTMDLSLLA
                     KVMDRSAASYEARHGPIERKQYSGFSRGDIVGSVAALRRYFRDYLQNDNPTSREELQD
                     ELAVAVSIYAFFRACHDMHFLTATRPRCGSGGGVGAEDFAGALDDLVDKKGQGIRQVL
                     RRSKYYRQVSTKLAKIEIVRDGRLERVYFRALNSAVDNLFEFRRTALIQTAVRTSDNE
                     RIQHFFNETSDVIMEMSWYNSMRRFCAVYLLKFFLREINALGLLIVFSINLVMVIGIR
                     APTSPYSSGTPEGIDRALVGLGIVDMCVQGVLLTHALLGPAVVNYKIGWRTWYSRRQE
                     ELTRMSDADIAVDRADALLRGKQCLVPTWYEWVLLSVYYAFWHADFLPHFFFCFVSVM
                     GFAQHRIWYALQMMQITIHSPVLASLFEALRANLKLLVLTYALLLTLVLVGANISYYH
                     LSQLFDPLGARLNGFNCYTLSQCFLVHVDTLRSGGGIGDVVNWPVFYSKDGYAYWVMF
                     YRIAYYLVIGLVGANLFLGVIIDSLTQHRTHQQLIQADQEKKCFICGIERNEFDIVRP
                     GAYSTHVTEEHNMWQYIFFLHYLSTKDANSHTGQEAYVQQLIAQQDLSFYPIGHSLTL
                     RFRDRGAADAPMTEGGIPVGGEEDAEGGVPRVVAMAAEAGGGDGVDRKGAGGDGKNGG
                     GAFDEATAHLISSLVEAALKEGLEPLRRNIEKTNERIEEVRVNLQH"
     gene            complement(<104548..>105309)
                     /locus_tag="LMJF_16_0290"
                     /db_xref="GeneID:5650574"
     mRNA            complement(<104548..>105309)
                     /locus_tag="LMJF_16_0290"
                     /product="putative proteasome 26S non-ATPase subunit 9"
                     /transcript_id="XM_001682055.1"
                     /db_xref="GeneID:5650574"
     CDS             complement(104548..105309)
                     /locus_tag="LMJF_16_0290"
                     /codon_start=1
                     /product="putative proteasome 26S non-ATPase subunit 9"
                     /protein_id="XP_001682107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650574"
                     /db_xref="GOA:Q4QEZ1"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ1"
                     /translation="MNGRSIEDIVEIEDYRAPAVDSTIGDMDKEALREELRRLDAQKA
                     ALETKLTDALQYLASTPVGLRGRLLDDEGFPRNDCDLYAVRTARNTADSTRNDLRALN
                     EKVYSLLNELHRQTQEEAQLQMVQDAAARRQRQAAAEKRAQRMAEVQRVSRLKPCLVV
                     AKVDANSPAEEAGLSVGMQILQYGTVTQTELIAEGLQALARETSTHEGAPIVVWVRKP
                     GELQDDPSELVLVPQRWQGPGLLGCALDRVGDEAV"
     gene            complement(<105845..>107740)
                     /locus_tag="LMJF_16_0300"
                     /db_xref="GeneID:5650575"
     mRNA            complement(<105845..>107740)
                     /locus_tag="LMJF_16_0300"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682056.1"
                     /db_xref="GeneID:5650575"
     CDS             complement(105845..107740)
                     /locus_tag="LMJF_16_0300"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682108.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650575"
                     /db_xref="GOA:Q4QEZ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QEZ0"
                     /translation="MMKPSALDRIHVREDDPKELFEIIESVGIGNFGVVLKARNRATE
                     DIVAIKQVPLSDTDKEDLDTIVKEVEILQECDHPNIVRFYGTYYSMGVLWIVMEYCEG
                     GSVDTAYDLLRRPLSEPLIAYVCRQTLLGLRYLHERHVIHRDIKGSNLLLTKNGQVKL
                     ADFGVSTELKHTLSRRNSFIGTALWMAPEALTEKDYDSRADMWSLGITTIELAEGQPP
                     HLGMHIARAVFFIPLNDPPTLQAKERWSPQMNMFIRRLLTKNKELRPSAATMLMDPFV
                     DPAAVASQEEMAAVVEQLLTRRRSMDERRDGNDKSSNASAMTIVTRTSSVVGAIEGAG
                     EEEGEGVAAIPTDEAAAQWIDEHVAPQRRASPAAGRVVARAGGGAVAAGAAAGDRGAP
                     LGGRLMLLPLLHLEDMSFDALSGGGRTLFCSSTAGTAGVSGGGTDAVGGATTSSSGLF
                     GAATAGGATLSSGGAANGVVGGGSRVGGSGVAQTALDGVYTGEGNGSTTTMASANRYC
                     HPSLLLPTSGSGGVAPIVSAFPPVYGPPSHEARMVAAAAHGDALAEALHLLGYSVEGV
                     SPLYLRCFETTTLNTVREVFLYNQYLPYTRAVSEAEAKHAQRMKLLCGTVLKNVYAAT
                     CEGTRNA"
     gene            complement(<110098..>112158)
                     /locus_tag="LMJF_16_0310"
                     /db_xref="GeneID:5650576"
     mRNA            complement(<110098..>112158)
                     /locus_tag="LMJF_16_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682057.1"
                     /db_xref="GeneID:5650576"
     CDS             complement(110098..112158)
                     /locus_tag="LMJF_16_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650576"
                     /db_xref="GOA:Q4QEY9"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR025792"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSAKQDGSTAESRKAPHSYRERVNSTVELAALVYRPLTASGALL
                     SILRGKLYRRRSVRNVLDVVAVRSISGGQGHSAESKVRVEYLTPAEGNANGNSISNIS
                     AAPCADIRGSSDTAATSSSPSTPAQPTLLEGRCKMCLLDPTVLKATELCPDPASAAQH
                     CTPVFLLGAAVVGSHVTRQLEAAVQAGQLSRKAADLLQQLHERLAGGPSSVSLTEDTD
                     GSEQPQGLPRAAAAPPPPSNKRRASYTGAVEVTFTPRAVELNYQAYTMSELLSMVLPL
                     REHADLVALSGFEQVGHIAHVNLSAAHLPYADIIGQVILDCNETVSVVVNKVDAISSV
                     FREFKMDIIGLRRRTDSVDGNVVAGADLDDAGEAGGSLTAAERQAIALEALSPTYSLA
                     EARVHRLLTATVRQHGCSFRVPYNRVYWNSRLSFEHTRLVDRMRPGDVLFDVMAGVGP
                     FAVPAAKKGVQVFANDLNPVAAQYMKVNAELNHLPANALHVFNMDGRDFLNSVLFTSV
                     TRAADASLPGHLCTGRRHVTMNLPAIAVEFLDVFQPLSSTCAPASEQRCNASAAAVVN
                     ERWNHLPAHVDPNAIDRRTLFHVYCFSAAEDLITDAVRQVEVNLGYTLPPENIEETLM
                     VRDVAPTKRMMCVSFTLPPAFWKNLLASRPGQGGEPGGAHAETASTLVEVEQAAKKAR
                     PDKM"
     gene            complement(<114041..>117853)
                     /locus_tag="LMJF_16_0320"
                     /db_xref="GeneID:5650577"
     mRNA            complement(<114041..>117853)
                     /locus_tag="LMJF_16_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682058.1"
                     /db_xref="GeneID:5650577"
     CDS             complement(114041..117853)
                     /locus_tag="LMJF_16_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650577"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY8"
                     /translation="MYILELNYGDGEIHRHFLLPDQTYTLGRKTCRILLPAAEPSISR
                     HHATIFVAAMPRYSVLDPSAQLEIRIEDVSKHGTFVDRERIGKGNSRFLYPEDRIRLG
                     LRVTARIIPVMLVLAISPDLTDASLDLVLDACVHVGALVVEDSIPAPLSYYEQHINCI
                     GFLYVAEDSFRMEETMMTALGHGYTLVTPHYIANLVRSLEKKSTLMPGEFPSPSSPLP
                     ASHTLRGVHYRRPAHTFFSVTEFLSIGRPMMAEIFRDCTVVLLESALEEIYSGVLRLF
                     GGTVEAVALDAIDAWRSRQSSSPPFPLTTVVLVGEADFRSVSNEVIERGGGRGVFSTE
                     HAHPVICGYLTMYKYGVCLIPEENVHLALYRNDLTELNAKPTSRYLQRTADDLLADAA
                     PSSADAAPLLRRSGTFTGSSSASRRGSTTRVSESPANASTSPAATIDPAPVLARRSRE
                     PSFHAGYSPSRADKDGNAPAAARPATTAPTAATASSTGDVRSCDSSRSASPHPASSLH
                     FAHSAGSESAAQEKRSNSASAGSSPYTAAPATTSVATVLPSANLNGTSHAPDTATSST
                     HSLLTSVATTASLSAGAGGGGGATTAFRCGDRSVSATSASTATLAPSAAPAPQRLRVN
                     TARRNSHPFSLSARQRNGGEESDDEECTNNGTGGVLEPEEAEGSQWHRRGAASLTRRA
                     SGSLRRSSIDNTTKMLPLRSEGIVRLLSGTGSALQPPGAAAAGSARGHQASTTLDERP
                     QRRPHVSSEERWCNSARGVWLRCSNTEDTESSAAKGAVPPLTSSSSTSPATAGPTGGT
                     TAAVMVLHRAGQPKSVPALTTPAVAAPAGEPAPSKPKHSERMNGNPIGKGSETAHPPL
                     PIRRGEQRLVSTSASAPCCGLVRLNPSLDLVRSGRYHDSERCTTPEHDVVVHTASKVG
                     VSPPRQRVEAVRIGSASGRRMLLSRDLEPSLPSHIEPAEGSADDIGNPRSVVRCEYLC
                     NGNRQLPGTAARPVSARRASSSFQRCDSSQMREMATPCRLMTPRLSSSVPRSRSTQAQ
                     GSVQRSWSQLATDDGTAHKTSIGYLREGRSGGASARHGSIQRRHGSPTQGNEASCAAT
                     TSSNLSVAAPIPGLRNGSVNSGRSTTNNVTVESYLQMNKELHLHCQNFMSSFLDNFVS
                     DAERTARCVVRQAYMDPPSKQMLKDGVGRVLEFLYYVNGTYPDIPAMYSTTSTRAACH
                     QVWQKSHYALSKVKSCYKAVNCKVPSVLTRACAALSTRAVPPPHHRRLTSITARAEAG
                     PSQRMSAF"
     gene            complement(<119179..>120342)
                     /locus_tag="LMJF_16_0330"
                     /db_xref="GeneID:5650578"
     mRNA            complement(<119179..>120342)
                     /locus_tag="LMJF_16_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682059.1"
                     /db_xref="GeneID:5650578"
     CDS             complement(119179..120342)
                     /locus_tag="LMJF_16_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650578"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY7"
                     /translation="MHATLLRSGIRTVVPPPKASPLYRFLRESTAQSVLDADNSTKMA
                     SEPLASVLPKGSSTESHALLSSLPVGVFEGLNRHVWVDSKRSFCYLCQETVGNVTIHS
                     SDRDHTSMLFFLLLYTAYPRHDLLTEAARAPTAGERAAVVVKDGSCASQASLSAEHSR
                     AAGLPRPMSASRSKAVPLFTPKHVLSGAKRDFPSLFRYATDCRTTDRLHVVDDAVRRA
                     ELEALLLYLAHPPHQALSHVLQGQSPNGYWYNGERMWKAHISRIVAQLYPPMSAGMMT
                     NFTQKCWGRTNGERLYDALCLHRIKAYHGWGPFESKERKAFFLRHLIWELLCVEVRDE
                     VSEEAKLLTSLALRRLAFEMVFLQSMDYMDRVQRVHELLGSPSLEELKNLNAL"
     gene            complement(<121066..>121575)
                     /locus_tag="LMJF_16_0340"
                     /db_xref="GeneID:5650579"
     mRNA            complement(<121066..>121575)
                     /locus_tag="LMJF_16_0340"
                     /product="putative
                     3-Beta-hydroxysteroid-delta(8),delta(7)-isomerase"
                     /transcript_id="XM_001682060.1"
                     /db_xref="GeneID:5650579"
     CDS             complement(121066..121575)
                     /locus_tag="LMJF_16_0340"
                     /EC_number="5.3.3.5"
                     /codon_start=1
                     /product="putative
                     3-Beta-hydroxysteroid-delta(8),delta(7)-isomerase"
                     /protein_id="XP_001682112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650579"
                     /db_xref="GOA:Q4QEY6"
                     /db_xref="InterPro:IPR007905"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY6"
                     /translation="MLMDGCVGVFKTNPLLTENYTKVDARYASELGSFNGSAMHVVSL
                     MELFVKGPLCVLLYWAFQVRYPMRDALEFFACVTQAYGTIVYLGQEAISGAPNLDVDH
                     DLTFSPHHLFYFWFAVVFGCVLYLLVPAVLGWRSYVQLRNHCTFPMQHHYSRRSDGRR
                     SGIHLAQHM"
     gene            complement(<122858..>123964)
                     /locus_tag="LMJF_16_0350"
                     /db_xref="GeneID:5650580"
     mRNA            complement(<122858..>123964)
                     /locus_tag="LMJF_16_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682061.1"
                     /db_xref="GeneID:5650580"
     CDS             complement(122858..123964)
                     /locus_tag="LMJF_16_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682113.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650580"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY5"
                     /translation="MAEKRYKLYEFSRRETRRRPPPPETDLTDVVQLHDLDRNTDENK
                     RLIHRVVLPRKPQHNDGASLSAADEAQPGKEVLCYTFAGVPGLLLFPGVLSEAEQQRW
                     CREAVLDYADSAKHPNILSTHAKAPQSTSCYQPPMRWATLGYSYEWTQKVYCRDRYST
                     FPSALRTRMCDLVSLVAGVRQDGFCCAYPDVYEPQTAIVNYYPVGSMMMCHQDISEET
                     LEQPLMSLSLGCSAIFLMGTQSREDAPYAFLLRSGDVAAFTGPSRSAFHSIPRILDDC
                     PAYLTLPEDELTEAERHRYQQHAYCAHPTPDGSFSRVEKAMMTAEGQERYWRLCMRHM
                     RVNINARQVYNERCPALFGAPRDLAQGRGATGAG"
     gene            complement(<126219..>128285)
                     /locus_tag="LMJF_16_0360"
                     /db_xref="GeneID:5650581"
     mRNA            complement(<126219..>128285)
                     /locus_tag="LMJF_16_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682062.1"
                     /db_xref="GeneID:5650581"
     CDS             complement(126219..128285)
                     /locus_tag="LMJF_16_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650581"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY4"
                     /translation="MEDIGADRFLVLSGEFPGEGVWCWARTYTELVKCVRTAWGSDFR
                     PVFKYKLPCILTDANAHTRCEVAEEKPPPQEEILIEEAVGAGLSASTPHKTRPSTCLV
                     VLNDADDFHLWRRGGAYVSAADAAASPAATTRDVRGDFVHHHGPPAGSAEEIMHTVAH
                     HMDYHRLASEACTADASATATATTTTAAAREEGHKERVWKPRPLTSTLYAFRSGVPST
                     GLLHAPQRQYNGSSASSERVRTRASPPVRRADADVIQVPLQCILDPALILRLNVTVVL
                     RHSAAPAEVVLFSSHTPSGQGNLPWGALCVKARNAWGVHAPQFRYVDLTNGVTQLLIN
                     HVNDYRAWWQQMRLTNCELLVVEQAPSATSGSAFASAEAQTAIGRYYEEEWPVERYSS
                     SKNVVELVRELKALEREERMAAVQRLGRAVTAPANGDLTASARAATPRRPTHTSCESP
                     KIDAAPAPSSETAAVASMATLAESRTLDPYRPLLLQKPQKPLSMTSTPSHGRCCSTPS
                     TVSSTATTPSRVPLTIEEKIDEEMWCSLLDAERYARLMKLVSPEHPDTVAVFSGSDPE
                     LEATSERVRRRSPGDAEAPLRRSRQWIFARLTSPESKTVTAKATAGHADGQVRTPFTA
                     ARKDAAGAAATANGVSRLSVAAMPEPMLDAHVRARSHNALLSHHFRTHSAYPLSARGI
                     GATPIW"
     gene            complement(<129105..>130547)
                     /locus_tag="LMJF_16_0370"
                     /db_xref="GeneID:5650582"
     mRNA            complement(<129105..>130547)
                     /locus_tag="LMJF_16_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682063.1"
                     /db_xref="GeneID:5650582"
     CDS             complement(129105..130547)
                     /locus_tag="LMJF_16_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650582"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY3"
                     /translation="MLSHFPWKRSVLVRSGLGVVSARVRHTDAAGVRRRRLLYPCISL
                     ASSISCHLTSTRQLFSSWWISKSGPTTTDGQNSTAAACEDSSATESDTSLIAVQASAL
                     ASEVQQLHQQVSDLKEALEDSQEALKQLLILSASQTPHPAWGTAAAADASTPAATTAS
                     ASVPSLDGCRHRQGACCVVRTSEELMSALRGHGSERASRTVLLDGKLFILDPYAPIVV
                     NRTRVSIVGNNAIIIGRIAVKGCGALLSASDVFFLEPGDMLHRSTTHSGDDEASATAA
                     AEVTAPLWINPTGRKEKGAAEFLMPVISATVGAGVHLNRCTLSSGRDGVYLGTGSYCT
                     LNRVRIVNCIRGLYEGVGCRTSMLSACTFQSNRYHMVLLGPNNAERAARMFRGASGAR
                     TAAVASPSGAADAEGTAYSVVFTSAASAADILALGFTSDGAIATQQTKAQVVLQHCPI
                     TDVYSDCWCDGAKVELSAQDATAGLSDPLF"
     gene            complement(<132901..>135333)
                     /locus_tag="LMJF_16_0380"
                     /db_xref="GeneID:5650583"
     mRNA            complement(<132901..>135333)
                     /locus_tag="LMJF_16_0380"
                     /product="putative tubulin tyrosine ligase"
                     /transcript_id="XM_001682064.1"
                     /db_xref="GeneID:5650583"
     CDS             complement(132901..135333)
                     /locus_tag="LMJF_16_0380"
                     /EC_number="6.3.2.25"
                     /codon_start=1
                     /product="putative tubulin tyrosine ligase"
                     /protein_id="XP_001682116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650583"
                     /db_xref="GOA:Q4QEY2"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY2"
                     /translation="MEPATGCTSGGKDKGVKSSAHNKTPAAAPLNALVNAVAGAAAAS
                     ETSPHTTAAALRKKKLTVRKVPAAALTRKTKERSRERSLSTPAPTPPLPRSPRSAKRK
                     NGKSAERPVGGEAQLLPSAAAQAPKPEVDADSVEKPPQQEPEKRTNVVGTGENDLQQQ
                     RALPPEDSDDGSCDADGFDNGASARVVVPVTSLAGKRHTKLIIVPGPANGSGAAAPAS
                     SGLGNGHRTRAAASISMGSSGGSHHHGDCTLRYRTDLDKQVIHFMFERYQHEQTHPTT
                     SAAASSPLSTTNAGAAEGTSARVDEAPHTSRGTGAAAATSASQVRARRINVEEICVTA
                     NNEGEDKNIGLGDWHFFWMHVRRVRHTVCSSSFRWQEQQIINHFPDHAELTRKDLMYK
                     NIRRYLREHQADNYARLTLHTATDWVSASAHAADAEGAAGPSAFAFAGGERRPPLSVK
                     SFCFADSVPLTYNIPNDMSMFKEKFQRRRGTQWIVKPTSRSQGKGIFIIDDVRSLQRW
                     MSEKKESENMASFLATSPSNRASWVAPSVLQQQRAAVPSSIESAPGAASGGNGCSLAS
                     PTSPHFNATSAVTSQTAVGAGGSGGGSLGSYIISRYISNPLLIGGKKFDLRLYVLVTS
                     YKPLVAYLHEDGFARFCATRYAGSSLSQEDLGSHLTNVALQKGDEHYNTLHGGKWSFQ
                     NLFLYVQKSYGPYTAEGMVKNIQFLIYHSLKAVEPVMFNDKHSYELYGYDILIDDHIN
                     PHLIEVNASPSMSTTTLSDRLLKEQVLTDTMKIVFPPGYPASNKGMPYWEYRLRTDLT
                     TRQKTGFKLLQF"
     gene            complement(<137190..>140147)
                     /locus_tag="LMJF_16_0390"
                     /db_xref="GeneID:5650584"
     mRNA            complement(<137190..>140147)
                     /locus_tag="LMJF_16_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682065.1"
                     /db_xref="GeneID:5650584"
     CDS             complement(137190..140147)
                     /locus_tag="LMJF_16_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650584"
                     /db_xref="GOA:Q4QEY1"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY1"
                     /translation="MGLLGLRKFIDSCGCTRLLPLPLSDAEAAEEVKRRLRVEGYYEI
                     TGEDADADSGALYTNSGEKNEAGDVGSRGARRRPLTSSSHMSRPEGAGVVAPGSYTPM
                     VDHVLVDMNCVVHSCFRHQSSENKTKKQLIQEVLERLRVLVTEVVVPRQSLSICFDGP
                     APIAKLQTQRLRRRKVSLLDTGSVQQLNTLSITAGSLFMIELENAIASQFKLNRGRGF
                     LRRACPVYLYGTTVMGEGEAKISRALAFLAYGSGGTADSTARTPQDEKALRSRRELGN
                     AGRRGSSGGGRAERNGRDDAATAPYLRCRPDDTVVVMGDDIDLVMTCLGATAFHNFSI
                     IGPSSLQLIRVSDILYRWLKATSATRGDAPFSPSQLPSVRIDFIFLFLLNGGDHYTGA
                     GEVAMALWRRYRCVRATYPHSSLVSPNLDAIDIDFLADVVQSSEYTGSSSIEVGMDLL
                     QSALWSLQTVVTGVCSDYHYVPAPAAPQLCHLRAAAAHCQRTNARVCIPNAKTGSQPL
                     TPLEAYVALMPTEATLPKSIAAGLHSKAAHQSILKTLETSNDTAAIARAAKDAVEVSA
                     PWLTKSEQYLRHFTSPVQLNVNPPRRRLSRHEQHRMLATHGYVQVEDPVPEVRPITMP
                     ENVPYLNVPYLPYTRYLDFYCPFDVATTQPQEADKGDDATSARHASSAPSANGGRLTH
                     LHGRAVSTRPFLFSAAVTPQDRMHASCSGDSTTEDGSDGAAGAAGRLAEHKRVYLNQE
                     EVAEELRQRDRKSAAAKLQRALDITSGILERGQHFTTPQQRRMQRRLHRLQQAESAEL
                     RAMLAREDRKYVSRTGKTDMRDLESELRHFLGADASPEKVAALMSNAADEHADVGVDL
                     RGAGVVASSGKTTTKKTMKTKEGVASAVEALRPRGAMVNQRKELKAGTHHDGSRTNAE
                     RYEDDMTASRVPVKQRKSRATVPADADSHADVEEASACLKRRRRERIESFEEESTRQR
                     TPSETKKRRRVRY"
     gene            complement(<141075..>142145)
                     /locus_tag="LMJF_16_0400"
                     /db_xref="GeneID:5650585"
     mRNA            complement(<141075..>142145)
                     /locus_tag="LMJF_16_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682066.1"
                     /db_xref="GeneID:5650585"
     CDS             complement(141075..142145)
                     /locus_tag="LMJF_16_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650585"
                     /db_xref="UniProtKB/TrEMBL:Q4QEY0"
                     /translation="MAPERCFPHGFLRRLQRATFLFFSMLAALYATTSLYYVVRISVV
                     EEPDLYHQIGSNVKGFAQRWVPWAVPMSEHLAGSPSAAEADAASLLVTLRASSHEPYT
                     QMYKALRIGEPLTRQRVRNPALPADVPLSDDDRERPSAEHGGSLRNAVPLRQRYVLDK
                     LQAGRRYMIRLSFLGSPSVGFDLVLYQVRRSSVQRFLKDSIDAAGAASPTARGWSEEP
                     QDTELFVFSTSRDNALEFRAEKDVWVDREDIDGVASGSDGTGATLRGVIRAASGTDDP
                     FVPVVEVRPRALSIPVDAYRVPIVLFNIELEWLSWPFLPKIVVLFLIYFVWVLVFVGY
                     LGVYTLVSSGIAGGEEVKQNLD"
     gene            complement(<143435..>145162)
                     /locus_tag="LMJF_16_0410"
                     /db_xref="GeneID:5650586"
     mRNA            complement(<143435..>145162)
                     /locus_tag="LMJF_16_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682067.1"
                     /db_xref="GeneID:5650586"
     CDS             complement(143435..145162)
                     /locus_tag="LMJF_16_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650586"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX9"
                     /translation="MFSKIEAITLDAEFRARMSDPLGTTTLELNLLEDPTAGLATGPA
                     EELTPTELETRVRVLVSGYTPSLYRLLYTPFVDVVALLVKEGLTPTADAEILQSSSPS
                     GSNSGSVATTGGGVGTGTVSINVRPVRPEEIMARWFTDGPATLKLPHATAEAMGKRRW
                     NAFCRALEAHWSAFEDVMPLTRVVQRHNLREELYIPLFRQLAMELVDPTKRASAVATL
                     PGIILSLANGRAPRSVGLPESDTERVRLVSNLFLGVAQETGNTDLAYLSVQLLRANDL
                     PTPFSAQKQITNVFAAASRIQTDWQMRATSLLIESYPKWLEYYKRVQLDNKMALEALS
                     CGAVPTTSNESAGAGEGDVTTAASRAPRKASCALDKHHGKRSKGRTADSGMNGEAADS
                     SLEGTEERSTEQYRYFTSRQQDDVTRVTALEENIEAALRSRASELREVPVNRRRKKSK
                     EEAASAAASSLVSEDSSAMPASPSEPSLSPSRSSQDADRADRSSEGVGGDAGVQSLSM
                     EGGAHPKDEAASSNPKGVSSSKTELPTDSADSLAPRRRGKLAAFKSEGASHDGGRGAA
                     VKVDEIFDL"
     gene            complement(<146669..>148384)
                     /locus_tag="LMJF_16_0420"
                     /db_xref="GeneID:5650587"
     mRNA            complement(<146669..>148384)
                     /locus_tag="LMJF_16_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682068.1"
                     /db_xref="GeneID:5650587"
     CDS             complement(146669..148384)
                     /locus_tag="LMJF_16_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650587"
                     /db_xref="GOA:Q4QEX8"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX8"
                     /translation="MLWPTAMRTNSGRIAPRPPTSSNPCGAAAAAALTALPAVATAKE
                     VFAEASTRAPTPSNTATDGGGALYSTTLEAYTVLLHTARTQAVTRCAGQHNAFAGSES
                     ARQYSSRLVLYCGDQCDALLVRAAQLLGIAHVRVTQTVAMKRDLPLPAAHSTGTAAAG
                     DVPCCIYNYAVDVRELQSRLVEDVAAGLYPLMVVGTFGSGLSGSVDPLLVMGEFCQRL
                     GVWFHIDASHGGAALLAGPAESVVPPVLLQRDAILTQFYAAASLADSVLVPTGLSTAV
                     PYAALPVSPASRFATAGSVALFFAHIRKAAWSVQALGEARQRTFNQWITPGVVESDVL
                     RVSPPSHMEAWLFEQHVAGALTTMRLWRAKPRANLQPVPAAPLALAERVSAHQQFVRA
                     VLQAVRGDGRFDASLDAAVFGIVCLRWLTAADEATVRLARAWAEVLAEAHDTPTTLQG
                     KHAASAPAHQSGSHRTPNAGGPSAIDVEGGGRAVPPVQVFVGLVQLQQRVWIHVSFGP
                     LLDVPEDAPASLAAAGKGAASGTVEGDPVTATSASALTYVQHTLNRAASLARTGGAAD
                     RMAEE"
     gene            complement(<150525..>151088)
                     /locus_tag="LMJF_16_0430"
                     /db_xref="GeneID:5650588"
     mRNA            complement(<150525..>151088)
                     /locus_tag="LMJF_16_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682069.1"
                     /db_xref="GeneID:5650588"
     CDS             complement(150525..151088)
                     /locus_tag="LMJF_16_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650588"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX7"
                     /translation="MAPKHAQEQRKDGKKRKPQRVRVTNKALESRQFSTVRLPRTSEV
                     PAQKMDVHSMYQEVACGSSGDTAAASASKSASAASPTASSPSSSGFDPIANDAMFTIV
                     TKSKYWPPPSLEELHAKTGHDHGDGFDSYDRREDDKEARKERVKVVKGEVNHPRGKPR
                     QNTVIQLSDSSSSSDGDDGEHRGCDAE"
     gene            complement(<152866..>156429)
                     /locus_tag="LMJF_16_0440"
                     /db_xref="GeneID:5650589"
     mRNA            complement(<152866..>156429)
                     /locus_tag="LMJF_16_0440"
                     /product="putative fucose kinase"
                     /transcript_id="XM_001682070.1"
                     /db_xref="GeneID:5650589"
     CDS             complement(152866..156429)
                     /locus_tag="LMJF_16_0440"
                     /EC_number="2.7.1.52"
                     /codon_start=1
                     /product="putative fucose kinase"
                     /protein_id="XP_001682122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650589"
                     /db_xref="GOA:Q4QEX6"
                     /db_xref="InterPro:IPR001174"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR012887"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX6"
                     /translation="MNVSFLFSLPCNLAEFKGAAKLLADAAALPLRECGAKGGVAVPG
                     LFCGCDPEGRPLGSGGGTVHLLHACYVDEQRHAPASAKRSFLSWLRLADNDGRVIVHA
                     GGLSRRLPAYAAMGKALLPLPPRRWHRGSQLSRTLLSTQVPMYREIVAMAPARLRTLI
                     ACGDVCVDARGALPSLAHFADSDVLCFGINADASLLQDYGVLFTARERPLDLDYMLQK
                     PSLDEVRRRVAEGRHSVLLDVGMWMLSDRAVEVLTRKCLGGALDAEDATDGGYDGHRC
                     TAVRTAYDLYSEFASALGNNAPIADPEIAGLKASVVELRDAEFLHYGTNRQLISAVAT
                     LQGRESPTPPWSWGTPLDGVLAPERGGGGEELDFAAGDAMPLLATPSSVIVQNSVVLA
                     PLDGSAAAAAADAPAGAPLSPVRHLWVESSWVGARWALRDQHILTGVPRNDWALALPP
                     GACVSVVPVLPAALGGCGDGAVPHAARPYHMDDAFCGDVRSGSTMYMGVRLHDWLSSR
                     GFSVAELYPAARAADGGAAQPLDMYEAALFPVCATEQQLGDFLYVATLPLEAATGGCA
                     GVDAARLAAGQAVWRTQPRVSAMDLLRLTDVPAMLRNSEYYERRMLTLMLALVAGDPA
                     APRARSPVLPGPMVALLQQQFFLLDLNRVAQRVVELGVPLPRHSGPTEWWGGVDAAGN
                     AVALSRQVAPAAPFAKGAAASAGSWAQVFSDEGSPSGGGRGAPLCTAPGRIVAAHYHA
                     FASRLMELALEAMDAAEPPVSAAEKARRLALLRASSAEEARSLVALHDAAALAELRAA
                     IMDSFPDERHDPEMSVHLDQIIWGRCPIRIDVAGAWTDTPPYAILSGGSVINVAVELN
                     GQPPVQVYVRVREDPIIMMHSIDSGEQLSVSSFDEIRTYATMQNPFSIPKAALALCGF
                     LPEFCATEYATLREQLAARFGGHGLEISLFVAIPTGSGLGTSSIVAGTVLRSLAEFCK
                     LPWDNHDVCRRVLLIEQMLTAGGGWQDQYGGLFEGLKLVQCVPGLPCLPTVRWMPDSV
                     YTDPRFAACHLLYYTGITRMAKGILGEIVRDVLLNNGATLQLLREMGGPTTAAMYDAI
                     TTGNYKGYARLVHRTWEQKKRLDDGVCNPTVQSIVDIVEPYVWGLTLPGAGGGGYMYM
                     CAKDEACARRIRELLTANPPNGNARFVEMSVSASGLQISRS"
     gene            complement(<159601..>160305)
                     /locus_tag="LMJF_16_0450"
                     /db_xref="GeneID:5650590"
     mRNA            complement(<159601..>160305)
                     /locus_tag="LMJF_16_0450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682071.1"
                     /db_xref="GeneID:5650590"
     CDS             complement(159601..160305)
                     /locus_tag="LMJF_16_0450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650590"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX5"
                     /translation="MAPRPFFTSGRGSSSDSGSGWALPKQIASWYPRKGGEFLGNTIA
                     GHNAFIQDIPTRFDEVHARHFSLVEGLAITPLYTLAMVHYFSIFCQYPARIAVLKPIL
                     EELQQKSELQHHWLLIMQAKRAPGEIIAWRCGLLTLQVVLFPIWLFLSSVAPQLVHAT
                     VAFSNHILHTKYSCLKASGSSAASGRAAGVPEFVSKAADMYAATETFHEAQSVTLPTD
                     FGVAIVVLLLILFFAA"
     gene            complement(<161487..>161966)
                     /locus_tag="LMJF_16_0460"
                     /db_xref="GeneID:5650591"
     mRNA            complement(<161487..>161966)
                     /locus_tag="LMJF_16_0460"
                     /product="putative 60S ribosomal protein L21"
                     /transcript_id="XM_001682072.1"
                     /db_xref="GeneID:5650591"
     CDS             complement(161487..161966)
                     /locus_tag="LMJF_16_0460"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L21"
                     /protein_id="XP_001682124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650591"
                     /db_xref="GOA:Q4QEX4"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX4"
                     /translation="MVHSYGYKSGTRHLFAKKFRKHGVPSVSTILTNIKVGDYVDVVA
                     DSAVREGMPHKYYHGRTGIVWNVTPRGVGVIINKPVRTRTLRKRICVRFEHVRKSRCQ
                     EAFKAKEHQFQAYLAAKKAGKALPPLQKSSRLGGIVRPKNVEVLARRVADYEAMVPY"
     gene            complement(<166354..>166908)
                     /locus_tag="LMJF_16_0470"
                     /db_xref="GeneID:5650592"
     mRNA            complement(<166354..>166908)
                     /locus_tag="LMJF_16_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682073.1"
                     /db_xref="GeneID:5650592"
     CDS             complement(166354..166908)
                     /locus_tag="LMJF_16_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650592"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX3"
                     /translation="MLLTRVVVLIFAILLVACGVCAALFPLMRKEGLMIKGHAAEKKV
                     YLWYEETHYKVGLADHYYRTYHRNSKCDGFKTAAVTGAAIHVAACGLGGIICLLAAAH
                     IHARKKFNICCSIMIFCLFTFACFAVSVATVVFVFSADTCVNDDATRVVALRHQGYIL
                     VEGFMLLCVAAFGFLIAMFLEVCS"
     gene            complement(<168324..>171887)
                     /locus_tag="LMJF_16_0480"
                     /db_xref="GeneID:5650593"
     mRNA            complement(<168324..>171887)
                     /locus_tag="LMJF_16_0480"
                     /product="putative fucose kinase"
                     /transcript_id="XM_001682074.1"
                     /db_xref="GeneID:5650593"
     CDS             complement(168324..171887)
                     /locus_tag="LMJF_16_0480"
                     /EC_number="2.7.1.52"
                     /codon_start=1
                     /product="putative fucose kinase"
                     /protein_id="XP_001682126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650593"
                     /db_xref="GOA:Q4QEX2"
                     /db_xref="InterPro:IPR001174"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR012887"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX2"
                     /translation="MNVSFLFSLPCNLAEFKGAAKLLADAAALPLRECGAKGGVAVPG
                     LFCGCDPEGRPLGSGGGTVHLLHACYVDEQRHAPASAKRSFLSWLRLADNDGRVIVHA
                     GGLSRRLPAYAAMGKALLPLPPRRWHRGSQLSRTLLSTQVPMYREIVAMAPARLRTLI
                     ACGDVCVDARGALPSLAHFADSDVLCFGINADASLFQNHGVLFTARERPLDLDYMLQK
                     PSLDEVRRRVAEGRHSVLLDVGMWMLSDRAVEVLTRKCLGGALDAEDATDGGYDGHRC
                     TAVRTAYDLYSEFASALGNNAPIADPEIAGLKASVVELRDAEFLHYGTNRQLISAVAT
                     LQGRESPTPPWSWGTPLDGVLAPERGGGGEELDFAAGDAMPLLATPSSVIVQNSVVLA
                     PLDGSAAAAAADAPAGAPLSPVRHLWVESSWVGARWALRDQHILTGVPRNDWALALPP
                     GACVSVVPVLPAALGGCGDGAVPHAARPYHMDDAFCGDVRSGSTMYMGVRLHDWLSSR
                     GFSVAELYPAARAADGGAAQPLDMYEAALFPVCATEQQLGDFLYVATLPLEAATGGCA
                     GVDAARLAAGQAVWRTQPRVSAMDLLRLTDVPAMLRNSEYYERRMLTLMLALVAGDPA
                     APRARSPVLPGPMVALLQQQFFLLDLNRVAQRVVELGVPLPRHSGPTEWWGGVDAAGN
                     AVALSRQVAPAAPFAKGAAASAGSWAQVFSDEGSPSGGGRGAPLCTAPGRIVAAHYHA
                     FASRLMELALEAMDAAEPPVSAAEKARRLALLRASSAEEARSLVALHDAAALAELRAA
                     IMDSFPDERHDPEMSVHLDQIIWGRCPIRIDVAGAWTDTPPYAILSGGSVINVAVELN
                     GQPPVQVYVRVREDPIIMMHSIDSGEQLSVSSFDEIRTYATMQNPFSIPKAALALCGF
                     LPEFCATEYATLREQLAARFGGHGLEISLFVAIPTGSGLGTSSIVAGTVLRSLAEFCK
                     LPWDNHDVCRRVLLIEQMLTAGGGWQDQYGGLFEGLKLVQCVPGLPCLPTVRWMPDSV
                     YTDPRFAACHLLYYTGITRMAKGILGEIVRDVLLNNGATLQLLREMGGPTTAAMYDAI
                     TTGNYKGYARLVHRTWEQKKRLDDGVCNPTVQSIVDIVEPYVWGLTLPGAGGGGYMYM
                     CAKDEACARRIRELLTANPPNGNARFVEMSVSASGLQISRS"
     gene            complement(<175958..>176557)
                     /locus_tag="LMJF_16_0490"
                     /db_xref="GeneID:5650594"
     mRNA            complement(<175958..>176557)
                     /locus_tag="LMJF_16_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682075.1"
                     /db_xref="GeneID:5650594"
     CDS             complement(175958..176557)
                     /locus_tag="LMJF_16_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650594"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX1"
                     /translation="MKCCRVFVFVLLMLFTACATCSILFPVFRKVVAGTDTTNTVYFW
                     YRQSSTPAKETPDVEIVRTYSYHLQCLQGQVYYTVTAALSVAATAFIASSALLTACWI
                     NARYNDSLAVTSTFTSFISLACCGATLGLIVCTYMTTLCPGEKTQMLAAKEDGYQLAE
                     GFYLLCVATGGTLLCFVVGFALCCSTLCCSEEGKDDDYE"
     gene            complement(<180746..>181393)
                     /locus_tag="LMJF_16_0500"
                     /db_xref="GeneID:5650595"
     mRNA            complement(<180746..>181393)
                     /locus_tag="LMJF_16_0500"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682076.1"
                     /db_xref="GeneID:5650595"
     CDS             complement(180746..181393)
                     /locus_tag="LMJF_16_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650595"
                     /db_xref="UniProtKB/TrEMBL:Q4QEX0"
                     /translation="MRCCRFLLLILMVLFTGCIIASILLPIFRKESNDTAQAKVNVFF
                     WHNDSVVTTGTPPELLITRIYTRNLLCMKARVLFLLMSGLSVMAAAVAVVACLMLACW
                     TTAGYSICISATSLVLSIFAMLFSIAVLAASTVVFKQDFCVNNTGTHLLAPQKNGYRL
                     VEGFFLLCIAVGGFLFMFVTLVVCLCCECRSQPGSRGQHSSRKHDNSNLPDSNLT"
     gene            complement(<183384..>186941)
                     /locus_tag="LMJF_16_0510"
                     /db_xref="GeneID:5650596"
     mRNA            complement(<183384..>186941)
                     /locus_tag="LMJF_16_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682077.1"
                     /db_xref="GeneID:5650596"
     CDS             complement(183384..186941)
                     /locus_tag="LMJF_16_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650596"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW9"
                     /translation="MNFSFPHFTRASTDNVYTQPPQKSLLELVIEAKGRLGLVPQRHA
                     LKQYPSSSPFSHFSDSDEEGEGVDGNANEAEARQDAVLTTRTSWVPPAYLLDYFFSGE
                     FLSVFLTLHSINASRPVSMLVPPLLTVRDAQLHPLVEAGLCAVFQDAAHSSSRQQRGG
                     GGGGWRDGVRGGRGGRDGGERSYMESNAAAASADGPFMPYVGGAQQRQLQGGVLGAGE
                     GNDNGAAEPSAPIAAHTSCVDAQRRVYEPATTPLAQRLLFRGLQQVALPALLLGDHVL
                     LSGPRGIGKRTAALLSAGANVLAFTSSADPGASEEADAPPAPVEGEGEAAADKPPAAA
                     EGPASTSPTEAEVKPEEAMEDTRDAADTRPDPAEPPAASDPASPPAPRALIVVSSYPE
                     VLSAAHWLGSVFGPSAFAPYTFQKDGVALRPLLEAQTAEQQPAVLDGGSGPYSSHALG
                     HGGVMLTFPTTTNGRRFIGPPLSLPFITDTTGAAGAPALPPADPTQVESAPRHAQATV
                     PALSELAALVMNASLPAEAAGTAQGSVGERTNGGDTKLKRRRHRDDEEVSDDDVDKER
                     AEKRSSRTHRRHHRHRGERDEVESEDDEIRRVRHREERSPRSSGRHRHRSRHGDRSDR
                     GGETESRGERAASSHRSHRRHRRRSDEGYGGEGGKDRRPVNREERHSQPHSSHRRSSR
                     RHHHRSRSDERPSRHRSRRHHHRSRHRGDRHGEDRRGVSSSSSSSSTAASSTSSAGCR
                     SAGLPPSMPTNAEAVLPMILDNSVAPPAADELRSLALDSVVPPAVPMEAAVTPFSAAA
                     VVEEPLAASETQQEAANEDSTAELSEVLRQRVPLLITTYHALGMALGMVQGEASALPP
                     LEHVRVALFVNFERVLMPPLKESFVHSWWLSLVNALDVECQFVVTADRMGSEVRGFLD
                     STIIPDAGERLVHFDQRDASIWAMMSVQVCAVPVEVPVTASPPNGGSEGRPRITGSDI
                     DAAKVAHLFSTIVEHMLSTGCHATHQRGDAAFEAHRGGQGARVVVVCSARREQSLVVT
                     QLQRLFHDQEHDTHAAMVRVTERVELFRALEAEVLVLTDAQLTDPRVLRDVHQCAEVD
                     LILHFSLPRTVMTQLEKKEIIDLLAQRGRAILGSSRHFCARRWWRSAAVASAAAGAPS
                     SAVDFVPAKVKCQLLLTEHNVHGRAGSCVMEALREVSDS"
     gene            complement(<189539..>190525)
                     /locus_tag="LMJF_16_0520"
                     /db_xref="GeneID:5650597"
     mRNA            complement(<189539..>190525)
                     /locus_tag="LMJF_16_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682078.1"
                     /db_xref="GeneID:5650597"
     CDS             complement(189539..190525)
                     /locus_tag="LMJF_16_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650597"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW8"
                     /translation="MLRRHACSTAACVTAIQTTRTAHSIAVLQNSAPTTTAKKLGSAV
                     SKEEVAAVNKVPAAILEKVCNPRLVAFTEMDLARTRFAPLIATITDEVDYTSIEQRVA
                     SRFLEDPSKLQPIPGALKKFRETNWKDVKSLITFYEETMYPIRMKHKEYKHHELTSFH
                     IKDVLKRGLSAFKQSYLDQQQEEQAMVKAYMQKCDDLVSTAVKDAFDTAICNDLANIL
                     RIGGEQHAHAHRMALKILDDMNMMKVPYNAATMEILKAVTFNDGPFDNSPLLFEMIEC
                     PERGEVHVGTDSLEKISDEILKLISHRHQTPLDDGMLIRSPDTHPNLQRSPE"
     gene            complement(<191978..>192940)
                     /gene="DHODH"
                     /locus_tag="LMJF_16_0530"
                     /db_xref="GeneID:5650598"
     mRNA            complement(<191978..>192940)
                     /gene="DHODH"
                     /locus_tag="LMJF_16_0530"
                     /product="dihydroorotate dehydrogenase"
                     /transcript_id="XM_001682079.1"
                     /db_xref="GeneID:5650598"
     CDS             complement(191978..192940)
                     /gene="DHODH"
                     /locus_tag="LMJF_16_0530"
                     /EC_number="1.3.98.1"
                     /codon_start=1
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="XP_001682131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650598"
                     /db_xref="GOA:Q4QEW7"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="PDB:3GYE"
                     /db_xref="PDB:3GZ3"
                     /db_xref="PDB:3MHU"
                     /db_xref="PDB:3MJY"
                     /db_xref="PDB:3TJX"
                     /db_xref="PDB:3TQ0"
                     /db_xref="PDB:3TRO"
                     /db_xref="PDB:4EF8"
                     /db_xref="PDB:4EF9"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW7"
                     /translation="MSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSK
                     SCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGL
                     SMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPH
                     SFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGF
                     GGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQ
                     EEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTLDGTAESTR"
     gene            complement(<194415..>195398)
                     /locus_tag="LMJF_16_0540"
                     /db_xref="GeneID:5650599"
     mRNA            complement(<194415..>195398)
                     /locus_tag="LMJF_16_0540"
                     /product="putative aspartate carbamoyltransferase"
                     /transcript_id="XM_001682080.1"
                     /db_xref="GeneID:5650599"
     CDS             complement(194415..195398)
                     /locus_tag="LMJF_16_0540"
                     /EC_number="2.1.3.2"
                     /codon_start=1
                     /product="putative aspartate carbamoyltransferase"
                     /protein_id="XP_001682132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650599"
                     /db_xref="GOA:Q4QEW6"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW6"
                     /translation="MPTFNPVASLKGQSVASAAQFSRADIDALIQLALDMKTHIEAGK
                     TIDTLRGRVMTPLFFEDSSRTLSSFCAAMMRLGGSVVNFKVETSSVNKGETLQDTIRT
                     LDSYSDVLVLRHAKEEALEQAMSVATHPIMNAGNGAGEHPTQALLDILTIHAELGAVD
                     GIAIALIGDLKKGRTVHSLLKLLAHNFALRKVYLIAPAGLEMPAEVLEHVATDVVKRG
                     IAIQQASGLTPEIVADCDVLYATRLQKERFVASAAGDADALTAFEASKASLLIDKARL
                     AHAKAKMVVMHPLPRVDELSTDIDDDPRAAYFRQMRYGLFMRMAILFSVLS"
     gene            complement(<198649..>200022)
                     /locus_tag="LMJF_16_0550"
                     /db_xref="GeneID:5650600"
     mRNA            complement(<198649..>200022)
                     /locus_tag="LMJF_16_0550"
                     /product="putative OMPDCase-OPRTase"
                     /transcript_id="XM_001682081.1"
                     /db_xref="GeneID:5650600"
     CDS             complement(198649..200022)
                     /locus_tag="LMJF_16_0550"
                     /EC_number="2.4.2.10"
                     /EC_number="4.1.1.23"
                     /codon_start=1
                     /product="putative OMPDCase-OPRTase"
                     /protein_id="XP_001682133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650600"
                     /db_xref="GOA:Q4QEW5"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011995"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW5"
                     /translation="MSFFDLLNARAKRSLLCVGLDPRAKTATAAAEECKRLIEQTHEY
                     AAAYKPNAAFFEFFGAEGWAALSEVIRAVPAGIPVVLDAKRGDIADTADAYATSAFKH
                     LNAHAITASPYMGSDSLQPFMGYPDKAVFVLCKTSNKGSDDLQCLRVGDKYLYEAVAE
                     RAEGPWNVNGNVGLVVGATDPVALARVRARAPTLWFLVPGIGAQGGSLKASLDAGLRA
                     DGSGMLINVSRGLARAADPRAAAKELCEEINAIRFAKGASVELAKALVDSHCVRFGNF
                     TLKSGKSSPIYIDLRRLVTYPAIMRLVAREYAKVLRHYKFDRIAGLPYAALPIASAIS
                     NEMNVPLIYPRREAKIYGTKAAIEGEYKKGDRVVIIDDLVSTGETKVEAIEKLRSAGL
                     EVVSIVVLVDRDMGAKAFLSKLGYDFEAVVGLHQLLPLWRKSNAITSQQEADVRAFLG
                     QWKQSKL"
     gene            complement(<200646..>202847)
                     /locus_tag="LMJF_16_0560"
                     /db_xref="GeneID:5650601"
     mRNA            complement(<200646..>202847)
                     /locus_tag="LMJF_16_0560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682082.1"
                     /db_xref="GeneID:5650601"
     CDS             complement(200646..202847)
                     /locus_tag="LMJF_16_0560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650601"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW4"
                     /translation="MVNPADAIKVDVTVKLIGIIGCSASGKSTVAHQLASRLDSPLHP
                     ICTDNFFFDDVCARLGTYEDYRCIDYGTVARWMSVLVHAAPTVSVSLLEERCTPAASP
                     EARAASADGNTALHHSPHDLEGRVHNAWWEEVLLHLPELSKYRRAAPDATSATTAPTT
                     VVVAAADTATPAAQSSRTVAEAAPAGAHRHDGTSDSDGDASLGAHEAEEEDRRRRSVA
                     AFTQRREGGGGTVCSPLELRSGSEEQAPHTAAPFSHHVIIYAVWEGFTLLCNRLANSY
                     IDYAIDVRCDLETACLRRFFRTPRRHLARYLAHDSAGGCQNGQDESQLRLQRARAAVV
                     ACVMRQVYRPRIEKLWRVRSREQHRADLTNALVQEMRLDGLQVLARGDSPTATSPPTC
                     VTARDALDLLSPSCFDPPRPRCRRQPAHSGAAKGMSDGGSGTRRQGESCGAEAAASTI
                     SSTSASPVAVAEEVGRCCSACWSADGLPTDAFQLFWESEFDEWLTRSSSSSATTAAAA
                     AALAWASLKHRDGEGVDAHAAHHVDERQRDVNGSFRSTSPPRVTPPNEEPGVAYVNRM
                     LAQRGRLALLQSLSCGERAVASSSPEASSIGGKGAASAEFGLEQQLAVGGIHSPTVLS
                     AETLSSALAPFYYEFRYWYVFEVLYYERIFRPLQVHRLRWRSVVAESSPASTDGEGRS
                     GEHGGCGATTAPCAVPRRWWVVKNGRDVYGQDAGELLTQVDHICAAVRAIR"
     gene            complement(<204085..>204477)
                     /locus_tag="LMJF_16_0570"
                     /db_xref="GeneID:5650602"
     mRNA            complement(<204085..>204477)
                     /locus_tag="LMJF_16_0570"
                     /product="histone H3"
                     /transcript_id="XM_001682083.1"
                     /db_xref="GeneID:5650602"
     CDS             complement(204085..204477)
                     /locus_tag="LMJF_16_0570"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_001682135.1"
                     /db_xref="GeneID:5650602"
                     /db_xref="GOA:Q4QHB5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB5"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYIVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<204997..>205389)
                     /locus_tag="LMJF_16_0575"
                     /db_xref="GeneID:5650603"
     mRNA            complement(<204997..>205389)
                     /locus_tag="LMJF_16_0575"
                     /product="histone H3"
                     /transcript_id="XM_001682084.1"
                     /db_xref="GeneID:5650603"
     CDS             complement(204997..205389)
                     /locus_tag="LMJF_16_0575"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_001682136.1"
                     /db_xref="GeneID:5650603"
                     /db_xref="GOA:Q4QHB5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB5"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYIVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<206884..>208101)
                     /locus_tag="LMJF_16_0580"
                     /db_xref="GeneID:5650604"
     mRNA            complement(<206884..>208101)
                     /locus_tag="LMJF_16_0580"
                     /product="putative dihydroorotase"
                     /transcript_id="XM_001682085.1"
                     /db_xref="GeneID:5650604"
     CDS             complement(206884..208101)
                     /locus_tag="LMJF_16_0580"
                     /EC_number="3.5.2.3"
                     /codon_start=1
                     /product="putative dihydroorotase"
                     /protein_id="XP_001682137.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650604"
                     /db_xref="GOA:Q4QEW1"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW1"
                     /translation="MPSAPTSVTAVVQLPPLIDCHVHFREPGLEHKADIASESTAAYY
                     GGITVACDMPNTSPPTQSVAALADKVARAKATAHAHCQLFFFFGATAEAHLQELEELW
                     TNPAHAELKTHCCGLKLYLDNSTGNMKSSLSVVEKSFEMCGRLQIVLVAHCEQSEIND
                     AAAAQHPYDGPASHSLRRPADSEAASVQSAIALARQCRTPLHLAHVSTAQSLDLIREA
                     RAADPTLQLTCEVTPHHLFLTTSDYSCCGARVKVNPPVRPPQHHEALWAGLLDGTVDC
                     VGTDHAPHTIAEKDHCDAAAQPPSGMPAIEVVVPLLLTVVAGQWPHPTAAKPSALAAA
                     EHQGRTLTLDDVVRVLHTNPNRIFNLRQPDAPHRSFDLACEWTVRGEELHSKCQWTPY
                     EGWRLRGRVLANE"
     gene            complement(<209848..>215376)
                     /locus_tag="LMJF_16_0590"
                     /db_xref="GeneID:5650605"
     mRNA            complement(<209848..>215376)
                     /locus_tag="LMJF_16_0590"
                     /product="putative carbamoyl-phosphate synthase"
                     /transcript_id="XM_001682086.1"
                     /db_xref="GeneID:5650605"
     CDS             complement(209848..215376)
                     /locus_tag="LMJF_16_0590"
                     /EC_number="6.3.4.16"
                     /codon_start=1
                     /product="putative carbamoyl-phosphate synthase"
                     /protein_id="XP_001682138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650605"
                     /db_xref="GOA:Q4QEW0"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4QEW0"
                     /translation="MEHYAKAELVLHGGERFEGYSFGYEESVAGEVVFATGMVGYPES
                     LSDPSYHGQILVLTSPMVGNYGVPRVEEDLFGVTKYFESTDGQIHVSAVVVQEYCDQP
                     DHWEMYETLGTWLRKNKVPGMMMVDTRSIVLKLRDMGTALGKVLVAGNDVPFMDPNTR
                     NLVAEVSTKTRVTHGHGTLRILVIDMGVKLNTLRCLLKHDVTLIVVPHDWDITTEVYD
                     GLFITNGPGNPQMCTSTIRSVRWALQQDKPIFGICMGNQMLCLAAGGTTYKMKYGHRG
                     QNQPCKCNIDDRVVITTQNHGFAVDFKTLPSGEWEEYFTNSNDGTNEGLWHKTKPFCS
                     VQFHPEGRCGPQDTEYLFSEYVCRVKESKVKEVAKFKPRKVLVLGAGGIVIAQAGEFD
                     YSGSQCLKSLREEGMETVLINPNIATVQTDDEMADHIYFVPLTVEAVERVIEKERPDG
                     ILLGWGGQTALNCGVKLDELGVLKKYNVQVLGTPVSVIAVTEDRELFRDTLLQINEQV
                     AKSAAVTSVEEAVAASKDIGFPMMVRAAYCLGGQGSGIVENMEELRHKVEVALAASPQ
                     VLLEESVAGWKEIEYEVVRDIYDNCITVCNMENFDPMGIHTGESIVVAPSQTLSNDEF
                     HMLRSASIKIIRHLGIVGECNIQYGLDPFSHRYVVIEVNARLSRSSALASKATGYPLA
                     HVATKIALGKGLFEITNGVTKTTMACFEPSMDYIAVKMPRWDLHKFNMVSEEIGSMMK
                     SVGEVMSIGRTFEEALQKAIRMVDPSYTGFSLPDRFAGVDFDYMEHIRHPTPYRLFAL
                     CRALLDGHSAEELYQMTKITRFFLYKLEKLVRLSKATSTLYANKLTEMPRESLLNMKA
                     HGFSDRQLAQLLNSTAADVRARRAELNVMPLIKQIDTVAGEYPAAQCCYLYSTYNAQR
                     DDVPFTERMYAVLGCGVYRIGNSVEFDYGGVLVARELRRLGNKVILINYNPETVSTDY
                     DECDRLYFDEVSEETVLDILTKERVRGVVISLGGQIVQNMALSLKKSGLPILGTDPAN
                     IDMAEDRNKFSKMCDELGVLQPEWISATSVEQVHEFCDTVGYPALVRPSYVLSGSAMA
                     VIANREDVTRYLKEASFVSGEHPVVVSKYYEAATEYDVDIVAHHGRVLCYAICEHVEN
                     AGVHSGDATMFLPPQNTDKDTMKRIYDSVNRIAEKLDVVGPMNVQFLLTAEGQLRVIE
                     ANVRSSRSVPFVSKTLGISFPSVMVSAFLARKDQNLVPIKRAKMTHIGCKASMFSFNR
                     LAGADPILGVEMASTGEIGVFGRDKHEVFLKAMLCQNFKIPEKGVFFSSDVDSQTEAL
                     CPYIQHLVRRGLKMYGTANTAAVLHEYGIQCEVLLQRSELPPGDVSESNRLAVYDEEV
                     AKKGKFDLVIQLRDKRRDFVLRRCTRETAPPDYWVRRLAVDYNIPLLTEPSIVKMFCE
                     CMDLPASSIEIEPFRHYVPKIYHKVENNNCAMLRCHKVGLMITNNNDSKVLALRLSQE
                     GLNITCFHAYLGGSDIDHFEQAFQSLNVPIEVVDLRSEIASSAFDLIMCQSADERHNW
                     HLSKLSWYIFGKYLIPVMRQRRMSVVAQTSKQNKKEAGFEKYVHSNCPEMGVYNAWRD
                     ARLMEDFETVADQISFLRKHGIKATVKNNVQVHSSVCGSTYYGDDMRSLPAPSLVKPV
                     RECSATPEFVSLTFRGARCVNINGIDVTPLLALQMANEIAGRNGVGITRTREGAMYET
                     PGMNLLSVGLQFLYDVSFDRCAADLFRIYSRHVSQNIGAGQLSEKHTQSAIEAVRFLT
                     SDVSGVVELELHQGEIIFLKLSHVQNPVDRRVAPQLVTEEELEEVFQPGNGSFSDVQW
                     "
     gene            complement(<218098..>218490)
                     /locus_tag="LMJF_16_0600"
                     /db_xref="GeneID:5650606"
     mRNA            complement(<218098..>218490)
                     /locus_tag="LMJF_16_0600"
                     /product="putative histone H3"
                     /transcript_id="XM_001682087.1"
                     /db_xref="GeneID:5650606"
     CDS             complement(218098..218490)
                     /locus_tag="LMJF_16_0600"
                     /codon_start=1
                     /product="putative histone H3"
                     /protein_id="XP_001682139.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650606"
                     /db_xref="GOA:Q4QEV9"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV9"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYVVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<219012..>219404)
                     /locus_tag="LMJF_16_0610"
                     /db_xref="GeneID:5650607"
     mRNA            complement(<219012..>219404)
                     /locus_tag="LMJF_16_0610"
                     /product="putative histone H3"
                     /transcript_id="XM_001682088.1"
                     /db_xref="GeneID:5650607"
     CDS             complement(219012..219404)
                     /locus_tag="LMJF_16_0610"
                     /codon_start=1
                     /product="putative histone H3"
                     /protein_id="XP_001682140.1"
                     /db_xref="GeneID:5650607"
                     /db_xref="GOA:Q4QHB5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QHB5"
                     /translation="MSRTKETARAKRTITSKKSKKAPSAVSGVKMSHRRWRPGTCAIR
                     EIRKFQKSTSLLIQCAPFQRLVREVSSAQKEGLRFQSSAIMALQEATEAYIVSLMADT
                     NLACIHAKRVTIQPKDIQLALRLRGERH"
     gene            complement(<220243..>223653)
                     /locus_tag="LMJF_16_0620"
                     /db_xref="GeneID:5650608"
     mRNA            complement(<220243..>223653)
                     /locus_tag="LMJF_16_0620"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682089.1"
                     /db_xref="GeneID:5650608"
     CDS             complement(220243..223653)
                     /locus_tag="LMJF_16_0620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650608"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV7"
                     /translation="MSGRRVADTAVSDSGELVEALLHVFHPLLLCVADALASATAVTP
                     PQAVAGGCVADGGSQGTVSLWLEGGETGAKTAAAPAPNTQDAASAQHSTATASFMVLE
                     GAAGAFSPVAPAPARDSSPPPADTTAVFCAAEEDEAGGHDDEGGNNRKAAQQRLPTAL
                     VHDKLSAAQGASDVECRDGGHGVDSDAAKEVTAGLRCSARKESVVACPPSSTSSLPHA
                     TSPSSAFMSANSDEASATMPRKRGRPLLSRTATARLHKKEDAAKTPEQALPRVPAPPP
                     HAARPFCFTVPNAMLWETVAALAEAVLIGGACFSWLQGEVQRRADAQQQHGEGQRGAK
                     TAPSLSLPSPARVLADALLGFGHLSVTAAHMRWREFAVSSKDGASPTGSGSHEPGERG
                     NGDSGVFAALPAEVQDAVFTAVAAALVRAAAVHTAQLLSPLCATTPGDARLTQRGGER
                     VGQQQDVPDPAQCRGDSPSFAAPPRATAHVAPVDDSSAASPHLQTNCGCRAASAPSFQ
                     WQQWAERRLAAEAQGFTNATGAPLTFRMVQEMVKHQNRRTLQAQQLQQPRPTAMSATL
                     SCSPASVSPASAAAVAPGASGPRGDAFVATATTGAPSATAAAGQPPSRTAESPLSVLM
                     RQAEAQDHSCFYVQVSTGDRDGATRTEATVAPAGNTAVRASEFTVQVLCSALASAMTD
                     GAAAGTLHDSATTEATRLVDDAAAGSGGVLVCACAAKREQHGEARNPHRLAGDARCGL
                     VRQWCAGLEQLACITSSMSCRSGTARRTRHASFSVSVAALFAYLRDSSVNPPLQLLAD
                     YARGTGKVTSASPKAPDPATRAIHGGHAATAGAAAATVGTAVHQSPWTTARWSMRPVI
                     GIGEVDYAADHFTRSGEHRRDHAQGVAALSSLPTDSAADAYPPNRSTPSALIDAGSPQ
                     EGPSKQQKTDAGQAASASPRLPPAVEWLRLSDEHGHPSQSDKAEVIDSAPPALQQSAT
                     RVVERSTAALFQRVLAPIIAGEQGDARISADVVNPLEEVGAVLATLDAVCAGRTLVDT
                     TAWRYGRNRMNVAAFSIVGLALPDSDKGGSAGQGNDDVGKDGASLDSTHDSPQGPSAE
                     RATLQSTWEEPSTAPVPACRALLPLGLYHHECGVLHVVDGATYALEID"
     gene            complement(<224424..>226379)
                     /locus_tag="LMJF_16_0630"
                     /db_xref="GeneID:5650609"
     mRNA            complement(<224424..>226379)
                     /locus_tag="LMJF_16_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682090.1"
                     /db_xref="GeneID:5650609"
     CDS             complement(224424..226379)
                     /locus_tag="LMJF_16_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650609"
                     /db_xref="GOA:Q4QEV6"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013049"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV6"
                     /translation="MTDSFTEVSPAVVAAHNAEAMRDEVLRRMEVYVLELLHTLLSLP
                     IKRVLPRGNAVAAFNEGTSGSLRRRGPYAMPREQQTSTRAARGAISAVPVSIPPDGRA
                     HTKASLPGDEGAATWSSDGRPVTSRRSLQTARHHLLILTELFRNVGRGDVATQRDVYY
                     HLVRHIQTQEVVNRTVQQLSRVLRLPRQLMGVVAGGRGYIAGWLSYRGRNLQGGGTGL
                     AAEEGMPLPLLSADLVVSVLGVVERAAVEDDDGRSVSGLASSSNLTHSRSLQQSASSR
                     WTTTEHRDVTSRSANSAAVAGFQVPPNVCAILVVEKHAVFAQLLREGLPRLLPCVLLT
                     AQGYPTHAARRLLAHLHAALPRAAVVGLVDYNPHGLAILAAYRWAATSDVLPAGSASM
                     ESRYYPVPTLRWLGVRTAHVVRVMEKRDSGGPSAEHPSAVQCPRLRHHTPAPLEASVR
                     PWEGTGKGSWAHSSDSAAASTANCASSAPHTAGKAAIASPLTSIAPLQHFTRRDAVVM
                     RHQIERLEALLRPAASSPAVGKDFAKEVEAAEGRRRDLVEPSYMERASVGLSAAPQTH
                     SRLSVADLECQADRASLVAWLNEAREMQRCSLKCEIEALYTAPYANRFLGTASVVHVH
                     VRRRGAQPPPSQFAEWVCEQVLRRQYI"
     gene            complement(<227038..>229104)
                     /locus_tag="LMJF_16_0640"
                     /db_xref="GeneID:5650610"
     mRNA            complement(<227038..>229104)
                     /locus_tag="LMJF_16_0640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682091.1"
                     /db_xref="GeneID:5650610"
     CDS             complement(227038..229104)
                     /locus_tag="LMJF_16_0640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650610"
                     /db_xref="GOA:Q4QEV5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV5"
                     /translation="MVPLLFHSSPLPSPLPPLDPISLLPTDTDKDVLLRPHSRWLVRK
                     DRTRIFLMQSARVALPRKGGSSGGAGVGVATAGLLLETSLGPLAIDFFGADCSALTAN
                     FLNLCRAQLWNGAVATEVVPEVVVFFSLAADPVYKELLEKLLRSHSAGAAAPPGPGPL
                     NFWSLLPRQERAEGDTSRTASTATVSLHSHAAASVHSTTDPVEQQETAVRQAMQQEAR
                     LCKRRRCVGLALPRAGGSNTKGGYQPVYVPASGSSGAAVATDAAHASASHSASSPCTV
                     CRSGSLLVDASAPTLRFGLTLSDRAMDFLDKQYITIGVVREGEEVLRRIRRAPVRDRC
                     GDDAPTTAGADPLAAVDNVAGRPALSWPRPVRMLRVKRATVLPTAGTEKYVAVPPSAW
                     WGVSSTASSAAAMKQQRQLTAAALHQAGCFEWWASEAAVRAAHRQLVDLVRTSLAAHG
                     YVVITRPRTVADASIYLQKAAASTGRHAAQPLIVVAAAPAQTRSDDEAATSPGEPELV
                     CNLHYAGDYLSSEDDDAEGFHNGGQTLPHSATAALSAKQLEERRKSFMQQHQEKANET
                     LSLMLNLLNGVADVRGDIKPPDNVLFVCKLNPVTTGEGLALCFSQFGRVTSADVIYDA
                     KTKQSLCYGFVEFESVEACFRAFQKMDRALVDDCRIHVDFSQSVSRLWAQRQREMRKR
                     DRVALE"
     gene            complement(<230148..>230465)
                     /locus_tag="LMJF_16_0650"
                     /db_xref="GeneID:5650611"
     mRNA            complement(<230148..>230465)
                     /locus_tag="LMJF_16_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682092.1"
                     /db_xref="GeneID:5650611"
     CDS             complement(230148..230465)
                     /locus_tag="LMJF_16_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650611"
                     /db_xref="GOA:Q4QEV4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV4"
                     /translation="MASPPTATGSSPADADFIIPIETRYLYVTARSVPRETLLMTGDC
                     PICKSALGQPCLKCTSSTDECPVVVGVCSHIFHQHCLEQWLQGTCPLCRNQWQQERII
                     QQN"
     gene            complement(<232913..>234613)
                     /locus_tag="LMJF_16_0660"
                     /db_xref="GeneID:5650612"
     mRNA            complement(<232913..>234613)
                     /locus_tag="LMJF_16_0660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682093.1"
                     /db_xref="GeneID:5650612"
     CDS             complement(232913..234613)
                     /locus_tag="LMJF_16_0660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682145.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650612"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV3"
                     /translation="MRLQLQLQELLQLPQNEVQDMRQRMQDPDIAIPLLQCYDAVIHE
                     KTEEVERLRREAVDLQTQLDAFRKDQLDVSNAVRMAEELAKSVQGKAAAEVQRYLEAV
                     RELQEELVRLRIEVTRALDAENIAKQDALRIAERAASLETALEAAKQATSKAEAAREA
                     AERKWTIQEQQAEEQEMGAVVQKAQLQRITQENADKAQELERLRAKMTHALRQASDNH
                     AAHLRIVEERHRMIVEDLRSVNRTQELEVLKLRAQLARCDMTNPSGAGRGTGASSAST
                     SSLRLQSTAELLEAQTRQAQEMELKRLHGEVSALQLQRDDAVRQCEQRTSRLQRDFDQ
                     QLQDAQRQLQSAQRSFSEARSRCEELEETKAAQEASLRKARDELRQAQQGGQQYRLSA
                     DSSARKLASAQQQLAEASKRFSTLQEEKQSAVRQAHERVSELEANVAQALQEVQSAKE
                     RAYAEVEEVQRRYEQLRLQNSKLQDDLREREAALVKKERERSILVAQIGRLEDGLEAH
                     KRQMMESDRRVQQLEQQLIAMRQQQREGFLSLEQVKLQNAQLTRTRDQLAEMLQARSL
                     "
     gene            complement(<236398..>238422)
                     /locus_tag="LMJF_16_0670"
                     /db_xref="GeneID:5650613"
     mRNA            complement(<236398..>238422)
                     /locus_tag="LMJF_16_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682094.1"
                     /db_xref="GeneID:5650613"
     CDS             complement(236398..238422)
                     /locus_tag="LMJF_16_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682146.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650613"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV2"
                     /translation="MFSSRRAAQRICGGCALAQGCLPASALHPSRPLRLYAKTLADVT
                     PQNAASLHGRDGARDDFGAGDAGRGCHRAVGGDRDADTQRDNTHGALVEGGESTYPVS
                     VSHAHTAAKQATAALKSLLGHSRLSSSAVAADTDGEDRLSDAEAPAAHGRIADADTVG
                     PDVAGSAGGDAVEGDGVSNGEEELLECAEAFADEVETMGVERAATVTAAKAVPPLQGT
                     ASPKQNSADRQQAAKPDATPYSVGEPLNLQGARYWGSIASATRSAAEARRFLSPFWAS
                     RRAFEDAGATVMVEEEEGVLVHTTTLVAVRLFNLEQTTLAAEYRAATVTEVIGRLRLA
                     RDRNSTSSYRRGYDASTKPLNLAGGHISFALTAAIVASLHFPRLQAQCPYWLSERDVQ
                     AIGATVRPEEVGCCTLVPLSSESWWQSTAATAADAELSYDARAGAAATSVPDEEASTD
                     TARSVVRYYNVAQLDDCERFARLNPLRDRLARCLNHRGNRYNPCTTWLMWEYCARYHF
                     PLTDTPLIVFLTMGRIFQLGGKVVQTKRYPISRTRAGRGDGAAAGSSRSSIGSAAAAS
                     VSMTPPSSSAAVPDFEKPGAIRHGELDVVPACGGEDNVACNGHSARGGTDGTSSTAAD
                     VGVVPPLFTMVIHDEIVSLCNAMQTDIADVVLARAGELHKFRCWKRLAQP"
     gene            complement(<239983..>241326)
                     /locus_tag="LMJF_16_0680"
                     /db_xref="GeneID:5650614"
     mRNA            complement(<239983..>241326)
                     /locus_tag="LMJF_16_0680"
                     /product="apurinic/apyrimidinic endonuclease-redox
                     protein"
                     /transcript_id="XM_001682095.1"
                     /db_xref="GeneID:5650614"
     CDS             complement(239983..241326)
                     /locus_tag="LMJF_16_0680"
                     /EC_number="4.2.99.18"
                     /codon_start=1
                     /product="apurinic/apyrimidinic endonuclease-redox
                     protein"
                     /protein_id="XP_001682147.1"
                     /db_xref="GeneID:5650614"
                     /db_xref="GOA:O15922"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR020847"
                     /db_xref="InterPro:IPR020848"
                     /db_xref="PDB:2J63"
                     /db_xref="UniProtKB/TrEMBL:O15922"
                     /translation="MASKRCRQCSGDSASSSTSSLSPSELPPSKKAAGGQRVTAEVEV
                     APITTDATSATVTAAGGAKKKATTGSPARRTSSAAKITNGDAGELIRTAEALAALNAK
                     KSEKEIWSDVVPFVRRTTDSDFDPSRMYKFITWNVAGLRGLLKKNASALRAFMEAEKP
                     DVLCLQETKLNVDEADANATLGVVDGYSFVDHPCAFKRGYSGTRTYMKNSTTVKGLHA
                     RCTRGFALPSEPQADAAAGSRVLVEGAGDEEGRVLTTFLSPDPDSASSSSRIALVNTY
                     VANSGMGLTRLPYRVQSFDPSMREYLHRLDTWATENAAVPSAAAMGSGSSPHGFIWAG
                     DLNVAERDYDRYYAGTFKSMQECSGFAPEERMSFRETMQRTNSVDIFRQLYPQAGPVY
                     SFWSQRINGRPRNLGWRLDYFVVSSRLASYVVDCFPMPTVMGSDHCPFQMWMRHP"
     gene            complement(<242350..>244005)
                     /locus_tag="LMJF_16_0690"
                     /db_xref="GeneID:5650615"
     mRNA            complement(<242350..>244005)
                     /locus_tag="LMJF_16_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682096.1"
                     /db_xref="GeneID:5650615"
     CDS             complement(242350..244005)
                     /locus_tag="LMJF_16_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682148.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650615"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="UniProtKB/TrEMBL:Q4QEV0"
                     /translation="MSLALLPMVLRKDDSLVLAVYNEQAASLTELNGEANRYTGDYRE
                     CEVAFNPARPTCFAHATTTTLTYTEVIENTAAAEDDPCRFSFQTLFAVPMPHVAVSLA
                     FSPKGTYLVTYAMMDQKRTPDGNLSVFETAKGRLLRRGMQARWPAMIWTADEAYVVRP
                     VQGWMHAMNGDLASTASSSVLLEGTNEENSEQQSDADHDGTAAVNGTLSKVDLMLAQD
                     KEIEYATAPAEGRPMLGLFKPFYKQRQATFSVYRLPQLREGPLYQVNFGRAEAASLFW
                     SPSGNYVALLVKSERDPSGKSYYGTVQLHIIDVMSRSITDVKLKGEGETVHDCQWSPT
                     LDELLVIHGKMPRNKCTLFTKNGVAQMTFGEAPRNMVAWAPNGAQFVLGGSGNLAGDY
                     QFYARPQMAQVAAAGAGSNATVPVESSAACTGEFNEKCSFQNWAPDSYNFLCSTVFTR
                     LRMDNKIVVTKLNGARVLTCKYPVLYGAHWVAMHAPNEYPVRAASPRAAGEEKPKPQA
                     YRPPGGTSRAAALLRRDPEATQKAKPAGPVGATVVTQKKKRRH"
     gene            complement(<244825..>247374)
                     /locus_tag="LMJF_16_0700"
                     /db_xref="GeneID:5650616"
     mRNA            complement(<244825..>247374)
                     /locus_tag="LMJF_16_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682097.1"
                     /db_xref="GeneID:5650616"
     CDS             complement(244825..247374)
                     /locus_tag="LMJF_16_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650616"
                     /db_xref="InterPro:IPR018392"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU9"
                     /translation="MEGLKRQVELLYAALQPLDVDHSCHRHGQPTTLPDEVVSALQVA
                     LARATALAHWATAVQREQLLQQRPSGGSGAPSLHCGAAAQQQTLGSVAELFKVSVADI
                     RHWNPQLPSELREEDVLPPDTYLKVRPAASSVSSLRPSSVSTLASRLRLVADSTGSSG
                     VAVSGHTSAKTQGTDAGYGHGVAARRHNSAASSTRSSCSSRATGGAGASIAGVGSGVF
                     PCGSEGGASQGRYSAWTADSGRGSSRSPQVPELSMPNSCVNAAPPSCAPEPVMMSVCS
                     NPCSPPDRYYLIDLKEDVMGSSPSPESDARANGKPCCSRSIPKDSLPSPPVLSLASSP
                     PFPGAATSPAVAAAEATPWHDSFPRQAFIDGGSSVTSAQELRTRGHSRSPPCSPTGGV
                     PAGSVVTSKGRRSDIGPMASPGASPTASRIRPPSSLADGGGDGRQPRNRTAGSAAAAP
                     AVPPRVAKGGARALAPRSPTREASVSLSAVSPPSSLGADGRSNSAHSRMRAGGAEGEG
                     ELFGAEAPRHQWLSPMQHSQRALGLSPSLAAPSETSSCSSMAKKQRPPSTATASKTAV
                     NSGDIHSPSDFLTPIQPRGRHGPQRTAGKAFSSTGRSDMEGSPVSASCSSPGGHSGIE
                     AEATESPRSDAEDSMEDEEERTPSMRPPAMLGRHVSSPPPNLSRPQQSACTGARLSTA
                     PPRLFTAPPRRAVESPQQLRQKPGVEMETSPFPPSLAAPSPLEPSQQRLQEWSELDDP
                     LEGPQLAGGEDYDTLEGIAAAYNLTVSTIIEWNPYLKKYGSSEPLPPDLPIALPMSSE
                     DEEDGEETNGLVREADSELLRKPQPRHGNHTPGGYSPSGALDNSPTPLRPL"
     gene            complement(<248867..>251896)
                     /locus_tag="LMJF_16_0710"
                     /db_xref="GeneID:5650617"
     mRNA            complement(<248867..>251896)
                     /locus_tag="LMJF_16_0710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682098.1"
                     /db_xref="GeneID:5650617"
     CDS             complement(248867..251896)
                     /locus_tag="LMJF_16_0710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650617"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU8"
                     /translation="MFPIFFFLSSVTMQSRQYCRTPQPPPQQPWCSSAGAGVPKPDAY
                     AAFTSSSSLLPSPALTPQHLHPYVRMQPLGIPRQGGAPAASALTPPQAVAPSLALPQD
                     TTVLSVHSAASGNISHIGVRDVAELVRHLAESRYMTRQLQQRVHQMESFSSMQTAATG
                     DSAMSGVPAQQGTADAVQATGERLAASGEADAAAAAGPATPLYYPNQRMATSERRQRA
                     PNARGGGWTRTAARGSAKAAEKTRRVFAAFPRPRSRNPLSPRSPHRCSSTTSSAPATA
                     STTASATTSSLPSTSPASSIAELPARCVSPSPSSRCASNGACSPTPRRHRRRRASLRP
                     YGSRRTHSALERPRQRPHSSAPVICRDTATVVSRKPEMQRRRGSAERRRTQSRSRMRR
                     HHSAHGSHDSTLSAERGGGDACAAAHAASVSLARHCRRSSATESRRHRRVKSTAARSR
                     HRVSFSSLPPPPAALPAPAQMRRASSKKVQALVWQSRYYDLLARYTDETTRRDADLAD
                     IYEMIEHISWEQDRSRYSHRQRHHAQTVEGETDGGERQLSRVDATPRGSARGIADAPH
                     AAIDGHAVATPQAVAHTPNNGTMRTKADDGGRGGNATVSDAVTPVHDSLERIEALRRE
                     ADVWRQGCLALLQQQQTLQQPQQQLGGELTWVSGTSVAPLPPRPSSVAAGRSPLTLGT
                     GPTSRQVELLMSTHAPTMADEGAGVTPGSGDGGCEGDVCTAAVHLAENAVHSKASPSA
                     LPSHPTAAAPMAAQTPQCTSPSATPAAAAGDASSPGLQLYHPYAPPRLAISSHVSSVG
                     AANFDSRFPTPPLPSPPTGFPSPMASPLHTAPAKPPLFVGVPGYQPLRTRHESRAAWP
                     SQAFPASLPAGKAPPYGTSAGYTFPAATSALHGAPSFDAIEACAWGGVTRGGAPQGRG
                     YAASSTSPWSIDATLEHQCHSNVPASSPTAVPEALTPYPHASSLLHVPPPSLSMTADL
                     VCAREQLERDIRRHDQLLAAIGKLQKTAAEHATRRAL"
     gene            complement(<252515..>254146)
                     /locus_tag="LMJF_16_0720"
                     /db_xref="GeneID:5650618"
     mRNA            complement(<252515..>254146)
                     /locus_tag="LMJF_16_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682099.1"
                     /db_xref="GeneID:5650618"
     CDS             complement(252515..254146)
                     /locus_tag="LMJF_16_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682151.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650618"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU7"
                     /translation="MRSQRVLQRTRKQKMESSSCASAPIAVDAQDVVVPPAVAQARAW
                     LSLYGACCTEEEVEMHPVVLSRVLQAVELVQSRSCLSSGSEGPLAATTTKHTCRSGEG
                     DAEAATARSSPTALHEGDDSKRGKGEAGLSIDFGGLWMLLSEWIAILRSLVATVPLHT
                     LSLRDTALGDAGLRCLCRQVATTSVKPASLEVASRCEACSFHLLGLSTLAAPPSCPPT
                     IPGSWAASTLRLLDLSGAALTDGGPLASLLASCPQLHSLNLSDNSLGSRDAGLALLCA
                     ALQVHPSLEVLSLRRNCISGSRNGPAIAALAELIVARSVEGSRTLSKACGYGSALCRQ
                     QTPAAAAVAAQPLRRLDLSHNLLGTYFLLSDATMTHRAEAGRPSAAREYDMASSSGRH
                     VGVHEAVASFPLVAALYLNNTLIELNLHNNGLPGALLEYVEAKLHVNQRTTGGGADFS
                     KTVSTEIIASTTVRQVLIHRLRCTLDHILAGTANASGMVGATHTERGDAPPTEVPAES
                     QSSVLSAAERRWTTGEVSELVQRLVYNVASDLSLF"
     gene            complement(<254998..>260697)
                     /locus_tag="LMJF_16_0730"
                     /db_xref="GeneID:5650619"
     mRNA            complement(<254998..>260697)
                     /locus_tag="LMJF_16_0730"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001682100.1"
                     /db_xref="GeneID:5650619"
     CDS             complement(254998..260697)
                     /locus_tag="LMJF_16_0730"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001682152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650619"
                     /db_xref="GOA:Q4QEU6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU6"
                     /translation="MSACVTGTASAAQLGVGDLWASEVLEGCARAHYTPRQELLGILA
                     PPSRSAAAGATPIESVVEASGATVENGRTLVDVDAAESMNGHSRAASPNSIREAVANQ
                     PPLNPMERSALSEEMQALRAVLSPALIRKAYRLNTPCMTKHTTTNERLLNCTASPRCM
                     VGLQLLGSDAATREDCLKALMGNGPYVVPLPAVKGSGVTAANVDAASSSSPASTGREQ
                     GGVRATKGTREDLAETAESTTVAGDAAESTVMSDPAFPCLWRGVRNLMNTCYFSAVLQ
                     LLFSIARVRHAILNDDAAAHNHHCVAAAEAQGGTGVNQLAESGLRELFALMAFSREGA
                     GADPKSFARYLSLDVKVQQDAQEFFTLLLDWLRCHCGPTVKAAVTSTFSGTLLYDRRC
                     GSCGRSSKRAEPFLYLSLPVCPTLEDSLSEFLKPEAVDGFTCEECGHTAVATSLQYMR
                     TLPDVLVIHWNRFDFDLQSLQRHKVTTSTSFPLQLDMATYMRQWHEQKRNTTSRAADC
                     ESVAPEESEADHLYELRGVVNHLGDTAVSGHYTYHGKVSGASAELGSSGGSRGSSWLN
                     FNDAEVSKLNRYQGQRGASPDAYLLVYHRITTSSSSPSSALVSAPPGTGKPRQLQPVA
                     AVPSTSATPTPAEYPVYLREYVDRVNDECLAKRHDWMEQRAQAAALFDLWATAAKAVF
                     ESATNASSAPAWISTTTTTTPSLYVLPTRWLQHFGRFFLPAYVDVAALGGGAESKLKR
                     SKRDLDAAAGPAGDSVSSALTSGAAGVDAKPIVVGSEEGASGSCSRAAVEGTVVTATV
                     GPLRHGHMQTAEEVRQQVRQYSLMQALPSVTCAHGCVLPWASYKVVSASAYAKLTHFL
                     AVCGSPSTVAANGDRPASPSTAGASMTTRLRESLAGGGGAACGTQSCCTLMEANLCPL
                     CVAAMAAGVQALASRTAEDEEAELSLTRAWEEAERQKRHAAGEEGDEGDSGAGPGAVT
                     PTALTQSTQQQGAEEKREDGQQQRVLISKAVVDAWASFYTSQLGWGRVRQAEGYTGVL
                     VMREARVAPPPARAALASTSTPSMVAAVTTPASSASSLASPAVPETVSTSLANADYPF
                     SLAALNVDRGDLNLSAQLLCPHGALRPGQSVVVIPDALRRYWVHRFVEVLTMAHRSGV
                     LRTSNPHWSVSEDDVEHFFLPLIPASETSTTCQECMRSSVQHLTSRHQQRMKRMEERK
                     RYPSLWLAGAMTCPAGVAQLLLATGAENEEQLLAAQHPNRLFFKQHGEREYREYVKKW
                     AEAHQQRVAHQSSEVQRLRTALMKKRQHDAAWNARVTMRRSGGGRSGGRGAGATNAPS
                     SPVAPSPSETVTEASAPPEPQTLEGRLYYAEEALERMTAQTAPDCTVTYGCVPTWWVA
                     RWYAAMQSEDNKSDTSKGGDDADGEPLLALPRISFAKFKCAHSESLLGVSWLNPSDGF
                     WQGARAKRAELLWNGVRVERAGVPTATSPPTGPTEAEYRSQCWLPPMVILPMDEYVAL
                     LAQYGEPGMLERVASRTGGIAGASTAGAAVGGAEPRAEVTDVDAEAAEDGASAEAAKK
                     PTDPSAAAAGDCTVASLSTPSPPAVTPVPKSRAQTVPVAAAVIQVRFHNGARQLWPST
                     CAQCCAAMLAKFDAQCESFVNGSLRLNIHVKKSRKNYYDAVSVLTSAAVQHTGGSAAK
                     SVEGGSTTTATGADVIPAGIHYYTTLRQLKSYISAHLREKHGYLVPAEVLQVGRGKNK
                     PLKRCSTPPHAVEASDHHTRGTAPTSATAAEDAQLDDATLQELGIRDGETLSVQSVDM
                     IAQTCATTAAIDEEWEAIPPELLQAGACGGASATSIVREHTVAFRETRLQGSHGGSIM
                     AASPAVSAAAAGVVAATPTVGAAIAMEEQGLSCPVCTFLNAPDMVVCEMCEALLPST"
     gene            complement(<262133..>264352)
                     /locus_tag="LMJF_16_0740"
                     /db_xref="GeneID:5650620"
     mRNA            complement(<262133..>264352)
                     /locus_tag="LMJF_16_0740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682101.1"
                     /db_xref="GeneID:5650620"
     CDS             complement(262133..264352)
                     /locus_tag="LMJF_16_0740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650620"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU5"
                     /translation="MLRQRLHRARATHCARSHDVCGTHGLAASFRRTCAARRCGSLSA
                     VVLGCCYASTATSSTATSPPLSYETASMPKLSPSQPPATARSPRVPPPPPLSLLSWAV
                     DGSGHTHHRCRRRLSMEERIPLVCETIRATASDVVALQDSTPELAEALINGPDEGIAA
                     KPPRPAPERRLRIYCAELARDLQQQRPSNASPTSSASAAPVAPVTTEAPLNADCHGQQ
                     PPTTDAPGPAASSPTLPVASSPSCRYRLVGRARNGRCGEVQLFIKEGSVWDAQLLPGM
                     GAGLTVELRSRTPAVLPPRTSKGDAPASDIASSEASNPTSSATRQGGADPAGSEADSP
                     CHRCVLTTLDLSYRGKSLGTNTEGLLADAAVSAEGSPFTLQTQQPSSLSAAKRHGRAP
                     GQLDAHRAMALDWVYHHVRPDVLVGNLFTGAREHVPGFEDTWVRAGSPAGQERTTNTC
                     ARHRVDHATNYFYFRPSRNVASSEAMQRLMRMDEAAATVSRPLSPPPPQPPTTDGTPR
                     SAAAAQTTSGKTTETTSTTVVAVAADAPVGTPIPLAASRDSATGSWLLCSSACGGGFV
                     AGTEHCDGSAAASSAAECHRAAENGDDSVCTSGDITVGMPEVAGRFQRCLLRRWVRRG
                     PASRSGRLSAHPFLRQYRHCRVVVLRPTVEVELSAVEQAWHTQYITAQYSTQKSAMLT
                     PSATAEGEPGEAAAAAVAASQTIRVGEGSSLSPRQARVSSRVRCSVSDQYPLLTLLA"
     gene            complement(<265164..>266975)
                     /locus_tag="LMJF_16_0750"
                     /db_xref="GeneID:5650621"
     mRNA            complement(<265164..>266975)
                     /locus_tag="LMJF_16_0750"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682102.1"
                     /db_xref="GeneID:5650621"
     CDS             complement(265164..266975)
                     /locus_tag="LMJF_16_0750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682154.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650621"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU4"
                     /translation="MFRGHWIVADMDGTLTPTPTRAHGKYLTLSYCMQTGLGHGAHYK
                     SCLPWLRLFLECGGTLCVVSTAGKRMWSQLYPDLAPALFRLGAAAAAAGATAAGGNRG
                     PPGPSPPIDSSDAPGTLYLCGFTGAALFRSRPWEAVWSDMDRLHPHWRVPSAPHPSCL
                     DEGAGLRNGETAVAAAMVPPAGVALEEWTEYREQGAAPDAAGSQAAANSAASRLATMD
                     AAACMLARDEGRQALVRFFEHASHVCGHDAARAKDFFAACLSTKYHSAFADLLEQLLA
                     EVHVTAPHGGDDASGSDADTPHVCFAASNVLSPAALAQHGFFLQETGDALVDAQPVPR
                     ADGTVADGAAVAQVVVMGIPMRFFDQVFPTVGSSSSDNPLATSRSWHCCPRCAATGAG
                     ARQRLEAAGLELKSQPNSVCLHRCGVDKATCVRWLLAQHEQHQLMFELSQALAFGDTP
                     ESVDAPLTTFPPMQFISLSPKDGAAARLADIERAAVAGSTSADSTGGWGVRQQQQHQQ
                     PRCLRDSVQYMFHVGGEEEGTALFLEELLGSCTSEQQQQQQERRRSAASSSSDAAAAA
                     RAINWFTADRVAACATRARRRMEEELLQRQQRSTAST"
     gene            complement(<269854..>270846)
                     /locus_tag="LMJF_16_0760"
                     /db_xref="GeneID:5650622"
     mRNA            complement(<269854..>270846)
                     /locus_tag="LMJF_16_0760"
                     /product="putative transaldolase"
                     /transcript_id="XM_001682103.1"
                     /db_xref="GeneID:5650622"
     CDS             complement(269854..270846)
                     /locus_tag="LMJF_16_0760"
                     /EC_number="2.2.1.2"
                     /codon_start=1
                     /product="putative transaldolase"
                     /protein_id="XP_001682155.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650622"
                     /db_xref="GOA:Q4QEU3"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU3"
                     /translation="MPNRLEQLREMTTVVADTANFSLMEKFQPEDATTNPSLVLAGSQ
                     MTEYAHLLTEAIDYAKANIIKHTDHYTSDDSNENLLALALDKLTVSFGIQILKVVPGR
                     VSTEVDAKLSFDEQKMIDKARLLIQMYEEAGISRDRIYIKLASTWEGIQAARTLEKEG
                     ICCNLTLLFSFAQAVACAQANVSLISPFVGRILDWYRKAEPAKADCFVGAADPGVVSV
                     TKIYNYYKKHGYKTIVMGASFRNVEEILELAGCDKLTISPSLLEELAASEGNVTRKLH
                     PDKVTDVEKLPELSREDFLFMHNEDPMAVEKLSEGIRNFHKDTVKLRNAIHERL"
     gene            complement(<273822..>275666)
                     /locus_tag="LMJF_16_0770"
                     /db_xref="GeneID:5650623"
     mRNA            complement(<273822..>275666)
                     /locus_tag="LMJF_16_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682104.1"
                     /db_xref="GeneID:5650623"
     CDS             complement(273822..275666)
                     /locus_tag="LMJF_16_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682156.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650623"
                     /db_xref="GOA:Q4QEU2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU2"
                     /translation="MPFSPPSSQSPCHLPIHSLLSSLPSERKRKHTRTRAHTHTHTHT
                     SMRTMALSSLYPSQHRTLRVLELACPDSDADVRENCAYLVSKRRMTIDEAIEYVKGEA
                     ERGKSTATTAITTTTPSLERPTTMSATRSAVAAPVAASAASSCSPSRSYLPPPSCPHP
                     RACEREGSDAGADKVGTTYYQGYRSVRTRLSTATEGTTTATCAVPVSARPTAAQPLTA
                     GTPHRNRTPARSTIRWQCTQGASALTVTPPVGETSPQTLVKGHSEHRVSDGTADGVIG
                     SEATESRPRSRGRLGQNDGELADLREASAPMAEGQLDELSAPHVLAPTTARKSRESAA
                     AAPTVRAPPALKPGRDAYNGDAATAASTPPSTATLLQRRPLPPCSSAVPSLAYAGGRD
                     GAADDGASRKAAERGDADEGYCGAEPWLSELKQTTEEERAAFESQQADMMYYWYRDET
                     SMFDDCLSRYGPGQVLFFMTSMTGERAVRDCCRLMENLLFIKLIPHHTIDIADSEFFH
                     RRVRRLYRSATNKHNMPGMPLLFVDTKLIGDFVTVQELEDCGELDAKMIEAGCRVLRR
                     RIVDAHQRQRAGYAAVPLLLPVNKRSAAESTDPGKPSSSALSVLRDPT"
     gene            complement(<278710..>295638)
                     /locus_tag="LMJF_16_0780"
                     /db_xref="GeneID:5650624"
     mRNA            complement(<278710..>295638)
                     /locus_tag="LMJF_16_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682105.1"
                     /db_xref="GeneID:5650624"
     CDS             complement(278710..295638)
                     /locus_tag="LMJF_16_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682157.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650624"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU1"
                     /translation="MLEKYIAALLVPYLSKYVENINEDKLKVNIWSGKATLNDLVLRP
                     EALDALLNSAADESDGCSCEASGDAATSPKSKPKKPLLPIKTYRGICKNVSLSIPIKH
                     LRSEPVVLEVGEVLVTLKGAHAGSTDGIGAAMVGSSSGSVKRNVKADKWAAAAAAKEK
                     ELDAFEAERKRQREQAEQQRTATLPTSGSDAAAQTGRGGFFSRLGELVVNNIIVKVGT
                     VHIRYEEESTETVLGAVLGGVQLLTMNECTAQPMFTDPCGLQRMWKRLVFNDLQVYCD
                     DPTRVRANAALGRTWLSQIDDWQQWYHRMRQRVRDGNVALSTVLGPVSGTVDAKVVFK
                     LCVRQLLETPFADVAVKLQYLMVNLTRPQYTKLLQTAMLFTNQAEVSQLQRSRPRVPV
                     LGHAREWWQYAICAVRTVLREPKREKLLAQVSQVCRPDYQVLYRDVVRQTEMTPEKRK
                     VYRFVTRLMTTEDMKAGRKCVYAQIASEIQLKRKDNEIRKAEEMAKQHLTSVEQQQQR
                     NPKRSWFSWLSERSTGSCTHATAAQSDTAKEIEADEKLFRSIELDYGISAADAAADHT
                     AAADLSGVGSGNSLPPSYCWLHASFDLPLTSYCIDTEKEESITLKLFQLRGGVSSYNK
                     PNSLLFFFSTQNITLANPTSSPAALTSIRSKAAASSSSGCDTLVPYLIEGVQVDRQAC
                     KSSPNEVRVAMRSLTGVDSGKHLSPDAPTIYDVINVDRKGRRLSSLTPVPLLGTRDSI
                     GSGSSGSEEGQHRTQRDCATPLFSITGFLNPVEQPLPDTSVDMAIRVQLLPLRIVADL
                     RTIEQLIRFFSLPAGMDVSGFAESTKQAASAVGSAATHEVRAAMAKAKGLYVTVDASA
                     PVLILPKSLSADVQEPALCVSLGRVLFKVRPLSETEKKRRLEAAVAIASGKSGSCSKA
                     PARVAADDEPGSLTSAAAAEEALYYYPHKASFSKFYLELTTLERAMRRPQQGFFLVPE
                     VSIAADVLQRIDDCNTAREAVVLRLRVPSLRVASSVHQIYLVTTMMDAWLSNLRSPAT
                     ASSRTGLPGGNRSGGGPGGAGMAAPPRLNMELLRNRPAASECGEVHRGDAAASTGDHG
                     SADAAARGSSELGHGSRAVSQARSSPAEAGMPSSSPNKIDAAHVTPAGSTDLPAMRLE
                     LLVERLGLDVHDDDPSTHAVSPLPAFQVECGSTELILAVRSLHKKMVLCLTKPHIAAA
                     RDTDFPIFSVGRVRVDLLFSEGDAPTAVALSLDSALNVCVGTPCVELLETVMDMVNLT
                     LSAMDSSSRGVSNGVNAKTAALSAAATADRPADGGLSYLVPATRAASSVACDGASTSD
                     DLAPSCSISVASRVSDLAYQIDLVQQQCSIPNRHVADVFVHIPGSITVTLLNRTPGKD
                     KDVPFASASMRAVELRLSKYTVTMDLSGHVGEVAASVLASVGLAEANRTLLAYRPPSA
                     DTNAGGGAAGPSELPSSAKSAVVDVASASPSTGGKAGEGDTHRSSCSRPRSTKRLDTD
                     APDQNVHISFSFRKSRPVMPVFAEVDGKRSLVNAQELRYSSAMELHVGASAITVDLHT
                     VMIFKTYFTAGLFSRISRLAERPVYNGRTLPLTREGPRLLMSMRVVVRDTLVVLPVDP
                     RASDSANPAAVATTHCFYASLGSLALQDSLRATEGQEAMIVSLGEVGMWREELRALPL
                     RSSQPRESSRPLNAPLPVSKRSSLLPAETHLEMAVHTALDLQSEDPPRIDIRSEDVSL
                     ELRETDLVQLVTLLRQNLTRTDPADIAAYALETAEVRQMVLGKSGEPVAAQGDSTSVL
                     RGGASSAGAAVGAIRRNGGAGGNRSGDLCVSMQLGKISMLLSDACGEAAGNCIAASSS
                     RFQLQSTGVSMSVALPSNCVGVRWKSLELDDVRDNNRAALVWCEAGSLHFSDSLTTHG
                     ILMRDFGARRTALRSADAEMESMMGTVGCSDAKDSGGHSSGSVGASPSFSTGAAARGL
                     HRTAPAQATSSIEGDSAASTQLLTLSVLSADFTLRRFAVSDQWLALSDLVCNEAVLSA
                     WTASQTGMTAAICASPPAGYAGGNSGGGGAASKSRTAATGSRSGMRVIVTTPSVVIPF
                     LNSRRETLIEAHIGALLADVVQLPTVKQVAVKVRELSVVDARSGEKILWKRSSCGRPS
                     STRVAAGNALAPAPATQSDWGDEWEEADLPSSPLITSGGGAAAESASSAPDAWASVTA
                     DPDQAEVLQFTFKSDPVANINKIQLGIGELHALVSMPIIQGLADYFASPAGPVAKIAS
                     LGVMREQRARMAAAAQQMADSSLLVLNVLWQQPRIILAGDAMQLRRRSGNLEMRLGVM
                     RAAVRMNSSAASLSVVVKVQEYSIPSLLKRSALRFAYEANCGVETIDLQMKRTTALFH
                     PAEVERLVRLAHRNVLMPRDVNYYGAYEKAMAQQSGNLATPAAAPMPTSAQHQSATCT
                     SHAPPAEGKKPANLASSPPTPSRTVKVHIDGLLVAVHDIAGVNTHTLTLAALDTTVLP
                     NGSVALTVPSLGMLDQSTGRCMLQSETVASSAGSGAGSRTAHAAASAAAPAGSGSDGK
                     VSTDAAATPAEAALRIAFHPANRTSDVQLGAVLVTFIPQSIGTLVNALLSVHIPSPDE
                     PDTGASSAAQPISANAVAPRCGKGGERATGSTVAASTAAAVTHTSAMPFTFKATLVEC
                     RVRFCQGDREVAVLHLARIACCSNSYPNGANELTATLGNLFMVDRISVNTNYRTVIYP
                     YEDTEAGDAPGPDANPTGSAGAAVRSLVAPVDALVTYEVKTSAPPATKLTAKSGGANA
                     AESTVPTYTRHMKCRVGSLFFVLVPDVVRAVLGVVREAQAHISDGNRHKAYTYVSDRT
                     AESMRRRSESEQLMEIDVLVRRPQAFMIDKPTATMGVLLSPGSLTVRSQLVLPGDTTA
                     GEKADATAAAAPSATPPQLTEPEAMPHEVFVVQVRAMGMLLRGASCFQKDCNIFVQFQ
                     RALPALMDSSTAAAVAVATSTGAAKVEEGQTAKGGTGDGSDRAAVQLQSMLKVDVPIL
                     SMMLTHEQTDFAMIVLGALLNGTEIDRTPATTTSAPDDGRSSARNAVASSPSEEKTGG
                     QNRGGGSAPGLHIPQPPSSLSRTTAGGAGSQTTAASGARPGPQRGSTTAGASSSAVAR
                     PPSLAAQSVPHFYTPTEGSPITSFTLIVHVGFLQAEVADLFRLRVEEARVLSTGVTTT
                     GKMTDVRVDSIYVQHIGAEVEAPQPVDAGLSPSSQLGNEPRVGAPRTARIQELVDVLT
                     VRKLHMLSVQPQPVIDVDAGSSMVENTISVSAGVFNVAISPTILFDTREVLYLPFCYK
                     VLRVPIDPIPILSLMDETTTLQEDVVLDNKHVLLTASRTRCCYVLDLNNHKLVFTDAP
                     SGQIVLCEGCELTITNGTVHIPGMYTIGSYVSFAPSTALFTTDSVCFKKEFLNLSNTA
                     FYHPFLSRPMGSPGGGVARRGSPGSPLSPVSARASSTAGLTAISSMDTLVKSAAPRVP
                     HSTAIELHDRTVRLLATFYCDTMEVQMLSEEVVDLSVALCMQCRIKFSQDNENEQPVR
                     RTVSMQLLNVRSAEEEEHILLPTDMVVNVSGVENVSVSVVLDSIEFCTRATLLRSLVE
                     LGKDFGAAFIEETTVSRVTPRIEYETESLDPLVPVLEAGECQHCGQRDAYLAPAANRP
                     GILCYKCCTGHDHVPAMNFWVEVPLIDGIVFGSRSDMAHVFMRNVLLSVDPSMDLQLT
                     LRASLYGFSNTAAVWEPLIEHFDANISGSVKAHDYTVRTDRFDYVVSPQNIRLLSGMA
                     ADYGAATALQKQLRKRFRGQKQLRTQQTAPSQGMPMYVDAAFLDEEAWLQQQEGRESG
                     FQDANTAAALSPFGSLGDAADLPAEFSGATAGMVNMSIFDALSAANRRLIGAAAARQP
                     KRVYAHVYVTNNCGVILSVGDRRVTPRGGTLRFAASEPSVTIRREAKPDEPQYEGYVT
                     SLSNPPLYVQTTDMVLETRVVLSQEEGARHLRRTVTVVVYPLHVSRTIICFENRLSCS
                     LASTPNNPPMRPGERFYVAPTVDLNTSILVQPVNTPDRAEYEAGKPVTEALGGRVSRG
                     PSKMPTLQEVLCGAPLIVCCTAKADATKSMTLAVYARQEEMRGGVPTFVVHIESRFRL
                     RNKLPYRLIVNVIPDADGLLAKGKMTSRPVQPLASTVLEVRQSTDLGLNGYTLNQVAF
                     MLEVRQRGRRTAAADAAALSAPSSHKGQQEEAEEEEVFSTLMPVAVSPGKPLVILRSQ
                     YRRQLVIRASLVTNNCSIMFSTPYVLLNHSPIPLTLRECTRSGENRLYEAEPNYSVLS
                     AEMNASIAACPMDIRKSEDFFVNLYHKEYRGACVPLHAQQRGVVIMQHCSAKAGGKQK
                     LPAAASSSSKKKGTAPSAHTPGPTVIHLAYSSQVDPNGSVLVTITPRWVLVNRSHLHL
                     YAAPSTYSGITAREAAAVTEVMAAAQQKHSKAGGGDAPLPTGTPMPQQDMDAMKHALQ
                     EMVTEDGIVFLSDAPTQVMALPPHSATPLLETPLCGPEIGYNLHILQSPLAPLYGTPI
                     GIESIHNELIIAYKPLADTGDRAADVDVRGASGIGDSCGPLPQRDRFLEVSITARGSY
                     TYVVLEPPVHAPYLLLNRTNYTINARDTAVKSKGRLMAHATPGHGTELLLDNTVTTLI
                     QLELLSSDGHRQLHKVSFDVGRSMTPQEMNTASASAAGVLYTLSFGGNGQQIIEVTPA
                     KAALPIAYVGVAAPPIPINVLLNMAVMTLSVVMPSMDVLFCAVTDVRFSWNRQKDREM
                     TKFSIENFQVDNQTEVSPRYDSCFLSLRTSKSTAAASGYLERILVPAKGLICLEEVRL
                     DVVPLALRVSDTLLVAIAGFVRAVRNGEDAPHSMQSNQSIVAGSVTTVAVQEAAAAAY
                     ERCPTPATLFRKAPVQIDIWASRLTLERFIVNPIVVRVWLTRDVDEHDFFRENINSKD
                     AALLSMMLQSCEDVTVAAPGIVTAKQSSRLGIFAQWVGKTYTDRLLAQLKGLLLQYAS
                     SLPMIGAPLKLASGFGNGAVRLFREPIEGLSTSPSAFATGLARGSAGFAQEFAGGGLG
                     AVSNITASWARLLSMGGGVSERERRKQSVFTGFASGIKGVVQRPMEGAAESGAAGLVK
                     GTAQGLVGVLANPMSGLLSDMSRATGTLAKLVTDTYIPKTRRLRPIRDFHANGGVAPW
                     RSLASVYQYQRIQVSTGTWSGDHLISSVDGPEWYPSQRENATYGKNKTPIPEDRWTLD
                     RYNTNFMGWTYSTKYYGIYTGRLTDEVRVRRMRWTALIRPLPYSRVAFYLRVCPGMET
                     QQRRTPSSVFTRTITMPQESTIGFTSPGMLQATTVEQLQARKSRARGPRSSSHMRSSS
                     GSKVGVTWPWERSSSKSQRANSEFFAEEEYMEKAQTIHDLLRSWTAVGRNVGVKGSIL
                     RSHSGMLDDDEADERLPDAGQSSTGVSESPAIGAGGSASGSAAAVAGRSTSASRDKQM
                     KMSRHSRSNSELEALASPRMPNSSHQCTGDADKRRSHSLSKRDRRSESVAAASAEESA
                     SSMVPAPNLYVRSASGKKLPVDTVSTVAPVPGASSTPLPRTASNASAPPPSTVVEVYE
                     YEKKVSLLGWGKRYLPSDCPAWQDVHGHEVPSRHEIRAPAGWIWTTEWTVSGGDRDGW
                     TIVSKGERNLRRRMWQRRLLKQVTSPPPHK"
     gene            complement(<297715..>299088)
                     /gene="CHI-1"
                     /locus_tag="LMJF_16_0790"
                     /db_xref="GeneID:5650625"
     mRNA            complement(<297715..>299088)
                     /gene="CHI-1"
                     /locus_tag="LMJF_16_0790"
                     /product="chitinase"
                     /transcript_id="XM_001682106.1"
                     /db_xref="GeneID:5650625"
     CDS             complement(297715..299088)
                     /gene="CHI-1"
                     /locus_tag="LMJF_16_0790"
                     /EC_number="3.2.1.14"
                     /codon_start=1
                     /product="chitinase"
                     /protein_id="XP_001682158.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650625"
                     /db_xref="GOA:Q4QEU0"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q4QEU0"
                     /translation="MVQRSALVRLACLVAVLYSSCLSAPLSSTIAAAAPAAARDTAIS
                     SRHNTSVTAASPSPLFTVFGYLPEYRQGSFNYEAFFKAGLTHLIFFSAEVDPATLRLI
                     HVDDRLPSGDEWARIRRLADLHGAKLMLCIGGGGRSAGFADLVGDTVQRKAFIEEVNA
                     VLLARKLDGIDFNWDYPQTMTEWLNFGRFLMELRSSLGYAAAAGGEHAAEPIGERRYR
                     TRVRGAVLSMALHPHPSMAAVLQSARMLHSLDYVHLMAYDHVAGTGPHSSVEYAASVL
                     SEETIGLFNEAVYNRRLGRMHQRPRTEQDHRRKLTLGIPFYGRHREDRRLQPEAYDRL
                     WFFIQEWASKNHPTWVEGGAELRALSEYGGYSFTCYDDVKRKMRLARAANLSGIMIWE
                     LGQDVPPGTSPMSLMTAVHEQLADWGLLTDSGRGIGGNVNSDNAHDRPQPSPQHSSPD
                     VAEDGDL"
     gene            complement(<300245..>302494)
                     /locus_tag="LMJF_16_0800"
                     /db_xref="GeneID:5650626"
     mRNA            complement(<300245..>302494)
                     /locus_tag="LMJF_16_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682107.1"
                     /db_xref="GeneID:5650626"
     CDS             complement(300245..302494)
                     /locus_tag="LMJF_16_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682159.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650626"
                     /db_xref="GOA:Q4QET9"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q4QET9"
                     /translation="MDILGVTFIAVSKVIVAVLVGVFTTDSIPNSKITLHNFAFLISS
                     LLLASLTLSNTAKSIDLDVLFRCSILILFSLISIASGLLWGAVLDVLFFRLDPKYSGI
                     PEELRKDVRLELLYDRVTDEGAEAHCLPSSSPTTKGPGTKAKRKKTSVPYVVVVLSEH
                     FREVGVTGSEIVNALEVPDERQEDCAGYRYAAWVGCSTQNGVTLPLSLMSNVASSISF
                     IDMTHSAAYIFVFSISYMLYLWSACPAIVEAGQKAAKKQRLIREILLKHKRMMARCDA
                     TTQTLSLPVSQVLESAEDLEEDVEVDSCDSEAGQARRLECQVDRFTQLYLAVSDPSSS
                     STSCSDNTSSLEAGGVANTDGCSSRADRHVHSATYSFDLITSLQSSFTQMRRLARISG
                     KRGAAEVTFKILGTPATRSPTAADERAFAMSTAEQLPYDWAAAGYIRFKYESELKALR
                     TKSASEKVQQLGRASWVLVKKLMTSPPFLSVVLGIVIGIVPPVRRLSEHWPLPMVMDA
                     IRLIGEGSIPSSLLLLGANLAVSSSANAAESAEVRLRHAEQNTEYPLLPEEWQLLGED
                     VAYARWYDAQHTDMEFDLHESFSLQTLMQRGLLHASMMPGGASAASAAPMGDDTDEEG
                     GGAKKGTFMDGVQRTLSLKGIRPAFVWGIIIFRMLISPTLSFFLLIFLIDKMPFLFGG
                     RGSLDKTLIMVLMVELAAPTAINSTLLFNAYKFMTYQWAKMLFFQYILCVLSMVMWAS
                     IGLSYVSSL"
     gene            complement(<303878..>305686)
                     /locus_tag="LMJF_16_0810"
                     /db_xref="GeneID:5650627"
     mRNA            complement(<303878..>305686)
                     /locus_tag="LMJF_16_0810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682108.1"
                     /db_xref="GeneID:5650627"
     CDS             complement(303878..305686)
                     /locus_tag="LMJF_16_0810"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682160.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650627"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QET8"
                     /translation="MPPPSNQFLVGQRARRLHVNRVSRFFFAQLDKGFASPYVLLASG
                     VFFSYLAWRVTEHYVRPRQEQLARRRLVQRVPFESSHNVFWGLANPGEAVVSAAAGHA
                     ADVEDVASNLFLPQSVNEGQEEAMRRPQLLFSEASELHERPSAGNPSGEVDVVCLELS
                     EFSPTLRDDVYYRSVHYVPAQGSSAAASSTEYYQGSSPKGSRQASSNSDSSWKSMMSS
                     GEVAATCSGASAVSSGTASPPTTAEVEKVTSTTDYLQFMPGQGEEVIHGMIKCRGVTT
                     QNNCVPYAGHLEQEYARKLMLTLGPVHILRDATQTILPRRFSFVKQVPVETLVLGLHS
                     GEMPRWLSTCYPNFNVHVVEKDGTLVRLCKRFLGFQESSNLTVNVDDPVEYVRRQAVM
                     TAHGNTTDSEVKPYELVLIDAMDGAGRLSTQYGRLEFISNIRRIMSNNGCIAVTLPNK
                     DAGFVFNMVQNWRMAFAGRPVVLVHCVTSPCTILMTFQDTATRGKANIGSVAKVEEFQ
                     DVLREHIRHYGADRVQFDITREVSASNFSVLNPEQTYGIEAYLPAGHPAILAARHQEV
                     QEAMLRKSRSQGWGAWLRRITRTALSVSQRSDLDGH"
     gene            complement(<306505..>308538)
                     /locus_tag="LMJF_16_0820"
                     /db_xref="GeneID:5650628"
     mRNA            complement(<306505..>308538)
                     /locus_tag="LMJF_16_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682109.1"
                     /db_xref="GeneID:5650628"
     CDS             complement(306505..308538)
                     /locus_tag="LMJF_16_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682161.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650628"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QET7"
                     /translation="MCEAERVHPLLRYVLRRCVCALTRTHAREHTHTQQQRKAAVFSV
                     MFILRIAGDVDGFKRNVEVSFPHRPSLQQVCIVAETILPLQERSGRRSWHPTWAAATQ
                     DAGDDTASTAASFIAPVDASPRAAALAAIYTVESLVYLNRATHEWEGLYSASQLTSGS
                     QVYCFFPLQHRRVAAAMGRGSSSALPSSSSAFPVREEYVNEAESPSLQAYASLPIRTG
                     VQQSRADPDRPGAIPAPQQRLVWDCASGVRGGVRPRRKGVDGGFSHVDSASPSPMQAS
                     VRSSSDTAHGFAAGLRRRRASSPFSSCSRRLSSLSPSSAVPFGASAWPTLSPTVGTAP
                     RAVDRARSPSFRSAPTFPTPPRHVGADFVRTTSLPTRKDCRGLVEAQAQKASPSRRHS
                     TLSWLRDDCNSSLSALRQGWSALLLSSEGGRGNRYAHLGDRLALLFDVLVHLDPQEDG
                     AGQRQYILLRNFYLLAARFASTFTAAAAPPCPTYASMSAYGTSISSTVMNITAELDAR
                     LHWTWNDVVRHADKDRDGCIAYREWISFGIEHPEVIQLLCRAVHALLLGEAASSGSHY
                     ADRHASPGAQTPLLAPSDHFFYHSTPSMGHEGDRTRNSNAELFSSVLQCCRMHQGQTD
                     GINADRGKVMRAAEVHGRHAKRYEACRELHAELSEDCRSRVSAQASIGFALRR"
     gene            complement(<309788..>310669)
                     /locus_tag="LMJF_16_0830"
                     /db_xref="GeneID:5650629"
     mRNA            complement(<309788..>310669)
                     /locus_tag="LMJF_16_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682110.1"
                     /db_xref="GeneID:5650629"
     CDS             complement(309788..310669)
                     /locus_tag="LMJF_16_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682162.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650629"
                     /db_xref="GOA:Q4QET6"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR017870"
                     /db_xref="UniProtKB/TrEMBL:Q4QET6"
                     /translation="MQTSLLGRIGGAALCPKRLFQSTAAASAGTTTAAAVNSSRSSDG
                     GANASASSDTSSHTQQLYKSFHKGRGTTPIPKSYKEPTLRSRVAPAGEADAASSATAA
                     AEALPPPLVGARSSCAEDAGPVPQRALSPLQKRQLQFRNKAAFVLTPQALRRVKYLLA
                     QQSIAHSAAAAKSPLPSDASDEVPCGIRIGVRRRGCSGYSYTVNYYFDSAQRSGKGAT
                     PSSKMTGLMEDLVVEQDGVKVVVDADAQFYVIGTEMDYVITNVEEKFTFKNPNQKYNC
                     GCGESFMPYDADDMDTG"
     gene            complement(<312022..>314427)
                     /locus_tag="LMJF_16_0840"
                     /db_xref="GeneID:5650630"
     mRNA            complement(<312022..>314427)
                     /locus_tag="LMJF_16_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682111.1"
                     /db_xref="GeneID:5650630"
     CDS             complement(312022..314427)
                     /locus_tag="LMJF_16_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682163.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650630"
                     /db_xref="UniProtKB/TrEMBL:Q4QET5"
                     /translation="MSGGSTALKLQRLLEAEGAVIHSALQVRALPSMGGGMGVVLTER
                     LAAGAVLARFPFRSMITARKARFNLAMAEVALELLEGHVATASTNNGSEGDNGSAGPC
                     AATDVLHVIPFASRVWSEYEFETRVRSRRLRQLIDAKVEELAGALDSTETIVCYVLLM
                     AALYGRLSKHARLRRSGADDGAADEEASVSGTEACACGDEAGPAPTLHYTHENAWMRT
                     WIHALPAQYDNLLELVPVPEDSPPCLAQHGTEPECAARAPSVLSGNATTASPPPPLLA
                     RVSAYTKSSGWLRSYISLCRFQASVAREQQAIQRRHAKCCAALRCLQRLPRGVEVTEE
                     LADAGHGAAAPQNRVFASCGSSPSSSQQDCGRHDHGAACTLGQFLWAFNTLMSRGFYF
                     PEATWALMPFVDYFNYALESNGTMYPQEDDPEDPGCFTNLLLAKTSRNGIGSVAPLMA
                     AAAPRKQQWRTALRTARVGKAAVPLANYQTYEFQLVRPTCPPSEQVMLHYGAYSDVEL
                     LMWYGFTLRPSLLPAPQLAAAPEGRKKGTIPVLPPCLSDADGSLLHAAHGLRLALSQL
                     ASATTRVAYYRRWVAPLHRCDGAAASDADAAAACKTWLAALHCAYRLPLSPIANAEGK
                     YPEATPGATWLDELLSAFAQTPAVAAPCTDAASEDEAAYRIDAWMRRWGSERWPGFAA
                     SAFPNITKGCAFGVLGLSPVLRAAVHSSFWTPTPERSSLSAGERLLVVRGLAWAELYV
                     NMTAAAHADGWTTSSVPASAAAAECARTMSVDQWTLLRFLALESTDAALEEYVEYVSE
                     SEG"
     gene            complement(<315436..>316872)
                     /locus_tag="LMJF_16_0850"
                     /db_xref="GeneID:5650631"
     mRNA            complement(<315436..>316872)
                     /locus_tag="LMJF_16_0850"
                     /product="putative metallopeptidase"
                     /transcript_id="XM_001682112.1"
                     /db_xref="GeneID:5650631"
     CDS             complement(315436..316872)
                     /locus_tag="LMJF_16_0850"
                     /codon_start=1
                     /product="putative metallopeptidase"
                     /protein_id="XP_001682164.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650631"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:Q4QET4"
                     /translation="MSTSVASPAQRSSGQSQWSLSTPVSSGPQHKLCSSVPIVSDAYW
                     TPDFAHMETARQQKPWRFDSLFFESVSVSLAATVKMFLHGTRGCPDMSQGRFNWFEVM
                     GLLIGHFSHRELILTDSFSLPVAASEVECSMTEASQIYMANYLEYHRRLGKAEPGCLG
                     WYHTHPGYSCFLSGIDVTTQQGSQQIQDPWVALVIDPVKTLQTGQFSMKAFRTYPGGD
                     FQGQRSRSASHSAVDGAHPAASPANATAFTMPDEYGIPPSNRVKEFGMHAHRYYELPV
                     RIVQSARDAPLWELLQRHFWPLSLSLTFPFAPSTRICHCCSAELAKVVSALGARAQDS
                     CTRERSPLACDGFSRGCVGSMPLLYQSSKVVGSAQACSGGDGSADADDVAEMEQRLLA
                     ITGEVLRVRAESFSLIGASHPVHAELLAAMRAVAAAAEPATTDKRHSCTSLEIARNAR
                     KEASFSSLFTSRCDDPMEEEEEEEEEEG"
     gene            complement(<317921..>318697)
                     /locus_tag="LMJF_16_0860"
                     /db_xref="GeneID:5650632"
     mRNA            complement(<317921..>318697)
                     /locus_tag="LMJF_16_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682113.1"
                     /db_xref="GeneID:5650632"
     CDS             complement(317921..318697)
                     /locus_tag="LMJF_16_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682165.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650632"
                     /db_xref="UniProtKB/TrEMBL:Q4QET3"
                     /translation="MLVVLDVKHTRAQPWPRTSPHRLAHAYSCLIPRTMPVINTPFFM
                     ELCPGEELKLAQAPSAALSTSSSAASAHTTNTFAKNEFHAMVSGVAFVEEDVDDKGAA
                     TAAAAASKPHHKHSVIRVSLLAHVQPPPQGSSTEHFLKTVTLASFNFSSDAFPNGDAS
                     NAASWERQGKARGSVSSLPSTVTRVESTVQFRSPLFFHSSGSIQSLSVVAEDMATTAG
                     SSGSSGSVKRYQGPRRFGVRLLGVQRTFLTEEQVLMLAQR"
     gene            complement(<319928..>321982)
                     /locus_tag="LMJF_16_0870"
                     /db_xref="GeneID:5650633"
     mRNA            complement(<319928..>321982)
                     /locus_tag="LMJF_16_0870"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682114.1"
                     /db_xref="GeneID:5650633"
     CDS             complement(319928..321982)
                     /locus_tag="LMJF_16_0870"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682166.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650633"
                     /db_xref="GOA:Q4QET2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4QET2"
                     /translation="MSSSTGGYGEFYQRSDERNELASSREKSENAAYGWPSEMLNACT
                     DVSAPQSPYQLNAHALPPFAPSPLSRPASQSAATQQRSEGTPLQAEILPKHGSSLRAH
                     TTTFPSTLSPVAPSLGSGELSSSPFPHLHSDTYERPLPPEALGAWQLVDYIFTPHCPG
                     RPHSSLSPPFIVPRPSPREIGWPMPLLAEPVNPSSGRRLVFFGKGQQPQFVLGEKKNR
                     FIAVVFKPILSAAAAAVVSAAPELGDTSTTTGYASYGTVLGYSDDNTKIVWHDRSERF
                     ASYVSLSSIQSIHRASAMQCRHCGFVLLKQELREHMNTHKKGSGVEYGVFTDDESLGM
                     LCGDSGLMQNLASPRRLGEGAQGVVDLMEVVQPTTEEVAQAGPSSAAYRFVSEHLSHE
                     SRLQKVVLKSMHFSSEAKALVEYQKSVRFMTVMQHPHLVEYLAVQLKPDRRTVGICMP
                     YYQEGDVGAVIRSFRGDRFDESFVCSIALQLSLALAFLHERNPPIVHGDLKVENAMFY
                     NNKQQIVLTDLDASREVLGGYQEAVQSSLGTTAYMAPETLKVERLMPSSDMWSLGVFL
                     YVLTVLPDFPMLLNPNTQNLDLLNADCWATEEDLRAMESYSSALNDGRSNAPSVNAGS
                     GNCGITLGECVRANITRKGYSRDLAQLVVDLLSYNPLKRPTAEAVGCRLTEIMTDHLL
                     EF"
     gene            complement(<323106..>324014)
                     /locus_tag="LMJF_16_0880"
                     /db_xref="GeneID:5650634"
     mRNA            complement(<323106..>324014)
                     /locus_tag="LMJF_16_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682115.1"
                     /db_xref="GeneID:5650634"
     CDS             complement(323106..324014)
                     /locus_tag="LMJF_16_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682167.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650634"
                     /db_xref="UniProtKB/TrEMBL:Q4QET1"
                     /translation="MHGFLVHGQASRGLMSAEVKKGYTGCRSYLMSAEDLGKGGRLTH
                     SEILIANEAIIKQRREGVQVSEEYVRRLEGQARSTCLESVLSRSVEAARARCRETKRM
                     RTWVSWSTQTLSKSSEPARVAQASYTMQTLVVVSAIYGVAFNERGMTPAENRDTALTL
                     KRAFDCLLNSGVALARAHSLQCPLPGRADDGPRGPDVFNREQEQETRARQEESTRPQN
                     GWKSGCRFGHAMEARPCRPCRCAAHGQRLFFRFFCLLELRLTFIWMAPLPSLLSSRAI
                     FKQSYSQRGATSLRDYPSMREPWPVA"
     gene            complement(<325556..>327544)
                     /locus_tag="LMJF_16_0890"
                     /db_xref="GeneID:5650635"
     mRNA            complement(<325556..>327544)
                     /locus_tag="LMJF_16_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682116.1"
                     /db_xref="GeneID:5650635"
     CDS             complement(325556..327544)
                     /locus_tag="LMJF_16_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682168.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650635"
                     /db_xref="GOA:Q4QET0"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:Q4QET0"
                     /translation="MKIKKKDLRKREAQLPINYPDPDVLPDSLPGGVIDLESEMVQVE
                     ILCKRLAHNEVAVRDAVLAEVPHYLERLTEAMATMEKTYEAEIAEVQAYFKAHPKTPN
                     PYRYENLPLALQQYREKVAEQEREDRRRVAMREFRHRQAQERRDKELYGRYDNPAGDF
                     AANNDDDAEAGLNVGPKPAHVYQSENVHRERYQTWMEAWCDVELVLLKLCRGIHYCLW
                     HSDKPLVQLACAQKIADLLHAPRTTRCKVLFYGCLFRVLAREWPTIDRYRMDKYLALV
                     RRMVFAYVKFVKDVHDGDASAPSAGASPAKRESEAAAALRSPTERSKKSAKRSRDDEA
                     AVAEPEDGTAALSALWKTAAGVSQAALHKYVGTVTATANVVGEIFYILQRQIFSSSTS
                     VGLTMHICDVAFDELVRAELGTNLFLVLSAGIPLHAMSQGNYVEKRVLDNFFPPLAGG
                     VYAQRRAEQLAQAMAAKVPATQKRASKRNGNGDTTASPEAIEALAAEQAAAEARTVMQ
                     EIAFFCRKYAVARGVAHEVRPMFSEAELIMRQSADPESFRPLTHTAQRRRIERELKEV
                     DGTREKVRSELQAMREMKKQDRHAALKEKVKARVAAAVTEKGDRAAGVSKAVLRKQII
                     AEEMRAKRKPVHNTKRKKAYHLTKQDLYGDADAQGDRD"
     gene            complement(<328676..>329572)
                     /locus_tag="LMJF_16_0895"
                     /db_xref="GeneID:5650636"
     mRNA            complement(<328676..>329572)
                     /locus_tag="LMJF_16_0895"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682117.1"
                     /db_xref="GeneID:5650636"
     CDS             complement(328676..329572)
                     /locus_tag="LMJF_16_0895"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682169.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0895"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0895"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650636"
                     /db_xref="UniProtKB/TrEMBL:Q4QES9"
                     /translation="MPQKMLAESLPLFRAARHRSCDVIPAPTQRRNPFIVAVGSSCGV
                     QRAADGTASPFISALAPSVCQRSKTCSVPTAHRQLFSSRSAGPQRPSEQRCGGSRRLS
                     WRTHLSQLLSEEQITRWRLRCEEQEERVEIALAKPSCRVVFSQVDVAAARSALGQGDE
                     RLGCGAYSRPHLPRSELVCATANEAHSLRAGRRRIKTKKHYSSGRRGGLQEHPTSETQ
                     NTASAPGPLYVRDSELLCALQRAEARIKQLEAGIVLQASAPWDKENTMSASSSTMAKP
                     QASAFLDTIHPFLPLSPRLETL"
     gene            complement(<330529..>335496)
                     /locus_tag="LMJF_16_0900"
                     /db_xref="GeneID:5650637"
     mRNA            complement(<330529..>335496)
                     /locus_tag="LMJF_16_0900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682118.1"
                     /db_xref="GeneID:5650637"
     CDS             complement(330529..335496)
                     /locus_tag="LMJF_16_0900"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682170.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650637"
                     /db_xref="UniProtKB/TrEMBL:Q4QES8"
                     /translation="MGCTSSSLSFRDVYIDLQQRWGLDPKLYGVLEPNGVRERSSVFA
                     SCASSTARQASQELVLRDGRLFVCDSLLVEQAPLLKHPLFHGEGKGTLHPYTAVLFRR
                     LLSAVSAEHARHAAAEVFSVVRDGGFIARWDFRVWMMACCEFYHVLAILQEQKALPKE
                     TKTFMKALTRSSEHSTLLHSTEGTVLSQDTLEKVWRDGSAVQLTTSTLGAPVMRELCS
                     QMPSVLACAPKGESSTAASTSGDSLAPRLIALAKEYEKRVLSMTGRQSSNPLRSCDNA
                     SAPSSVPLLVFAEWAAMECALSFCGQEEDFASYGVTPLPLSLVLAQHENNVRQQWRAR
                     LLHLSEVKSELAELEPFDHLSGAYKQLLAKAEGLEREVEEQVARWRRGREVLTAEDAE
                     DMCWHLLEIWESLPNRTVHQILSRKAFECAAGADGTIATTGQLCQYLRYYLALHDLYR
                     DVLFHQLKGSEVGGLGDGLCLPRHLDFDTFRTALVAAQARHDADIEPLLGAAAGCGPV
                     TPALVLDVMRQLFDSVADDDAKDGVKGVSFDALCAMVLQNLARGRRVSPSLRSIDELR
                     RALGMNETKQQSAFTASFLRQVSTAHQDDFSACSPLLATKALEAAAELPQYTNHSARV
                     AAMAVRYASLDPRCWSALSASDDVELAALTRWLYRLRSESLDRFSQTEDSAHMEFAVR
                     TLFCFAAAQRGIEDTAPGAEKSVNYDVCFDGVQFSATRPPMTTDVTQSHFVRAVAAIC
                     KYLECPAEVLLNNAQALLLPANSAADVFITQAVNPTFTIESAFRFFQSVSHSTADWHG
                     CDDEVEEQNAQDRKQTARVRHILFVMVFNYTRQHCFRYWKNHKRYDDDLDASLSAAKD
                     GSDADYPKWDGESELLALSRAMPLRTLAGCYRVFAELTEQEAQHSGPAESASGRQAAF
                     LHAFYEQYMLFFQRLHLDEDHVTEVGVRALQFIASQSGRCSCDTGDLGITRRDFSSFL
                     QFVLGHLLVETAYESTVQATSEARGVAQDGPVEVLLSEQDFRRLLACFGRFTKGGVSA
                     IPTIEEAHLWLRSHHVDNTYKGFISLQNVLLWYSSHRAEHYALESLYDWWRESHAQRI
                     PFTMSVEHRRERKSAMREILRIKQHREDLPESYPVEASEDEDGYLPVEITSSVLERRW
                     SVEEITTRVFGMDEKPTAEATPPGDGGEAQASSLSLAVPLWLDSCECGCNAALHPTDP
                     YSRKVHRGEFRFLLEYVHHFVSAYVSLNYTLTLLEASSGAVSVEGSEHGSPSTPAAHQ
                     AKMTELLSESLLLLLPLTIVPVELSSMLSGVMADVWNDMQTTGVVVDATYRRSAHSIA
                     AFLVGRSYLIASRARKSYLQGIGTQDLCETLTTQDAVVGALGAYDVYAKLSYWERLRI
                     LLPFGPSLQRRQRRREFFMCMDHHRRGYLTVSDIARGLMDMVQLQSFRADFTPALLRA
                     FRATKDVAGERQNVVYLTQHTEEQVLMPWELNAFLEYLYRYLQLYFMFDVLTCGGHIH
                     PETLHVVQKQQRCGTADPDEGSPSGESVGARMSKRADYAADAVVAAGGATAAPHTRSA
                     AVALYEASMQPYQIALEAAPMKKEVSLSQFRMARQLLSRWGAHVENPVEVFQHVDRQC
                     REGGKLLFNGFAIWASEQDLQPEGNDYGYDDSIDAIAIMEEYATQ"
     gene            complement(336766..337290)
                     /locus_tag="LMJF_16_0910"
                     /pseudo
                     /db_xref="GeneID:12981425"
     misc_feature    complement(336766..337290)
                     /locus_tag="LMJF_16_0910"
                     /pseudo
                     /db_xref="GeneID:12981425"
     gene            complement(338304..338807)
                     /locus_tag="LMJF_16_0920"
                     /pseudo
                     /db_xref="GeneID:12981426"
     misc_feature    complement(338304..338807)
                     /locus_tag="LMJF_16_0920"
                     /pseudo
                     /db_xref="GeneID:12981426"
     gene            <344504..>345166
                     /locus_tag="LMJF_16_0930"
                     /db_xref="GeneID:5650640"
     mRNA            <344504..>345166
                     /locus_tag="LMJF_16_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682119.1"
                     /db_xref="GeneID:5650640"
     CDS             344504..345166
                     /locus_tag="LMJF_16_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682171.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650640"
                     /db_xref="GOA:Q4QES7"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q4QES7"
                     /translation="MGFRESKPKLSQTAEKPEKSQITPSDKARLQLKLQRDNVQAAIR
                     KYERVALLEHEKAKEFMRVGNRRKALYCLKREKAQQSQISVVTDMLDNIQHLIDTVEF
                     SQIQREVVAAMKDGKCELDNLNKMLDIDDIERLMDEASESIEEANQINVVLSQPLAGL
                     PDDDELLRELEQSASTQKADQELPNLTVPTHTLPQRESKFKGKEEVNEQYEDAVPARQ
                     YA"
     gene            <345438..>345776
                     /locus_tag="LMJF_16_0940"
                     /db_xref="GeneID:5650641"
     mRNA            <345438..>345776
                     /locus_tag="LMJF_16_0940"
                     /product="putative dynein light chain"
                     /transcript_id="XM_001682120.1"
                     /db_xref="GeneID:5650641"
     CDS             345438..345776
                     /locus_tag="LMJF_16_0940"
                     /codon_start=1
                     /product="putative dynein light chain"
                     /protein_id="XP_001682172.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650641"
                     /db_xref="GOA:Q4QES6"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="UniProtKB/TrEMBL:Q4QES6"
                     /translation="MDTKVKEPEGPCNLEYVRRYTQSLNYPLEKTSDMSEEMRVDCKE
                     IVVNALEKHEDSYEMAAKYVKEQMDKKFGPSWHCVIGEGFGFEITYEVKHLMYMFHRG
                     FIAIVVFKGL"
     gene            <346095..>347489
                     /locus_tag="LMJF_16_0950"
                     /db_xref="GeneID:5650642"
     mRNA            <346095..>347489
                     /locus_tag="LMJF_16_0950"
                     /product="sucrose-phosphate synthase-like protein"
                     /transcript_id="XM_001682121.1"
                     /db_xref="GeneID:5650642"
     CDS             346095..347489
                     /locus_tag="LMJF_16_0950"
                     /EC_number="2.4.1.14"
                     /codon_start=1
                     /product="sucrose-phosphate synthase-like protein"
                     /protein_id="XP_001682173.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650642"
                     /db_xref="GOA:Q4QES5"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:Q4QES5"
                     /translation="MAKEWLIFALGTNNWQGPGQFAPGSGILHQGQHIAMNSLEKCHC
                     YSIWPSDLQKTPTDRDDYRVYEIPHPIPICESVGPQSSKRWHSMTDEEVTSYCDNLLK
                     ECTDFIEYIEKKHGKRINLFLAHHCFMNPVIMSEINERRVAQGIPKVPLVVFAHGTAL
                     KMYENEINKLPEFPMKYYDWIRGTKNIFESTGHVSGVFAVSAPQKNSFEKLFPLFPQE
                     RVAITPCGYNQLVFHRIQGMTREKAFGHMPQALYDGFDATQLSPVQRHVASDQCIPDV
                     NAYDRVVVFCGRFAHWKRIDSVLKAASRWEKEDKRILTLIFGAGSQETRKLYVDMAYQ
                     TLGLKDTFFLGPQSQPDLANVYTVADVSVFPSHDEPFGLVFIECMGCGTPVIGAKSGG
                     PLDFVNDEVGALVDEGTNDEVAERVYAAVKQALAEDWKKTKGAQCEQYALKKFSLASQ
                     AELMLEFVESHFTK"
     gene            <348061..>349527
                     /locus_tag="LMJF_16_0960"
                     /db_xref="GeneID:5650643"
     mRNA            <348061..>349527
                     /locus_tag="LMJF_16_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682122.1"
                     /db_xref="GeneID:5650643"
     CDS             348061..349527
                     /locus_tag="LMJF_16_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682174.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650643"
                     /db_xref="GOA:Q4QES4"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR027034"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QES4"
                     /translation="MRLLSKVIVGTTCVTVFCGSAYVAAITLAPPPNYTVSNNDRLKS
                     YDKLSINNLYEKKTKCQEFYLGLSRWRRKMLRDEGLLRGRVLEVGAGCMGNYAYYPHK
                     YFSDDPEVQRHLRGMMGRRDDTQAAGSGDNSTSYMLQHIGKENPCDEIVLCDRSAGMV
                     QSCIAKIQSRLGYAPYRYPDYDIAGIRNSIEARVRTQQDARRLGPDSADKAALRKRKI
                     VREDGTVQEVLVTPLSGTEEEEFLEATSSQTNLAGDAIIVPVLQALDTGDKLPLLSKE
                     GEATLARREREVQARGEFRRQVESELQREERLSMLKRGRADVSAANASTAEKNRLVEA
                     PPELRGGNRELERQPLFAVANYAAEQLPFPDNSFDTVVDMFGLCSFDDPVRALRELSR
                     VCKPGGKLLLIEHGKGHSTRVNNHLDKWAPQHAKSWGCWWNRDIRRVIRLSGLSVEKW
                     ESKHFGTSHYIIAKPYKSMEEWDRFELQRKQQATKAAV"
     gene            <350235..>352520
                     /locus_tag="LMJF_16_0970"
                     /db_xref="GeneID:5650644"
     mRNA            <350235..>352520
                     /locus_tag="LMJF_16_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682123.1"
                     /db_xref="GeneID:5650644"
     CDS             350235..352520
                     /locus_tag="LMJF_16_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682175.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650644"
                     /db_xref="UniProtKB/TrEMBL:Q4QES3"
                     /translation="MAVAYPSEEDESVLVGFTEFFTQQEGVHALLRITEQDVQTVRSA
                     CSSVLAHLSSTSRLILASVPLNQAEAAQLVMGNNGRDTAYQVGSVYPHVLQHSSPMGY
                     NITLSESAGAAPPLLHHPKSFLGSQLDAIDFMAAELESAKDTLLSLNARYAYLWTTNV
                     DELRRYIAQDDRRQKMQQPMWKHAQMRAAPIEEETQKRPAHSPTDEVGLRDAAPQQGD
                     AQGITERAPKKDPQAEAPSESSAQAPTYRTLLALDPSQLPSKQVQRSFMKFIQACLSL
                     LEWTDSVLGLLSGRDDVPKAGTFEVSGQRESSQRRVDTAREASEQRPTNQATTSAGGR
                     PGTKTVRVFRYEIRDVSHIYDMLYQQAECFYLPEYALYDARIKQRLLHPSYYYSLRIL
                     IEDATTEMTRLEHITASRADLVRADAGQSPFEAYRRGAFVPYPEFLGMRVSPSLSAVH
                     DRVALEGGEPARIVFRPALPQFAFLRNTLRVLLSVCINEDDRTSFKRYEELYQTFVGS
                     ARDAVVELQHLPKPPPPLLEPAAQSMFGHRLAWTAGRPHFELVLVSDESSAQEARSGG
                     KVAWVISAEDRGRLHAGFEAYWELRDGVHSLKLSLDKDIRRKDKTHRTRVLDACVARE
                     KDLVAIAALERERELQEAELRSRRESGGWLGAARASLRSLAGIATCKAEVQMEDLGIP
                     TAPERDDAGADMTTTSPYHAEKTLLQESVNRLWSAVEAHGVHMEREYPGLFYRSERQR
                     WARRVSSLIEKVNAVGVVFSP"
     gene            <358015..>360210
                     /locus_tag="LMJF_16_0980"
                     /db_xref="GeneID:5650645"
     mRNA            <358015..>360210
                     /locus_tag="LMJF_16_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682124.1"
                     /db_xref="GeneID:5650645"
     CDS             358015..360210
                     /locus_tag="LMJF_16_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682176.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650645"
                     /db_xref="UniProtKB/TrEMBL:Q4QES2"
                     /translation="MVSENAMAEKSKAAEDATRRKKELLELLDREREEKSYIMADYRE
                     QTESLIAEQGREITYLRGALDKLKGEYDDLAKQHQVVEEELEGLQEKVESVTAQLDKE
                     RSDAAGKTKDLQANMQQECQALIEQLAAMQEQLQRAATQHAAKQQALTDQLQKGEEKQ
                     RLTEEEYQCTLDTLKQAYRRDTDSLREELNRLKETHSKQEEELRHDLEKAARRESRSV
                     EALRQALEQARQEKELSVEDGFKQREVLQRQHRDKVVALQKELDATVQQLTEEHEARK
                     DREADVEVLRVRADNLEKANQRLSNELETIQADQRSRERSTEQAHQAAVEAMRTKLRT
                     ALTDLGYAQDQLTQQAADAQQLRDELAKRTSALEAAKEKIVMLERASADELGKAKDTA
                     AQREKEAAQVITQLRTSKTQLEAACEQLERQLRETEGRVQGTAKQVSEERRSLEEANR
                     RLQDARVEVEDLRAVVNHERERGTFLQEEKRQVERQLAEEKLYREELENQLHMAERRL
                     QEQQQDHARQLQQMEEKLEEQVQRHHAELAASRIAAEQVRGEVGRAREAIVEKETALQ
                     QMREEVGRLHREAAMREGGLKEEMEDLREMHEVEMHRMDELLNGLRSDLAKSQATCTQ
                     YQRELSQMHQSSAGARSDLEMALEQADAVRAKLLEDAKYREQLNQELQGTVRLLSSRL
                     TSNEEEVRRMQEELADTNKRIQDAHTLIGRKDAAIGQLNAKLRAYESRH"
     gene            <363575..>364975
                     /gene="CRK"
                     /locus_tag="LMJF_16_0990"
                     /db_xref="GeneID:5650646"
     mRNA            <363575..>364975
                     /gene="CRK"
                     /locus_tag="LMJF_16_0990"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682125.1"
                     /db_xref="GeneID:5650646"
     CDS             363575..364975
                     /gene="CRK"
                     /locus_tag="LMJF_16_0990"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682177.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650646"
                     /db_xref="GOA:Q4QES1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QES1"
                     /translation="MSTAGRYKHVVKLGEGTYGSVYKGTEIQTGKVVAFKRMVVTSDD
                     EGVPGAAIREICLLKELRHDNVVDLFEVLFDPPKITMIFELCDCDLKRFMESRPKRLL
                     DAEAEMRPILKQIFIGLEYLHSRSVVHRDMKPQNIFVNVRAPDFAALTASPSSRQDHL
                     QPPPFSGVPTAVGGDAQSAAGSGGRPNPFAGVDSVPPREAATAPSNTPNQLIVKIGDF
                     GLARVEEIPVKKYSHEVVTLWYRSPDVLMGSALYSYPVDIWSMGAIFFEMATSKVLFS
                     GLHEDEQVLRMFWLLGSPTRETWPSMLSYPGTMERLERASRAAAERPDLRFGSDVCVQ
                     QQPPSSQSHSGSRAPDLLTQIAHKRFYHSLKTIQQREESARSSANTYQLPVELWFDRP
                     LFGEYMSATGFDSCVTAEGVDLLRQCLLYEPNHRITAAAAVRHAYLHAVPVPTAGALD
                     VLMTSLLQTMEACHLL"
     gene            <367387..>369825
                     /locus_tag="LMJF_16_1000"
                     /db_xref="GeneID:5650647"
     mRNA            <367387..>369825
                     /locus_tag="LMJF_16_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682126.1"
                     /db_xref="GeneID:5650647"
     CDS             367387..369825
                     /locus_tag="LMJF_16_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682178.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650647"
                     /db_xref="GOA:Q4QES0"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QES0"
                     /translation="MEHRTLTCASVPGICSSPTDLATGAEAVSNIAKALHPSCISVLD
                     SQDRRTARPAPVFEDAARQYEEGEHVPEEPHLLPGLQIRRRTFTPAELLERFGDTDII
                     YSFVNGSEANHYYRKAMSMWCLPQLRDLENATYSEGGRLPPALQSIVASNTPACLPPY
                     LQNAYDNLHSTRDFVATVASNARPGTDDRETDELRHSLRSVEQHVRWHRGRVVMVSPG
                     HHPTWVDGAKNFLAGVCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQ
                     HLWRVRNVTSVHVYMNDDYFVNRDVAITDLLNEYGGTIVRTERGILQKGVLGSPSGGT
                     WSEGVRNTHLFNIMELDLQHEDYLLETLERQWSAERVQRGASGVGDPVPPIALNDMVD
                     AAYAHVPASRPPTALPRRHRRYATHAPFVCCTNMHRFLQTRYAAELAYNSLHHRRRSV
                     RDLYVPFVYNAFIMARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGP
                     ASLRGGFIASECVFAKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEAADQLRRFL
                     HGKFPTPVYLEVGGRTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRS
                     LALAFAGHHRGGVRVSVEQHGGATLREARAALGHRVVSAMPAPACTYKEQVSVDPAAR
                     GESVAEIARRAMGEMRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDAL
                     AVPAQTLSLEDFRAVAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVE
                     AYEDMDAEVRWSVP"
     gene            <375066..>377846
                     /locus_tag="LMJF_16_1005"
                     /db_xref="GeneID:5650648"
     mRNA            <375066..>377846
                     /locus_tag="LMJF_16_1005"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682127.2"
                     /db_xref="GeneID:5650648"
     CDS             375066..377846
                     /locus_tag="LMJF_16_1005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682179.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1005"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1005"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650648"
                     /db_xref="GOA:Q4QER9"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER9"
                     /translation="MLPSAHARSGGAVGASTAPKDDMMVRAPQDEKLRRQGQWTGTPR
                     TPAAERRTSSTTTITGANKTSASSSLPPPVMPVGGVTPALPDALLHPRSKTSAEPPAA
                     GPLTAFEASKTAHHAQATAPTRIVTAGFYPAPARPWVHRLPPQFSPAIKRPNLPGVQA
                     QYAPEKPHLLPRLQIRRRTFTLAELLERFGDTDIIYSFVNGSEVNHQYRKAMRRACME
                     AILAIESTSYVKGHTFLTPRTNPPEPPTTSSTRAPVNPLEALLQSLHCAPEFLTGTQN
                     PVRTTNDVLQAVKAAARRGADNRDRETDELRHSLRSVEQHVRWHRGRVVMVSPGHHPT
                     WVDGAKNFLAGMCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQHLWR
                     VRNVTSVHVYMNDDYFVNRDVAITDLLNEYGGTIVRTERGIIAAGAVADGGASWAKGV
                     LHTQQFNTQELDVLHEDYLPEALVTMWDSLKRVNRSASAAAVTSISVPPLDEAVDVAH
                     QYEPDPLPSKSLMPRRPRRYATHAPFVYCTNMFRFFETRYEREFAAAALRHRSRKARD
                     LFIPFVYNAFIMARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGPAS
                     LLSGAAESDCVFAKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEAADQLRRFLHG
                     KFPTPVYLEVGGRTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLA
                     LAFAGHHRGGVRVSVEQHGGATLREARAALGHRVVSAMPAPACAYKEQVSVDPAARGE
                     SVAEIARRAMGEMRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAV
                     PAQTLSLEDFRAVAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVEAY
                     EDMDAEVRWSVP"
     gene            <378924..>381788
                     /locus_tag="LMJF_16_1010"
                     /db_xref="GeneID:5650649"
     mRNA            <378924..>381788
                     /locus_tag="LMJF_16_1010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682128.1"
                     /db_xref="GeneID:5650649"
     CDS             378924..381788
                     /locus_tag="LMJF_16_1010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682180.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650649"
                     /db_xref="GOA:Q4QER8"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER8"
                     /translation="MFQVSSSGGMRKLPGKHNSPIAVSVPGGLTRVASARQGKRRASR
                     VFYVGCLSAVALMLVCACVYYLALSEGLENSIRLAVADQPTARENFIANWMKEMAARR
                     EQKWTTSPPATAHGIVERGKPTTSSTTPTPTAAPSSPPPMATPPVLTRDEDTPTLYPD
                     IDKPKPEAPLSQTDFPEATPFTTAATVDLRTVRPDMYELDGAQHTDHGEHVPEEPHLL
                     PGLQIRRRTFTPAELLERFGDTDIIYSFVNGSEANHQYRKQIHRVCMQAILDAESNAF
                     HASILAPVSAYHNDAPRCLPNFLWSHIGPEKTAADLVRAVEAAARHGADNRDRETDEL
                     RHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDGAKNFLAGMCGGARVQALRSSGTHLRV
                     TTVHQDAVMPYGMRLTVDSHVIEQHLWRVRNVTSVHVYMNDDYFVNRDVAITDLLNEY
                     GGTIVRTERGIIAAGAVADGGASWAKGVLHTQQFNTQELDVLHEDYLPEALVTMWDSL
                     KRVNRSASAAAVTSISVPPLDEAVDVAHQYEPDPLPSKSLMPRRPRRYATHAPFAYCA
                     NMFRFFETRYEREFAAAALRHRSRKARDLFIPFVYNAFIMARPWQASPKFLPYLLELH
                     RSRRLGRTDAMSPTQIVLDNEDGCGPASLLSGAAESDCVFAKFLNNLTLNEAVVERVR
                     QVNPLYFNINAGFSSAEASDQLRRFLHGKFPTPVYLEVGGRTSSAGAAAAAEEGALSR
                     LFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGGVRVSVEQHGGATLREARAAL
                     GHRVVSAMPAPACTYKEQVSVDPAARGESVAEIARRAMGEMRGGVELPWTCGGGGAGL
                     RVRGFVVDARTRGAPVRSAAALRDALAVPAQTLSLEDFRAVAVGPSEGDVVLVVSRED
                     AEAQAVHWVNGASESDLLLTYPLPVEAYEDMDAEVRWSVP"
     gene            <384128..>386704
                     /locus_tag="LMJF_16_1015"
                     /db_xref="GeneID:5650650"
     mRNA            <384128..>386704
                     /locus_tag="LMJF_16_1015"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682129.2"
                     /db_xref="GeneID:5650650"
     CDS             384128..386704
                     /locus_tag="LMJF_16_1015"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682181.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1015"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1015"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650650"
                     /db_xref="GOA:Q4QER7"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER7"
                     /translation="MRSGTLAEDLEARGDAINKQGHPNSTRVTEEPFSAATVAVVATS
                     TEVPLLSLTATESPARSSVSPTTTTTISAPLAPPPTTEYKNILDSQDRRTARPAPVFE
                     DTARQYEEGEHVPEEPHLLPGLQIRRRTFTPAELLERFGDTDIIYSFVNGSEANHYYR
                     KAMSMWCLPQLRDLENATYSEGGRLPPALQSIVASNTPACLPPYLQNAYDNLHSTRDF
                     VATVASNARPGTDDRETDELRHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDGAKNFLA
                     GVCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQHLWRVRNVTSVHVY
                     MNDDYFVNRDVAITDLLNEYGGTIVRTERGIIAAGAVADGGASWAKGVLHTQQFNTQE
                     LDVLHEDYLPEALVTMWDSLKRVNRSASAAAVTSISVPPLDEAVDVAHQYEPDPLPSK
                     SLMPRRPRRYATHAPFVYCTNMFRFFETRYEREFAAAALRHRSRKARDLFIPFVYNAF
                     IMARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGPASLLSGAAESDC
                     VFAKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEAADQLRRFLHGKFPTPVYLEV
                     GGRTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGG
                     VRVSVEQHGGAALREARAALGHRVVSAMPAPACAYKEQVSVDPAARGESVAEIARRAM
                     GEMRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAVPAQTLSLEDF
                     RAVAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVEAYEDMDAEVRWS
                     VP"
     gene            <389044..>391614
                     /locus_tag="LMJF_16_1020"
                     /db_xref="GeneID:5650651"
     mRNA            <389044..>391614
                     /locus_tag="LMJF_16_1020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682130.1"
                     /db_xref="GeneID:5650651"
     CDS             389044..391614
                     /locus_tag="LMJF_16_1020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682182.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650651"
                     /db_xref="GOA:Q4QER6"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER6"
                     /translation="MRSGTLAEDLEARGDAINKQGHPNSTRVTEEPFSAATVAVVATS
                     TEVPLLSLTATESPARSSVSPTTTTTISAPLAPPPTTEYKNILDSQDRRTARPAPVFE
                     DTARQYEEGEHVPEEPHLLPGLQIRRRTFTPAELLERFGDTDIIYSFVNGSEANHYYR
                     KAMSMWCLPQLRDLENATYSEGGRLPPALQSIVASNTPACLPPYLQNAYDNLHSTRDF
                     VATVASNARPGTDDRETDELRHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDGAKNFLA
                     GVCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQHLWRVRNVTSVHVY
                     MNDDYFVNRDVAITDLLNEYGGTIVRTERGILQKGVLGSPSGGTWSEGVRNTHLFNIM
                     ELDLQHEDYLPETLERQWSAERVQRGASGVGDPVPPIALNDMVDAAYAHVPASRPPTA
                     LPRRHRRYATHAPFVCCTNMHRFLQTRYAAELAYNSLHHRRRSVRDLYVPFVYNAFIM
                     ARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGPASLRGGFIASECVF
                     AKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEAADQLRRFLHGKFPTPVYLEVGG
                     RTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGGVR
                     VSVEQHGGATLREARAALGHRVVSAMPAPACAYKEQVSVDPAARGESVAEIARRAMGE
                     MRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAVPAQTLSLEDFRA
                     VAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVEAYEDMDAEVRWSVP
                     "
     gene            <393954..>396524
                     /locus_tag="LMJF_16_1030"
                     /db_xref="GeneID:5650652"
     mRNA            <393954..>396524
                     /locus_tag="LMJF_16_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682131.1"
                     /db_xref="GeneID:5650652"
     CDS             393954..396524
                     /locus_tag="LMJF_16_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682183.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650652"
                     /db_xref="GOA:Q4QER5"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER5"
                     /translation="MRSGTLAEDLEARGDAINKQGHPNSTRVTEEPFSAATVAVVATS
                     TEVPLLSLTATESPARSSVSPTTTTTISAPLAPPPTTEYKNILDSQDRRTARPAPVFE
                     DTARQYEEGEHVPEEPHLLPGLQIRRRTFTPAELLERFGDTDIIYSFVNGSEANHYYR
                     KAMSMWCLPQLRDLENATYSEGGRLPPALQSIVASNTPACLPPYLQNAYDNLHSTRDF
                     VATVASNARPGTDDRETDELRHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDGAKNFLA
                     GVCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQHLWRVRNVTSVHVY
                     MNDDYFVNRDVAITDLLNEYGGTIVRTERGILQKGVLGSPSGGTWSEGVRNTHLFNIM
                     ELDLQHEDYLPETLERQWSAERVQRGASGVGDPVPPIALNDMVDAAYAHVPASRPPTA
                     LPRRHRRYATHAPFVYCTNMHRFLQTRYAAELAYNSLHHRRRSVRDLYVPFVYNAFIM
                     ARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGPASLRGGFIASECVF
                     AKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEAADQLRRFLHGKFPTPVYLEVGG
                     RTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGGVR
                     VSVEQHGGATLREARAALGHRVVSAMPAPACAYKEQVSVDPAARGESVAEIARRAMGE
                     MRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAVPAQTLSLEDFRA
                     VAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVEAYEDMDAEVRWSVP
                     "
     gene            <403539..>405611
                     /locus_tag="LMJF_16_1040"
                     /db_xref="GeneID:5650653"
     mRNA            <403539..>405611
                     /locus_tag="LMJF_16_1040"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682132.1"
                     /db_xref="GeneID:5650653"
     CDS             403539..405611
                     /locus_tag="LMJF_16_1040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682184.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650653"
                     /db_xref="GOA:Q4QER4"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER4"
                     /translation="MQAILDAESNAFHASILAPVSAYHNDAPRCLPNFLWSHIGPEKT
                     AADLVRAVEAAARHGADNRDRETDELRHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDG
                     AKNFLAGMCGGARVQALRSSGTHLRVTTVHQDAVMPYGMRLTVDSHVIEQHLWRVRNV
                     TSVHVYMNDDYFVNRDVAITDLLNEYGGTIVRTERGIIAAGAVADGSASWAKGVLHTQ
                     QFNTQELDVLHEDYLPEALVTMWDSLKRVNRSASAAAVTSISVPPLDEAVDVAHQYEP
                     DPLPSKSLMPRRPRRYATHAPFAYCTNMFRFFETRYEREFAAAALRHRSRKARDLFIP
                     FVYNAFIMARPWQASPKFLPYLLELHRSRRLGRTDAMSPTQIVLDNEDGCGPASLLSG
                     AAESDCVFAKFLNNLTLNEAVVERVRQVNPLYFNINAGFSSAEASDQLRRFLHGKFPT
                     PVYLEVGGRTSSAGAAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFA
                     GHHRGGVRVSVEQHGGATLREARAALGHRVVSAMPAPACAYKEQVSVDPAARGESVAE
                     IARRAMGEMRGGVELPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAVPAQT
                     LSLEDFRAVAVGPSEGDVVLVVSREDAEAQAVHWVNGASESDLLLTYPLPVEAYEDMD
                     AEVRWSVP"
     gene            <409591..>412665
                     /locus_tag="LMJF_16_1050"
                     /db_xref="GeneID:5650654"
     mRNA            <409591..>412665
                     /locus_tag="LMJF_16_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682133.1"
                     /db_xref="GeneID:5650654"
     CDS             409591..412665
                     /locus_tag="LMJF_16_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682185.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650654"
                     /db_xref="GOA:Q4QER3"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER3"
                     /translation="MHVSGAALPPSPRMMFCPQKDVKRSSCRAYVSLCVRFVVQMGRR
                     LGLVCGSEKAGVGCALLGAICLVGFGLLFLAELVQMTSVVLAALLSLSASSPPLGCRG
                     SDTSAAVDFSVRSFAFRDMGEADQQRERELHVRLLEERLQEAKRRPRFDATYVIKGET
                     DPNVFRLTGAARDATVRLVDAVVDGYSLVRQPDTAPLPRMHTMWRIHSPAELYERYDA
                     LDVIYSFVNGSEANHGYRKQLRSSCGPQILALEKQYFLSGHTSTASLSTPEAGPRGFQ
                     PLLAQLASQCPLYQSLLRQRNGELLKLFGGSANTARVDERDRETDELRHSLRSVEQHV
                     RWHRGRVVMVSPGHHPTWVDGAKNFLAGMCGGARVQALRSSGTHLRVTTVHQDAVMPY
                     GMRLTVDSHVIEQHLWRVRNVTSVHVYMNDDYFVNRDVAITDLLNEYGGTIVRTEGPS
                     VAEGRRGDVSASWVEGVANTELFNVYHLEHLHEDFLPRPLLDSWRRLLKRSSLEPQSA
                     SNGLISSLKWKLSEMLAPARRRSVGTTNGGGDDDAARAEFEQEARYILGFSDLLSAAN
                     TSSYWEAALSNPITPTSLPSGRHKGVQKHYYATHAPFVYCTNMFRHWSVRFRDEFADL
                     QLHHRERRARDLFVPFLYNAFIMARPWQASPKFLPYLVELKEAMEAAAADAKAALSHL
                     RQTETVSLMDALREEFQKHLAKYVPTVSIFLDNDDGCAPATLYRNPAAEVMYMRATNN
                     IEENKRVMDEVARQDPLYFNINAGFSSAEASDQLRRFLHGKFPTPVYLEVGGRTSSAG
                     AAAAAEEGALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGGVRVSVEQH
                     GGAALREARAALGHRVVSAMPAPACTYKEQVSVDPAARGESVAEIARRAMGEMRGGVE
                     LPWTCGGGGAGLRVRGFVVDARTRGAPVRSAAALRDALAVPAQTLSLEDFRAVAVGPS
                     EGDVVLVVSREDAEAKAVHWVNGASESDLLLTYPLPVEAYEDMDVEVRWSVP"
     gene            <414197..>417133
                     /locus_tag="LMJF_16_1060"
                     /db_xref="GeneID:5650655"
     mRNA            <414197..>417133
                     /locus_tag="LMJF_16_1060"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682134.1"
                     /db_xref="GeneID:5650655"
     CDS             414197..417133
                     /locus_tag="LMJF_16_1060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682186.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650655"
                     /db_xref="GOA:Q4QER2"
                     /db_xref="InterPro:IPR021520"
                     /db_xref="UniProtKB/TrEMBL:Q4QER2"
                     /translation="MRFLRFRESRGAAPCAAHDSASVVVPTVGSHRLRSASWYARILW
                     QWSSSLRSSSCRCCVSCFALLGQRVQRWYHWLKRCRLLWYAVAALLLLLITLTLTVIL
                     FIALTWNHPWTQLHVEGWLRDLTVSRFSAVVPGNVHPREPERLWGLTVRSPEALSVEP
                     VVNNSRGGRTSETDAAARQERLAARLLDLHGAMLLLYTFVNGSEANHVYRRLALTTCG
                     DYIRNIEFQLALNGVVTDGKGTTEICTTSIHRAKTNAEVRKMVARRASATVTSRDRET
                     DELRHSLRSVEQHVRWHRGRVVMVSPGHHPTWVDGAKNFLAGMCGDARVQALRSNGTH
                     LRVTTVHQDAVIPTHARLTVNTNVIEQHLWRVRNVTSVHVYMNDDYFVNRDVAITDLL
                     NEYGGTIVRTESAAIAGAKTGKAGLMTWAEGVLGTNFFVTDELDLKHEDEVPAAVVRL
                     WQQQDDALTLWDVEAVREGKAPLPAVKAPDPRNTIFIMLDYAETSPPRSIAVPRVDTV
                     DGVVAAYRSRTFGTLRPRFYATHAPFVYCTNMLRYLALRYQREFAQSMFLSRARSASD
                     LYVPFLYNAFIMARPWQASPRFPAYITLRQQLGERQMRRASLSPSLMPAAPKTGDTGG
                     VGVRQPHTEWPSQPAPQQVPGVSMEETRINVAPIELNNCDGCAPATMLVGPEKSECLF
                     GAFSDDLRANDGLMRQVRQAQPLFFNVNAGLTKPKAADQLRAFLQELFPKPVFLENNA
                     GGDAALSRLFGDLMALPVVGVVSYEEGVCPLVRSLALAFAGHHRGGVRVSVQRYGLGE
                     VDATMAEVRQDLRYTQQSAMPAVACTYAAHVTVKKSRRGESLAALARRVLDDADKTGD
                     SGVELPWTCSGGCAGLRVRGFLVDARTPGAPLRDMRAVATALAVPAQTLSLEDFRAVA
                     VGPSEGDVVLVVSREDAEAKAVHWVNGASESDLLLTYPLPVEAYEDMDAEVRWVEWRP
                     RAKATA"
     gene            <417743..>418492
                     /locus_tag="LMJF_16_1065"
                     /db_xref="GeneID:5650656"
     mRNA            <417743..>418492
                     /locus_tag="LMJF_16_1065"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682135.1"
                     /db_xref="GeneID:5650656"
     CDS             417743..418492
                     /locus_tag="LMJF_16_1065"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682187.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1065"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1065"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650656"
                     /db_xref="InterPro:IPR005375"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QER1"
                     /translation="MTLCRYFVFAPLSRCASFRYLPVCCAQVPAPLLPSLTTYTHTHT
                     PTHTHASTVLPAVIPSAFRWHSFSQHFYFFRHSTSLSPRARTIDTDRPGRTDGHLVQN
                     LFDRRSGDEWRERGEGEPQRKQKKTFTSVVRRTMSAANQSGAPAAPSGNKVTFRVILT
                     SERSQPFRVISIAEEAPLTAVLRFAAEEFGIASVDSMAATTKDGTGINPAQTAGTVFM
                     KYGQEIRLIPRDRVGAAPCVRLLRSRWWCRG"
     gene            <419438..>420988
                     /locus_tag="LMJF_16_1070"
                     /db_xref="GeneID:5650657"
     mRNA            <419438..>420988
                     /locus_tag="LMJF_16_1070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682136.1"
                     /db_xref="GeneID:5650657"
     CDS             419438..420988
                     /locus_tag="LMJF_16_1070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682188.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650657"
                     /db_xref="UniProtKB/TrEMBL:Q4QER0"
                     /translation="MALSSQWSQAVVVRATPKGEIIVPQQPNNGTARAMAAAGNPIIV
                     RARTAANFGEGVTRNEDGSGDRGSSGYGFLSAFGTGYDISQTFWMPNPGKGEIGLLEY
                     LYRRGPTNKSHVLLQSRPLPELQFNFSTCTGCNIDLSHNMFRLSKAAMALQHMDATLG
                     DDSDAYDDSGMDVSVGGSGAGGSIGCNNFSSSLSSPSTSSRRPGSTPQRISISTRAFK
                     ATMRASLQSLQDEDYYLVKYRDYSAWAVSEYRSICKTDSVFGRKYVEQCFAVHVGREP
                     GELVLITEAQFLYGVDLLQRQLINQLTNAVPCPPAGWGGVDANQSSYQQYQIDINYSA
                     LNADQFRSLGAVLGDGMRHVGVTWEEEERAEKAKAEARARGRGGGEDYDHTPPAWYDW
                     TPSAIRARVQRRLHRCYRSVGQLTVQLAVVGVCGFLVYRAVKGYIPGLSSLSDDYHED
                     RGGGGRRGGRGGGSRGGRGDGRYRDCRHSGRGEDDYYYDYRPGLFRSILMGPKEVFDY
                     MLAPAPDR"
     gene            <424988..>426910
                     /locus_tag="LMJF_16_1080"
                     /db_xref="GeneID:5650658"
     mRNA            <424988..>426910
                     /locus_tag="LMJF_16_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682137.1"
                     /db_xref="GeneID:5650658"
     CDS             424988..426910
                     /locus_tag="LMJF_16_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682189.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650658"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ9"
                     /translation="MSRITSHPAIPPPPSRAPGRQRASVGMASVVTEPDSAQMAQENI
                     TLLQALVQPTRYRRRVQPQFEAFHLEDPDYMKYNLKAYWPHHLDSGAVTADRAAPRQP
                     GSDDRGSTALVAVQSRMSPQPLRLANGVLPSPSAAYGDPHRMGSCNMDRDQQLHCKEL
                     TTRPPPVLPGAGRRGSSSDYQLPPGRSDDEEGWPTMLSGFHSASERHSEGDNYNAGCA
                     SEHSTYNDRHRHPERPAPQYPKGQQQEYSLSSQQQAENSSRCPSAYDTQPEREKRHRE
                     EERPAGQPRRSSTSNAHALSIDGGAHRRSGLGGGGDSATADCHDQYGPSAGECGVDSS
                     RPQRFEAALPVGAPHYGWPHVVSANGGVSGTAGNGRVGEADEGEAFEDGDGSYGDGGA
                     EWGAALDEWDDDEEGGAAPVTAHNLYANDGEEWMDTRDGAYHDRDDDNADSEPSYLQP
                     PPPASKEQRPQPSLRASLPAEAPAPPSQHRHQRPTRHIQRQSADVTSLQSSRKGSQQP
                     RPVEGEVDWSSTRGKKKTRSNKHNPRAFLNRTTHTWVSTNTTTTVILPPATVQLVPMS
                     ALAMSEVRQPVDGRWAATAVLPPPSPYSLSSQSMLGYQQRCSQMEVLDDSGNSISNGR
                     KHVGNSLPCLPSRNTV"
     gene            <434546..>440989
                     /locus_tag="LMJF_16_1090"
                     /db_xref="GeneID:5650659"
     mRNA            <434546..>440989
                     /locus_tag="LMJF_16_1090"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682138.1"
                     /db_xref="GeneID:5650659"
     CDS             434546..440989
                     /locus_tag="LMJF_16_1090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682190.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650659"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ8"
                     /translation="MLQQTASAHTHPCQRAARSTAIEEAGNACEDDYRENQNMNGTNH
                     HPGAAADELQKLKEASPPALPLLPRHATEGSTSLHSSFSSSVSSHEKRTAAAAVDPSP
                     FSVVSHISTGTNSGMGGAALLTRDPRLIMLPLRRNETNSTAVPPPLNGGVMDATMPSD
                     QLHLLPIPRSLLHTSPAGCTLVADVGTASPLFIDLNSLQLTGMLESVLVCTCAAAGAA
                     TAAIPAVQPSVVPVPRTPPALGTLVVDTDEHAGVSMTSHTDSATSGSASAPVSATTVG
                     RVNGKANASRSSRTQVHCPPTAVAALPLYANGASDGASLAVPPVAAAAALHILPSSFG
                     AITAADTSHLTPATRSAGEGGCLPPCFSGHYTTSSTPDFQPSSLTHVTRAALSPLGLP
                     SEKSLAAGATATSVTSEHGPAEEGSGRNGKYGDEPAPRCRMTAMLKAKTTPPSAMASD
                     IHREHSRALSAPAAATAQQRGVRRGNAHRNVLDSRGPFRGGARGPPSVSIKEALADAP
                     LLRCAAADAVADTMVSMPPLAASARQDSTDTAFRQLAARRHQVSLPPAPPPPPPPLLQ
                     EPEALPPPPTTKAPMQLSASFPAGEVLSLDGTLRSCADDAALVSNMSKGSFLSTTMAF
                     AATAGTTASAPLLDSPAGVAGGFSAMRRRAYGGARPAPPVQPPRSPTQNPPCSALWMR
                     PDVFQQGADARAAVAAATPADERTVSTSPQRAARTAASSQGGGVFPRDDGTAALQLVL
                     TTSQEFLVPCAQRMSGGVPNAPPAATLEAEPERHPQAFCDNPPGQAAHTAPQLPHPAS
                     ESVTAVLQLPVNAAAPPANLVADSQALSANTGKDSVARSGVAARQAPSPSPAPQPPTA
                     QRELAALHVLPMHRITETARATQQPTAVSLSRSVERHPAVSGGAGEARGGAIMSPCPS
                     AASVMSIDVHTIAASPHARASAFERRDAPSTPRSTTHRCSSTGIRNEPRGVARTMSSV
                     SAAPLYSFAHVTHGEQAQTEPCRLFMCSTPPPRPPPRRAAHTAPLPACITAVSAAASS
                     STSSETTPLCRPVDVRDAGAGDGVLSIIPATMDTAGSSASSLAASELPGVLKDWTPTQ
                     LAVSQPLRASQRAAAVVVVAPGADVEKPSTRETSPPTAAIPATQAEALDTRVKMHMRT
                     TRASDTAGKAANLRRRDARGFSAAASPAHHDCRGVRVELQRDDRRGTELAAETPHTSL
                     PTHVVPVADNLLKHLTTAPQECRARGGEVSASMAPITRLPASESVTATPFAWNGMAAA
                     GARSRSQTITATLPTAAAATATHALPLSLGPSWERMEPLPVGHLTSATPTATPLTART
                     FPLHSVPAKTAGMRLAIPHCVPTPPSLPSSFQQQCTPRGAVFTSFKSASRQHPLRPAA
                     PGPFRQPPAPTTLHQRGEGARNSSASGEALATPPHTLIAQQLAGGAAASTPHQGEVVW
                     EVLPATHSSSCDWPNPASSCPSSVASSCLQRHQLQAGCRSGLPRSLPFSDMTRDSMPM
                     AMLGPKPEAAVRRRPFSTDPGGGDETTSGGHSRRQARPVPHQEPQAAQRSSPSPWPWW
                     RGQHALTPGQRLPVRVQRHGEGARTGGFFVALPPNPVMVDGADNAAAPNSRPTLSSSA
                     TAVAAGGVGSVGDGGGLAPTASSIPAAPTSLRLCTAHLATTRERVGGRGGAAVKKSAT
                     SGCATAGQPLHRVAAGAPATSPGTTTAAEAATPVRTCAGSGLTGVADYYGAYQRTQQP
                     RSTKSGPLPPSQTFHSQSSMGTGSQSPQDSGGGEARGNTGTASRPGSLPVAEAGMTLP
                     NTAAVAAAAGSQEPRCHHRQRGTPLQRYSDGTNAALRDRGGVKGDYGPQRAPRLTRAL
                     LDQLQRTYAAVADTSSRPRYLPSDLPLKEALVASWHDAIHHGPHSGNDSNGTPAMLQR
                     PRLSAPSCKQGVENVMAVLSRSEWTVAYSYHGPDSPPPQLHATVGATPMDTRSESPIA
                     AQPHLPAAAQQERLYMQRCTSSSPSPVPVAPPPVVCKNYGAVLRTHHPQALPFVVSSQ
                     QAQPRLLRRNLVEQPTRKHTAHTSAGTVASAPVVLQEATLAPAKILATPPSLASLEHQ
                     QTPVLTAVATVPAAPPPMPWSPKGNGPDASSETLSVTEVCPRQGSSGPRISNFFHLFR
                     ERQGQRRGGRAWIAH"
     gene            <443362..>445038
                     /locus_tag="LMJF_16_1100"
                     /db_xref="GeneID:5650660"
     mRNA            <443362..>445038
                     /locus_tag="LMJF_16_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682139.1"
                     /db_xref="GeneID:5650660"
     CDS             443362..445038
                     /locus_tag="LMJF_16_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682191.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650660"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ7"
                     /translation="MTRAMNNITAWEKRREEYQQWRRENLKGSTYYRLSRPLDALGGA
                     KTEAEENGVLPCLYNAYAPVLFSSEERHRIERLRLRALEAERTARSTARAHEQAAYEK
                     EVLLQRSRKLHGEAVDLPDSYLRTTYPDPSTFTGYAEPVTGDDKGRTYPAPHASKAAS
                     GYLANPKLVVKDHHRAMQQHRVARQQARLDQEAQRLEAAERQRRDLAAQLTDCQLQEA
                     AYLASWMEGRPRVCRARETERHARQEAEQRAVDEWNRAAQTREREAYAVYASQEAAAA
                     AAHRQELRVRVVAPRLCNRKGISGGHRPEQEVQPFPAASAAEYNGAAARVPSPPSTGV
                     PHASGAVDCPLQAAAPPLSMVPSQAPEKLARSARPVTPAVRPETPALPPSQVVGPTST
                     NFFNEVKQWTREFPSPNTVPVNGSDAAHRRAWKAELEETQLRFNRETTQRQREDIVRR
                     VQEAREKAFEGSWQQAEQKRHEKRELAARRADHTQADVEAATAVRLEVRLESSRAQQQ
                     RMLQAAERYNETQFLRQQSKQREMVLRSLEEEELQQLRMMVSSASAANRG"
     gene            <448073..>449176
                     /locus_tag="LMJF_16_1110"
                     /db_xref="GeneID:5650661"
     mRNA            <448073..>449176
                     /locus_tag="LMJF_16_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682140.1"
                     /db_xref="GeneID:5650661"
     CDS             448073..449176
                     /locus_tag="LMJF_16_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682192.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650661"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ6"
                     /translation="MELSRLLHRYHSGSSTVSAPATASSNELRGTRREEGLPPPPAAA
                     AAAAAGNSTVAKAQAVIAAAAALKRHANTSASLSASSASSPRPEAADGAAGSPTHGSK
                     AATSQACSAPSSSSDSRHHVQVYREHCTIGWSPDEFYSVVADVEHYSAFLPWCAGSEV
                     HTTRRVRVPRDALRLPPSPAAASPLATGSEAAELELVDAIEMTTTLTIGFSFFKEQYT
                     SRVTLYPGRKIVAALYDEEDVDVEAAPQNTSRASSAAVASSRDSNSALGTGSGNGLVL
                     SFFRKAASTAGVAAKRSILRHLRCEWEFAPVEGKPNTVDVLFFVSFEFKNPMYRHMIM
                     NNVVGLMTRSFERRCESLYGPPSATKVSLPVLS"
     gene            <452839..>453651
                     /locus_tag="LMJF_16_1120"
                     /db_xref="GeneID:5650662"
     mRNA            <452839..>453651
                     /locus_tag="LMJF_16_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682141.1"
                     /db_xref="GeneID:5650662"
     CDS             452839..453651
                     /locus_tag="LMJF_16_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682193.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650662"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ5"
                     /translation="MVMGEGHRFGRRTRERRIGSCQCLNGVREARCTALLASLSILPV
                     CLSLLYSPRSVAAPLLPLPLLLPLPLVVVHLECADAGSLAHLQFSTLSRQLRRRRGAH
                     IPSSLPLSASHMRRLSGSSMASSAHEAADAGSGDVDMAGVQVLESSVDFMSLFYCHLT
                     SCPPHGPFVYYAAMTLVRRAKRRYGTSGSNSATDAEVCSAYASWSSDAMGADGAAAVL
                     RALTIPNVMALIEKRYDTSHLSNWPLLYVPAEIRSADVDALIQQRQQQPQQG"
     gene            <454500..>455042
                     /locus_tag="LMJF_16_1130"
                     /db_xref="GeneID:5650663"
     mRNA            <454500..>455042
                     /locus_tag="LMJF_16_1130"
                     /product="tyrosyl or methionyl-tRNA synthetase-like
                     protein"
                     /transcript_id="XM_001682142.1"
                     /db_xref="GeneID:5650663"
     CDS             454500..455042
                     /locus_tag="LMJF_16_1130"
                     /EC_number="6.1.1.-"
                     /codon_start=1
                     /product="tyrosyl or methionyl-tRNA synthetase-like
                     protein"
                     /protein_id="XP_001682194.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650663"
                     /db_xref="GOA:Q4QEQ4"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ4"
                     /translation="MSRCCFAVGKVLEVSRHPESEKLYIEKIDLGAELNMLSNNEPRT
                     ILSGLQEFVKEEDFVNRLVLVIANLEPRKIGGIPSAGMVLCASTGEDPHDPASAGQGE
                     RKVVLLDIPEGTAVGERVVFEGHDMPYEPVLKKKLAKNFEEVMKDVRSSADGEVCWQG
                     KPFQTSAGVIKASLCNARIS"
     gene            complement(455433..455504)
                     /locus_tag="LMJF_16_TRNAGLN_01"
                     /db_xref="GeneID:12981427"
     tRNA            complement(455433..455504)
                     /locus_tag="LMJF_16_TRNAGLN_01"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:12981427"
     gene            complement(<455991..>457910)
                     /locus_tag="LMJF_16_1140"
                     /db_xref="GeneID:5650665"
     mRNA            complement(<455991..>457910)
                     /locus_tag="LMJF_16_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682143.1"
                     /db_xref="GeneID:5650665"
     CDS             complement(455991..457910)
                     /locus_tag="LMJF_16_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682195.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650665"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ3"
                     /translation="MHLLVDGDYLLSGFRPTSEEEVRAAVERLVTAIEQQLLQPVGAD
                     TAVTALVSRIIFFSSALIQGLEEGPRMFIISTMRRLRFQTHVLESIHGRPGTPVDAAL
                     CTKLLQLSLLPTGGGGFSGGNSAVASHGRGAHAFCLVTPNAYLSTAMELIASRESGEI
                     VFAVYEGDEVAEELLGYASARYGTTGGVATMAKHDGVTFLPSTEAAVAALALVQQQEK
                     GNLSVSALAELKALQVRLQQQTPTTGTGATVVMPKASTAAAVAPPAAPTVPELFAPPN
                     GPQPTAATSQSSSNASSSGIVDKDRASVPALPFTASAAAAATTAAPSFFETGPLHTVT
                     TTTSPPAVVQHASPPSAMPPPLSTSPLSTVGGREGAAVSLGEPMVSTTLPVEWALVYD
                     AARQRHYYAYTDTTGQTRSTWQHPLGPQKQLELEEQVQAWRAARLQPQLNSALPDGWE
                     ERTDPQTRRTFYVDHKSKTTTWERPQPSVATPPSVANVSSHASGGSAMALPAMWEARV
                     DPRTGRTFYINHETKTTSWERPAVAPTPLPAAQPSSGNVETGGDSDWVPCVDPATGRT
                     FYVNDKTRQTSWSRPTPAVQAPPPPTPPNAPSPMQGGAVALPPPWEARVDPGTGRTFY
                     INHATKTTSWKRPLV"
     gene            complement(<458842..>459195)
                     /locus_tag="LMJF_16_1145"
                     /db_xref="GeneID:12981428"
     mRNA            complement(<458842..>459195)
                     /locus_tag="LMJF_16_1145"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721742.1"
                     /db_xref="GeneID:12981428"
     CDS             complement(458842..459195)
                     /locus_tag="LMJF_16_1145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1145"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1145"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:12981428"
                     /db_xref="UniProtKB/TrEMBL:E9ACR6"
                     /translation="MADVQLKALLMGVEAERGATVTCRDPSALEMLLRISNSDAHRGS
                     VCVIFQNASAAASPGAQMLFINEKCAKSVEEEVQLWLDPFNITAVDATAGSARKRARA
                     DSESDDFESEMDSDA"
     gene            complement(<460266..>460994)
                     /locus_tag="LMJF_16_1150"
                     /db_xref="GeneID:5650666"
     mRNA            complement(<460266..>460994)
                     /locus_tag="LMJF_16_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682144.1"
                     /db_xref="GeneID:5650666"
     CDS             complement(460266..460994)
                     /locus_tag="LMJF_16_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682196.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650666"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ2"
                     /translation="MWERELRQQLVRHEQEELMQMVLSEEKTLFPVMAALRDANTLGL
                     MQEEAVWRWGIQKNYHHFLRDVMQVLEVLHRRSLAFAEEPRCRKQIENSEGQHWIAAR
                     RRQVMRETQEAAAAEKEDRVMRLAYFAHIQQQLYQIFLLEESERDDRMEVERLQRLYV
                     GSLVAAMAKEYRHARLCQLKYETRRFELQPEVTRDLIAGEALHRSWLCQDQALGFKKM
                     QADEIRSYLASARQELLNQRVEED"
     gene            complement(<462968..>464422)
                     /locus_tag="LMJF_16_1160"
                     /db_xref="GeneID:5650667"
     mRNA            complement(<462968..>464422)
                     /locus_tag="LMJF_16_1160"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682145.1"
                     /db_xref="GeneID:5650667"
     CDS             complement(462968..464422)
                     /locus_tag="LMJF_16_1160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682197.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650667"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ1"
                     /translation="MSFSPPLPPPAPMSHVAHQQELMRVYREELQLQQRLKEQCRLLQ
                     CLAEAAVGMFSWWREGAAAAAAATTDSALPVAGRSPISEASMGSDANTGEFTLPSASS
                     LLKLHSGMVFYSLGELLQLWSATTAPSDFGGNSEKGTDENASEAETMSQGGRDASRRE
                     VRASSYDPRRVNKSSDQHPPPWSFPTSIAVPVPQIIGGAGDVPHTPPPPLQLPTPAQL
                     IRYRVLDAACPLPVTHRLLLGSVDADSFRLLLLWLMRLTKECAEAMLLCRPDRHVREV
                     HMQSARIEGHRSSSASADDNRRPLRAVPTPAVIENEAAEPIGTKRPRPQDGGSLRCSD
                     GSVVSESWNVLCASLIRVLSYLVAAAAEASPRTGSERRQSTEPLLPSLMSCMASAATS
                     AALRADLRLFLAEVAEVRDTVLEVKQYCCVVDAQRDDTERALKRPRGESAAAAVRPPP
                     PASVAGQGQPMAMSNMALLAHLAAIVDMQVRKYL"
     gene            complement(<465404..>465559)
                     /locus_tag="LMJF_16_1170"
                     /db_xref="GeneID:5650668"
     mRNA            complement(<465404..>465559)
                     /locus_tag="LMJF_16_1170"
                     /product="putative 60S ribosomal protein L39"
                     /transcript_id="XM_001682146.1"
                     /db_xref="GeneID:5650668"
     CDS             complement(465404..465559)
                     /locus_tag="LMJF_16_1170"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L39"
                     /protein_id="XP_001682198.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650668"
                     /db_xref="GOA:Q4QEQ0"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR020083"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="UniProtKB/TrEMBL:Q4QEQ0"
                     /translation="MGRFKPLAVKKKYAKKMNQNKPVPYWIRLRTGNRIKWNEKRRHW
                     RRTKLNY"
     gene            complement(<466727..>468337)
                     /locus_tag="LMJF_16_1180"
                     /db_xref="GeneID:5650669"
     mRNA            complement(<466727..>468337)
                     /locus_tag="LMJF_16_1180"
                     /product="putative delta-coat protein"
                     /transcript_id="XM_001682147.1"
                     /db_xref="GeneID:5650669"
     CDS             complement(466727..468337)
                     /locus_tag="LMJF_16_1180"
                     /codon_start=1
                     /product="putative delta-coat protein"
                     /protein_id="XP_001682199.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650669"
                     /db_xref="GOA:Q4QEP9"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP9"
                     /translation="MTVISAGVVNKQGRIVLARQFTDISRVRIEGLLSAFPRLLESSM
                     SKQVTYIDAGTVRYVYQPIEELFLVLVTTTKSNIVEDLATLHLMGRLIPEYVPEGITE
                     ASLEAHSFEVFFALDEVVVCGKRENSTVEQIRVYLEMDSYEERMALEEKQRQIAEAKK
                     ITAEHARKMREQRMAGGGPTGGMYGGISSDDPNYGGFGSSSAAGGNMSLYTGGVGGME
                     TTYPAPSATISSHTSAPLKMAAAPRSGMCLGKARKTDITSKIQKEMGITASQAPDALG
                     EASDPVAMGRNAVELPVAMVPQEAVNITVEEKMSATLQREGEPTPIDIKGELTVLVAD
                     PQQDHIKLMLAPVSDAFTFRAHAKVNKTLFASDQVLTMADGKPFPVQQPVTILRWRLS
                     NSSVTAPINFTCWPESSSITIEYEVADPNTRPLQPVRLVIPLYGASLQDVQPSTGTYQ
                     AVDGQHVIWTIDVVDGHQNTSGNIEIVADSDHGASGEELFFPIRVALSSQVSIAHVNV
                     VEVVSTQNGNAVPFSQQLRLVSDNVQVL"
     gene            complement(<469429..>473754)
                     /locus_tag="LMJF_16_1190"
                     /db_xref="GeneID:5650670"
     mRNA            complement(<469429..>473754)
                     /locus_tag="LMJF_16_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682148.1"
                     /db_xref="GeneID:5650670"
     CDS             complement(469429..473754)
                     /locus_tag="LMJF_16_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682200.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650670"
                     /db_xref="GOA:Q4QEP8"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP8"
                     /translation="MNIPSSLPPDAKYDDQGIYLSFIAGGILLVVLGGCMAFLSYTPI
                     LWIKRFYRPNHTLEPAPLTRAASAAAVAAARRVTQGDLFNVSPSPSSPLTEIVFAEHT
                     VHPHGSHGHSVTRRKRLGISLPYLSTFFVRPTWQDWISIEEPSLRDRKYSALSPVHYQ
                     TPTLPTRQTSDRSFVPLQAPSYPVHRRRNGSLAAQPGSERCGGDGASAAAGLPDFSPR
                     HRPSLRSYGALEESWSRRSLPGTSDGETASLQALPKTAVDPLVAVYLFTLKFFFSLMF
                     LGELFTVWIMVIAQKDNYMERTLIQRDIHDCKSQDNNATGCELRKPYCYYRGDGLGCG
                     VVALHGLYDLTVLNISPRSQRWMGVGMLNLCFCVVLVSLTLLYLKKVGKYAEAVMANQ
                     MRHALGYRVVCVRGLDSTDVCTDHAFREAFLRLSVYFPNASPSPSAANSLAATAATSP
                     GSGAQRRCGEGTGDPPARLGKSNGFNGESDSESSYVVCDCPGLNCLFSTARMHYYVVR
                     RSDAAFTEPENVEQILITREPPLGTLEIIAATEAAMANLQEAIADEKALRRRRMLRHE
                     TRASATVWRGHRSLSNARLFPGRTASVVVSNGDITFDDVAARHDSHADDGRDAVLMMR
                     APFPACCDKMPAVPYYEAVFFRRVRDMNMALERVPQQQVAGAAFVVFKDSLCAHEFTQ
                     LFTARFGGLFSSLTATIAGPPGRIFQSSLTAGRCSLWLRFVLIFLLYVVLLLTWSIPI
                     SILGSLEQLSEISSIAVLRKYSELPKWMRSLINAYLPVGALALLNIALPHIIRFLVRA
                     MGAFNRTECDGGQLYMQYIFMVVTAVIFQAAFQGAVSRLADLLANSDHDAIINFFVSC
                     ISPSNGYFYAKVITATCLSTWVDLLDPVGMLKVLLFRGQAHIQRNYDALFLPCEFEFP
                     RLLSFDLMVLSMGLLFHMTAPLLGLLVVCYFFVRYWSQRAKQCDRYRPTLSPAHDCTD
                     FGVAAQVIRCVMWLYCFSEACGVLLMSLRAHKGGVVMCSLALGIGVGLTIYVYVQTRK
                     WTASLANVRHFAQNAHHFYSQEAVQQATSAPTVTTPLRRFPPKHAAEVSGGNAGTNVY
                     ASPPSSSASVAPAGASPSHVYAGSDNLHESEDDAAEQRRSPNTRNSAVQEEGALDRYE
                     NVTLQQVLFDTTRNPFLSHLLPRKPGLTMRYQPKHQRLAVINAAAELRAMKNTDFVVE
                     RYWDRGMTWFEEDASVYRNLDMDDEYVGEYRYDDMADHYSSDGGAAARSPPRNDSDDF
                     NQGKGEALHPMHTQLMDGHDVSPTQASAAVPPSVNSGLRTAATVSTNDLSRVVPDNTG
                     QKTAVVATFMPAVAATENAQDGAADQKLTYASTPTVMAAAHSHEGSSGPPSCRHASTL
                     PPPLPLRSYEEQRADDELAQSLLQMRLQSSGPSSPHTTLEGGAILCAATEPVMSNGEP
                     PSPTV"
     gene            complement(<475218..>476318)
                     /gene="CYP13"
                     /locus_tag="LMJF_16_1200"
                     /db_xref="GeneID:5650671"
     mRNA            complement(<475218..>476318)
                     /gene="CYP13"
                     /locus_tag="LMJF_16_1200"
                     /product="putative cyclophilin 13"
                     /transcript_id="XM_001682149.1"
                     /db_xref="GeneID:5650671"
     CDS             complement(475218..476318)
                     /gene="CYP13"
                     /locus_tag="LMJF_16_1200"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclophilin 13"
                     /protein_id="XP_001682201.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650671"
                     /db_xref="GOA:Q4QEP7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP7"
                     /translation="MNPLSTRRLGGTVTPGSALSGTCYVSHITRPARTMCWMKLAVFT
                     QFPVVPSLAGTQVQGRQDLLASTAGAGTPEEASLFLQIELFDDECPQLCANFRRLCNG
                     QSSTRQGQVYCFQGLTPSYCGTYFHKIIPSYCVQGGDITMRVKPGGTNSYSSAGRTWL
                     PDEFKKRRHNEIGLVSMANNGPNSNGSQFFITTSAAHERAFNGRHCCIGHVVRGLDAF
                     IALVAPFGNIEGHPSKYAVVVDCGEGEAPTLMSASSSPAAVFQASMAISETGTAGSSP
                     AADSRSVSVEEAPAELDAHYCEQPPQLQLQHRQAADGTGVMAALSPSDAAAAAAPLSI
                     SPAQPLKSSLKEKTTAVSEAAKTHAKHVTYQL"
     gene            complement(<477248..>480955)
                     /locus_tag="LMJF_16_1210"
                     /db_xref="GeneID:5650672"
     mRNA            complement(<477248..>480955)
                     /locus_tag="LMJF_16_1210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682150.1"
                     /db_xref="GeneID:5650672"
     CDS             complement(477248..480955)
                     /locus_tag="LMJF_16_1210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682202.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650672"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP6"
                     /translation="MQHPPVTTVGAHAPLKHRVRSLWRVLPLSTKSNRWVPLMESWET
                     ALQHTRNAAVLRIQRSSNCRGFTASAGGVSSHALLVGHRTCCSSASSSSSWKPPSSAG
                     AATAAAAAEPEMISLDAIEIEVVSAEESPSTTSTTATVRHAEVHRETPFPGHRNHCVP
                     HPHCHHHQRQREVSATDFFTAQLHATSAAGGREYDSDGASTASAARVVSGSGETETGV
                     PVSAVQRQEDYCDAHTIDAFARGRISNFVRRMGHRTGTVFHVRVMTPAQAAAVTGSTT
                     GPTLFAATCRLPLPEPHGSRVAEGVAEDAKEAELLAAMHAERVCDALGVQLFRLRTAQ
                     QKHADAVRKEEGRYAPYPDDPIKPLGTPIPPPLRLLRSRMHTSSNAPGAASARSVFSV
                     ATEVAAADAAASSQSHRYTAERGEASAATVTAPRVQRSHLARTPPAPREGPLAGQALP
                     AESAESGAGEDDSASASPATAGAATSFESTKIVLRRHDPIDDYAQLVFHYTDEEHAER
                     VRTYASSVYYPWMCQWEGGAVAQGDVSATPQGGAMGSDGTAAAATLGQVFDPTENGMW
                     SMVNDRDMRCSPTPHDALVLPIVYDGPCAEARITDYYTQHNTTLKEHLMVRSASGSAG
                     SPQRMVEAELRLVGLTIAAKGKAQTEPMAIHLAAMHAELLLDALGHPLFPADPQRQAR
                     HAEVVAGYGRWAMNPLTGAITPPNPHDALPLPLKIQIGTDDVWLGPEARRQLGHRWSD
                     SEHIIVAMQHLNSQTEDEVEINPPAVLLEEAEQLLQEWQAHVAESRFTHLFVLFNMDN
                     VFQATTLLPVPRRFGIRGGLGIGKTRKMAVQVCSLHALDTLCTLGVPLCVDPERQRRY
                     LQRRAALGMVLQRTSPADEGSLKHARVPRSFSGLPPPPLPSAAERSPGTSDGGVLRLP
                     TYVVEGSHIRLLPNITDTLHTMQLRIPEDYCLFGGASEEVLVEIGNQVRMAVQNYLQE
                     CLGKLLRSRNMQQRIQSNSGASRAVQCAAAAAGAGDAVVEDNIAETQAWATQFAMNLL
                     PHNIIRGYGRQNSLHNTSFLQVPIPSSAVLPSPEMSHKIDASAVSLPPHPLMGPVYAI
                     AIGTSLKRKDAERACYLHAASILHSFGVDVLVQYPRGQPRVRHACSFADVAKYLSKEP
                     LIITSPFLSDGTLRASAVEAAGVKPTEAVSPPPSTSEEIASASSASSAPQPGSLHPPR
                     PVMHTNMKAFLESTRGITLPRKRKARFTSPF"
     gene            complement(<482477..>489085)
                     /locus_tag="LMJF_16_1220"
                     /db_xref="GeneID:5650673"
     mRNA            complement(<482477..>489085)
                     /locus_tag="LMJF_16_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682151.1"
                     /db_xref="GeneID:5650673"
     CDS             complement(482477..489085)
                     /locus_tag="LMJF_16_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682203.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650673"
                     /db_xref="GOA:Q4QEP5"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP5"
                     /translation="MRDAAERRHSSVELQRPQSQQRQPEEHHHQQHEDAAHNQRHGSR
                     TTSGGGAALEEAASFQARPLARTPPQHPGFVETFGGMPAALVLSRSIRNQAHARDMGG
                     LSCVASARSAADKDESATLEVPQSLCRHTAAFPTHHLSTGTPCSSHATASTAELEMPM
                     QFESLWGDIDRYLFAVYTTLQTGDEMSLRPLRTPKHRMGWYTVIYNACSGDPTKSREL
                     YARLALLLLHILESHVLFPVLQNVDHSRVHFLTGAEDSRGACGSGSDQRGGQSSRSAP
                     TGSGIDGCSSGGWSRFKSIAIAATSGSVHRSPLKETSRNSSFTWSSRGYRNSDGSLAL
                     MKRLFHPSPHPTATTTAARASPVGGGGVKADEEEDGAGQPPQSPKAPAPVNGDSMASS
                     GVGSRGTSWFAQQGSGGSVAVPKSPAAANEFQTAFAGFDSTVHRSPENRVSLKLPRQQ
                     QRTTGFSIVTSTQSRPTTSPPRSPAIRMHTPRTPSSVTSLHVTQHAGSAPTESGRSTL
                     TARSPTSIGGRALPPATHSAVSPHHARVASKTGRVVVEDDEEVLYAVDTVPAAARHSL
                     RRRQHRGSSSDSNSVAAPVSFNDTEEGSAGLRAGADNDDDDDSLHTMNSFSSESVGRE
                     SRARLGKCAGEGATATAAREDARGRDAARAGEPPRTDHSDEGGTAEPPASRSSPFTTT
                     LSSINDALSPLLAPEAPATMRSTGTNAPPSLLRATAAVDASIRCTSSPDAKTVSETSV
                     TATGYSAREASSSSPSATVALAPPAASVTTSTGTTSPATPAYSAAETASSVARTASTA
                     RPDERRFSLCYTFLQEWHTFVVFRSVVLSCFRYLDQYYTRRFGMDTITLMCFKVFYVV
                     VYEPLRPLLVIELCYLMQYVREVFETTGQVAREQLRLIQETYSVVTELLLIVQSTSSS
                     MVAQQQQQPQAGSGVSGGGGATAAAASAATASTAGSSNATNGPPSVVAPSAAGLSSMV
                     GAFSAAEAAVAETPVRSHASSRARSTSVHNLSTASSAVSTPHVSALDRHNSSSTVAAP
                     SPAAADGEQSGAHPQVSRRRRLISLFTSGRLGDGVKGGGGNSARDQRATSRASSTPAS
                     PWVGLASSTSSAARLPSTFEGTPRPPAGRGGDSGRLSARDEAEGCSDKQQGGAAKADY
                     ISAPAVVVDLRGTVELRDRLEGHTTAHHLTTQALKRWEGMSADRRLRLGTIVKEIAKP
                     LSTIVMEDVGNEYVAGIYAFYRYTRDARRSTEEGRRGYVSWAGDVKELEKLVWRRVQL
                     PFLQASLRSALNEVLVVEPHRSILLDTRFGLRALLDTWSASVESADLSLAPPMSAAAA
                     RPGDAATQADGSSTTAVAAFHRRTGSTMTSTSLGGGLGEADPLARSGVQRGGGKYPES
                     LILFGVHGSHPTHPLSFPHQRTPRSFPFDGGERDEVVSQTSCSVFSGEKEKEKDDGRH
                     GSSGGDVVSAVRWTTAGSNDSHSTVITVAPAIDPSSNDRLMEHAGAWTGTRRGEGKPS
                     TVATASTPRFTSRGDSSTCVPPMEPATHAALAPHYRLGEQASLSSGTAAAAETGRTVS
                     GEAEGDSASAWAALKSLYGLFDDVTEDECFLLIAAILITKLIRDAADIIERYLRAMSS
                     PASATPSQPHPQAPGIHLMASLVGLVERYTDLVEGVFRNHATVLRALSNAIEELMCPF
                     RWTRKGALQASQQRAQEALTAAASATPGAYGRSWSEVLSSTGADLPSVLLSRDARQAT
                     LPLVSLAANYPQAVQQLKFSVLIARYTDVLLQQERGGGRVLSGNLHKRLRLVARLVSL
                     LEDKDTFLEHHRLCLARRLLGYASGPAAPQSEAALAVVGGNAKQPLAVGRASQGSSAS
                     ASLNLEAERQLVSFLQSYLGVTATHAFEAMLRDYEGAERTRDLFEQEAAYLELLTKIR
                     VQLITSAQWPTYAMPPLQVHASLQRGMEVFRAYYARQHPSRTLLWVFSLGSATLIAEF
                     VSGTKQVAASTLLATLLLVVSDAYNAEASDAAQAGALTGAQLARTLGLPFHALRAHLQ
                     LLTQHRAFNLLRWIPANSSGGGTGAAAATASITENDSFSLNPCYAHKLRKIRLPLPKA
                     RPTGLPSGDAQAFDGGPEPATQREPSATLSSPGATTAAATVTAIACEDAVVAQHVQAT
                     RRVLLDAALVRIFKSRRVVLFEDLFQTVTAHLSRQFMPSRRDVKAQLEGLIDRDYVKR
                     SPDNPNTFVYLS"
     gene            complement(<490799..>496240)
                     /locus_tag="LMJF_16_1230"
                     /db_xref="GeneID:5650674"
     mRNA            complement(<490799..>496240)
                     /locus_tag="LMJF_16_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682152.1"
                     /db_xref="GeneID:5650674"
     CDS             complement(490799..496240)
                     /locus_tag="LMJF_16_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682204.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650674"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP4"
                     /translation="MLRARARSAYTVARSSAARCSAAASIGAGSGALNGSTGLGSGVG
                     AGAASASLHEPRRYSFKYATKRQHNEARQPSYIHDKRYGLFSNEHNIGKSRRGLPHIT
                     PIYTKHMSLWETDTDASTNRFFRHYVFGQREEHLLLGRPHGFEADQAGGRQGDSAYEL
                     NTDQRYKGVPRPAITNLHYEPVWNQTLYRNTAHGNQLTNPSSKLTAAVLGPDLMEVRD
                     IKSVEHCKAWFDRLSFLIQQHYDAVGDIGAFRSRHAQHVHEFFVAFHDALSSFDFQDR
                     YLYDQFAKARPKHLEDLFAIFLEMEANYVNEAYCPRCSLPYATTRYCGEGDPNTPFRK
                     HRGRWAPHQYWGKEWYDVVMRRAEALWYRATEDPFFGTTAHTQRQAEALLSVYVKTKH
                     RAKMVDFLHALRGSKEFLLGQLQITPAMQKAADDLLDSTPHEHLLTNAFKLESSAAKY
                     TGDAQSVPHSPLQMRLDMEMNKYRRQQREEGVVRVPPASWKLDTSAIVPYKVDPQTKH
                     VANWRAVKEGIEQSFLATGLPKEAYTSEEWREMLYLKERIASRGARRAQLEAERQAEE
                     AAMAKKYGQRSPAATSSSSWCVFPDTAWYRVFETAAEALKPYGVTHAGQRVLMRSQTY
                     ANPAAVPYTDPVRNASVLLDTTPEACSVFGGFESGEVLRLTPKEPEGAAAFDVVVVGV
                     DKSGAEAEWSLYAMHRDVASQTSKGLLNLGTDCLQLLSSYAKVETTRRRAVLTVLDAQ
                     RTLPEEHLGQVVGVRRGELYVQWHLQRGGSSELDRSVAVPLGNPETVKQLYKLQTLTD
                     ADGAPALLQEPPSWRTPFRNDFVDERLKELEQAPFKREQWASLIQGKYTPKVKKYGYA
                     QHTTQDDFQTKEYKDRLLARQYFHSPQAFSVIPERHERSVKFMGKWEHQRVCGLPTAD
                     RDELEKGWGEAEEISDAAVGAIEQALRDISGRRPGNFVKSPTETQSLRLNESWWTPLE
                     FGWEEHNREQMAFLDSSERSIVEGARLPFGGKRPPFGTTYGMGERISEIAADYAKGFG
                     LGPHGHSPQHDTAHFNTLEAEQQRVKVLGLGNALVRLFHEKLGNQDIQAWSLQQCGES
                     DANVRQLLLSVEEWRTKGRAPSLLLRKVLQRYLKEELDAFNSGLPAHVPRLAVPCADA
                     SAADSIGSSSAGCIWVDVDRNAFALEHASQFRRGDSDEPYIVGLVQRAGMSSGSGGAL
                     AASPAGSGADNTYAEYIQQDVLQRFEIGLARIVGRGIPSSIIMERTVKNSRGLERESA
                     KMLTLVLVGELAKLLSKMRVTPDNISMVVRGLAQCPEKELLGGGDFAVPVSLIFSWNG
                     PQSNVSAATSNSSSSNANAGASRGAGISAVQQMLERTRHGSSPGSSGSGDGEKMVGKV
                     LEELAWSQDGVAADVLYALQQNKANPTLRQEFLNAFLPVCSNDHQKAQHMYADYTLGK
                     FVPNITVAIEAFVKFLGNISTHPGQLTSDVEYFEVDNARRADGTEGTGQYTQVRLLPP
                     EIGPFQYENTLIESIETAERFRRYGILAGPARVPASGFIAANCKSLTYMTHRDKEVVY
                     VTTENDQGLANALRSSALFKSIASNPKLSYLLKGITGGAPSHPLLVDSFNRFFYRVAP
                     MLSFYQSLLQEYSATMPSAQAEAQIANFGLARALESEASTAIEQDFRRNAERYWRNVL
                     EGRSTEEAALSSGGRESASAQGRRPSQQGSGRAGQSGSGSRRGSGEFNLASVVGHRAA
                     AGARSEKSRVPVSSSSSSSSSTVATAASTSTRVKGLLGSLKGGGSGAGRGKGSRPASP
                     SGVASGSRGGRSSSSNNSGDKNGSTSGRK"
     gene            complement(<497230..>503667)
                     /locus_tag="LMJF_16_1240"
                     /db_xref="GeneID:5650675"
     mRNA            complement(<497230..>503667)
                     /locus_tag="LMJF_16_1240"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682153.1"
                     /db_xref="GeneID:5650675"
     CDS             complement(497230..503667)
                     /locus_tag="LMJF_16_1240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682205.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650675"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP3"
                     /translation="MGCANEKLHAQQIAYQRDFLGACWNSVLGEDEAKEYLASRWMGI
                     SRQVMGLCTNNHCFTVHTLRKEKTAATDPSKAPGDLIGARPGVGGNIGVGSSGRQRTL
                     SVSVGASPNAGSPPASPNSSTQVINPSLLCAPASRNFPKTTRHGQSGSSDAPYLANAD
                     AELSAANARVAAAGKTKRADSGTLRTVMKDAIQLEKAAHSQHPYLQRHELSVYSGVVF
                     RCAPAHRLYHRISFVPEARAKRLNDAPVSAAAGAREDQQPASTLPSTPPSTSSGRAVK
                     HSPLCEGDGGPADGMPALQLGSTLAWHTISSGADWEADDPLSASNNYPIEDRDVDGVA
                     ATRPPVIVGSITAMELQALPPNAELCFGGWLYVSLQDEQERLRRSLARYEKRRQRRAA
                     AREATITSSPIASSTWPTPSTFCKDSLSPGQSPGGRPYNSVNGGTVEDASDGGKAPHL
                     RTSVVARSMSAPRRPWQRRDSSDEMITRSQRPTAAAAAAPPSPLGVVQEDTPAPPRAD
                     VSRQLSPNEGLGDAVIADAEDAAHTTAPMVDTTSAAEAASSRADGKEEEGQPVQHTPQ
                     LSATQSEKRAAPAMKTATALPPPQSQPSLAIARPLNLSCNLRSAAASSARNPSRTTGE
                     SHKRVISLAPQQPTPMLGVSPLSPLRCTGKYAQEAMEAEALVASWLPYAYVVIAVPMY
                     ECSLVPTAFHTALIRRKAVSLNLADAQSRQAYGVGCITAARYGGVMVVEYREKISEDD
                     DAEWIDELLRVGRASQEKYGEAGAKPDGMSTLGLSASAAAGTSTPSVRHLSRTVAHHA
                     RAEKLHRIKSCIWHKLRRQGLYVILASTCMADRRHRQQRAFVASELSRVFQASASWLG
                     TPATSVSALSKGRKSRHSAALAACASETAGDAYEDVDGIGCDYYAADMNGVVDYDSLD
                     DNSDSCNSRTGRASQSSNGSIGASEAARSGGESGGRRHSLWSKLSLPGGSKNHWHRRR
                     HHYHGSRGGGDGNAERKKHDSTHFGLSGQQRDGSGRRGPTAANPSLWAEPNYDNDFLL
                     RGTYRQIGGMKYLDVVALIDGCPVSELVQGIKRWVVNLLSMPIKARPLCLYLQRYEGI
                     ASSLQLLSTQVASAALASSVASGHLIAPMNLSFRAGGGAGLEAASFVSQQHAEATGGA
                     TSTGSFSAASVLMNVSATASTARRNVPYNTYYRGPLDPVVRAVMSPEVESMIAACHTR
                     QLPEVLRSPQLPAPRAVTSDGATDAGPLPPLPSPASVASRGSCDDPRSSSGRTSLTPQ
                     FLPSLSSSDAKRAVSVEARVGIAAQVLCSPRLSTRSPATPRTGRPLCADPGPSPSTSA
                     VRLQRKEQHETPAGSAAVQSSTAHVDPTSASLLPSAPPPAALSLRTADTAPPKHSSAG
                     PPLEASECPLCNDSLQNDSAVGHSCTATNGKALAAAAAAAATASVVPGDSIGNPTGDG
                     ITNGSAASPTVIDPLTAPSLLQDGWKQRGTSSSRSNCFSAAASKGGATGDDTRPDDNA
                     CTGPRSMLDHTRYPGQRSLPERSEPMGAAAAAGCCNSSGDDDASDDGDRDAAARQKAG
                     GTACAGAEEEEVSYGEREWQLADRELRALKLELDEMRYLVSTAHSELLQRLEESSQLG
                     AIFLPHTRPDQVDLSLLTLKMMRQYPEEVPVKEIHTDWVPMLMSLLTISRDNLFCGAG
                     AGDDGGDTLDFLRTYNNAVTQSDACDADKRRELYDAGTAKYTIDPLPPLPAPRPLHDI
                     VIAPQPIRFTKEMLREVKRVGMDETGLSFAFSGGSLGVLAGVLYYYTDFLRAKYCSGV
                     AAAGRWPKDAGATVQDVLARDGYNVVLRRIWIWGVIPDSSERKSGITSAAAKTKQLLR
                     GKLRRRDRADSATSTESTSTRCAEDANYVVMNTTGLDGGGARVRGQPFRSTEAYALYD
                     AVLHYLRTLEEFHTEHHGNDFIAPQGAMKRRSALMAWRRNKGCPDAAAAACGNGGEPN
                     GAAGSAAAASPATWTLVPKFEICVATNYYYKELMEEARQPRTPARRSSSLLYTSGSLH
                     HTPSETSRCKRLSAAVPPPPAASSSAASGTINAAKDGRKVQATIPPPPPPAGSAGSHA
                     KVAKEVVAKAQQHVEQPYCGGEETVRRKAPQRHAVKKIFGFLTEHYEQWRAQHSDDPA
                     ANALAKRIHISTK"
     gene            complement(<506141..>506593)
                     /locus_tag="LMJF_16_1250"
                     /db_xref="GeneID:5650676"
     mRNA            complement(<506141..>506593)
                     /locus_tag="LMJF_16_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682154.1"
                     /db_xref="GeneID:5650676"
     CDS             complement(506141..506593)
                     /locus_tag="LMJF_16_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682206.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650676"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP2"
                     /translation="MSDSVATLPGVLARGPALHALVRVELTNGTMVVGRLLEMDAATM
                     NIKVDAITLTAVRRRRGRSREDAPATRALATAGSSSSSSPAGGSHGLTARKTEDTIEV
                     NPMALRCIQSIVVRGAYIRYLDFIHETKDGGTSYGEVLVAAEQVRPSV"
     gene            complement(<507843..>513068)
                     /locus_tag="LMJF_16_1260"
                     /db_xref="GeneID:5650677"
     mRNA            complement(<507843..>513068)
                     /locus_tag="LMJF_16_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682155.1"
                     /db_xref="GeneID:5650677"
     CDS             complement(507843..513068)
                     /locus_tag="LMJF_16_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682207.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650677"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP1"
                     /translation="MMVRNNSFFAKKTCAASAPVAAATADVGVVPLRTHALTAQRPPQ
                     QPPAQRAAPAPAAAAAAATAQSIKVRLSRRRDSAEARASVLATARHRRLLPLTGASVV
                     EHEVEKDSAAASAVRLASGSALGRSVSLSSELQVSVDSSAPALGSLLCRGRSSRSSSR
                     APAMLSAPLPVNATVAVVSVLEHETATGTLVRAARSHSSGSQLSDNASPLSEGEATVG
                     SLTSLQQRLWDWTGGTTTCVTSTTGPSLGVSEPHRGQGRQRCLKPTSCVPTAPLAASA
                     AASPDSTKVRAAAQWKRVLDSERIRGERGKRLAHFLIQRLLGTVATTGPFGGVFGGLE
                     HFIPDMCDDEVVSVVSGGHLRPLCERAVVATYLLSSLVDGLPRHQQSLSPYIHMLIEF
                     TLVSDTPTNRAILGGSVQDEELLYALELDRKDGGDGGGRETVAAASGLPPAVTGHEST
                     SWLCGEVHRGNRLPCHIDDGLSNATDLYELLHPRFTRMTYVAAHYNAARTTVELAHEV
                     RSLELHQRSVPRLIECTHRHWMRCLMRAVLRAWKRLCHERKVQEQRQRARWAERWTCE
                     WVRIALRRWRGYGALTLQIAEADSLAKALLAKKRADIERLENESASMQASCAVLQNTL
                     HRQDEERDAVEGITVQREQVYKNLLQHVREIDRVGSLMLRSLLLPDAPPVLDEADALK
                     SLSAAVNALSGGGDRSSPAPSLNASQANLGCSAASSCLSTASDESVARHPPHTLVALP
                     TLLQWAQACVDTVQTEYVSFFPDDEDDDDDDVSEVTGEGSAKDVTAGQRPEEAKDVVR
                     ENVGLRDKRIASASPRLQAKGGSDTLDASSTSKMPVSRATSTDRASNASKKEVTRGPF
                     TGLEMLLNPAAAGVSASTTRSIAASDTVLVPLHMILLLMRGCCGVQDESRGAGHDRHD
                     ALATTTTTSVTITGAADASLTDHGSAATATVPSWDLVRTIELADRVILDECHTLLRKA
                     EQLADIDGGGGSAAVAGAAHAERRPPAPSNSEEASSGLVSVSAYGVSMHGLSSTTREN
                     LQQVCRVVVDTYEQLTGTACIVTVDQLFERSRGTLLVLIAALMRYYTNWSTRHRQQIA
                     PVSIKGKRTDLPASTAAAHEGKRHRLNDEWSHPPHSHRGWLEQVRRQAQWIALSFSAL
                     HNAVRFAKHSVNVLSIIEQERVARLLQRISLTEFIDILCRSPDQTMQSYVGIIGVVER
                     YAPSLDLVFHQYAVPLAQLCASSEAASTPTQCGDAKDDGDAYITGNTVWSLLCLTCLA
                     GKVPRLSGASSKGGVSLPSLRLAIPSPPLPATLHRPAVFSLIEYVAQRSVTSAGTQRP
                     RASMRSFSEDTASFPTSSSLASSPKKTMLPPRTKFARAVSVSRKGRPIPCYARALRDD
                     RHVDLRPDTGAVCVNYVQFVKLVIRLAHAWQCQQQQQPLIAKEKALHRAEAGEEGGQR
                     ATRSLMDMSSSSPLTGAAASARSSLTSFTVDNGGYSDQVRYEAIDYASPLCPSYFDTF
                     LGGLLLPRLLGANRWIGAVQRAFWRKPVLELLAQNHDALLTVFNTYQQPCESRGVRAA
                     LPPPFSAILASQVVTKAVDTEQHSTTSLVADGGHGLNHVEYPSLVHATRANSQIGGTA
                     TGTWPTGRKGSAELPIKPDPNHRKPPSSRSHPGSVFGARDVGIVSVLRWKNVQDMAKD
                     LEWHREARLTETGLRHCFNHVVADSAREGDVLFFAEFLQLLCAIAAYAAPDPTVPLEV
                     KLHSFLEIRVLTLLE"
     gene            complement(<514264..>520893)
                     /locus_tag="LMJF_16_1270"
                     /db_xref="GeneID:5650678"
     mRNA            complement(<514264..>520893)
                     /locus_tag="LMJF_16_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682156.1"
                     /db_xref="GeneID:5650678"
     CDS             complement(514264..520893)
                     /locus_tag="LMJF_16_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682208.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650678"
                     /db_xref="UniProtKB/TrEMBL:Q4QEP0"
                     /translation="MGCRASASRNRESSHGSRAASLGVSASPNTNADTRRAPKNWLST
                     SLRRSSRREAGVGKANSGRTRNGEPGLQQCVYTQDDNPLAPPPPLSSEMVHQGNSTPV
                     RSASPTSGRMSRIPSFRRHPSDSAPPRVKGGVSNHDSAVLERLYKERPESHFDPLLMP
                     DVLHLQESTGSRVASSSLPSRPSSCVATLDSEDHNATFRTEIDSHDKTDSAQAAKEYQ
                     QHVQARRSAQAAHTKRRQLEEFDPVRPMDSFNVTHRGLLGRCWDRRGPELIPVSFVHA
                     LEAALRAAEEIHPASTTTSHPPGAETGRDEFMPVSPRVALSQPMPCSPRGGGLGGRRV
                     PRCSHWFSVGGVSCDTMCPPVNGSGLGSQAGASIVSSYCMNSGVSSPITSWPGASGPG
                     FPLTTSSPALSRAGAAVLRSKAKSFMATAASSPAVYGGAIDSLSDDRDSDAAKPRQAL
                     KAEPISALPMEKREQYYNDFLTRNPLFMGIKDGFAFRLSDGVSEDPTTKFLRKRNLEP
                     APGVVAMRWNRVEFFHPTLHTLIRAVAMTQGMTLNVAHAELLQQASGTGARQPGMQHS
                     RLSPSASTNHMLHVTGEEGGAIAEMLLRHSFSQYVLSHIESGSFSRGSGSLNNSFLSQ
                     SDKLRGTGDGSGSHLSNSLLSPPRNRTRRPDKDGNGEAGAFAAAKFPEDSVLALALCI
                     PSSRLPSLMGALPPPQLSGVGRSSSYSASAAALKTSRDGDGSPAASPGPSGAPHAAFT
                     RAGSDGSVLVAFSVSSFSVSIDPFRWQEHRYIRYPIDIDDSKKSSRHTYGEGVVTDVM
                     YGGIMFVEGSSFTAVKELQTLLADMTWTEGRTLSGVVGDVRKYLKLVQGNGNKVRQAT
                     APQQQQQKAEEQNSHRYRICSRVGGRPMRDAVELQEISYYLDDVEVREEIVTLNPPIR
                     SDDVTAAKGAAAGPGGETGSSAGCFESKHACHGNSLAADPDVSPSFSRVASVWVTLPV
                     IAAVLRTWGLHLLSNPEFAQPTALLLQKYAGIAPVLQTTALGALHSDNDTPSEEVGDD
                     VDYLFFEGGGPAVTVPAAAAVCATHPQPAPRIPKFNCFYASKSSTPLLAADEHHTSHP
                     GAASHSPANMHRSSNVALDEQGANGADENQPSLKKLGEDTCDGLGPKSQSPEALKGEA
                     THLADSVNSLCTASEAKLGGDEQSSHALSFIDTEKDQCDSVRGKSCGTKRKRVVGKRS
                     GAANEGTEGAPRTLQCGSRGNKAKPNRATNRKSVSTRPATRCNSPLSPRSGTRPQSRR
                     SDADCDQGSPTSSSSSSSFPSFPAAMKAGTNDFQGNLSSLVTSSCNKLHQSAFQSVSH
                     SRLGRSTSAPSPSTPAARGEDTLRTSVPPTPLLTAVSSFTTLPTLSALTFDGAPVEAA
                     SAEPSVMASTVGPESSAAAVASGKKMGPDAVQEVSQVAFRSPHFPREPKTHLTMASSG
                     VNSRGAEMPLTHRDKATAAPSTVSAAAAPSPPLSLPLKVRRVKIIATPTTTTAPKGTS
                     AAAIVAMTTKLRGVTATSTCRKVSGPVKRAPVLIKHAQISVTHFVESEQRARDSPPSP
                     GASVLSTGITVNSAETSAAYRATDDEEEEMWHMAMLEVKAQQQELEELRQARRDAEDA
                     AKQREGLLRSLNRILLPHTAPQELGGVLLYLKTAIYEPEDMPHGRLFLQQPSWLPMLV
                     AVWTAPANRIRSVEIAAELTWVDIPRLGLVAGLLYHQYASGPLEELIIRADKLLGSPQ
                     ATATLPNNSGSYADLADKTAARPRKPRLLAGRSRKSKHGNNRGRSAGANRGRSNLNFT
                     TELDQVTSGFGPGCPPFLVTPEEARDTLWLLLCSVAANMRAPTFRVVLCGLPTGEISA
                     AASGSGAGRVRSHGRGHTPFTYLASFFDGAVSRFRNEHDDAQLLLKSRSMVLDNFVVC
                     PGSRLGSDRDMHSAAQRSDSSCLGTSTTHHNAACDEGQLVCTNSSLQLDEDGTAWLSS
                     MSERKGNSTLRQTLSLVIMSLPAAVSADMGGAACSSDGHRCNSNNTFAAVRPVVAPTP
                     CTGEAFAGVSISGGVDGTARAIEAVQTHRHRVQRHRAWVRNGNDVEERPFYELLVHRC
                     DAVEEATATTENDTDDARFYAEPDRQQRLQEAVSQSEAPPRLWQSPPPSPLPRHLPGS
                     GFAHGLRTAEDEQVALQSEVAALRERAGDIWEALRKSVKHYNQLQMEAYHKAMKQNGG
                     SQSPLSPPPQPPRQIVLEY"
     gene            complement(<522184..>522483)
                     /locus_tag="LMJF_16_1280"
                     /db_xref="GeneID:5650679"
     mRNA            complement(<522184..>522483)
                     /locus_tag="LMJF_16_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682157.1"
                     /db_xref="GeneID:5650679"
     CDS             complement(522184..522483)
                     /locus_tag="LMJF_16_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682209.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650679"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN9"
                     /translation="MGIQIPWLFVCVSTVPVFMIYTKTKRMDAREMHEIQMRVKYHSE
                     YWKKGNVFVKEFQDKVAAQVMLTADPLVGKDIASISSKELAAAENPVRARRWLLF"
     gene            complement(<523109..>525292)
                     /locus_tag="LMJF_16_1290"
                     /db_xref="GeneID:5650680"
     mRNA            complement(<523109..>525292)
                     /locus_tag="LMJF_16_1290"
                     /product="putative diacylglycerol kinase"
                     /transcript_id="XM_001682158.1"
                     /db_xref="GeneID:5650680"
     CDS             complement(523109..525292)
                     /locus_tag="LMJF_16_1290"
                     /EC_number="2.7.1.107"
                     /codon_start=1
                     /product="putative diacylglycerol kinase"
                     /protein_id="XP_001682210.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650680"
                     /db_xref="GOA:Q4QEN8"
                     /db_xref="InterPro:IPR000756"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN8"
                     /translation="MNNEVKPSDHESSPAAPSVHATECQNSNTNGTEVSPSSSSSFAL
                     EYGLDENNGELFSASDVTSANPSVLDPHAGGRHGRDSLPRKAFARALRSGRERAAVVE
                     IENAVPSVPATPVQLAQQSFQGCESGAHPPAEAAASGSPAQSPQQLIDWYARSYDSGV
                     EATYHYVVAFINLGSGETGVGEVVLGALCDELGTKRVMTLRGEVFMNPAPLRLLIKRQ
                     AVIYHTPDRPPCQQRGTVVVCGGDGTVSFIMTQLDLVRRELEDEFQPFLTASQVQLHR
                     ENSALVTSSLCDKPVHPYFTMPALAPLPLGTGNDYSNCVGFGYAFSSSGSDYRLCTLC
                     GCGVDAGAQVATALCDAVTAPCVSFDRWEASLVPLRVAQAAVRSESSQAAAEAAQGAT
                     PNVLSKARVAASEHAAASAGAQALHSPLWNRAARPTNVANAVCLVDWAKVHASRQCAT
                     YGVINYLGVGFDAYVVKKFDDTRRAHPTVCRTRAQNKAVYGVMGIRASFRCKKLQKII
                     PMVCVPRPQLSGSGVAVAATRSMGSTRDFVALQLPSTAKALVLTNVNCYSAGTHPWDP
                     KRGKLHYRPVTLRNGKVTPTLTTISSGAAVETLPTPTPRPVAINDCAFELQAMGGVLN
                     YTSLGIGLSTSTKLIQTDEVFVFVLCTPDDLHFPSGRCSAYTQLNLKEKYESRIESDS
                     SVRASLNVQIDGESMPPITESTIIHVRPQPGTRVLIRCRSASVVQ"
     gene            complement(<526432..>529425)
                     /locus_tag="LMJF_16_1300"
                     /db_xref="GeneID:5650681"
     mRNA            complement(<526432..>529425)
                     /locus_tag="LMJF_16_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682159.1"
                     /db_xref="GeneID:5650681"
     CDS             complement(526432..529425)
                     /locus_tag="LMJF_16_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682211.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650681"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN7"
                     /translation="MSYDTNLHRTFDYQLSPASLRIIDWAPVKAVARSVFQPGQGAKE
                     FTLVDDAASNASSAAAAYAQQENQRRVHESRESLASLSTPAATADAAAPARPLSAIGE
                     SAALEFPGLSAASPYYTPGMNSGAAAAAECSGGGHAELCALHVDDALPQQQRQQSDTW
                     AATPGEPAGGAATGNTTATSEALRHTVASSAETTSAVAVPATAVLVNGSGTGTPVAVM
                     DSAQRPRTSSPLAAPPPLAKGVSQYGAAGMMYGFDAVYHKDSFGVLAGLFTGAGYHQV
                     NTHYRQEQPAPPRRTEPVKGEHGSWAGALGATARTSPDVVTSAVPTPRSCSTTRVAAN
                     RSSSEPGPSGAVDAAVMPSAVELQAAENCAPSPPLTLQPRLEHVIASQRHGQLQVYNA
                     LQVFWYWGARRWTGVLNVRVTPLPSGDALLPVCEYVARTVMTECSLVIDDPVVYLHSF
                     VVMLGRRTRTAEELGSGHSTGAAVVGTEVQSGNEPYQAGSRHPLEALAAASLTDEATG
                     TAITGAQHHPAEGTGHLSVPLAPGAHRDSIQSKAGRPTEGGTAAGPPGNAGVASISLS
                     SNATPSPPDRHSPAMSSAQHKHRSPPSVCTATASDHAHSAAQYNVAVPPDAAAVDNAG
                     GAPLPEWLYWYQRCALETTDEWLWNRAASEVAEDAARSTTPWWKPRHIKMGVGLALRY
                     RKPRGVNVYWGWSARVGRGMHISGHIDVLRRMSCAVSSTFGFLDWSVRLRVNLVTLHQ
                     TALDAGVCWRPMPQVPEFAVRLATSANGTTLGVEIADVAPTLYGPVIARLSDWRSRRH
                     HAEAAEPCKGIGGSGEDCMAGADQSSVSDGAPTGVADGNREDLVGLLPITWHYLQSTG
                     STINSAFSSVKGAVTNTLASVSSASSGAGSSCGGGSAANTPAAQGSVSDVRRRPALLS
                     ATPTLTTPATSPTLPVGHKLSHVMLPAGKASLRYARNAWQALADLGWLENMLSISHVN
                     VSMGVTSEPSNRHREWSLFLIISEK"
     gene            complement(<532864..>533205)
                     /locus_tag="LMJF_16_1310"
                     /db_xref="GeneID:5650682"
     mRNA            complement(<532864..>533205)
                     /locus_tag="LMJF_16_1310"
                     /product="putative cytochrome c"
                     /transcript_id="XM_001682160.1"
                     /db_xref="GeneID:5650682"
     CDS             complement(532864..533205)
                     /locus_tag="LMJF_16_1310"
                     /codon_start=1
                     /product="putative cytochrome c"
                     /protein_id="XP_001682212.1"
                     /db_xref="GeneID:5650682"
                     /db_xref="GOA:Q4QEN5"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="PDB:4DY9"
                     /db_xref="PDB:4GED"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN5"
                     /translation="MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLF
                     GIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQER
                     ADVIAYLETLK"
     gene            complement(<535832..>536173)
                     /locus_tag="LMJF_16_1320"
                     /db_xref="GeneID:5650683"
     mRNA            complement(<535832..>536173)
                     /locus_tag="LMJF_16_1320"
                     /product="putative cytochrome c"
                     /transcript_id="XM_001682161.1"
                     /db_xref="GeneID:5650683"
     CDS             complement(535832..536173)
                     /locus_tag="LMJF_16_1320"
                     /codon_start=1
                     /product="putative cytochrome c"
                     /protein_id="XP_001682213.1"
                     /db_xref="GeneID:5650683"
                     /db_xref="GOA:Q4QEN5"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="PDB:4DY9"
                     /db_xref="PDB:4GED"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN5"
                     /translation="MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLF
                     GIVNRPSGKVEGFTYSKANAESGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQER
                     ADVIAYLETLK"
     gene            complement(<538444..>542469)
                     /locus_tag="LMJF_16_1330"
                     /db_xref="GeneID:5650684"
     mRNA            complement(<538444..>542469)
                     /locus_tag="LMJF_16_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682162.1"
                     /db_xref="GeneID:5650684"
     CDS             complement(538444..542469)
                     /locus_tag="LMJF_16_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682214.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650684"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN4"
                     /translation="MNRAASSALAPALNVNVPGNGTLYAGGSMSHERRRNISPDEVCP
                     PDTMLRTPPPTARNSVDAVRVAAHASSEPRYVKPDRLSLASEGASAAATERLPPLAGL
                     LAAANGPTATRARTVILRSTRIPLGRSPATSPVASTSTSHLAPPHAPTLDAWSSSTRA
                     PHPTVARQPPARTPPAPANAAGKGEAPVSTRDMEGMQEALKKFNARVLEENEKEKARN
                     SRRSSCAASWESSMVTLPVAHPTLSAASESLPKSNPLQASPSKDKNKISSTSSSHSPL
                     SAPASSSENGSTRHPEVSPHLVAQDPHCGLPRTVQPEQQQLRPVRSLPAGTSQSQRGS
                     SSTSPSDEVSTPPIIATPRSAKIVAGKPQIAAVKLPPSPGAPSPTMPSLPYRYAQGSG
                     AGAQKNERSAVGRPPTGLTPSTSPPLAVDPVYSAVEIQESSSVSTGSSGGRWGLLSDS
                     KRPHTSGINSWQATADKATVNATSSFSSAAASHPVRQPTLPGLRKSQNMDELGNVGEE
                     APAWETDAKPSYNHGASSGYPPGSPSRSDNLHDGGPHRLSHASTSGAGNGSPHTALRV
                     LSSTDEQPGNRSPNGAAPVKTSPLDNGSSRCGSAQCPDSALNHNSRYSPARVNSSATT
                     AAGRNANGQHGSSVDSAILDIDAETAALNSYLKEEDLNLSMSTFTNIGSILAQSLALR
                     VLNLKGSTIPSEGLRGLADIPTLKLVCVSHMRCLTTLVPLVTPTLRSNGRPCGIEEID
                     AQFSPLENEGVWGLEKLRRLRRLDLGMTPISDVTCLAASQSLNDLYLNGTRVDSQGLA
                     GLERVSTLTLLNVARTKVTSLKQIAKSRSIQTLIAYSCHITDAGLLGVGEMPRLRTLD
                     VSTTKVTNLSVLQKSRSLKWLRAQWLSLKNCHDIIQQRRAQLDGVTPDSSVAWRDTEA
                     GFSGLASIPTLESIDMSFNTIRSFHSLCNSKSLKHLILRRTRVDNSGIGSIAQLAGTL
                     ETLVITNLTDILDDSDDEEANGPSNAASGLLSIIGDILTLRRLTSLDLSFTDVYDLRL
                     LQELRVLRELIIVETLVTVDGLRGIEKIPTLETVDISQTSIVSLQFLVGGAPSLKKIL
                     AKSNRNVRGFNLGRIDQLRALQHLDVSDTVVEDIEPLLQSKWRLQTLVWRWKERRDSK
                     GPAPALECCVTSPCLAGVNTMPCLTTLDLTNSSVQDLAFLERSTSLTTLYLKCCRLLR
                     NSTIKSLGTLPALEVLELSDNRHISDVTCLRTCRRLRELRLNHTYVTKAGLKGVTDLP
                     ELMVLDIANTRAEDDVKDEDVNGALERSRLLEDSNVREGSTLLDSSVAPAQFRVPRRR
                     RVSFIANDGGEGLSSKTDRHE"
     gene            complement(<544494..>555770)
                     /locus_tag="LMJF_16_1340"
                     /db_xref="GeneID:5650685"
     mRNA            complement(<544494..>555770)
                     /locus_tag="LMJF_16_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682163.1"
                     /db_xref="GeneID:5650685"
     CDS             complement(544494..555770)
                     /locus_tag="LMJF_16_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682215.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650685"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN3"
                     /translation="MRPRRALVCALADSAIAAVRVLTTGTVTTSPAVLAAAALRQQRR
                     SVMEQSRPAFAAQRRRSSARKSSAKADVPGASAPDQTVASSWDTARAPLKDPEPRSSA
                     TANAQQQHLEDASPLKVAEEEAVTEATTSGSGGGGTLSAHTMLDTGRDAAQKQERLRL
                     AKLRYCLLVGAHSAMQSTAGEDCRAHAPSLTLEKVNITSKSATPVSGSSDAESSPTVT
                     PSKLCVKLPSPVQRARCGAISAPSATEQLSVAEALRVFANTFALTLHSTPQKWRTRVS
                     AATAPVLPVFSGPSTIPIAGAPLSSSFLCSPLAIVAAPAAVSSVAQRTIAVEETAPLR
                     WLETSFLDLCERLLRELYDEHAAATQRHDLFGKVQGQAAVVLRAVDKECRAVNSHVLH
                     VMRRQCRRDAAAKGSSTTGGSSRKRKLSRVPKDTSVEDTLQNTLERVGQELHLVHAWI
                     IHLCCDDGAGAAAAAAAVCVARRALRWDALRGAAATSTVTLDDVRWLFAVALLEHLHT
                     QTYCFHHAKTAAADHITDAAAAAHSGKTRMPSIVVEAHHLRGLAALIDFAMAQRLEVP
                     LLLATQLYSRGTAAFSLAAVAQQEALLDVIMVYHALLPTYALLFPSYHRVVVVAATPS
                     LTPHTQRYTARETHSATPRELVLDDGEADAEAYQVIAPAAVDYAKEEDGNDVGNDAAR
                     ELADRGAAAASPLRVWDVLVQHWERQQEQVRNEGAAAVVWWLRMLPLWISTATDSLQL
                     CLILVSSSSGGGSGGDAVRTAEPMKELLDRAAAVLRDALRFDRREYERSRGAQRRLTM
                     RSASARSDASPLGDEDGVSTGNETGKADKAGDFGTAAAGAAGATEAQYALANDNGLPA
                     DAPPPLRRQRGKRSLFYKSPHESDGGVLVRESQGTSARGGANGVGSSARSRFESRSRT
                     TAGLAARYASSATGVFGSPRGGADGHAAGACPGRHGRAASAEAAADRYTSPIFQTLVL
                     SSETPVVLSTLFRLDAVRRQSCLEEAWAAIVHSQSELWRLLYNLPPAAGAASDAARDE
                     KVDRTTFLRNVLPVAVASLVGTAAEAASGINSNSSQRRAAATSSSARVPVHEETLRRV
                     LCTLQSAQEQLGLPLFESLHHVLVSVAQVLLRIERVSDRALLSCRTPQDCTAGKRAPL
                     DHVHQRQAFTHVLTIGTAILLAGNSLPWESAQVAWQLQQQQLRYPQIEFRSGAAVPQL
                     PRPRFVSAAMDAFAVQWTRAIVKDLSLLHVSCRQYADVVLANALEMLRVLQTPSTSAA
                     LPLFAKQVTAVALLRSLSVLAGQWRQRMDAAQKGFRVHRIAGLAEVQHDKVMQLHQGV
                     LDLLRDNGALRLLCGYATFAGELFEIHVRLKAKLASLVKWADMYLLPSLLPVVVAGLH
                     RSRSTHNAATHADMCEATLGLLSQLSRYAANPQMSVVEVVRTQWNQVLLQVSLYCIRT
                     AGRGGRKRAPDYGLPPPVLPSLDDVAALQRPSHGTDAAAAAREWAEAFTGGREPLFLA
                     LLDRSEALLGAPRGTRSSAVEVAEGATCALSAYIAAWDEQVRFGRCDWDATRPVSHEG
                     IADDPTVDTRELLAHLQVSYEGAQAFGRITSPAFRASAEVAPFMAAKPNNTRQLGFLV
                     RFMEQHLRVQERLSRLSDDELESFVLPWPAKDEAVPPAVQAVPRPSPPLPPSSLAASA
                     ATVSETAPLVLLDFAGYLSSRSVWAMVTWACNIAETVVKIELKRYRHIPETVQAVATT
                     AILTQLRAVPPPIRGAGKPPVNILRALLSLSDMVAGTTESLLGYHRRSVIRGLLSNPT
                     RDQYRVVTFGLKQATAYVQEEARQYQGLGTRESGACDDLASAMADGDTAADVETAAKT
                     EEVEEAYSADGALHFRTNADGTIDRTWLAAGPPGLPAPPRQQDVGIYYMKVWAAYAAQ
                     QRLRAAASEAATAEADAATATLVPYLRTDLNREYRFFLSCLVCLVDASMESALLYLRR
                     LQGDGEEDIRLLVEAAISEVCRTVSAIIHSLLNLSPEVRRACCQREEAELLWASLCIV
                     ATISAVVPRDPQERFFTPRCTDAIGRVFALTRWLVDDAILTMATPSTTNDEADSNKIR
                     EGTATVTSEAGASLVHRPLTTALVRGAQLLLRDPHSSQRMAIRFAVRQRERDDLSAVL
                     VALQVLVKSAAAYEPGRSLLHYVWAQLAVEVSQPLLGPAVATAAPPPARSAKSKKSNL
                     SAAAAATIHAAPTELNVAGTVISRSEYNTVLRGLASVCAALPPSSGRGGKLARDTTGD
                     AASESGLELATAGGSGVAGAGAGPVVCDVDAAVRHVVEDAAGFEAERRRCLNESASQE
                     EWHYAGVANSDEAAFPAAGHGPTSSLLLHPGQDVASEHPAFSVAEVMESGSMPTTAII
                     DAVIAHAAATVRAAGGRSSLDVNSIPGVARTAPAAADTVDAVDDDPATAVGFLRLVRE
                     FQRHATELLSLVPLRDIVARPQVEVFFACMSLLHGTVSAAAEDKVWALMTSKWTAELL
                     APSESTFLQLQELELAKVRELRAVTSRDLHSMADTHSRGGVDGAGHGGGSSSAYGSLP
                     FSAAVVDMFAAAGRAPTRRSAQSNAELSVLAAAERSMRHHWCAEEFDLPRHDDVSRLF
                     SNAGGVRKGPRNAGKDHRTQQRNGDRASTLELDPQATGMAALAAMPDPIPIPVVLTIF
                     KVLSRRPVEHAASGSVEGLSQTFDVHGGGMTSRQIAATTSWLAKGGSDGSSVDSARVR
                     GAEVERDCFAAFAEVFLTYTARAYWLLRPRLGDNAWVVWAIMEKSMAVYPTDNGVRQR
                     EWDRVCRQWRLPVSLDRAHAVAGHFFTEEQRRRISAWTAALHAAASGESASTSVSTKT
                     VDGAEEVAVLRYLQAAALYLHLLAMTLLLLSRLGIFGDLPKASVEVVRRRVQAQVLQH
                     RLPGSRSAATTSSAFLVSNEALTRELTLMALERQTQPLFVNRNLFEGAVLQFLNVIWC
                     IVRHADSLTHTATDVVVARLQVPDPTASMGSAAAKALRATPPTAVAAAAIVSYADHVR
                     IMVVGVVQDTLDMVTGLGCRAPAMLPQHAVKSLLTSGFSCEPLTLRLPAHRTRSATTT
                     AASSMHSSHSSTRTDHTTDGLSAPAVHVIATHLSTTASVSSAMVLEDALLPTPASAAA
                     LLSATPELAVSSVFNPVARPELFVGSPTMLAILSPQFVRSTICRSLDSKVTSSTLLPV
                     AFALEFYLSRQGVPLAPLLEATTELLTACTLRNSAVHMYCEHLASELTSRKEFRQALA
                     PPTIASAEQGAAGSISNEVVISFLAAIARQDVLVTKKTLAHLLHSVMRMRPDVFGQPP
                     TENRQGKLTLVQVGTTVDSAIDTTNPLYTPAQPAAKRGSGTGAVTPSGSTPGGSSDAD
                     GPRDAAAVMNAFNLEKWSDATAMTHRKALAALTISLPTVVEVAMHMNWMRPLDSSEWR
                     RAIQMLKAADEARRERVAVHRSQAQAAMQQGRAGTEQDGEGSAGKKGQITDSTAAAAG
                     KLDASLRLEDPFDFGVGMLHLRYALRKIVHASLRRLLHQQGPRMLADVASMLQMVDPA
                     LQRATSTAQASSSVAGDRNDGARNRRKWSSPLVHGVSAHGAGRSAEQPRPFDGVLAGT
                     TRVLLSRAVLCAQAIGYDSTGAALEMSPRSGSSQSQEAQPVLKLPVPALQPSVVEAAI
                     SATASAASQHLRKGRHVQAGHSTGKIGLLSKEEKATVHQRVELERDAATTVGLTTAQL
                     PPQSARRIARALRFTRHRVKMKQRQQEYRMRREKPRLSISAAPHHVSSRCASVSETHG
                     SR"
     gene            complement(<557621..>563050)
                     /locus_tag="LMJF_16_1350"
                     /db_xref="GeneID:5650686"
     mRNA            complement(<557621..>563050)
                     /locus_tag="LMJF_16_1350"
                     /product="putative DNA-directed rna polymerase I largest
                     subunit"
                     /transcript_id="XM_001682164.1"
                     /db_xref="GeneID:5650686"
     CDS             complement(557621..563050)
                     /locus_tag="LMJF_16_1350"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed rna polymerase I largest
                     subunit"
                     /protein_id="XP_001682216.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650686"
                     /db_xref="GOA:Q4QEN2"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015699"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN2"
                     /translation="MSLTTAFPFHAYVGDLRTRTVHERKSGVSLSLMTSEDMARLAFV
                     EVRVRCGQEDRLAPWTPAVRRDGTHATFYDTRMGNFDARTFPPQACSTCCNTLNSKYG
                     NERCQGHYGYISMPRRYPNDPNRSQERLSVINPHLAQEVEQLLQAECFFCHRFRVPEF
                     DVTRYQQALRLVDSGLIGEALRFLDMVANAHGQDMRSRRRRDANETVINDIPLMLDHV
                     DTLLRRRGAAAPPLPGVTSGEAGAHGNANGDAGAAGALTHVDGSDDGFRKPVLDVRNE
                     ICKQALRSFREFGNVCSHCQGISPRITTKNGHLFFFFNKKNADFNVANGGVTTAQLRE
                     WEEMNRRQGRSHTYFRTSWVREHIKQLCQRESAILAALFPHLGEATLHMPYACSLPSM
                     YYYKVFFVDKLLVPPLPLRLSSGVQISESGGIIPDTGTRALSDVLEFVEQIEAYYVLA
                     NNSTPERNLVSAAQEIAQEHNLRNLQAKVTEVYTDVLEGFAKKEGLFRMHMMGKRVNQ
                     ACRSVISPDYLVEPNEVLLPRPFARALTFPELVSSYSPARMMFLKRCVMNGPDVYPGA
                     THLEIGLPSGETRFVDLHVPELIRRQHAMKYFAMAQNGSLTVHRHILDGDHLIFNRQP
                     TLHKVSMMAYRAKVLSGLKTLRFHYVNGSSYNADFDGDEMNIHVVQSLEAKAELECLM
                     DANLNYLVPTSGKPIRGFIQDHVVAGVLLTLRDNFLPHHTFVQFVYNGIAPYMQKQGK
                     PLSALATLTELIPVPAVLKPRPLWTGKQLISVIVHYVTGVVESRGGAPRSNGVSMHGT
                     SLIQPSTYTTTDPHTGELVTASRKCMEDDHVQFFESELITGILCKNQLGSSNLSVVHV
                     IHEIYGPHMVGELFGALGRVLSMSLQREGFSIGMDDMILLQEERRTALLRELDSAPLN
                     LPDDEARVMPVIMGMATSLQKEFVPGRMLRPFPHNQLLTMTMSGAKGSNTNAIQMSLG
                     LGQQLFDGRRVKRMNSGKTLPPFFVAEKRARSLGYAIGRFTSGIRPAEYTFHAMAGRD
                     GLIDTAVKTSRSGHLQRCLVKGLESLVVQWDHSVRDANGSVIQFLYGGDGLDPMRTSS
                     LQAWEVVKDNCIDLGRKMNVNTGVVTGEEAAEEAASRNSQGKRERAHEAAAAMRAAQR
                     ALLEAEAQRDPLPAHCKASLGTYLETKAQYPLFKKVSQVARWVKNGVLNEKLREKREE
                     SIRYYRDVMTELTTRRRVRAYCDAGEPVGLLAAQAAGEPSTQMTLNTFHSAGSTVTHV
                     TEGIPRLRELLIYASVQKVAIVVPVEKATEVDEEAISRILQAGVATRLTDCMARVPAA
                     VTAGADSGAAARAQTTPGYHYRVTRSAEGTQVTVALLFSKTLLMQKQHAMCMSTAEHL
                     QSFTQTLKNFARQVVTALRGRSKDEREGAGGPLRGTTQDPSSQMDDGTAAAGGGMSDN
                     EDDMDERSTQMNTPALGAASAPSVAGSELGRDDMIPERDDNGGSSGSDEDDYDEAVDA
                     ADSSRRRKGGKGNSPLRKKSRAEEDDNEEDDEDVNGLFWKSSSNGGTNSEAAAAASGK
                     VSYDCFPTVCVMYGNKKYRVEIAPLLREAATRDGVVPLPEDLFVVNVSIQTSDQVVTV
                     IPDVLESALAQQTFPSWLTQFDSVTYTRKAEDPTSGEMVFQGSSATIRSVTAFLALFT
                     VRARAIKLQKARSTDIRDMCTSFGVESGYTALFDELEKLFKRYSVDYHHLTLIADAAT
                     HRGVWENYNFTGVISHSASPLFQMTFASSKRFLHTALTRGIGDELNSISSAIMVGERP
                     RVGTALVKVGQDPQILRDVIEKNFA"
     gene            complement(<565462..>567261)
                     /locus_tag="LMJF_16_1360"
                     /db_xref="GeneID:5650687"
     mRNA            complement(<565462..>567261)
                     /locus_tag="LMJF_16_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682165.1"
                     /db_xref="GeneID:5650687"
     CDS             complement(565462..567261)
                     /locus_tag="LMJF_16_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682217.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650687"
                     /db_xref="GOA:Q4QEN1"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN1"
                     /translation="MSAHRIFLGLAIAAGAALSYHFAYLLGLITYGVAVCALCNWWMS
                     AFMRAGPRTSRQIPQQRIAYCQQLSALELSKAYREGQLSCVEVISTFIEHIKAVNPYI
                     NALVFDCFDEAMEAAVEAENVWAAWREHKDPKRMPSWLLGVPCTIKECMECRGCPNTS
                     GNPNRRRIISEVDSPVVKNFRDAGAIILGVTNTSELCMWYESSNYMYGITSNPYDTRC
                     LVGGSSGGEGAAAGAAFSTFSLGSDIGGSIRMPAFFNGVYGHKASPHYITNAGQYPGA
                     KTSANHYMATGPICRFPEDLIPLSEVAARGGFRLDPVVYPPCSPLKKVLDLNHHPLRV
                     YALEDYGLPGIHVSESQIEAVHTAAEALRERYNAKVAYVNVRTPSRSTGGAVPPEFQS
                     FARILPMWVSVLTKDPTEAKFSLFMSQGHVGGVNWLAEAVRWVFGRSHHTLPAIALCV
                     LETAELVMPRWLKISCDEELLPFKMGLESLLAVDGIIIAPTFPSAAPRHHFPLWNPFQ
                     FQYTAAFNVLQLPATACPVWPGSLMANRRKSISIHEERSMRLPHDFHLPKGVQVVSAT
                     HQDELCISVAIALKDALGGYRYPSWAMLEGADY"
     gene            complement(<569548..>569874)
                     /locus_tag="LMJF_16_1370"
                     /db_xref="GeneID:5650688"
     mRNA            complement(<569548..>569874)
                     /locus_tag="LMJF_16_1370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682166.1"
                     /db_xref="GeneID:5650688"
     CDS             complement(569548..569874)
                     /locus_tag="LMJF_16_1370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682218.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650688"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q4QEN0"
                     /translation="MAANGNRHASDAEAAEGHPFLGRELRVELTDGRVIVGTLIAYEG
                     SGDLLLQAAVEQRVYKDGEVTMRGLNLLAIPFKHVKGLHRRQPGLGPIVLTSGETERE
                     TPALMV"
     gene            complement(<571444..>571992)
                     /locus_tag="LMJF_16_1380"
                     /db_xref="GeneID:5650689"
     mRNA            complement(<571444..>571992)
                     /locus_tag="LMJF_16_1380"
                     /product="putative small GTPase"
                     /transcript_id="XM_001682167.1"
                     /db_xref="GeneID:5650689"
     CDS             complement(571444..571992)
                     /locus_tag="LMJF_16_1380"
                     /codon_start=1
                     /product="putative small GTPase"
                     /protein_id="XP_001682219.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650689"
                     /db_xref="GOA:Q4QEM9"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM9"
                     /translation="MGQAKTKLNIIICGLDNSGKTTIINFMKPENQRSENIAATVGYN
                     VDSFKKGNVYITAFDMSGAQKFRGLWESYYSNIDGVVFVIDSSDALRLCVVKDELEQM
                     LNHADLKACTVPFVFFANKMDLAGAKTPMELTQILQLNSLMGDHPMNIFTSNALRGEG
                     IHEGMDWLRSMMLRRLEQSKKK"
     gene            complement(575232..578044)
                     /locus_tag="LMJF_16_1385"
                     /pseudo
                     /db_xref="GeneID:12981433"
     misc_feature    complement(575232..578044)
                     /locus_tag="LMJF_16_1385"
                     /pseudo
                     /db_xref="GeneID:12981433"
     gene            complement(<579666..>580529)
                     /locus_tag="LMJF_16_1390"
                     /db_xref="GeneID:5650691"
     mRNA            complement(<579666..>580529)
                     /locus_tag="LMJF_16_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682169.1"
                     /db_xref="GeneID:5650691"
     CDS             complement(579666..580529)
                     /locus_tag="LMJF_16_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682221.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650691"
                     /db_xref="GOA:Q4QEM7"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM7"
                     /translation="MEYAQKSARLPRSAEEKEQWKRVIVILEHCPLQTIQTDRGFELL
                     SDRHRSYHARHNQDPADWRPDVVHQCLLHLQDSPLNRAGMLEVFLRTKKQVCIAVDPR
                     LRVPRNVRLFEKMMVSLLFKLKVRASTGYLSLLRVVGNPITDHIPAGTRLYRVEKDGD
                     LIDPFTFCASCGYAADVLDAQRTDRKISLARRRLTSSTSGTLEETTAEAGTEEFAKAQ
                     RKAAERRQFQPFAFIIGGMSRGDVSVDYARPGEVSSIRLGDRGMSAAAVISTLLHGFE
                     EEWLREDNEAC"
     gene            complement(<581736..>582326)
                     /locus_tag="LMJF_16_1400"
                     /db_xref="GeneID:5650692"
     mRNA            complement(<581736..>582326)
                     /locus_tag="LMJF_16_1400"
                     /product="trafficking protein particle complex
                     subunit-like protein"
                     /transcript_id="XM_001682170.1"
                     /db_xref="GeneID:5650692"
     CDS             complement(581736..582326)
                     /locus_tag="LMJF_16_1400"
                     /codon_start=1
                     /product="trafficking protein particle complex
                     subunit-like protein"
                     /protein_id="XP_001682222.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650692"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016721"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM6"
                     /translation="MSSSAHTSTSAAQLGDAAFDNNVKMSAEFLALTYGALVQQMVEE
                     LTQEDAVEQVNQQLYNMGHRIGARLIEEYSVRSGAAPCRTFSQAAEGVALVGLRMFLG
                     VSAEVAQVKDAADTFAISFQDNPLALFVELPDGPLREYLWYSNLLCGVITGALSLVGL
                     QTEARFSRDRLRGDSKNEIILHFKGRERETFQVERN"
     gene            complement(<583138..>584706)
                     /locus_tag="LMJF_16_1410"
                     /db_xref="GeneID:5650693"
     mRNA            complement(<583138..>584706)
                     /locus_tag="LMJF_16_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682171.1"
                     /db_xref="GeneID:5650693"
     CDS             complement(583138..584706)
                     /locus_tag="LMJF_16_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682223.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650693"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM5"
                     /translation="MEMDPMTRQEAAKVENVLADLAEELQILTFLPDEFSSWVRDESV
                     VAATLRDTNMYLHRYEEHVARKTKEAGAKHDVIRGTPTVAGLRMSALSSRSSSGRSSS
                     CCSSWANTGRHGDGAASDLPISSSSSSLTPEYEEERQRAVKAACFVYAAGHYGDLTAN
                     DDNEAVLQVSDYAQLERDLLAGAHTTGSVDEADLQAHHLSTRALIDTLRDGGYGDIMK
                     YHVKHLYMPHLSSTAASQQPDPSVAASDSRALSRAYSCGMIDENLDHLRGLVVTLHRL
                     IRQRNQSTVNEDIHRYQLLHDAVNRDQAGTADVQVLNQRYLDMKAARQREVAGLDREI
                     EALEEELQYVQRTADIELEAFQSMQETVQEDRRCSLRQQLEVHRKNADEMARRLQQAQ
                     ATALDELNTLRSNRTKREAAVSGTITEYDAQSALLEAAMRQFNQEAEEDTERIVALEE
                     VVEKLHKEREEHAWEAMVAEQRQEHAKVICEHQEHDARVIQAYYRAFIARVHTQRELE
                     KNTRKRKKKGRAKK"
     gene            complement(<586907..>587977)
                     /locus_tag="LMJF_16_1420"
                     /db_xref="GeneID:5650694"
     mRNA            complement(<586907..>587977)
                     /locus_tag="LMJF_16_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682172.1"
                     /db_xref="GeneID:5650694"
     CDS             complement(586907..587977)
                     /locus_tag="LMJF_16_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682224.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650694"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM4"
                     /translation="MPRATFMSGSIRRTGSSVGSKAFMPRLITAAPDYTAYPSDVSKY
                     LKDVIRRREEALMFKLLPTAQLMDQAALQAQAAYELIVQQEAFEFLQICHKRKEVETK
                     RREQECTKAYKERMEEQKRQHKEEMAQQKNDVAAMAKQTETEIKEKLKTLVSLHPKLN
                     VVSAVMAQLQDPASDCALLGALMMEEKQLQKALRGDARYNKSKTAETDGGAVPYWWKQ
                     CVCSSFNVSAMLRQEPHRASIVDVSFATKTPADKKVIVVKDGKGNIVAWAHTRSGPDP
                     NALAEAYLAAKPEVPELPANAYKGVLWPKEDAADVVRKAKAAKSPTADILPEVITILS
                     YSDMGSLEMSKKDVAAVGEATY"
     gene            complement(<591295..>593094)
                     /locus_tag="LMJF_16_1425"
                     /db_xref="GeneID:5650695"
     mRNA            complement(<591295..>593094)
                     /locus_tag="LMJF_16_1425"
                     /product="paraflagellar rod protein 2C"
                     /transcript_id="XM_001682173.1"
                     /db_xref="GeneID:5650695"
     CDS             complement(591295..593094)
                     /locus_tag="LMJF_16_1425"
                     /codon_start=1
                     /product="paraflagellar rod protein 2C"
                     /protein_id="XP_001682225.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1425"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1427"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1425"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1427"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650695"
                     /db_xref="GOA:Q4QEM2"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM2"
                     /translation="MSIAADMAYPAEAAAAADVSEVSDITLEAARKQKIHNLKLKTAC
                     LSNEEFIQDLHVSDWSETQKQKLAAAHEKAAELLAAAESGTKWALTEAYDVQKLMRVC
                     GLEMSVRELYKPEDKPQFMEIVALKKTLNELKQHPNKTRTVSLTGTIDNGVVKMEKAE
                     EELRQSQLDASDLAKVPVPVLKSLEDCMNVTVVQNALQGNEDQIAAQLTSIEKACEIR
                     DVAIADGEMAIAEEQYYIKAQLLEHLVELVADKFRIIGQTEDENKSFDRIADTQKRAF
                     QETAALKDGKRRLKGRCEDDLRSLHDAIQKADLEDAEALKRYATQKEKSEQLIAENVE
                     RQEEAWRKIQELERALQRLGTERFEEVKRRIEENDREERRRVEYQQFLDVCGQHKKLL
                     ELSVYNCDLALRCAGMVEELVAESCSAIKARHDKTGEELAELRLQVHQEYLEAFRRLY
                     KTLGQLVYKKEKRLEEIDRQIRTTHIQLEFAIETFDPNAKKHSDVKKELYKLRAQVEE
                     ELEMLKDKMAQALEMFGPTEDALHQAGIEFVHPAEEVEDGNLNRRSKIVEYRAHLAKQ
                     EEVKIAAEREELKRTKVLQSQQYRGKTVRQITE"
     gene            complement(<594664..>596463)
                     /locus_tag="LMJF_16_1427"
                     /db_xref="GeneID:12981434"
     mRNA            complement(<594664..>596463)
                     /locus_tag="LMJF_16_1427"
                     /product="paraflagellar rod protein 2C"
                     /transcript_id="XM_003721743.1"
                     /db_xref="GeneID:12981434"
     CDS             complement(594664..596463)
                     /locus_tag="LMJF_16_1427"
                     /codon_start=1
                     /product="paraflagellar rod protein 2C"
                     /protein_id="XP_003721791.1"
                     /db_xref="GeneID:12981434"
                     /db_xref="GOA:Q4QEM2"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM2"
                     /translation="MSIAADMAYPAEAAAAADVSEVSDITLEAARKQKIHNLKLKTAC
                     LSNEEFIQDLHVSDWSETQKQKLAAAHEKAAELLAAAESGTKWALTEAYDVQKLMRVC
                     GLEMSVRELYKPEDKPQFMEIVALKKTLNELKQHPNKTRTVSLTGTIDNGVVKMEKAE
                     EELRQSQLDASDLAKVPVPVLKSLEDCMNVTVVQNALQGNEDQIAAQLTSIEKACEIR
                     DVAIADGEMAIAEEQYYIKAQLLEHLVELVADKFRIIGQTEDENKSFDRIADTQKRAF
                     QETAALKDGKRRLKGRCEDDLRSLHDAIQKADLEDAEALKRYATQKEKSEQLIAENVE
                     RQEEAWRKIQELERALQRLGTERFEEVKRRIEENDREERRRVEYQQFLDVCGQHKKLL
                     ELSVYNCDLALRCAGMVEELVAESCSAIKARHDKTGEELAELRLQVHQEYLEAFRRLY
                     KTLGQLVYKKEKRLEEIDRQIRTTHIQLEFAIETFDPNAKKHSDVKKELYKLRAQVEE
                     ELEMLKDKMAQALEMFGPTEDALHQAGIEFVHPAEEVEDGNLNRRSKIVEYRAHLAKQ
                     EEVKIAAEREELKRTKVLQSQQYRGKTVRQITE"
     gene            complement(<598036..>599835)
                     /locus_tag="LMJF_16_1430"
                     /db_xref="GeneID:5650696"
     mRNA            complement(<598036..>599835)
                     /locus_tag="LMJF_16_1430"
                     /product="paraflagellar rod protein 2C"
                     /transcript_id="XM_001682174.1"
                     /db_xref="GeneID:5650696"
     CDS             complement(598036..599835)
                     /locus_tag="LMJF_16_1430"
                     /codon_start=1
                     /product="paraflagellar rod protein 2C"
                     /protein_id="XP_001682226.1"
                     /db_xref="GeneID:5650696"
                     /db_xref="GOA:Q4QEM2"
                     /db_xref="InterPro:IPR007824"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM2"
                     /translation="MSIAADMAYPAEAAAAADVSEVSDITLEAARKQKIHNLKLKTAC
                     LSNEEFIQDLHVSDWSETQKQKLAAAHEKAAELLAAAESGTKWALTEAYDVQKLMRVC
                     GLEMSVRELYKPEDKPQFMEIVALKKTLNELKQHPNKTRTVSLTGTIDNGVVKMEKAE
                     EELRQSQLDASDLAKVPVPVLKSLEDCMNVTVVQNALQGNEDQIAAQLTSIEKACEIR
                     DVAIADGEMAIAEEQYYIKAQLLEHLVELVADKFRIIGQTEDENKSFDRIADTQKRAF
                     QETAALKDGKRRLKGRCEDDLRSLHDAIQKADLEDAEALKRYATQKEKSEQLIAENVE
                     RQEEAWRKIQELERALQRLGTERFEEVKRRIEENDREERRRVEYQQFLDVCGQHKKLL
                     ELSVYNCDLALRCAGMVEELVAESCSAIKARHDKTGEELAELRLQVHQEYLEAFRRLY
                     KTLGQLVYKKEKRLEEIDRQIRTTHIQLEFAIETFDPNAKKHSDVKKELYKLRAQVEE
                     ELEMLKDKMAQALEMFGPTEDALHQAGIEFVHPAEEVEDGNLNRRSKIVEYRAHLAKQ
                     EEVKIAAEREELKRTKVLQSQQYRGKTVRQITE"
     gene            complement(<602882..>607279)
                     /locus_tag="LMJF_16_1440"
                     /db_xref="GeneID:5650697"
     mRNA            complement(<602882..>607279)
                     /locus_tag="LMJF_16_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682175.1"
                     /db_xref="GeneID:5650697"
     CDS             complement(602882..607279)
                     /locus_tag="LMJF_16_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682227.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650697"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM1"
                     /translation="MMEAAPAEQRTRFARGDASAFDSVVGEAVSHVPCSWDSCAGVAR
                     CSSLSTLATGAPTSGTPAGVKDRELDLRMEVVPSGGSTDDAQAWRMLSVPTELAWCAL
                     GSHSEGEASSSFSAADPSAVDASPFTAEERGYWSSYFTITASSHGAAKCHATAGVCRD
                     DHEAPHGGVPDLPRLRLTPCVTAWILEAAATLMRAKSNHEAVNDGLVDGTAFSAVPAT
                     TASACFEQATLYLLRWRRAQLQRCLIGEVHEAALHAGAEMLAVGEASTTVRRASAGRY
                     HEPQRTAESPLRWSPVSFLRDALLCTYLYAAQPATAALEQETVINEDVAGANATTTRG
                     INPDRRTTLLDVFLDCVCTSDATASSKGVASAASVRDGGLFSAGCRRAPALLSSSALT
                     QPTLMTARSSASASMRHFHMAWDEAHAVVVQLHKGLIQCFGERATMAPAVAAPLCLYT
                     QPAMLHVVSSLSVGFARCHETDLRRAAGWKPWTAVQMFLKEHAAVYNADTYARHHMPA
                     VRLGLHNSLLNALLLLTTYHADTAFQLREPSDVPRVLLSSPAVDFAASKGRTAAPYKA
                     AERQAISWWCMMQQEAPAYRHQNLQSSIAISMGFLTALQEHSREQLEVREALMREYEQ
                     RRAAYERNHKEEQGGLSHSFSGGGPSRVRKYYASSSQSPEERLAEQRQRLEELRGVAL
                     IDRLLPFGSATVSPDATASLLRQLLEGGHPYKALKLAASIVHASRMLRHADKQPRPSL
                     QQGVRTVHTRVWSRRSQRHVLVKKHVPVLRLVGDPNAEGSDDDDARPGAQARRSVRPV
                     GLAFVISDRVVVEMARVGLRMGEAGAALVNGIVQDCQRGALLDFTHRRGLPVPLWEDI
                     ADMLSKARLAQSLFSMVTPASASVAATAPSQQLHECQAHSARRRGTEGSEAALLVIMG
                     VGGGEARLGRGDVDGYGAAHQRIAPTPALLEVLQTHTPPSNTAQHTAYLKLLLQDVAR
                     FSTVPVLLALQYQACFSRSRYATSRADGLAAATAAMQAAYVMTISAIGTASSFPESNQ
                     ASSCPTSAASAADGGDASRTYPTPAECSRLLRALHAEAEAQRPALQEAILSDASSLHR
                     HRGAADGVSSPSSPFALHTNPCLKEVKALLWGTSQEDDASRAGVRRDGEEGAAAVPAV
                     RRRAKLRLAVLLHHLWTSSILARSAAQQSTSLWAVCAATLLGVAEAALLRSQGSSDTE
                     RGGLEADGAGASLALHHAYVAAGPLLRHVAPQQSPLYVDATVKALLLCSPLACCEDSR
                     KDNGGVAYAARSSSSLAATPTRTTRTDGSLASTHRGEHPSDEWPMVLSSASAARVRSL
                     PAFLALQCSLCTALYTAEQCTLTAETPVPAHLASLLEGLAAARAAPPDRVREWPAWKL
                     FAPLLRQPVLARMWLHDALLCPSSNLLMWLVGALSRDDVEGYAMLRAWLEHIEAGPRL
                     TLAMLQELLAETERRHRSAVARRLRRQRC"
     gene            complement(<609166..>610083)
                     /locus_tag="LMJF_16_1450"
                     /db_xref="GeneID:5650698"
     mRNA            complement(<609166..>610083)
                     /locus_tag="LMJF_16_1450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682176.1"
                     /db_xref="GeneID:5650698"
     CDS             complement(609166..610083)
                     /locus_tag="LMJF_16_1450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682228.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650698"
                     /db_xref="UniProtKB/TrEMBL:Q4QEM0"
                     /translation="MNTGSATSAAAARSPSWVAFKNSDTAVPPSEDANAVDGVVVDSD
                     TAAHMKEAETSLRRTLQEARAALRSLQTITTTLATQDETLTFLEECVAENDEEWRQGR
                     REMRRTWHWYAAVAHWLRCGKGGSRSQVANKSPSAPPAARRLSGTAPVTDFSTCRRLK
                     HESRTRSEASGGITATQPEAAHFFNADALDNCNTPAKKGNSVQRTAVAEDISTDVMKS
                     PESITPSVHLGSRHRTAAEKHRVNRCVDVAMCDRMEPTLDEIRGIVGELHDRATMWNA
                     MLTSDVGRMDELIQRTDKTRAKNKKVERH"
     gene            complement(<611612..>618385)
                     /locus_tag="LMJF_16_1460"
                     /db_xref="GeneID:5650699"
     mRNA            complement(<611612..>618385)
                     /locus_tag="LMJF_16_1460"
                     /product="putative kinesin"
                     /transcript_id="XM_001682177.1"
                     /db_xref="GeneID:5650699"
     CDS             complement(611612..618385)
                     /locus_tag="LMJF_16_1460"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682229.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650699"
                     /db_xref="GOA:Q4QEL9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL9"
                     /translation="MRRAEAIKHNNRVNVYVRVRAFREDETSGDMGQLAVNMDDSAVE
                     VTVPKKGRFTFGFDGCFWSNDRACPSGKASASQEDVFDEVGRPLVENALAGYNAAVMA
                     YGQTGSGKTYTSFGPPGSIGTSQEGLIPRVCNMIFSRAANSAQKGVTYTVSVSMLEVY
                     LEDVFDLLNHRKQLSVRNDFTSNTFSVVGQKTVPVNSYMDVLAVLNKAEPLRTFAATS
                     IHDHSSRAHTLFMLEVQTHFDAPDLAPRCAKILLADLAGSERIRLAGTEEGLAFEQAR
                     NINLSLLALGSCIEAVATRGRGNSRPIPEFRNSTLTKLLKDYIGGNSISTMMVTISPS
                     ERDANLSVQTLRFADRAKQITTHAHVNTVDPQQAKQDGSELGDRWRDEYLRKKEALYA
                     EYQLKGTIEKLLARIAELEARLRECADDELALHLTTEIEELQKALTEADYQMGLQRQI
                     LYGEFLMLEDELRELNTKMQEMKEEHEEAMEGLLGEEAGRFEEMKRGYEARLRALQSE
                     SDAALAASTDEIAALRRLVAELQERLAAKETECADLADRLSALQAKYDADTCAGERAR
                     IELEAQLEESDKQLGELTERQARLNAAMESTAETLQETSAKLADTEETLQETSAKLAD
                     TEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
                     ETLQETSAKLADTEETLQETSVKLADTEETLQETSAKLADTEETLQETSAKLADTEET
                     LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEQTLQ
                     ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
                     SAKLADTEETLQETSTKLADTEQTLQETSAKLADTEETLQETSAKLADTEETLQETSA
                     KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKL
                     ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLAD
                     TEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
                     ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
                     LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
                     ETSAKLADTEETLQETSVKLADTEETLQETSVKLADTEETLQETSAKLADTEETLQET
                     SAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSV
                     KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSVKLADTEETLQETSAKL
                     ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLAD
                     TEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
                     ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
                     LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
                     ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
                     SAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSA
                     KLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKL
                     ADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLAD
                     TEETLQETSAKLADTEQTLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTE
                     ETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEET
                     LQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQ
                     ETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQETSAKLADTEETLQET
                     SAKLADTEETLQETSAKLADTEETLSAEIALLTEQLGVAHTLCEQQGAYMNQLLTYVS
                     AAYNVTLDGMTEVQATAVADILRQCDYALRSVAQAASDEVEHVKEMYNMVDGNYKETA
                     ARFDILRRILGKIDQDVKEASVEIDAPERRQTCSLHPTPRRLGDVSNRENSIENKTRS
                     ASRLSGRLF"
     gene            complement(<621484..>623907)
                     /locus_tag="LMJF_16_1470"
                     /db_xref="GeneID:5650700"
     mRNA            complement(<621484..>623907)
                     /locus_tag="LMJF_16_1470"
                     /product="putative kinesin"
                     /transcript_id="XM_001682178.1"
                     /db_xref="GeneID:5650700"
     CDS             complement(621484..623907)
                     /locus_tag="LMJF_16_1470"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682230.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650700"
                     /db_xref="GOA:Q4QEL8"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL8"
                     /translation="MRRAEAIKHNNRVNVYVRVRAFREDETSGDMGQLAVNMDDSAVE
                     VTVPKKGRFTFGFDGCFWSNDRACPSGKASASQEDVFDEVGRPLVENALAGYNAAVMA
                     YGQTGSGKTYTSFGPPGSIGTSQEGLIPRVCNMIFSRAANSAQKGVTYTVSVSMLEVY
                     LEDVFDLLNHRKQLSVRNDFTSNTFSVVGQKTVPVNSYMDVLAVLNKAEPLRTFAATS
                     IHDHSSRAHTLFMLEVQTHFDAPDLAPRCAKILLADLAGSERIRLAGTEEGLAFEQAR
                     NINLSLLALGSCIEAVATRGRGNSRPIPEFRNSTLTKLLKDYIGGNSISTMMVTISPS
                     ERDANLSVQTLRFADRAKQITTHAHVNTVDPQQAKQDGSELGDRWRDEYLRKKEALYA
                     EYQLKGTIEKLLARIAELEARLRECADDELALHLTTEIEELQKALTEADYQMGLQRQI
                     LYGEFLMLEDELRELNTKMQEMKEEHEEAMEGLLGEEAGRFEEMKRGYEARLRALQSE
                     SDAALAASTDEIAALRRLVAELQERLAAKETECADLADRLSALQAKYDADTCAGERAR
                     IELEAQLEESDKQLGELTERQARLNAAMESTAETLQETSAKLADTEETLQETSAKLAD
                     TEETLQETSAKLADTEETLQETSAKLADTEETLSAEIASLAEQLGVAHTLCEQQGAYM
                     NQLLTYVSAAYNVTLDGMTEVQATAVADILRQCDYALRSVAQAASDEVEHVKEMYNMV
                     DGNYKETAARLDILRRILGKIDQDVKEASVEIDAPERRQTCSLHPTPRRLGDVSNREN
                     SMERKASMC"
     gene            complement(<630987..>632909)
                     /locus_tag="LMJF_16_1480"
                     /db_xref="GeneID:5650701"
     mRNA            complement(<630987..>632909)
                     /locus_tag="LMJF_16_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682179.1"
                     /db_xref="GeneID:5650701"
     CDS             complement(630987..632909)
                     /locus_tag="LMJF_16_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682231.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650701"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL7"
                     /translation="MCEICGSLCCCRPLHRPPSPLLLVLLSHLSLSLFLTSGSGAMGV
                     CCSDCKRSDAEKNTKLMGQVTTRNGFKLMQNNALCFQPVAFDVVVPEGANMVTASPQR
                     GNVVFDCEVNNFSGTLSDASLHTIRDTITVDRSGNTCDPMNETLSNMSFTNSFYAVDK
                     RAVQMFMKNVTRLADRNNKGTMLEESFISANIGPDTCACNRSMLGSLNMSTMVQEDLD
                     YIAAGATLQDRIARLEEVEAVLRRSIDGSWRVDSMLLQLACCQILPTLRQRRCPWAAG
                     RSATQSKSTAAQQQSKRKPVLVIYAQGLQMDPSVITAPTSITASCPSPTLPSELSIGN
                     LNDGKEGGGNNNSMVLGASRSRASVSTAPTKVQQYELLALTCRGIDPHRADSALVENS
                     TWDFLSVSCAVAALNEGRCMFRFMCGPLAEADPETQGIVDAIINLSSFADEVKVNNVP
                     KVNVYNNEDAAKYIGIHVKAMYMLPGIMLKDITKDLVVSAEYQKACQPSENKIQECEL
                     DDTFRLTMTVIRFVFSLTIQFKVSEITDPAVLKSLAVCDGMVPAKVLMLERTKRQIAK
                     VDATAKVRSMLLYYPVNDGVLVDNHTVVLNTSLPKVVSRIMNNFGSQGAAQSVQTAKL
                     TREYLLQRFGDSRSKY"
     gene            complement(<635664..>636758)
                     /locus_tag="LMJF_16_1490"
                     /db_xref="GeneID:5650702"
     mRNA            complement(<635664..>636758)
                     /locus_tag="LMJF_16_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682180.1"
                     /db_xref="GeneID:5650702"
     CDS             complement(635664..636758)
                     /locus_tag="LMJF_16_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682232.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650702"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL6"
                     /translation="MSFLRNRFLHSAYDELVVVGSRWTRVLAVSVDAGEVGPPHVQSH
                     LAHPIITVIPTLHVAGIKFYDRVLEYIDHAVKRNKDTLVLLEGICDSEAAEKQQMQEY
                     QDIMQNDALRQTMLAKADDNTLYSPEVMREICQEVGIRYELLQSMESTVRLQECYLKP
                     KLAAMCGLNLRNHADLHMRDVQRLLEEESARLQTLGEHLPSSIAVSQLGSFPVIRKHR
                     ERKVAQVARMHCTRWFEQETDGEVIIPWGYFHTEAIIHYILEGNKSVSAAVDTNGGGV
                     ASSTGASGSAGAASPSDKASTRSSTGPGGLSAKAAAAGGGASAAVTIEHAPPRLVFVE
                     ADELFAKVPFSVPKELIERAPEVADSSKCS"
     gene            complement(<637833..>639539)
                     /locus_tag="LMJF_16_1500"
                     /db_xref="GeneID:5650703"
     mRNA            complement(<637833..>639539)
                     /locus_tag="LMJF_16_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682181.1"
                     /db_xref="GeneID:5650703"
     CDS             complement(637833..639539)
                     /locus_tag="LMJF_16_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682233.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650703"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL5"
                     /translation="MLRCPSLWLSKRTPGYVFWRQSSLTELEHSKRNYLLSERPVPLG
                     EISRRMARVKSRYEDTRDFHERNLLRGEYKYFTGKLCDLRAARLGDMVVVLQCAAFFG
                     FWDAAQVDQILAELFLQLEGMEAVELVALFACMPQLRRQESELYRRVAMELVPLVPDL
                     TTEECLAVCRACTAETPPELTEPVLRDLTEHLEEISPAQCVEVLDTWSVLPAAAQRRV
                     RDVMEPVRQRALCHLEELECMDIAVLFTCLQGAVSVGGADPILSEALQRRLLKAFVRD
                     ISRACPRSTAMLFSAVRGTHSLALELAQQMADRALFLSTDFTPAELLAVFRVYVEGLV
                     SLSALSAELRTPALPAGTASRVDVTAALHGSLSSAALLTSPLSLSSPSAARQRVLEME
                     QAAQSLSTLQRVGDALSAQLVEMLDSASAYLSVASQLEIVALYVDAVEQLAMGGTMGG
                     GDTCGGSGRDATAHLLQLLPQSRRALQLVSSKLIANMKSLSLAELLQLLEQANTLGSA
                     AVQDAAVAAAVQELITRDIDGLTTESALALEQRLRALTELRAEHQRRLSTALIPKVRR
                     LV"
     gene            complement(<641028..>641369)
                     /locus_tag="LMJF_16_1510"
                     /db_xref="GeneID:5650704"
     mRNA            complement(<641028..>641369)
                     /locus_tag="LMJF_16_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682182.1"
                     /db_xref="GeneID:5650704"
     CDS             complement(641028..641369)
                     /locus_tag="LMJF_16_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682234.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650704"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL4"
                     /translation="MSQKTQEVLTQEEINLRVRQGLQRRKKCSLCTQIFYVNELPGAI
                     THKSILELRQKWGMDVRRGEYMPPPSQLYKREEICIFCMQFFDTTGSMQTQQKLLAST
                     RDGISPALTLR"
     gene            complement(<642854..>646291)
                     /locus_tag="LMJF_16_1520"
                     /db_xref="GeneID:5650705"
     mRNA            complement(<642854..>646291)
                     /locus_tag="LMJF_16_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682183.1"
                     /db_xref="GeneID:5650705"
     CDS             complement(642854..646291)
                     /locus_tag="LMJF_16_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682235.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650705"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL3"
                     /translation="MSAEAVKRQILLSVDSLAISLNRVPSSSSIFEACAAAKLLRNRL
                     LRERTRVVERIEELRERQMYNEASDEDFDYDNGDAEAQLAGGDVSRTEFVFMCEMMVA
                     EKLVVPLLLAHGMNFSDTLLPQLLKLLAVMLLPIPRFSANEVLQKDMLQKIKMRCGTD
                     EFFALLVQCVAPIAEKRTAGELRLEDAIILEIVLTVITYLLDGHPMNTERIVGAFCRN
                     HGVELLLVVINQNYSRIHDINAAANRDTNNEVLNSLNGIKNESHERDTSGVDLKFDQV
                     RGEIHLEEEGSDVDLEDDDSLSASRSSDMMHRALDQEYQKQVDNLLESDEQLWKWNRL
                     VLGAMASIIWCVPAEELAHLTMLGHTSDSSPDRVLSSLLNGQHFRDCKKASDKWRFVA
                     RSRNGAVASNGILVRPSSGSVTGGRAIGTVFSLLGPRRKDPLEAMKDVDLRKRGRFVK
                     GMYQDLTPQCNIPLPTKIQLSHQNSAFLSFGFEPLRVMTFSKVQDAAAAVERATKEHK
                     EVVVGYKGSGETVEVTSPLDSAMYQNLGNVLHYMTICRCILRYVRFITEQLKTEQQSF
                     PVVFPQQWHSVSAIISLDNVELGFSVLSSFLDCTDIRRREDVSIVVEYLAEILLLLNS
                     LLQGEMAADPAVQVAAHALASSVLYKEENIKVVFGLLSEYSRWVIAIHKAQVFTLFTF
                     SVFQLMEKCSYKGNLLLPKRSKQQKKAVPADEAEDMGGVENQGDNESVDSAALEDLSE
                     EMLRGMADMIDDEKGDDDAWRPDFEASVQSSAAGERKVPSAAADLPEKTFEPVGGSSS
                     VDGDGLGPSERDTSQGRLPSIASSNRTALSTMSSEREVAVSGFFHRLASPKNISLVYS
                     TLRHWRVNDADVNIALTFLMDALVRHNCESVFFNIAFLLLMREVLVNGEKTHAPLYAV
                     CDRIVYDFFNPSFAKAQDARAASVLQHEVENGMLSGAQSYLGFEVSLRCTRALFNLGT
                     LDYTYIEEKGMSHLMSYTAIPLSHENSDAKREELTAVAAETISTRSPDFRAHCQCRTA
                     TSAGGTSQRDSSKLASEVEDGDERAVLSQSHAAGDGNDKRERGWKWRHRHGHGEKKRR
                     RHEVSDAVAADDDDVSGRDNESATDMTETDDGAAATAAQLGAVAAPLFDAAKGTSVI"
     gene            <649214..>650512
                     /locus_tag="LMJF_16_1530"
                     /db_xref="GeneID:5650706"
     mRNA            <649214..>650512
                     /locus_tag="LMJF_16_1530"
                     /product="putative endoplasmic reticulum oxidoreductin"
                     /transcript_id="XM_001682184.1"
                     /db_xref="GeneID:5650706"
     CDS             649214..650512
                     /locus_tag="LMJF_16_1530"
                     /codon_start=1
                     /product="putative endoplasmic reticulum oxidoreductin"
                     /protein_id="XP_001682236.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650706"
                     /db_xref="GOA:Q4QEL2"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL2"
                     /translation="MCRMNIEATIKCACSVLLVLFLVFTHEAPKTTAGPAVDFDNPVK
                     PLIVLDTTKLDYGYCHSSPGEIDEGTKSLLDILNRITVSPYFRYFKVNSAKPCPYWAV
                     SLLCTSAENTCDVCKCDEHSIPEALRANEDMSELNTPDGSVAKTVLQPVNLEDWGDWV
                     KADDGAEYVDLASNPEGNTGYSGPLAAQVWRAIYAENCLSSDIGGTCQELSILRTLLS
                     GLHMSINIHVCTSFYKDPELSSPQRNAGIYNNPNISFFPNCEMYNKRIAPFPDFVGNL
                     YILYQFTLRALAKSRSFFTNNVSIFNTGARGEATLTDLQLHDNIKELFNSRLLCSPTF
                     DEGAFLESEKARSLIPQFKAMMLNVTRLMDCVTCEKCRIWGKLETKGIAVAMKVIMNP
                     ENERITLDRSEMVTLVNLARQLAFSVRNAQRLGLVCREDD"
     gene            <651123..>655142
                     /locus_tag="LMJF_16_1540"
                     /db_xref="GeneID:5650707"
     mRNA            <651123..>655142
                     /locus_tag="LMJF_16_1540"
                     /product="putative DNA polymerase I alpha catalytic
                     subunit"
                     /transcript_id="XM_001682185.1"
                     /db_xref="GeneID:5650707"
     CDS             651123..655142
                     /locus_tag="LMJF_16_1540"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /product="putative DNA polymerase I alpha catalytic
                     subunit"
                     /protein_id="XP_001682237.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650707"
                     /db_xref="GOA:Q4QEL1"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL1"
                     /translation="MPGGNDGASWRPSRKPNAPNFDETQEDQWRSLREEMFQSDEDEN
                     IPESGDLAIPQFPSAKKAAKKLRKPSSGAKPTPKPKQQTLAQSMTDMDMERLLKRYRI
                     DEDVDVAEDIGVSHLLQLQSDSDDGGDAQEATLTADEFLARLTRAEAAPAASIAQEKH
                     ESEENTTVVALKEESFNFERDRSAKPLRPRPNPRAGDGAGYQNEETPKQAIELAATLA
                     PQTDAAQFVSPAVPYKSEEMTEGLFYWFDAREQPHTLSVDPGSLFLFGKVAVEKNGRT
                     SYLSCCVRVRNMYRSVFVLPKAGSSQQDVVKEINDICRNQGIEQRRIKFVERYYAFEV
                     PGVPHEKTQWAKLRYPGRYPPLNAKGPFRHILIIMGASSSLLELFLIKRKLKGPSFLR
                     ISGLVASPNRISHCALEFSVESPKNLRAEDTKLPVPPFTLASIQIHTQLDSKGACNEI
                     LIASVAIYKDVNIESTIRHIPDSILTGVRPASMNTPLPIDLESYCSAKGLPGVRRFAN
                     ERALLDWFAQQLGKIDADMMIGHNFLGFTLDILLRRYQELNISSWSTIGRLDLKRLPR
                     FQGTATNVNQEKETCIGRLVVDSYSLSREHYKTVNYRLLSLADQMQLQGITKGSNNFE
                     PGTSVLTPAMLSASRDIYDVLLQVCNCAVLSTAVVSHLDVIRLTKRLTTIAGNLWSRT
                     LFGARSERIEYLLLHTFHDLKFITPDRYVQDFKRGHDDEEEDGKRKAKYQGGMVLDPK
                     CGLYSDYILLLDFNSLYPSLIQEFNICFTTVDRENRSEIDVPPPENLICASCAAAGLS
                     APCLHKCVLPKVIKSLVDSRREVKRLMKTEKDANNLALLEIRQKALKLTANSMYGCLG
                     FEYSRFHAQPLAELVTRQGRLALQSTVDLIPQLNPSLRVIYGDTDSVMIQTGIKNDIK
                     AVRDLGLELKAKINKRYQSLEIDIDGVFRAILLLKKKKYAALTVTDWQGEGKTYKKEV
                     KGLDMVRRDWCPLSKSVCDSVLSRVLNAEGSEDILDYVMNYMRDVAEQVRAGRYTLDN
                     FVISKSLTKEPEAYRGNSFPHATVALRMKQRKELVRVGDLIPYVICTGDRLSDKAFHV
                     EEVRQNSQLRIDSEWYLSVQIYPPVMRLCEHIQGFSNAQLSEAMGIACHTGAKLEEEE
                     AETMNDFSHSSLFQSRNLEECFPAAVPLQVACTHCRLMTPINPHTRVMEVLADQKSQR
                     DRFDLYVCVSCRKSLPVDYVANCFTQTCYGIIRQFYQCGGSAAAVKAVRTQFTYYRAL
                     FDVPHAPGCPARVKDAHYYQARRCLGVDRRLYTLAEAADPAVQEVADPVDPLNAAVET
                     IYKRIDHLFINLDSLFAGI"
     gene            <656946..>660656
                     /locus_tag="LMJF_16_1550"
                     /db_xref="GeneID:5650708"
     mRNA            <656946..>660656
                     /locus_tag="LMJF_16_1550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682186.1"
                     /db_xref="GeneID:5650708"
     CDS             656946..660656
                     /locus_tag="LMJF_16_1550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682238.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650708"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QEL0"
                     /translation="MSQNPRMIERRVVFGVCEDVKDGVHYLGEDYIVWVAGESLVLLD
                     TQQGTQELVQCTPGCERVTAMALAPSRRLLAVAESGKTPFIVIYLFDSTASPRIKRRS
                     VLHLSDLGSTEFVSLSFSQDGRYLVALGGFPQWKLVYWDVEKHKMLAHDTALENTIAA
                     KDSRHLKQCSISPYDASLVCVTGQGCVKFFSYTDGHLFPTTGGVEAPDVHYLAHTWLI
                     EEERRLIVSTDNGDLLLFEKQQYKHPLPLSPSDGIAITALASYTKGFVCGGDMGLITL
                     FERTLSKEMYRKVRTFRFAADGRYGAVTDLMTASKIGAQVPVIRAFTFTPPPAEEMLA
                     FLTSTKQIYSLNVPNADFTKAEDMVFQPVGQPFHTGGVVAVDTCVQRPLVATAGRDGS
                     VFLWNSITNVVEMRNSFQEEIVCMAMHPSGLHMIIAFTDSMRVFNIYEKELCEFKRLS
                     IRNCTACRFSHGGQYFAVANSTIIHVHYTYTCELLGHLRGHNSKVRSLSFVPPDDTRL
                     ISSGADGAVFEFSLCDFHKVRDNVTKAVTYHCAAADVHTVWAAGNDRKMRQVDRATML
                     QTIEYNLPDASMRCMLVSQSLKLLFGGCEDGTVRVFNTYLGEKLNGQGVDRGGGGAGG
                     GGVGGGGDGHHGNPRIVMAQRDITIESHVTHIGVITDMALSYDEGMLITVGEDGMVVF
                     WDVVAPHRGTVKQVEHTTELLVDRRDLDASMQLLRNITAQVKDLQQRMAQQKLKKERQ
                     HEEQIAQLDRDYQSEMQKQKAEIAALQAAKGEQAIRFTEFTAEMERKFAQTLSQTEED
                     YRCKIESLSSRADQLRHLLAEADTNHEREKALLQGEADTQRLADKQRQQREFHALDEE
                     QHRIAAEKERNDAETEAMCAMIEEDNDTEIVKAKEYYEKRLREQEEEAAALQSANNAL
                     LSKLNMSRAELESKMTDITEKLRQQTVLESHINSAKRDIEALTNEVRERGETIAEKER
                     RIQDLRTKNQELEKFKFVLEFKRKELKTQIEPKDNEISASRLKLEHMEAETGQYESSN
                     EHLVLQIKSLRQKRAAQQKELDGLAARIAEAKSLQGRMWAEISDTYSDYQASKDKKRL
                     KSMAKALYENYTDGHRPANQRQFTSARTATDEVKDYHRERDHLEGNLASLKRKIAKDE
                     DNHRVEKQRITTENVILIKEINDLRKEARTLAAKAGVVRPTDPNGVSVYDEQYAREVS
                     VQQAEMVRLRAIVEQLEAQLKAKGLPLPVTDA"
     gene            <662033..>664108
                     /locus_tag="LMJF_16_1560"
                     /db_xref="GeneID:5650709"
     mRNA            <662033..>664108
                     /locus_tag="LMJF_16_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682187.1"
                     /db_xref="GeneID:5650709"
     CDS             662033..664108
                     /locus_tag="LMJF_16_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682239.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650709"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK9"
                     /translation="MLFSTGLPRCFASLAVASASSFMQSHPTTETALHTGDKLTLWID
                     DTAPAARALEEHIQSAAYKELHRPALTTSAMGLFGGEPGFEKAHRVWVDPDRPHMKHM
                     YNQTPLAKNLRYTRYGYFKRDMHLLDIDKLVRHARMLPTPNRLLTDFLYQRVPLPDKS
                     CAAILRYQRDQLTLVADWQRVASFQCAEEIFERMVVTNIPPVDVGPETHAEMIRCCAV
                     CGEWEKGWDVYLQRAREMEADASGDAADAFTLTTYLYDAVLELCVACQKPSHGMAIMA
                     EVIQRHLRPRPSMLAKTMILVSMAAEELQKTPAASSAFTSGETTEAASTSSASPDALG
                     GVSGVPATWEAYTARGLDTWSLYDFYSLKRSSECVEAYMRMCSMLNMPTLVLEALSFA
                     DGAQICVSLECYQWALYSIRHVPGMGDYIVDVLGQLSQRGLTADYLLFTMAFLDCATQ
                     ADGELALTVYEQFFLHSDINPTPEMALLFLQACTTCDKPTVQMYASCEAMMQRLEAVG
                     SIVDNILPMYDQCIELAAHVGAVSSAYGKVKKLVSYGKPLTTRILNSLLLANAQAAEG
                     SLSMTSDVIRLYSLLGIPFNDDTLTCLRMCQDVHGTSAEVASFAAAIEAAQAAAPSGT
                     LGEDAETTVVDTPPHRLRQLKTKWHLRPRDTVLRRFGQHTKPMGREDVGSMLGSVIPF
                     GRSPGERAV"
     gene            <665078..>666103
                     /locus_tag="LMJF_16_1570"
                     /db_xref="GeneID:5650710"
     mRNA            <665078..>666103
                     /locus_tag="LMJF_16_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682188.1"
                     /db_xref="GeneID:5650710"
     CDS             665078..666103
                     /locus_tag="LMJF_16_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682240.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650710"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK8"
                     /translation="MLRWDWPQTWSLENREAIRVALETAIRGAMAKGESKVVRGLVHV
                     ELPEIGSTPPQVMLTGIRELSLEHTALMVKVRYDGEFSLKLRGLQVNVDTVGANSTLS
                     SDLSLAMPFYCPLEMTVSDIHVDGVASIEVFQEIEDVANSEDAALLSPDSTMGLTGTP
                     RTDEVESLSSLCRVPRSARSYILSAAQSSTGRSARSGGYPSSGYGVLLGAGGRRAMRP
                     PELAQGGHTTVAPPPLTSPHGNSVATADASVTGSSGTHTSAGLSTAPSQPRHSLIDLA
                     SKRAIVKKRRIKVQLFGDPIKRYKVESNLVAVPGAGKKVEEHIQDMLEPLIERLMAEG
                     VTIELTP"
     gene            <667123..>670374
                     /locus_tag="LMJF_16_1580"
                     /db_xref="GeneID:5650711"
     mRNA            <667123..>670374
                     /locus_tag="LMJF_16_1580"
                     /product="putative kinesin"
                     /transcript_id="XM_001682189.1"
                     /db_xref="GeneID:5650711"
     CDS             667123..670374
                     /locus_tag="LMJF_16_1580"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682241.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650711"
                     /db_xref="GOA:Q4QEK7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK7"
                     /translation="MADSGDCETARVTVSVRVRPKLAHPLTPLQQSERYEKVVCIPSS
                     DNSLRFADCRATKGTRNLYFTYDHVFDMDATQEDVYEAAVLDCVDSVLAGTNASILTY
                     GQTGSGKTFTVLGKTAAVHDSGKGVHSVGADTGLLLRSIQGMLIFAERMRAKCERHVV
                     LGMTALEIYMDEIRDLLHEGVAGRPLQPIMTRDVLHLPHLTHVPLRTLQDAFRLYERA
                     AARRAQRATSANDTSSRSHAFFTIEVFQTPIAPEHPSPPTLAECCALREARCAASIAA
                     EQKKRGPQPLRSECFEGAANALLGTRAAPVMYSTLTVADLAGSEKAKHAEVRGTGFDE
                     LRHINASLTALGNVVHHLYHGTPHIPYRDSKLTMMLRDTFAAPRAQVALFVNVSPTAV
                     TCEETLSSLYFADKIKSMRVLDTGAESPQHAALQSEYLESIHVHDALLAEARILQVQQ
                     EHATGLLQLAVASTLRHPLFQPPFHTPLANGTDKTARMQVLCAHLRERLAHEESPDAR
                     MRNFLETRRRELLRDMLRQYSRRRAEVQTQITTADEAGVDLRAQLSRDESAMRQLLSK
                     VKEAAAAITATRQELSKVKGMRLGELQRLRDFEEASNEGEGGIVDARAADTHDEASLA
                     AFEQERAIYKEALELAQLRLTLVGLMASGSTPSPSTHTEGEPAAGHCRRNTTSCSCRD
                     ATSTTASSTPFKPPSIEGWLRGAVLAMAGNAVVQSSRKHPRQEPPQQERLQPISLPQP
                     FGTFGNFTNVSGDPQPLPKYWSVCHRCEETGKIEADANAGAVAPDAIGKGTNRRPRHL
                     SSFDDPALLTRVTAYMDMGASLTKLDRYGRPHARWFYLSQRNNRLLLCWDESHHGPGL
                     TGGGRVYLDAVVKITLGRSSPAFRKYALHERKGEVGDFCTSFTLAYHTRAHKRQLKFV
                     DVMCRDRAEMETWVVGLAQLAGVFPCFEGMRQPIGPEDGDEEEAAVTGSAAAANADAA
                     AAEEAQKELSVVEMMLCRSWHIPAQTMLHTRREIETRRRRHQPGRLRLSPGELRDRTG
                     LDIFRASALWLHFSREGSVVNPFKELHCYVSDRVASSEPASGSLPRAMSGRIA"
     gene            <672367..>673218
                     /locus_tag="LMJF_16_1590"
                     /db_xref="GeneID:5650712"
     mRNA            <672367..>673218
                     /locus_tag="LMJF_16_1590"
                     /product="putative U1 small nuclear ribonucleoprotein"
                     /transcript_id="XM_001682190.1"
                     /db_xref="GeneID:5650712"
     CDS             672367..673218
                     /locus_tag="LMJF_16_1590"
                     /codon_start=1
                     /product="putative U1 small nuclear ribonucleoprotein"
                     /protein_id="XP_001682242.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650712"
                     /db_xref="GOA:Q4QEK6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK6"
                     /translation="MMEGDEEESRLQRKRVAAHQRQEMHAAWKRTFFQARPPPPSIGR
                     LHRRQPGITKGHSCHNAFNTALALAKQADEDEPTRDAKVDAPLPSSSTLTRSATATAA
                     GTLSKQEAWAAQLQGENERRNPFTDLNARSDPLRTVVMANLHPETVEEDLRHFADQFG
                     RVLSVRIVRHHRTGKSRRYAFVEFNLVGEARKAVQFHRKKRLKGYSIIIDREKGRTEP
                     GFLPKRLLTASSFWTPPANEASSATSAEIEQARTVDSAALGTGGAKVVLPMPENDDDF
                     LNAILNS"
     gene            <674302..>676209
                     /gene="EIF4G3"
                     /locus_tag="LMJF_16_1600"
                     /db_xref="GeneID:5650713"
     mRNA            <674302..>676209
                     /gene="EIF4G3"
                     /locus_tag="LMJF_16_1600"
                     /product="putative eukaryotic translation initiation
                     factor 4 gamma"
                     /transcript_id="XM_001682191.1"
                     /db_xref="GeneID:5650713"
     CDS             674302..676209
                     /gene="EIF4G3"
                     /locus_tag="LMJF_16_1600"
                     /codon_start=1
                     /product="putative eukaryotic translation initiation
                     factor 4 gamma"
                     /protein_id="XP_001682243.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650713"
                     /db_xref="GOA:Q4QEK5"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK5"
                     /translation="MQFTVEQIRSVRNNYLEPPYPGFSLDEVVRRRRLTQTKLVRGEN
                     AWVAKGTAQTTEEWVQRLLHGTLNKLTEENKDIMIDKLLTKELFATEDIMNMVVNIIF
                     KKALDEPENSKLYAGVCHSLALYEAKVLRDGHKGERPQSQLRDAIISTAQHEFRTLSK
                     ELSKMEDKSEEELEYERSNVMRRKRSNMRFIGELYLCTALTHSTMFTVMDLTMRCSDK
                     TGFPSSENIELLAALLNTIGDRLDKNHKKTLDPYFTSLENFNKKSDCPYPPRIRFKIM
                     DLLDLRKRGWGLKPKPVKAALPPSHGKDKKYATAPPPKKGGRDQGSAAAASKSWRDAA
                     TTKTGTAAAPAPSADKGLNGRGTSSAAPAANTAALSSSAASTAAATAPAGASFRDEAS
                     PQVPLVKFELRVASMFQEWVADRTNDVILHWVDQFNTCDRFFESESELCVAVAQEVIH
                     SACTTTRKDAQREAFSFLVVGLYMIDTEVFDGFASALASAIEDGLLEDVPKFGERFMS
                     MLRLTSTEQETRADVYFDAANVLRLTYNRLESPDDSAVDTLMSFWDRVPLPSTDEENM
                     IRMDLDVVYSLCNPEGVQDGLEKLLSRIIHSMLQMQLMDAEVLDEFLCLDVEDGLCAK
                     VIADYKERFPK"
     gene            <678309..>679115
                     /locus_tag="LMJF_16_1610"
                     /db_xref="GeneID:5650714"
     mRNA            <678309..>679115
                     /locus_tag="LMJF_16_1610"
                     /product="prohibitin"
                     /transcript_id="XM_001682192.1"
                     /db_xref="GeneID:5650714"
     CDS             678309..679115
                     /locus_tag="LMJF_16_1610"
                     /codon_start=1
                     /product="prohibitin"
                     /protein_id="XP_001682244.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650714"
                     /db_xref="GOA:Q4QEK4"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK4"
                     /translation="MSKLLQKVAIGAMAAGLSVYSCCFVVYPGEACILYNKISGLKDS
                     VYGEGLQGRIIGLDEILRFNVRVRPRTLHTMTGTKDLQMVNVRLRVLFRPMADRLPQI
                     YRTFGLDYDERILPSVSNEILKAVVAEYKAEELIQKRDAVSARIYQLMQEKVNQFGLI
                     IEDLSLVDIQFGADFMTAVEQKQVAQQEAERYRYVVMENEQKRRAAVVRAEGEAESAR
                     LISEAIQKSGSGLLELRRIEAAVEVANQIVPMQNVTFVPKDANMLMNMSR"
     gene            <680551..>681900
                     /locus_tag="LMJF_16_1620"
                     /db_xref="GeneID:5650715"
     mRNA            <680551..>681900
                     /locus_tag="LMJF_16_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682193.1"
                     /db_xref="GeneID:5650715"
     CDS             680551..681900
                     /locus_tag="LMJF_16_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682245.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650715"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK3"
                     /translation="MSVKETTIALPLMVESVLDVDSGITATSAISVLDDRAVLIGTSE
                     GSILLCAPVNESAHVLTPYSDTTLHCGAIYDLAVSSDHLVATAGHDAVSCVFPLHTFF
                     RASGVRQCRRITGHTVPVVAVRFLSDGTSLVTLGADGRVLVAEVHSGHVLASLLCGFA
                     ATCLACSMDETQLFVGGRSLASIDLHHAMRPMSLQSVAAAASGPDPWASLSSAAAAPG
                     AAASLRTPAWLRLYAWEEKSEATAGASRRQFRAPPHTFIRSLSVDSRDGALTATFARH
                     AGGTSSVEVCGSARWAATGGRTASEATWAPQALQGVSAALRYPMSRDRSTGVATGKLR
                     VRCRVKASARPSAKQTPAPPGSFASTAAALWNGRWYASPFELAGGTPRLTASHGLAET
                     SVFTAEKSDQYGFPSAGPRTPAEELLIAQAQCDELQRECDALVFQIKSFLARKAPIR"
     gene            <682762..>683481
                     /locus_tag="LMJF_16_1630"
                     /db_xref="GeneID:5650716"
     mRNA            <682762..>683481
                     /locus_tag="LMJF_16_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682194.1"
                     /db_xref="GeneID:5650716"
     CDS             682762..683481
                     /locus_tag="LMJF_16_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682246.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650716"
                     /db_xref="GOA:Q4QEK2"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR027105"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK2"
                     /translation="MSTPNLDALLGVPLAAELVARAGGLLALCKLSDAALRMLGTEEF
                     QSIASSSRARQLHAGLLLKAPLFTNAFGDEEEVDTTDRKAAQKGAAQLGRKCALVAKA
                     DLAGAFSDGSLGEAEKEKLNAAFTRLLAEGKVTAEDTQALAAPFVYVHGDAAKHRRGG
                     VKERKKRESQQESISVVARATQRVRMGVSEEEQVQQLLQREDIRSEFAKERAQQLLKE
                     SRKRARESVHDEYDDLQNISL"
     gene            <685269..>690182
                     /locus_tag="LMJF_16_1640"
                     /db_xref="GeneID:5650717"
     mRNA            <685269..>690182
                     /locus_tag="LMJF_16_1640"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682195.1"
                     /db_xref="GeneID:5650717"
     CDS             685269..690182
                     /locus_tag="LMJF_16_1640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682247.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK1"
                     /translation="MHDFLEEFEGFAKVLVESLWREGGLPPTARPSSATTTCARYGNV
                     LVHVWPDGKLGMWMQRSFRVLMECCVPHLSLPLTATFRYFGDVVTVAAAISLQRAGPA
                     EYAGNRRSDPVMHVPLQELLGMTQDALNLHRGDPRGEATGGANDEATKPQQRKVRGIE
                     VREGMDTRLYVVNCLGLLPPLFSTDGRVLTLRRWLHLIQHPPMPWAGSVVCTDIYRRE
                     AAAAVQYLSGALQAPVERRNTRLVQLLHKNGLNVSLLGLVAQTMLAAAKEDLDDTSEL
                     VLRLIAVEVLARVVRRSLFRSMEREGSARSLKTANNYLQRTAGSLLCTTQAHFEERLH
                     PLVREMFWLDEAMSTEPYMQLLKRTLQRQVVLITKRLCELCGLRVVRGSVAEIMCQAS
                     HHNYSSFYSAEHQALIATLARDESEYPPAFRTAYLLPLRIRFYCRGGHLAEAWREATQ
                     LVELRSRHTSECFLNAEAWTTAALVAAQVGREEESADLIERATRVFFDIPAFLLQSTA
                     PLVRMPSYLYFLRGQVHAKLAHGFICIQRQLFDEAEELFTAVLRLPDVLEDERQPHVA
                     HLRQQAVVGLFSIAVHSEKAKVMQLDAQWSTELRSMAPSLQGARISELFGSLFFDRDM
                     FPSAVARLWECLETTEQLLGATALRVGEVLNKLAYVYYRWDVRQYGLFCSCILHRAEA
                     IMVERSGLYSPLHLSIVENIASVFILRGMFVAASQRLHLLSTLPPRYTGRLSREHPAI
                     IRIAVIKSKLRHEFGNIAIVIIQRYWRKYRSRAILRDVCESSAQEVQRLGRAYLVRRA
                     LLHLCHGHVTADGIALAAQRYAMRTFSRPLICASALFSKEQRHWNSELQHSCLFTIWW
                     ERVEQQVQLDERQRLVAEFEAAARSCLRGMRSGTASGVRVPGCSTSFVMQNMVFTQVP
                     AGHRLSVLQLRLMQHLRCSSPCLLTVPLSTLVEFTDCAYYAEALIPLHHHPRIVFTVD
                     GHSSDPHAATARSIVRYMMRQYRDAGLTTYRADNCQCVEIVSGADGLLYLTNSLGLVS
                     SLVHQQPTMDVSTLTLPANIFSLAREKCNAGNAKEAVDMLELALLSQGSDEYGLLGIY
                     FLSCLASARFASGEDLDAAMRLFQRCSTELEENTAAFPAALILYTEGRAWLSRGATTA
                     ALGPLLRSLNIYAERIRLHAYYGAFCIFEVALWVLRSNVVWGSRVDAAVLRCVAHAVE
                     FGEPTLSLFITCGRFILYTQKVGDTAMSQQLIHLRNIRARELQPIELDRYLHVLLRRS
                     ESLQRRGGNESYSDCVFVHQTAIHMAEATHSESRMLGVLLTSHGLLLTKMNRLKEARR
                     VLSRANAVLLKTVAPTSPEAMTWRKNNQTLKHRMQDNAVAVIRRAVRLWKERRRLERD
                     MCAENPAAYQALQAVRFKRRIKSLVVSEATARVLIADSHADEYHRLQKRKGRMRNDAM
                     LKQTYGARVQIFLDKLDTALIDVRDLALATKAVMAGASKDMCQCMLSAFLMASHRIER
                     RGVIGKWRASLLVVKLWHLEHVDAVIRVEFLGAFHAFMRRCVAAEERAWRRIITGNQK
                     NSKQALGKTIGRALRPKPKRVPAIDIRAVLLNEARRREGILAREEDDYRTLMDVFTFS
                     PEVDDDEEVGVEASLQYTAMNALTGGI"
     gene            <692452..>694524
                     /locus_tag="LMJF_16_1650"
                     /db_xref="GeneID:5650718"
     mRNA            <692452..>694524
                     /locus_tag="LMJF_16_1650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682196.1"
                     /db_xref="GeneID:5650718"
     CDS             692452..694524
                     /locus_tag="LMJF_16_1650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682248.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650718"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="UniProtKB/TrEMBL:Q4QEK0"
                     /translation="MDRVYIKCCSTFSLAAANWNEAYQLALEMGDSTIQLATARQDKL
                     RQVEKAFEEEVVQGAVRIVTMDPNAPRPVPKELLCYRDKNVFYRLLPDGRSGRSLVAA
                     LRGVLQSRSALLTVPLTSVIIYRGTPVLAQALAPLGAEPMKLYGDGAEPDLEVAAEVE
                     IMADALKTPLPDEILCEVYRGLDGRMYVTNTNVTTIALDDSMLIGGPLKRPEMLALCP
                     CVTATCEDTLSVLRNPVVMEALRRVLDTAADQQCRHLSETLHFYGVNLCLLRAVVDAF
                     AERYGDAAYDVQHFTEVVALEMMARTIKQEFYMEVQAKRLGIDVVGINKCYALNLRAA
                     LHSEQDDRFIRLVLLKYAIHNEGGRADGFVETLLTVRRDHRSALVKRVSRLIGVRSAP
                     AAEGTENERTVVWAPRIVGRITPRLCDPTLTCSLEPLYRSLQSCEGHYFAHCYPLQVK
                     VALWQGRVGDGLNLASTAAEQARARYGDVSLRTVQAQRTFMRLLFTVQSLENVRKAYD
                     MVTSILEAYEDCAGPITRAKCHIEVGCCLLAASAVIDAVGEAARHFRAAGQLLPASLR
                     SSSGAWLYLQPSLGLVRCRQLDRKSGLVPLKALVTDAMYFSRVVRPADYCTEYLWELG
                     MELAAERHYAESTQILTAAYSMAKRTQRTQLDVDRLRSDTISVYSVCDPETYAAYCSA
                     ISESARVA"
     gene            <697520..>710767
                     /locus_tag="LMJF_16_1660"
                     /db_xref="GeneID:5650719"
     mRNA            <697520..>710767
                     /locus_tag="LMJF_16_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682197.1"
                     /db_xref="GeneID:5650719"
     CDS             697520..710767
                     /locus_tag="LMJF_16_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682249.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.16.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.16.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650719"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="UniProtKB/TrEMBL:Q4QEJ9"
                     /translation="MESQLAICKNPSFPIQQTAPKPYLAVCAEITPKGRNWNAEFQLA
                     WEMENDSIEQAELRMRILHQIERDFEREAADTIVKIVRLEKDMPAELLNFVQCFRVRN
                     IFFRILPDSRSGRNYIASLRGILQSDSHLLSVPLSTMFYYRGMPVLAQALVPMTKRPK
                     RLYGVHSANDVEVEAELAFIAEALHIPLPDTGIEVYEALDGRYYVTNSNATLTPLFVD
                     DTIMKRQEMLRVCPEVVEGADNTMEVLDDRALQETVLQVCCSSTTATVSATLTQVCES
                     LHARGVNLCLLKQVAHRLLFAGHYDIRAVEQTVQLLACEMLCRAVKQEFYIEIQGKRM
                     AYDELFLTRTLSKYFALVFAPSPQFRAKFLDVVSKKYGITAEDEDLIDVLVSFRTEWK
                     QRIMDRVCHLLGATIRKENGAMQVTWRPFANSSVIPQLVDPAVAIQLAAVYNRVRTDP
                     PHWYAFCLPLRWKVACWQRNFAEALSLVREGAAAQEERTGPQHLIRLMMERSVCHVSF
                     QTHDWQCIQDGRSRFPTVLAGYEQWASRKTQGRRCIEYGFWLVDVAEALIEAPAELRS
                     CVEEAVYYFYNAIARMPAYLRSEHGAWLHLQPYMGLLRCKKLLPSCSVDTHALVQHSV
                     ELSKVGWASDFFISYLSELGRQLEYEGNFADAIQVLLTAISLSKEKPTFAPDLHTLLA
                     DAAHVYRSWDLRTHADACLELTNEAIRYAAKYYGVESREYGVALNNRGSIEIELGWFG
                     RAEETLRNAGAALNAAGVPHGDPDYVAYARNLDTLWRRRHPSQPRSTHLPRFLRRFPF
                     LESACEGIPWDDVRPIEDGRFAELARNRAREAEGTKEAYRLEADMKQRVGEIFRALLS
                     GATLKQYPFLPAQLEGVYVEGLSLMYDRIFLELATQWQHTPAASPARHLQERRMLAYV
                     SVKGRRMADRRAYEHHVEDTFLERYGTSVNVLLPVDFSEVVEDAEVQSLMSEYERLKA
                     HRAPTAELNEAQARIGHRVDAFESEQWGWRQAISAWVPERLLHSCCLRDLSRDGALRD
                     LLTAHQHATHTGEIVMPQDILEARIEALCMSIWERGQLDRLYCRSESHQLQQRYRLSS
                     PRVHLQPLDAIFEDLLEPWSGSLHASTDPDDRDHVVAAVHRRARLNADAEYLEQWYPC
                     LRGTQCPTWMLVGLPHRFDAAYQRERVQWQKSDDSNSAVALVRLRQYLAFIQTRAHKA
                     RVGVMRSRIRAEAMYPFLCLRYDGVHVLDLALGEDRIFCEHYADYTRLSSESKLSARQ
                     LQSCEERMKARAAVLAQQLREREAALEHRFGSYLRSGDAPLQWSSTFIEYTPRVLQYE
                     KYHLAHKKEVAGSKAARDSARCAHRLRRCIRHMSQDQFQRRLIRGSYGEEIAERYPYL
                     SLMPIASVSLTTLPFECRQEFRMLHATLFAPLRETQEDMEGNMKRSNAATAVPASHLC
                     ASLRAYRPESVATKTHQLTCIVEKMAQEELDAQVRLLKAFPSIPHSVLGVPTTQLVLP
                     PNFEQQWSRAAKEGFNGPSTLEVYSALVECATFTRALPLARQYLDELTLASQPFLLYT
                     TRQCVYLRHLPLRDDGRYTALLEKYGALLERSPPTSPECALQRVRLAARADQLALRAT
                     RQWDRLLRQFPQPPALSDDQLVHLQRHPAMLRTTQRAPDTAIDPHTTQTILEDLENQQ
                     RQDTERAIADAELHSDLSFLHSSTEAQDVTGTSTLLQSYETAEQSLQTPSQLNQDDIP
                     YENEIHGKTTNIKQNASSSIIHPAIPSRHENHTKPRVAPTPIPHEYDGFNKITSTYPF
                     LRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAVENGMNERGDAVAAAL
                     RRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAV
                     ENAMNERSDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAAEYAD
                     LVCDPRKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEAL
                     GADEAFQRLAAEYADLVCDPRKNAAALRAVENGMNERGDAVAAALRRAAAMEELASRY
                     PFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAVENAMNERGDAVAA
                     ALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAAEYADLVCDPEKNAAALR
                     AVENGMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAVEY
                     ADLVCDPRKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVE
                     ALGADEAFQRLAAEYADLVCDPEKNAAALRAVENAMNERGDAVAAALRRAAAMEELAS
                     RYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAVENAMNERGDAV
                     AAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAAEYADLVCDPEKNAAA
                     LRAVENGMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAA
                     EYADLVCDPEKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGW
                     VEALGADEAFQGLAAEYADLVCDPEKNAAALRAVENGMNERGDAVAAALRRAAAMEEL
                     ASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPEKNAAALRAVENAMNERGD
                     AVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNA
                     AALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGL
                     AAEYADLVCDPRKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHEEE
                     GWVEALGADEAFQRLAAEYADLVCDPEKNAAALRAVENGMNERGDAVAAALRRAAAME
                     ELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVWDPRKNAAALRAVENAMNER
                     GDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAAEYADLVCDPEK
                     NAAALRAVENGMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQ
                     GLAAEYADLVCDPRKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRLHE
                     EEGWVEALGADEAFQRLAAEYADLVWDPRKNAAALRAVENAMNERGDAVAAALRRAAA
                     MEELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVWDPRKNAAALRAVENAMN
                     ERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQGLAAEYADLVCDP
                     EKNAAALRAVENGMNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEA
                     FQRLAAEYADLVCDPRKNAAALRAVENAMNERGDAVAAALRRAAAMEELASRYPFLRL
                     HEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAVENGMNERGDAVAAALRRA
                     AAMEELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVCDPRKNAAALRAVENG
                     MNERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGADEAFQRLAAEYADLVC
                     DPEKNAAALRAVENGMKERGDAVAAALRRAAAMEELASRYPFLRLHEEEGWVEALGAD
                     EAFQRLAAEYADLVCDPEKNAAALRAVENGMKERGDAVAAALRRAAAMEELASRYPFL
                     RLHEEEGWVEALGADEAFQGLAAEYADLVCDPRKNAAALRAVENAMKERGRWVGVLLS
                     EKGFCELLDGVIAEEDTSRCRMRASEGDGRGVIVFDALLESEEVERNRIISLEEERLS
                     SLSSALFLERSALSEATRARFEKAFADCSAEEAAGRKAVQLEAYARLASVAVEFVQNE
                     EKARRCAIHAVEEAAALELADAALRDREAAAEQMRLRQHRALADCESVEGDVRGQVAA
                     DEAAARFSVAAPFLMSEEALQRKEILSMEQQSAVQLAMRESCERGVVLRKMLSRLSAF
                     IESSVEKEAESRSALELLETRTRDALAEDAKKHTEALSLVAARRSSLLQSETLTREGV
                     ELDEKGTRESLKGEYQLLRESVASKYPGATESHKAHAKLEATEALLPMEENSLDIALS
                     SEQSVALLQRAGRGRLLRKKLQRRLENRRRDILKQGVSHILAEEFTGRRTIVGDEYLQ
                     RQGLRDQYDRAVPMTHYDDPVDVALQQLMIAEESERDNILSDYILARGAIERAEHKQF
                     LKQKALLWVSGALEFSDDEEVADLHLSDFQGTESTLTAGSRTNRSRTRYKGFELDALG
                     RFLLDYEKDINQMQTTLADFRRSVAIVHDQLKDARDRAAQEIVRGGTGAIWVPARPLP
                     LADLVRGPNTQYEGKRAHRAL"
CONTIG      join(FR796412.1:1..714651)
//
DBGET integrated database retrieval system