GenomeNet

Database: RefSeq
Entry: NC_007259
LinkDB: NC_007259
Original site: NC_007259 
LOCUS       NC_007259             739748 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 18.
ACCESSION   NC_007259 CT005257
VERSION     NC_007259.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 739748)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 739748)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796414.
            On Jun 1, 2012 this sequence version replaced NC_007259.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..739748
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="18"
     gene            complement(<1694..>4702)
                     /locus_tag="LMJF_18_0010"
                     /db_xref="GeneID:5651100"
     mRNA            complement(<1694..>4702)
                     /locus_tag="LMJF_18_0010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682355.1"
                     /db_xref="GeneID:5651100"
     CDS             complement(1694..4702)
                     /locus_tag="LMJF_18_0010"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682407.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651100"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QE41"
                     /translation="MLRCSPQLLRLRLSGVFACTAALYGRTGAFHPFSQKDEDDLLQV
                     VKTKPRHVLRHVRQQVWRSRKRELQFRNTVTQLMIILQEFLRKQLIDPAHASQIMEGI
                     LEECVKYGQHDMAHLLFRAFLRFRKYGCVMTVHSIRCLFESYRHNDTAELMLQLAQEM
                     KDVAELRPLCIAAYLFSNSEAEAQALCEGLSLTQLGSDDVVALIAGYEKLKRVDKLQE
                     IVDAVPTMSTAEARAEVCAALFRAFFKLDSDEGFTRTLQVALEQKMPLSAELSATVLR
                     HKMRRVTTVDEIAAIEEELKELGYVPDATCDSIVITAYARLLHFGDRGSEELMLAKVD
                     TLLSSIESRLKQGDPDMDISAAHIRAVIRGYGAAGRPEAIKDAWQRMQFASITNDVRI
                     YNELLKWFALMGNVKDVLAVKREMESNGVCADAVTYTWVFRALGKYYPRHVEEYYKEM
                     QERHVRPDIHLYTTLLGIFGDLRRMDTVDVLMTELRRREQAGSVQFTPITFAVLIRIH
                     GGDLDKAKALYAEAQQRNISDHPHVQTSMLHTLAVHKGGTAADVEEFLKTLPAWSTDV
                     YNVLLHMYGKSMDRERFDATLEKMKSESVEMNDVTFGTLITAFARWGERDKVNEVIQL
                     LKSHDGGISATFYSVLASSLSRMGNQEGVENAWEDLVASRLFPDTEVYNQFLSLYSRQ
                     NNVSKMQGVLDSMMKQVPPNPVTATTVLDMLGKSGRMSEMESLFEDMKSTPDTAPTSV
                     TFHQVMNAYAKTGDVVKMEKVHEEFLEKGYTDNNVTYNILMDGHGRAKGYEQMEELRQ
                     NRSAAGIPMDDITYCIMIAAYGRSRLDKDVQRLFDEVTKEENRPLLTKRVVWSAMDAF
                     CRCNSSAGLEKCVELLRTLNGEGEALSSSDYCGLIPYYCRMGQMEKVEDVVRLLHDRD
                     DAEALTYNALNAIARGYARTGRFDKTVETLHAIRDRNWVPDAATALQLSGAFLKAGLH
                     EQAQQVIEWRRRYAKVACSAAATTAKNSQN"
     gene            complement(<6788..>7939)
                     /locus_tag="LMJF_18_0020"
                     /db_xref="GeneID:5650887"
     mRNA            complement(<6788..>7939)
                     /locus_tag="LMJF_18_0020"
                     /product="putative mevalonate-diphosphate decarboxylase"
                     /transcript_id="XM_001682356.1"
                     /db_xref="GeneID:5650887"
     CDS             complement(6788..7939)
                     /locus_tag="LMJF_18_0020"
                     /EC_number="4.1.1.33"
                     /codon_start=1
                     /product="putative mevalonate-diphosphate decarboxylase"
                     /protein_id="XP_001682408.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650887"
                     /db_xref="GOA:Q4QE40"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="UniProtKB/TrEMBL:Q4QE40"
                     /translation="MSAPIRVTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLST
                     KPFRSKTSVELRSDASEDELWLNGKKSNIQETPRIQSVLSCIRDNCPDNTKNLKAYIV
                     SENNFPTAAGMASSASGYCALAAALVKAYGATVDVSMLSRLGSGSACRSVYGGFVIWH
                     KGEKPDGTDCIATQFLDEKYWPEVQVMCAVLKGEKKDVSSTSGMQQSLKTSSMMRERI
                     ESIVPARMSAVKEAIQQRDFNQFAAIAMADSDDLQEICRTTKPPIQYATDDSYAMIRL
                     IRAFNAKKGYNVMAYTFDAGANCFMFTLKQDLPEVVVMLRAHFPTSWDKLLFHDADLL
                     EKCKAYQLPASFEGLIDYPKKSFEMLLQSPMGQGIVYLDDAESLIPPHA"
     gene            complement(<8741..>9775)
                     /locus_tag="LMJF_18_0030"
                     /db_xref="GeneID:5650888"
     mRNA            complement(<8741..>9775)
                     /locus_tag="LMJF_18_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682357.1"
                     /db_xref="GeneID:5650888"
     CDS             complement(8741..9775)
                     /locus_tag="LMJF_18_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682409.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650888"
                     /db_xref="GOA:Q4QE39"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QE39"
                     /translation="MPNDAAVVYIFLDDADKAVSMEDVKEWLQIINDVVEIKLQFDVA
                     TERPCYYVEFRSPVAAQQAVQYLNGARLKNCIVTIQSRVYSAAAATQGPASGSGESPS
                     AAGGAPPVTRKRCRETSQLPFNHLLPPELQMDSPLAQYIPELEKSELYSSDGVVLWQK
                     LQAAQKELVELYHDLEVTTAQVADCDAQLTQLLHMSWTAPASNDVIMSHSPSSGPGRK
                     TALQAQHFLCHERAIAFDAHTPSRVVALLTDCFGPLSLCSDTVTQTGFFLVVRFVFAA
                     DEALFLAAAAASGSTEVTKQRDQRQGAEWRSVVQGLGWKPTASVAGVHHLFSVELDAR
                     LQRMVYDVLA"
     gene            complement(<10218..>11834)
                     /locus_tag="LMJF_18_0040"
                     /db_xref="GeneID:5650889"
     mRNA            complement(<10218..>11834)
                     /locus_tag="LMJF_18_0040"
                     /product="putative major facilitator superfamily protein
                     (MFS)"
                     /transcript_id="XM_001682358.1"
                     /db_xref="GeneID:5650889"
     CDS             complement(10218..11834)
                     /locus_tag="LMJF_18_0040"
                     /codon_start=1
                     /product="putative major facilitator superfamily protein
                     (MFS)"
                     /protein_id="XP_001682410.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650889"
                     /db_xref="GOA:Q4QE38"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q4QE38"
                     /translation="MGTEEVSQETTLLLPNASRDGATRTAAVNAEVETWMTPRMVLWT
                     FTVSNFLLYFDRGATVGALSSICSDRDISDNDTPLSDAKRGFLVSGFIMGYVVASPFF
                     TSRGSAWGSRMVILLGMALWCATCLACAISLSYTVLLVCRILVGVAEAAFVAFTVTIV
                     DNTAPATHRTSWIGFFYSMIPIGTAVGMGCAGLLTSYPALWGFTPWRVIYVTEVVAAL
                     PIVVLLCYIPACYHLAPATEFTPQLPFLTATGSVLCNANYMLLVIGLSMYCFVTGAVS
                     TWGIPLLHEGPLQLPKATAALLMGIETTCSAVAGSLVGGLAVDYWGGSTGSVGVIQCQ
                     QFNILMILIAIPCGVAALLRTDALVFAITFAVAVTALFAITAPINASILTVVPAGLRP
                     YAVSYSIFIIHLLGDFPSPTLAGIVSDFFGRSCRGLSRDGCHAAEQQFQCAWMDDADG
                     LGRCMCRVELRNALLLVFAYLFLAPPCWTVVWWRLRREVQTADVSADDGEDSSTLGTP
                     GMPAFPLSHSHDEHDEVLHMCMWWKRSGHY"
     gene            complement(<12709..>15630)
                     /locus_tag="LMJF_18_0050"
                     /db_xref="GeneID:5650890"
     mRNA            complement(<12709..>15630)
                     /locus_tag="LMJF_18_0050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682359.1"
                     /db_xref="GeneID:5650890"
     CDS             complement(12709..15630)
                     /locus_tag="LMJF_18_0050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682411.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650890"
                     /db_xref="UniProtKB/TrEMBL:Q4QE37"
                     /translation="MTAATDGGMSGVVKCAEWLHELIPCWLDGDVSVHLEDALREVAT
                     HLDGVSAVAEKGVHLPLKAALRVQIMALDSWNATALRGWPLERKDLKVQARWLVTYLF
                     LCSHCVFAGQEVREAHLSHHLDDAEKCILMCLKTSKGLLRARHTDAAEKLLAWAACVV
                     KACAGVPGSMRRFSAEIQFAQLRAAWEAAQHERACVIATQLAEETRSSTAYTEALLEF
                     IYNVGVKSLQEGRPNAGALDSAAHGASEVEGVGLPACASGQPMPDVQASLQSLLLLSL
                     RLQKAVKARSVKQRTFLGMTYLQYGYSLLLCGKYDAAAEAASTSYDLLRTLEPIVVRF
                     KAEVHRHATDEVLALFRALCSDATVAVGDLCAMASLSLEKMPAVQETLLAELHRRVAA
                     STSAVDQFRLLCVLIRHCSEWSVTELLRRLSDGDMPPPAFHRFLFCCLWRLSAMAVNG
                     QPRCLSATTRWSCLDTAQRLFRGVASEEERQAVLLDMTQLVLAMHDEGVDATEELEHT
                     LALCHNVGTIASGLEASSLQAQAQIAFLLGKQEHGMERVRGLLACTAGEAAVRACSEL
                     VTFLLRTSLLHSAGAVAELCVVAFHQHQSPVCIIEFAKVFAMGCLVDQNEGLRAEVGE
                     ILEVHVCPILKHVSLTLPDARWWSRFLWYAAEALLDSDPVHAVRLLQAGVELPAYRSD
                     AGEAEVSTTAADAFLRNRLCLLLDTEFDTFAAGQAALSTVELRRHGDSLASLLSSCDE
                     EKNSTDETSTLRQRVTLFLARLEATLRDMLVHDASTPIDVEALRLDELPSMVAISSAD
                     LEQVAAVCHYVASRLSPPGSHFLCDAALNIMLAAAQLQLSSDVTSTAALSALLATIYA
                     AFKMARNADGRLLVSEALTAALPLLTAKNASLRAAFSHLHNNDGECPTVARDLGLCET
                     VVEFFAVEAWNESVQWNILQRRELVERWRAVVAVLTSVLSHGNASKAAIADLAAQMPL
                     L"
     gene            complement(<16445..>16918)
                     /locus_tag="LMJF_18_0060"
                     /db_xref="GeneID:5650882"
     mRNA            complement(<16445..>16918)
                     /locus_tag="LMJF_18_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682360.1"
                     /db_xref="GeneID:5650882"
     CDS             complement(16445..16918)
                     /locus_tag="LMJF_18_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682412.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650882"
                     /db_xref="UniProtKB/TrEMBL:Q4QE36"
                     /translation="MLRRCTASRMNRGHLAPTPSKYSDRPGMWGPGAGPVKDTLARRT
                     MFYRMLVMNKIGLWTKPFRTNRSRWIWRKAQMQLWKTMVMSMVFICVILFCNIWLSFV
                     YHAYTVGPTTPVLERKVREHRVSKQIMQMVRERERDMTQEEEVEKARAVIESQKQ"
     gene            complement(<19126..>21297)
                     /locus_tag="LMJF_18_0070"
                     /db_xref="GeneID:5650883"
     mRNA            complement(<19126..>21297)
                     /locus_tag="LMJF_18_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682361.1"
                     /db_xref="GeneID:5650883"
     CDS             complement(19126..21297)
                     /locus_tag="LMJF_18_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682413.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650883"
                     /db_xref="InterPro:IPR025874"
                     /db_xref="InterPro:IPR026319"
                     /db_xref="UniProtKB/TrEMBL:Q4QE35"
                     /translation="MPPLLTEVKPAGYRPQLRVCYLCGQQFGSASIGIHVPQCYQKKL
                     SQWEVTDPAVRGPKPKHPDMVKWKGGNGASVEAINREQYQEFNSQLVACPHCARTFLP
                     DRLPVHLRGCRGDGKVGVPSSKAKADGGGGSTPGGGKHKSEPRRAAGCRSLSPGPPLL
                     PTCYLCGQQFGTASIGIHVPQCYEKKLAQWQNADPHSRGHPPKHPDTVNWRGRPGASP
                     REQAEEQFQEFMNNLEECPNCSRRFLPERLVVHLRSCRPDNPPKPTSPRKAKTGGGAR
                     CPTPTTATTPADTAATKASIGGQTPRSEKQQRKQEPPTSSAGEDWIHPKRNRLTRHST
                     LPTESRVCPQCDAVEYDADAKFCRDCGHNFVPKPLSNSCQHCGERIPHGSRFCGTCGQ
                     PVQGASAHELTPGGPNKHASTVRRVVCPACEAISDADGNFCDNCGAALGDADLTPAPA
                     AAGAAATPPSTRAGGSTEHKAVLYCAKCKETVEDTTAVFCEDCGGRLEALKVLTTKDD
                     GPPLRADGTLPPSDVARLKVARASTPQRPSASEPAKTVTTPVASSVAPARPQTRNACT
                     PIEEHTDEFPAYAEDDLVRVPCSHCGRQFASESLAKHERICCSQKKRRVFNATKQRLP
                     EGATAAAKPSAGSQPAAPKRDWKAESESFRRALREARQVDQVLKAGGTAKDLPPPTYS
                     TNPDYVPCPHCQRRFAPDVAARHIPRCANTVNRPKPPPRRR"
     gene            complement(<22425..>23864)
                     /locus_tag="LMJF_18_0080"
                     /db_xref="GeneID:5650884"
     mRNA            complement(<22425..>23864)
                     /locus_tag="LMJF_18_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682362.1"
                     /db_xref="GeneID:5650884"
     CDS             complement(22425..23864)
                     /locus_tag="LMJF_18_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682414.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650884"
                     /db_xref="GOA:Q4QE34"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q4QE34"
                     /translation="MQRFSVRSASAVATVGAARTFWDPFGHQPESMFLDRKDLCQMYP
                     TQKPKTTGGGFGYERGPYWATMLLPNPAVRLPHERRRLNPKPAKCVTVFGASGYLGAE
                     IVRELCEHPDIEKVRATTRYPTLIPQGSDLDGLLLKYPDKLELHECDVTDRIQVNVAA
                     NGSDTLIFAVDYHAEYANNSHHDVFLIGATNVSWTARSVRAERVIFCNGLDATFASES
                     NYVDFRARGEDAVGANHPDATIIRFGPLYGKNYRYRGLGRYIYPACFPNTQVQPTWVV
                     DAARAVVRCSMSHRAVRYKFDLGGPQTLSHVEAFREIARHFEKRLVVPCYRGFGRFFG
                     KLATWTVPNPWFDDNYVLTFELDQVNRRSTLFDRLASWERIAYTPHTIREASEVERGI
                     RKLAPLQELDIAFKKLEAADKAAFEQEEEAAKKFGIYRAKAEPGFGRTDGLEALAQEI
                     YPGQQFRIKPLEGAKYPSNVTQPGPTAIQ"
     gene            complement(<25237..>27675)
                     /locus_tag="LMJF_18_0090"
                     /db_xref="GeneID:5650885"
     mRNA            complement(<25237..>27675)
                     /locus_tag="LMJF_18_0090"
                     /product="putative alpha glucosidase II subunit"
                     /transcript_id="XM_001682363.1"
                     /db_xref="GeneID:5650885"
     CDS             complement(25237..27675)
                     /locus_tag="LMJF_18_0090"
                     /EC_number="3.2.1.20"
                     /codon_start=1
                     /product="putative alpha glucosidase II subunit"
                     /protein_id="XP_001682415.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650885"
                     /db_xref="GOA:Q4QE33"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:Q4QE33"
                     /translation="MRRSHMTPIMVALLLLLASVASSVSVVTTEGGLAVDAIGYPNNV
                     VRLTAKPADKWTYQPDGIILPHAVALQVTKGANDAQWSIPHGECVLTVSMAPPHVRFV
                     FSCHANSLVEATAFADAMAAPEVNFTFPAAQTMYGLAEHAADLPLRGGSVYEMYNTDT
                     FQYSVNSTEALYGSIPFIMAYAPQSTCGVLFLNPSETNVGVGADSAAPSCQWKPEVGA
                     IDIFFLPGPTPAKVQQQHAALTGATVMPPYFSLGLHQCRWNYLNLKDCLSVDEGFDTH
                     NMPYDVLWLDIEHTDKKKYFTWDPYTFPDPKALTDALASKGRKLVTVRDPHVKRDEGY
                     YIHNEAQKGGYYVKDASGEDYVGKCWPGSSSWPDFLNTRTRDWYSQFFHDDRYPGGSR
                     DIHTWVDMNEPSVFGGERGTMPKMAVHSLDNGQTVEHRFVHNAYSFYSVQAAHKGMLE
                     AGGPNAAPERPFILTRSFFSGSQRYAAMWTGDNMARWDHLENSIPELLSLSISNYPFC
                     GCDIGGFFFDPEEELFVRWMQAGVFVPFYRAHANLDTKRREPWTFSTEAQSLVRIALA
                     LRYALLPYLYTTFYHAHTEGNTIMRPLFYEFPGQSELREVQNTYLFGPSILVQPVVKP
                     GVTEVTVPLPKEVLWYNYFSGELAVGPHTMPVGKDTIPMFLRGGHVVPMKLRLRRSSF
                     AARLDPFTLFVALNAQGNSYGDLYIDDGTTYDYTKGAFVHRAFSYSNQVLQNSAYPDF
                     PATAGLYNAANTVERVVIYGYVGKVSKVVLSTRVDETEVVTPLEFEQLGQTVVVRKPS
                     VLVAADWIISFENE"
     gene            complement(<28475..>29830)
                     /locus_tag="LMJF_18_0100"
                     /db_xref="GeneID:5650886"
     mRNA            complement(<28475..>29830)
                     /locus_tag="LMJF_18_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682364.1"
                     /db_xref="GeneID:5650886"
     CDS             complement(28475..29830)
                     /locus_tag="LMJF_18_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682416.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650886"
                     /db_xref="UniProtKB/TrEMBL:Q4QE32"
                     /translation="MSLLVCSEDCSLAEFSQKHQLNPHTLWLPLRAALPSRAGAKSHV
                     AVDPRTPIALLETATDTLLLDKRAICVKLHVANAVRCEETTVVVDPAAVPPGCEVFVR
                     WSRPGGKKLRANTLVLHYDVENATNASARSAVSGLKRSRVDDNDSSVGASSLAGSLQG
                     KQSRLSLVQQSTEDLQRRFSAAVGALGGQLSPRSTQILQSTLASMRYRQSQPPLHFVL
                     PSDATVLEAAGVRWARSNRRILSRVFRSITSGERSEASKYSDGSRQLRFYFIEDVLLR
                     RTREWRAAAARRHVDEDGKTGKGTPPEEVELLLKDEVLADMNTFAERGGRIVFFEHYP
                     VLHHGSRYTVEQTLAPVVRLCRTGCPHLTVTVVLSAMSCVTAAQKGGLELSLVLPQTG
                     LLTFFISELNTSLLPDPKTAAVVGASDRGSEFLNKLHAEFACNASLTYVDEKELRRQR
                     L"
     gene            complement(<30359..>34834)
                     /locus_tag="LMJF_18_0110"
                     /db_xref="GeneID:5650891"
     mRNA            complement(<30359..>34834)
                     /locus_tag="LMJF_18_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682365.1"
                     /db_xref="GeneID:5650891"
     CDS             complement(30359..34834)
                     /locus_tag="LMJF_18_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682417.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650891"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE31"
                     /translation="MDTKAAQRSAYSFFDSYRYLWGPQRPQRTAEEMERLRGSVDAPA
                     AEVLSFISFEDRVAIRSLFYVVVDDTNLRNLLDGLLLPPPYTFPDLHQKRWTQEDVRA
                     LCVVLNPSLDWVVVNVPFNLALRLGSYDARLRAAARRLSWILSIPFSLVEREENSLAQ
                     VHMTVSRDAAAEQADVARQEGLLKSKEQQKRSLMRAATIGGFSVLGGAALLVTGGLAA
                     PVVGPAYAALVSATATTLGVIGAVGGAVLGTGALATVFATIVGAATHAAALASVVTPM
                     LTAANMTAIFGVTGASLGGYKAFRRTTDSDIFMLRSVDEIEAFETAAAPTAALATTAE
                     EEEADLNKEVVHRLACSQQTVEKGSGTAGTSWDLSVVLEDNSKPGVVVPSHTRMITMS
                     HVRNLSLLQKRRRHVVFAVENNLDGFQLRLKAIKLISGVWAMAPPAVIAPARAGVFAC
                     VNRFAHPTGTGFIICYMATPSPGTANLTSLRIWVRAERDFFGAWALSAACEKTDLEFD
                     PMAAENWMEGHLAGSDFTRRQWGVVLEMHVEPYTYLKLYPASAGEAAQARKVTFPKEE
                     LPQRQLEYGQKVKQRRKLGVSLVNCSSHDVFTRDAGMISGEQWPETPSPIGVYPAEAS
                     LTYFTNSEWSLAGAEGYYIVEVVNRSSRPVTPRFYVRANFAVSSLNNVNVAFASAYNL
                     SELTRQSLTPATPSRAQFSVDLPPGIFFSLTCVVDVAHYAVQLVFQDFVERLGSAGVP
                     ATEKMTLAIGVSGYSAIFDPRRPVRDQQVCLWQSVLRRSELLGSTESYVLQWEDDMLM
                     KFGETIHVNLEIADTLMMKAVSTATENTLMQGALFTGLHALSSLVHAFKLPLFAVWAT
                     SVIDNTFATLSNRSAYTGKDLAVALLDKQRGNRPVTLVGFSFGSLVIVECLRELERVE
                     AYGVVENVYLLGCTCSSDPGLWHCLRRVVAGRLVNVYTREDWTLWMMYRLNKTDLKPM
                     AGINPVNVPGVENVDVTPLVSAHGDFAVKLLPVLSAIPPEPTSTTWSPRQHHGSPGVT
                     VPVRNCRETVAAVCKSLHSYIKATTYVAVGVKNCVVSDIPHYEPQVELLTVQVYGCFF
                     DFVPPPLTDIGMASVAGLLGDTEKPMGAVVAYRMRLPPSSPQDLVVALYLCSSAKGDL
                     QVCAQPNLVGRWSCAAETQEQAYQRLCAITAETCQTLDDVKRMCCTHGAEWELSSGAT
                     HTQSILVPVPNTFDDAHQTAIVRLALERLDSAGVTVTWLALLTRASTHLQQETFDETQ
                     FKTAVAAIGTHHPHHQGDGNGMPLPVVAETCSTDNLQQRLHSLAAQLQDPAKHPSNTA
                     PFVLVNCGTLPLYFSETFHNAAKVAAVPDVPSCIWSMPQWRRFPPPEIPPRSFAVALL
                     TLHDAEPGTHPAAPPVRYETNNGQCAFDVEFSDKIFTNGGAQGGADLAAAVHCTPVEG
                     RPYRGEVTLSSTTIQATPFIIIMMVPRTAADAAVDVEDAQDTVESRLRAHGWYVM"
     gene            complement(<36384..>36767)
                     /locus_tag="LMJF_18_0120"
                     /db_xref="GeneID:5650892"
     mRNA            complement(<36384..>36767)
                     /locus_tag="LMJF_18_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682366.1"
                     /db_xref="GeneID:5650892"
     CDS             complement(36384..36767)
                     /locus_tag="LMJF_18_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682418.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650892"
                     /db_xref="UniProtKB/TrEMBL:Q4QE30"
                     /translation="MDTEEGEFIICGNGGSPEDAAFDAVVGVIEDFMISFDPEQVWQS
                     LPPLHTVSGDHDQHTVYTSFLEKVDQELDAHVLASCPEYKSIEQVVTLLQKRHEDITE
                     EVWSFVSEGCFDYEAFMEQWKKKRP"
     gene            complement(<37769..>39835)
                     /locus_tag="LMJF_18_0130"
                     /db_xref="GeneID:5650893"
     mRNA            complement(<37769..>39835)
                     /locus_tag="LMJF_18_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682367.1"
                     /db_xref="GeneID:5650893"
     CDS             complement(37769..39835)
                     /locus_tag="LMJF_18_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682419.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650893"
                     /db_xref="GOA:Q4QE29"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QE29"
                     /translation="MPMQPPFFTAAKSSSPWLLALALGLLDHVAIEAAASENEASGYA
                     AWPKWVLILFCITTVLLSAMYCGLTIGLLGMETIYLEIIADAGQEPDRTYARKILPVR
                     MLGHELLATLLVGNMLTLVLTSQLVAAIVGGSELVNFILGTLVVLIFGEIIPMSFCNK
                     QNNALWAGAKSLQALKVSLFVLWPIAKPLGMMLDWMVGHEAGQIYDRQELKKLIRMHC
                     EKFSDKSGIDTDQVRMMLSVMDTNEVTADAAMTPMGKAVMLEASTPLDTALERRLWEY
                     GISRVPVYERSRDNVIGVLYVKDLIDNSYLGHKSDMTVRDFVAQHPRDMLVVKADTLL
                     QEMLYIFEHYHTQLLFVEPTDTATADKRRGRAGITASNSRDASPYSAYHVHQGSKRAA
                     PAQRTPKTINPMALLSNAMEPSSFIGLVTLEDVIETLIASEIYDEDEYLSDKKLLLDA
                     EAFDESTIEPPLTRPPRVNFYSYGVRSKLEDQGLSDDQLWALAYYLTRTYVYFATWNV
                     AHVKFLLQQIGDLVVDVDDQVSDGEKSKSTPLCGIAAALPDLSTADPARVLYRAGQPS
                     STFTLVLSGGVEVTIGREKIRTELRSFSDLGADVLLSGAPFLPDYTAVVSRTSRLIRI
                     THADVVMVEKKLNEHRARQPQKPLFLTPTSGAGAAAAVTVPPACAPHRKAKERMRGEA
                     KRVAIE"
     gene            complement(<41951..>44191)
                     /locus_tag="LMJF_18_0140"
                     /db_xref="GeneID:5650894"
     mRNA            complement(<41951..>44191)
                     /locus_tag="LMJF_18_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682368.1"
                     /db_xref="GeneID:5650894"
     CDS             complement(41951..44191)
                     /locus_tag="LMJF_18_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682420.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650894"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QE28"
                     /translation="MHVWHSRASAVRSIRLCIMFAAYGVFLAATLGANGNSFAKDPSQ
                     MTEKELANENRKQTKRVYSLLDHSLRICMYAFLSAVFAGLTLGVMCANTFTLEIIAES
                     GPTPDCKYAATLLPLRKQGHKTLSTLIICNMLCNVLIVQEFNDVFDVVEAIRTRGTST
                     HMVDDKGSGIWKFILSTLVIVLFAEILPMSICRSKYSLRVAAAGSVFVNVAMILTYPL
                     SATLGWFLDVVVGSEETGQLYDKKELRKLMVMHYEREGDDNAHMAKSELKLLLAAMDF
                     HERKVRDIMTPIEKATCVRGTDLITPDFLEMLWKSGRSRVPVESAPGVFESILVVKDL
                     MTVNTSLEFSPLTVEQVVKAKDRLFAMVCATMSLPSMLKFFLEAQTHMAVVFEEDANI
                     IGAAIPAIMTDFEAWRMESSGLRGFAATHLKCVGIVTMEDVVEELLASEIYDEYDSYD
                     PVEREPRYAAVDIPGNDCYPNTLHLPSEPETPPRVNFYSYFTHPTESIPLTDSQVWAV
                     AYYLNRTVPCFYSWQPPYIKLLLDECKDLQLCAITLSQQNGTPDMLLSTSPDQMHDSH
                     STSSSQTGGVQGALSPSQFFFKGGHAQFLNAVNDPSHILYSRGIRSDRLLLVLGGCVE
                     LLVGSEAFRSKLQSFNYIGEEALTTPFFVPDYSAAVITAARVYSIPKVLFEKYQYYQF
                     ANRQRSSNVRILSPGLPTLLRSSAPRQGMGTMTSSERDSLLGHRTDSAQALQRRQYGT
                     ASKNTS"
     gene            complement(<46564..>47973)
                     /locus_tag="LMJF_18_0150"
                     /db_xref="GeneID:5650895"
     mRNA            complement(<46564..>47973)
                     /locus_tag="LMJF_18_0150"
                     /product="putative serine/threonine protein phosphatase
                     type 5"
                     /transcript_id="XM_001682369.1"
                     /db_xref="GeneID:5650895"
     CDS             complement(46564..47973)
                     /locus_tag="LMJF_18_0150"
                     /EC_number="3.1.3.16"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase
                     type 5"
                     /protein_id="XP_001682421.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650895"
                     /db_xref="GOA:Q4QE27"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011236"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR013235"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QE27"
                     /translation="MEESDRLKQEGNAYFQEKKFQHAVESYSQAIEAHKTPTLLCNRA
                     FAYLKLELPGAALVDAQEAVEIDPGFVKAYYRKASAHLLLGKFKDAQKEFAAVLKLVP
                     TEKDARQKYDLCEKELKRIRFENAIKSKDCEPVSTTIKLGTIAASYDGPRIENDTITV
                     QFVEAIQEHFRVEKKIDRRDVVFMLLGVLKLFKSYPNFVTVTVPDGEDITVCGDTHGQ
                     FYDLLNIFKLNGKPSPTNRYLFNGDFVDRGSYSVENVLTLFAYKLLYPEHVFLSRGNH
                     EGLSMNRVYGFEGEVRAKYSAEVFDLFSEVFNALPTGHIINDEVFVVHGGLYSRDDVT
                     IADLQKPNRFRDIPENGLICESLWADPQPMPGRTPSKRGVDCPSFGPDVTENFLKNNN
                     LKLVVRSHEVKEDGYEVDHNGKCITVFSAPNYCDQMGNKGAFIRFTGGAMKPKYTTFT
                     HVAHPGKRPMQYACGAGLF"
     gene            complement(<48813..>50930)
                     /locus_tag="LMJF_18_0160"
                     /db_xref="GeneID:5650896"
     mRNA            complement(<48813..>50930)
                     /locus_tag="LMJF_18_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682370.1"
                     /db_xref="GeneID:5650896"
     CDS             complement(48813..50930)
                     /locus_tag="LMJF_18_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682422.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650896"
                     /db_xref="GOA:Q4QE26"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QE26"
                     /translation="MPSLVWFGRAWRVGSDDFAFSSVVHAMLLAGSAALVACRVNTAR
                     LNYLDDCDGASAAWGRVMMGLLFVNLVGAAPFLLTAVYSLRGGVFEISKRKAVPMLLY
                     MNTACIAWVFLLSCLGAKHAIIEREASYCTRASTRHMLRGAIMIDFINCVLYIALLIV
                     AFDPSGRRVYQSNSEYANAWWNRFRMCCCRFGKWNQAEDAYIHLAQVFAIAFRGYDIV
                     PSDIAAGILLLHGYQSRSRRLLSRLVDYGPNPQGYHERLSSQARPAQRLTPEQRAWAH
                     ELQQYSRFFIAAYGWLLFEFQHLGSGLARLCCFDPCMCCRHHPGRHIGQGCFCDVAAL
                     LHETLIPEADVLLTSWENRVFEPVHYVAYDRSSDAVVIAIRGSMSIEDCVTDFAALPV
                     TLSLRDTPPDVPISEYYAHGGMVRCAYYVLENLCEHGILQQLLRGSYAGKKVVVLGHS
                     LGAGVALILSAILWSDHTVLRNRLRCLAYAPPGGTVSKALMEYQKDFVAAACMGYDMI
                     PRLAQHTFDSFREAVFDVLAASSMNKNMIFMNVLRTSTIAKSFHPSTSANFQQRRSAE
                     SASLREFLQITSFTPTYETQKLYNCSLMIHYVKVVEVCTNTWCLPGCQHYEEVYIPVV
                     HDFKEVQMVLASPRMLTDHFPDRLFRIMKRSMELFDKGELDRFYVDDISNLAPCFEEA
                     PMHYVESTPTTAGTASLVSYGAA"
     gene            complement(<59930..>60973)
                     /locus_tag="LMJF_18_0170"
                     /db_xref="GeneID:5650897"
     mRNA            complement(<59930..>60973)
                     /locus_tag="LMJF_18_0170"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682371.1"
                     /db_xref="GeneID:5650897"
     CDS             complement(59930..60973)
                     /locus_tag="LMJF_18_0170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682423.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650897"
                     /db_xref="GOA:Q4QE25"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QE25"
                     /translation="MQNSPIIVMRSSRCPTQMQFYTPSSTNLFVRYLPREVDDNRLRE
                     IFSAFGKITSSMVMRDIYNGQSLGTAFVRYEEHEEALRAMRDAHGMPLLGKTVSVQWA
                     KQQHDDTPAGQERLKMNKLFLRNVPLEVAEEDLVRLVSPYGSVKKVTIHNDTAPLIDA
                     TERRRIVFITFAEQGAAEAALLAVHNTCAFHQCRGIPLMGKLINDAVKSKRHRMNASR
                     SHSISTEFVTNSPTTACARSSRMAVAPLNAADMMNAARKMSLESFSPSQVPHFISSSE
                     ESVANTPSRSCGGLQWDVAALMPSRASPAAVPRPIGCDSSDSSLPRSSSDVSYSSRFC
                     HNPYSLLGEKTYV"
     gene            complement(<70601..>71647)
                     /locus_tag="LMJF_18_0180"
                     /db_xref="GeneID:5650898"
     mRNA            complement(<70601..>71647)
                     /locus_tag="LMJF_18_0180"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682372.1"
                     /db_xref="GeneID:5650898"
     CDS             complement(70601..71647)
                     /locus_tag="LMJF_18_0180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682424.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650898"
                     /db_xref="GOA:Q4QE24"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QE24"
                     /translation="MTKSSQHQHKSSSFTPSSTNLFVRYLPREVDDNRLREIFSAFGK
                     ITSSMVMRDIYNGQSLGTAFVRYEEHEEALRAMRDAHGMPLLGKTVSVQWAKQQHDDT
                     PAGQERLKMNKLFLRNVPLEVAEEDLVRLVSPYGSVKKVTIHNDTAPLIDATERRRIV
                     FITFAEQGAAEAALLAVHNTCAFHQCRGIPLMGKLSEDYTQKARTPRTAHAPYSRRYS
                     GSERSPSGTCSKAVKSRSEDPAPPVLGRCASGVNAADCAGADTQRVVETPRRAGIALM
                     SRTSHSQCSLNLAETRGLANTQRVAAEIHAFEAAPRCTCEAFVGPTTIHALDSGITVT
                     IRHRPSSRTFKRHS"
     gene            complement(<87422..>88450)
                     /locus_tag="LMJF_18_0190"
                     /db_xref="GeneID:5650899"
     mRNA            complement(<87422..>88450)
                     /locus_tag="LMJF_18_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682373.1"
                     /db_xref="GeneID:5650899"
     CDS             complement(87422..88450)
                     /locus_tag="LMJF_18_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682425.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650899"
                     /db_xref="GOA:Q4QE23"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QE23"
                     /translation="MSYKHNGGYHRGRPSVATAADSKLNLLVRFLDHGVDDSQFRVFF
                     EPFGEITSSMVMRDIFTGESRGFGFVRFARSADAARALRECDGKRLGGKAVNVIWAKQ
                     QHDDTPAGQERLKMNKLFLRNVPLSVTEAELVALLRVYGTVTEASLHSDKIPAARHAP
                     ARRIAFIMFADEGAAEAALRGVHNTCPFPSCNGIPLMGKLSEDYKAKNGGSSNSSSNS
                     SCQNFSAPSRAPAILFTDHARLPPMLDCAFCTFTPKHVGGGCSPTPASSVHLSDSAAE
                     DLLFSPSAVVAGGSQADGVIAEQEAMARYSPALRLSTLRLPVPTLPKVFRHNPYAASL
                     IAPRSNSG"
     gene            complement(<99021..>100496)
                     /gene="GLF"
                     /locus_tag="LMJF_18_0200"
                     /db_xref="GeneID:5650900"
     mRNA            complement(<99021..>100496)
                     /gene="GLF"
                     /locus_tag="LMJF_18_0200"
                     /product="UDP-galactopyranose mutase"
                     /transcript_id="XM_001682374.1"
                     /db_xref="GeneID:5650900"
     CDS             complement(99021..100496)
                     /gene="GLF"
                     /locus_tag="LMJF_18_0200"
                     /EC_number="5.4.99.9"
                     /codon_start=1
                     /product="UDP-galactopyranose mutase"
                     /protein_id="XP_001682426.1"
                     /db_xref="GeneID:5650900"
                     /db_xref="GOA:Q5EEK0"
                     /db_xref="UniProtKB/TrEMBL:Q5EEK0"
                     /translation="MSADKVVIIGAGPTGLGAAVRLMELKHANFHLYDGGTVPGGLSR
                     SVLDDKGFLWDMGGHVIFSHYAYFDDVMNLAISDWNTLQRESWVRCSGAWVPYPFQSN
                     IHRLPPEVRDTCLKGIEEAEAARSVAAPEKPQNFAEYVSRHFGEGIAEVFMRPYNFKV
                     WAVPLHLMSTEWVGERVAAVNVERIRENIQLKRDDVGWGPNATFRFPKSGGTGAIYKA
                     VWKMIPEAHKTLGPQCRVTKVNPITKTLTMANGEAVSYDALVSTMPLDDLLLAVAAGV
                     EEDAETASASALKAPRLREIADKMVYSSTHIIGIGVKGCPPPEMRTACWLYFPEDGIP
                     FYRATIFSRYADTNAPEGHWSILLEVSQNVLYKPVNVDTIVEDCIAGLRTVTLLRPED
                     EIVSRWHHMEKKGYPIPFVGRNELLEEVQPVLRDKYQIYSRGRFGAWRYEVANQDHSL
                     MQGVEAVGHIFYGTDEDTVHKPEKVNTRRGEMRCTWSSTAS"
     gene            complement(<101888..>102943)
                     /locus_tag="LMJF_18_0210"
                     /db_xref="GeneID:5650901"
     mRNA            complement(<101888..>102943)
                     /locus_tag="LMJF_18_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682375.1"
                     /db_xref="GeneID:5650901"
     CDS             complement(101888..102943)
                     /locus_tag="LMJF_18_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682427.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650901"
                     /db_xref="GOA:Q4QE21"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q4QE21"
                     /translation="MAKVGEGDPRWIVSERTDGANVNSWHWEERDLSQHTHSRLKSIF
                     AEHAIPVPADMGKSVEYLKIEELSDISGDVTVAQRKGKMMCYFELKMTLKWVGKMADA
                     DQVMRGKMEVAEVDHDEFRNDYDIAVTCQDNDAASQQIQSVVQAAGRATVRQEIVAFF
                     DALFAEYQIGKQLKSGAALPPPPPPSSASASTSPGSNAAAAEKKSTAQSKSSSSSNEN
                     TSFSWKMRWGAPVAELYAALTDPSKASVYTRSPATMDVKAGGQFSFLGGVISGYYVDV
                     QPLTLIKKQWRLGSWPVGVHSLVVLQLVKEEPGVTTLEFTQSGIPAGELQSVQEGWKA
                     NFFEAIKAVFGYSLEYM"
     gene            complement(<104850..>106079)
                     /locus_tag="LMJF_18_0220"
                     /db_xref="GeneID:5650902"
     mRNA            complement(<104850..>106079)
                     /locus_tag="LMJF_18_0220"
                     /product="putative RNA-binding protein"
                     /transcript_id="XM_001682376.1"
                     /db_xref="GeneID:5650902"
     CDS             complement(104850..106079)
                     /locus_tag="LMJF_18_0220"
                     /codon_start=1
                     /product="putative RNA-binding protein"
                     /protein_id="XP_001682428.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650902"
                     /db_xref="GOA:Q4QE20"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QE20"
                     /translation="MSGTPMQTRFGCYIGNIDRSVTIDMLKQVFCQCGTIIDCSLNGR
                     EGDPYRFGFIDFATEDDRARAMKYNGFTLVGRKLKVGVSKGNVNKPEGYATGNGAGGG
                     HSRMGGNRHYNNDGGMMMSVNGLSPQQQMEARLLLQFLQEGKMDPRQLSPVQQQLLIT
                     CLGHGNSSNAANSSSANSDSSTPASAQQPQMGVMGSSAMQSPLPLPTMHNSGSMMGDA
                     AAFMPSPNAGNGAPGAGVPMMGGVAPQGIHINMGPSMMDPMGGGYGMMPPRQPQPQQW
                     GDMSMNGPGMYPPKMCGLPLRQQPQMPMQAGQQQPYGLGGGAASISGPGAADHNRGGF
                     INPPPAAETLKLREKQREQFFEVVRQDAEKYERKLQEKKAQSAAGGDAERSADSSASD
                     DDEDKKPAKRSKKESSK"
     gene            complement(<108589..>109485)
                     /locus_tag="LMJF_18_0230"
                     /db_xref="GeneID:5650903"
     mRNA            complement(<108589..>109485)
                     /locus_tag="LMJF_18_0230"
                     /product="putative 60S ribosomal protein L7"
                     /transcript_id="XM_001682377.1"
                     /db_xref="GeneID:5650903"
     CDS             complement(108589..109485)
                     /locus_tag="LMJF_18_0230"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L7"
                     /protein_id="XP_001682429.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650903"
                     /db_xref="GOA:Q4QE19"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:Q4QE19"
                     /translation="MGKNPPKWLPGERVKETILLQRKSVEQLRADRVLRKDKLQERRE
                     RHKNKLDVKRKRKLSTKKFISAQTILKHAQRKENQGRKFQKIGEKVEGRRRHVNFGEL
                     KKRLRESPVRLVVRAKGSQIPPEVAAAFRKLGLLKIYSARLISLTPRTEKLIEQLTPF
                     SIVGQPDRAQLESLLRTRGSLYNEETQTKRLISGNLLLEQALGQYNVLCIEDLVETIA
                     THGEHVEEVLRHIAPFDFHPPRQLFIERHRSVHQKLEIVNKDSFAAYLSDQLHQITVE
                     KQRKAAAAAKKSKAVTVKRKAA"
     gene            complement(<111536..>112750)
                     /locus_tag="LMJF_18_0240"
                     /db_xref="GeneID:5650904"
     mRNA            complement(<111536..>112750)
                     /locus_tag="LMJF_18_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682378.1"
                     /db_xref="GeneID:5650904"
     CDS             complement(111536..112750)
                     /locus_tag="LMJF_18_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682430.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650904"
                     /db_xref="UniProtKB/TrEMBL:Q4QE18"
                     /translation="MVPARHIIHYFADRHTAAVATAFFIYVLIIGWCGNTGTREVQQR
                     TEAVFRRLHSTADASSSAGSSFFTSSVAHSVSVAVLRLTDADAELLHGGTLDRVPSWA
                     EREQQLLSLASRWQYYFTVGDFTLISAPSRLTASGMLKEWIATLGSVYPTCVFASLAG
                     GAGSEDTEDDRQVLILPSAWQSHRRALMGDRHQQSLRVLRVHTLPAPERLRERAAAVA
                     AASNEGNDGAKDPLFVFVSENATRTWSAAVDAAERKRLATERWRSGKSGLDAWEELLQ
                     TTSMSQAALRAAVGSAAALPSVDDFLPPDPRRRVAQLRGKTTRAPSTSVMDAAQYIPR
                     LAMDLANTYRAPYVILASWCSSAGTYGWNGTSPSGAGTEDEGLVLVLCLQDNELVDIV
                     PSRQHVSRLLQQ"
     gene            complement(<113445..>113873)
                     /locus_tag="LMJF_18_0250"
                     /db_xref="GeneID:5650905"
     mRNA            complement(<113445..>113873)
                     /locus_tag="LMJF_18_0250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682379.1"
                     /db_xref="GeneID:5650905"
     CDS             complement(113445..113873)
                     /locus_tag="LMJF_18_0250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682431.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650905"
                     /db_xref="UniProtKB/TrEMBL:Q4QE17"
                     /translation="MHDESDFRQCLLEARRLMGGQEPEKLTRYQQGQFADRLGNYMSG
                     IASDKLRRAHAEEQSTKRYMQDGTPTGENYWFEASNTLSSPAVPGFVKDDILKDMQRE
                     RTAKSPAFVQPAEEEQLTANDDDYAAHVRRQRHKLLRDTD"
     gene            complement(<115059..>115415)
                     /locus_tag="LMJF_18_0260"
                     /db_xref="GeneID:5650906"
     mRNA            complement(<115059..>115415)
                     /locus_tag="LMJF_18_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682380.1"
                     /db_xref="GeneID:5650906"
     CDS             complement(115059..115415)
                     /locus_tag="LMJF_18_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682432.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650906"
                     /db_xref="UniProtKB/TrEMBL:Q4QE16"
                     /translation="MLGGLRPLAAATRRTVGGALVSPALITPSRALSVRTEDFFSKEA
                     VSHARRVSWAPHTTEKKVGAFAKLSRSNFNDPLPVSFQSEPYFEEEIEAYRAHHRPDV
                     YVYKYNVSPTHLSLRE"
     gene            complement(<123069..>124136)
                     /gene="GSK3"
                     /locus_tag="LMJF_18_0270"
                     /db_xref="GeneID:5650907"
     mRNA            complement(<123069..>124136)
                     /gene="GSK3"
                     /locus_tag="LMJF_18_0270"
                     /product="putative glycogen synthase kinase"
                     /transcript_id="XM_001682381.1"
                     /db_xref="GeneID:5650907"
     CDS             complement(123069..124136)
                     /gene="GSK3"
                     /locus_tag="LMJF_18_0270"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative glycogen synthase kinase"
                     /protein_id="XP_001682433.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650907"
                     /db_xref="GOA:Q4QE15"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="PDB:3E3P"
                     /db_xref="UniProtKB/TrEMBL:Q4QE15"
                     /translation="MSLNAAAAADERSRKEMDRFQVERMAGQGTFGTVQLGKEKSTGM
                     SVAIKKVIQDPRFRNRELQIMQDLAVLHHPNIVQLQSYFYTLGERDRRDIYLNVVMEY
                     VPDTLHRCCRNYYRRQVAPPPILIKVFLFQLIRSIGCLHLPSVNVCHRDIKPHNVLVN
                     EADGTLKLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFA
                     EMMLGEPIFRGDNSAGQLHEIVRVLGCPSREVLRKLNPSHTDVDLYNSKGIPWSNVFS
                     DHSLKDAKEAYDLLSALLQYLPEERMKPYEALCHPYFDELHDPATKLPNNKDLPEDLF
                     RFLPNEIEVMSEAQKAKLVRK"
     gene            complement(<127467..>129518)
                     /locus_tag="LMJF_18_0280"
                     /db_xref="GeneID:5650908"
     mRNA            complement(<127467..>129518)
                     /locus_tag="LMJF_18_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682382.1"
                     /db_xref="GeneID:5650908"
     CDS             complement(127467..129518)
                     /locus_tag="LMJF_18_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682434.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650908"
                     /db_xref="UniProtKB/TrEMBL:Q4QE14"
                     /translation="MSAPASVEALRRELEAEQDAHAATMAQLQEQTRTFQAVLAEQQE
                     AFTDLITRVTELRVAKSEYMAAQVAGRTQHMTFNTGSALLDGFLYSLHAKLEGPEMSV
                     ATSVLQKLENAALEALTPYGPGRLSALLTSSASAVRTTGLLVLFPNDVRGVRQWARKH
                     LSSCASCAARQAQLPAWTPYRYDSKGTGFAAAPNLRAIPNKHYHHVAISLLQERSIAD
                     RMDTENQLVIMRTTALVRVQSAQTGQRLADSATACSQMTSSLQAFLAETMTELRNTIS
                     VSAPWSTGANPNSELSAAIEILLHMVEPGVQVRPMQQVAVTSTGASCTLVEVETTVSV
                     PLHVSALAPLLRLMDDPAQRGYVIQHVLTPLARRIGDALGDGDLAAHYTATGLRFVEA
                     LYRLAVHQGLVETDGKSKTLEQLYLILQALAVFGTSVEAEVITPHVPASPPESKPDAK
                     RAALRLARALLRQFAAPKTLVVPRGDDADAVNMTIKVSRAPTTFLEVLNRAFSSNHRV
                     PPTSRSTALDAFMSPKSKISLGLKLFRELVVEVHRPYHPCTGYVLAAENGVGGRRRAP
                     PCVPVIDLPVDVVEANVRVAEYVEQLLQQLNEIEASDAVAAEGRLEREGKAFVQQVVS
                     TLQQTAPAERLRSQWTAAQITISEVSKVCVDVLVPFAMTEVDARAATKPLLYLHVVYN
                     S"
     gene            complement(<131126..>132136)
                     /locus_tag="LMJF_18_0290"
                     /db_xref="GeneID:5650909"
     mRNA            complement(<131126..>132136)
                     /locus_tag="LMJF_18_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682383.1"
                     /db_xref="GeneID:5650909"
     CDS             complement(131126..132136)
                     /locus_tag="LMJF_18_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682435.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650909"
                     /db_xref="GOA:Q4QE13"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QE13"
                     /translation="MKTIRTIGFTGTIASGKTSRCKHLVKVAESWQQPIVAAKGSGKN
                     SGTSSVSLGSDRTMHPPAIPSSSALAVHYINADLVGHHIYEPGKPCYYDLLQHFGTAI
                     LSAPAPTKASQQAGSPTQGVQEGAGRGCSAAGPGKAEPFIDRRVLGQIVFAEERRLQE
                     LNSICWPYITAAIKDEYAKVYASLKAAYPPLMGSAETLSSAAKTPTAVSPPSPSPSTP
                     PDAAVLAAPAVGLVIVEAALLCEMTEVLELTTDLWMTHCTPATAVDRVMMRNQISRED
                     AERRVASQLDVERKLLKLRHLPYKGDIEVFDTTQVSLEEGLKETEAAFERYWRKKIAV
                     HL"
     gene            complement(<133918..>135018)
                     /locus_tag="LMJF_18_0300"
                     /db_xref="GeneID:5650910"
     mRNA            complement(<133918..>135018)
                     /locus_tag="LMJF_18_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682384.1"
                     /db_xref="GeneID:5650910"
     CDS             complement(133918..135018)
                     /locus_tag="LMJF_18_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682436.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650910"
                     /db_xref="GOA:Q4QE12"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q4QE12"
                     /translation="MTVRTSDTLLQKIGASFAVHYYTTLVEAPATLTALYTPSAHVVH
                     RFEKANGAAELSSLLTSLTAEGLTGVRLEDVMAVPTTSGAIKVTVKGQFVSADNTQSF
                     TQEVELSELEKNTYGITSDKLSYSAVGRTAWAAETPAAAPADPVKSADVHETAAAAPA
                     GDATANQPACQAAEQAPAANKKPASFAEALRLNKASEGAPFSNTAVRVTDKARGTGEK
                     DTGKGAKKGKAASPSAASAKPKPTKKAHSTSDSVIYYDIILKELPSSTTEEKVRAVVS
                     PVAAVKLVNIVKSEKRRRSKEAASETITFAFVQLERPADAAANHVKSVVAKLTEMNKE
                     MRIEEVREKPASAGARKTREGAAASRKKEVKA"
     gene            complement(<136577..>136885)
                     /locus_tag="LMJF_18_0310"
                     /db_xref="GeneID:5650911"
     mRNA            complement(<136577..>136885)
                     /locus_tag="LMJF_18_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682385.1"
                     /db_xref="GeneID:5650911"
     CDS             complement(136577..136885)
                     /locus_tag="LMJF_18_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682437.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650911"
                     /db_xref="UniProtKB/TrEMBL:Q4QE11"
                     /translation="MSNRFFQKFYLRCGNCSAIQRSAQGYQPIANPILFKSDEHCRNY
                     HDEQRRAAGYSGMVVTCRCHRCERVHSNWKVLDAQQFLDAKLRMTPEERAQRLWVSKS
                     "
     gene            complement(<137701..>138894)
                     /locus_tag="LMJF_18_0320"
                     /db_xref="GeneID:5650912"
     mRNA            complement(<137701..>138894)
                     /locus_tag="LMJF_18_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682386.1"
                     /db_xref="GeneID:5650912"
     CDS             complement(137701..138894)
                     /locus_tag="LMJF_18_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682438.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650912"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:Q4QE10"
                     /translation="MATVAVEETGACLLCYTIHFVLKCIAVARVGDVLLTCAGTRSLW
                     RTLSPLRHSLSPLFLSLSLSLFPALPGNCAYGSRVKTSAFSLTLPAERCRRVLEEGRE
                     AQGTTVAVNRTLAPSLLLPTANTNLCTPRGTLVEAMLRPTCALAAAEFKQKSRWSSVW
                     PNMRYGSMYLNYSVGRQLPMKGVNWVTRDSNRLTNFAARYSSVIEDVDVKRNEEELNI
                     QMSDVRWNDHRRIYWKCSFCGSSYRKNVSVRTKYHAGCNFCKGRYASEVLREQTPVVA
                     LREAQPELFKGLAENEKNDNIGSLSVTSKFRAEWKCQSCGQPYRATIRSRTGLTEPGQ
                     APLHPRITEWSAHCPACAWRTNMTAIGRKAQEEGQYLGLETSLAELTGAAAGKRIPRR
                     RKLVA"
     gene            complement(<139836..>140570)
                     /locus_tag="LMJF_18_0330"
                     /db_xref="GeneID:5650913"
     mRNA            complement(<139836..>140570)
                     /locus_tag="LMJF_18_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682387.1"
                     /db_xref="GeneID:5650913"
     CDS             complement(139836..140570)
                     /locus_tag="LMJF_18_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682439.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650913"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QE09"
                     /translation="MRVSRVARTGLRHVTCSVAGYALAFGATAAAAASTAPLRTQARY
                     ASSKNPYTVLGIKQGADKAEIKKAYRVLARKHHPDAPGGSDERFREVQEAYEQIKSGV
                     WVRKDQEGGGSDGGGGNANRYSGFRYTTRTHHKSKVSYDQFYEEMHTGRVKKDPFADD
                     DEAEDPAAKDPRRNPFAMNEIAFQAWLRFIIVWCVVFCSLRLVLFLMFPPKWEKPQRK
                     PPPRELRGRKPPPPKPLRISEDAIVA"
     gene            complement(<142197..>143366)
                     /locus_tag="LMJF_18_0340"
                     /db_xref="GeneID:5650914"
     mRNA            complement(<142197..>143366)
                     /locus_tag="LMJF_18_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682388.1"
                     /db_xref="GeneID:5650914"
     CDS             complement(142197..143366)
                     /locus_tag="LMJF_18_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682440.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650914"
                     /db_xref="InterPro:IPR026755"
                     /db_xref="UniProtKB/TrEMBL:Q4QE08"
                     /translation="MVHDEIRELSTQVKSMIAQHLPRDGTSKEQVMWGVRQFGPSKES
                     RRVLNKENDAARLAWETGVYCVWRCREKPRLSGANGDFCCRIGYQHVCFCGHPLAAHT
                     TPARAANSSATAQANRGRDREAVGNDGDKGHAPSCGSCTTPATDAQLAQWKGRCEEVG
                     CSCARYRYVPNTPLEIGEGWLTRRANWKASEWSAKCRCGHGHKVHDPKTMRCKSCGGC
                     SGFTSAFLCVVCDLPWEAHDTVWESEGRRVGDGHPVCEAYAPLAGVDDDVREAVLTDA
                     TMGGRIEPSATYLALKQRTSGSCALADTTTTAMTASSAPRSIAGGRPSSTAAAKNREG
                     GSSAGALPAITASPAPDPILDVEYCRFCATVYKRPESKFCAQCGQPRPQRPAKLR"
     gene            complement(<144723..>145637)
                     /locus_tag="LMJF_18_0350"
                     /db_xref="GeneID:5650915"
     mRNA            complement(<144723..>145637)
                     /locus_tag="LMJF_18_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682389.1"
                     /db_xref="GeneID:5650915"
     CDS             complement(144723..145637)
                     /locus_tag="LMJF_18_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682441.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650915"
                     /db_xref="GOA:Q4QE07"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:Q4QE07"
                     /translation="MSRMDSKQLEEVMRKFEEQENESSRVLSEDSLYQMEVSLKPRSS
                     CAVRVFWKDVDVVELEDRYPGWFAVTVDGRKVKAMKSSQVLAVPSEAMACCCAQEYAE
                     QTGHINQLLMPMSDICSGALHIAPQMLTPRIDYLLSFFQNDNLYFRAAPIAAKQDAMI
                     APIIAWFERVYEMDVPRVVGIGNPHITPHATAKMRDALIAMNMNPYQVLAMCVTAQFT
                     SSLLLPLALFSGVVDLPTALAINRAEEQHSISEAGLVAGYHDIREADAVTKICACALT
                     WKLMKDVPLAKCLEMPRAASAMEEAEAV"
     gene            complement(<146659..>147732)
                     /gene="GPI8"
                     /locus_tag="LMJF_18_0360"
                     /db_xref="GeneID:5650916"
     mRNA            complement(<146659..>147732)
                     /gene="GPI8"
                     /locus_tag="LMJF_18_0360"
                     /product="putative cysteine peptidase, Clan CD,family C13"
                     /transcript_id="XM_001682390.1"
                     /db_xref="GeneID:5650916"
     CDS             complement(146659..147732)
                     /gene="GPI8"
                     /locus_tag="LMJF_18_0360"
                     /codon_start=1
                     /product="putative cysteine peptidase, Clan CD,family C13"
                     /protein_id="XP_001682442.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650916"
                     /db_xref="GOA:Q4QE06"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="UniProtKB/TrEMBL:Q4QE06"
                     /translation="MTSPTRFTATALLVVALLVLTASSCFPDAYAAIRTAVAAAASAP
                     QGATGKGQSNNWAVIVSSSRYLFNYRHTANALTMYHLLRQHGIDDDHILLFLSDSFAC
                     DPRNVYPAEIFSQPPGERDANEHASMNLYGCSAQVDYAGSDVDVRRFLSVLQGRYDEN
                     TPPTRRLLSDDKSNIIIYVAGHGAKSYFKFQDTEFLSSSDISETLMMMHQQRRYGRVV
                     FMADTCHAIALCEHVEAPNVVCLAASDAESESYSCQYDGQLGTHLVSFWMNEMYSLLN
                     GTSCSDPLTRRIGNDAVSVLHQSWYNFNYHPYRVEASRNRSKPAHRDAVNDPTALREW
                     IVADFMCGQEQAAVPVDVRYDLE"
     gene            complement(<149636..>151030)
                     /locus_tag="LMJF_18_0370"
                     /db_xref="GeneID:5650917"
     mRNA            complement(<149636..>151030)
                     /locus_tag="LMJF_18_0370"
                     /product="putative tubulin tyrosine ligase protein"
                     /transcript_id="XM_001682391.1"
                     /db_xref="GeneID:5650917"
     CDS             complement(149636..151030)
                     /locus_tag="LMJF_18_0370"
                     /EC_number="6.3.2.25"
                     /codon_start=1
                     /product="putative tubulin tyrosine ligase protein"
                     /protein_id="XP_001682443.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650917"
                     /db_xref="GOA:Q4QE05"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR027751"
                     /db_xref="UniProtKB/TrEMBL:Q4QE05"
                     /translation="MEHRRTRTGPIRFRCFLRNTILDVMRCRGWIETDSESDWDYYWA
                     DVSWIRENYDGLRLDDHQHLNHFRNHYELTRKDTMVRNIKRMVKALEKDGDAEEVAAA
                     WDFFPVTFSLPQDYGLFEQEFRRHPNTIWIMKPPAKAQGKGIFLFSKLSQIAEWRREF
                     KLRHGYLTNSGGGGGGGVMGGGGVNGASSGGGGGGGGSSCSGNGLGSVYGVPEPVEPY
                     LAQRYIANPHLVGGKKYDLRIYVLVQSYQPLTVWLHRTGFARFCHHRYSLDDIDNTYI
                     HVTNVAVQKTYPKYTAASGCKFGIRNLRTILTATHGSARANQLFGDIQQMIMRTLFSV
                     QKIMLQDKHCSELYGYDVMIDDTLHPWLIETNASPSLTAETPADYHLKFNMLKDMFDV
                     IDMEGRRSGEEERVGGFDLIWANGPAGVSTNDNQKTMTSSYLGCANELEIPMSQLRLP
                     PRLQTHSSSEHPLT"
     gene            complement(<151795..>155187)
                     /locus_tag="LMJF_18_0380"
                     /db_xref="GeneID:5650918"
     mRNA            complement(<151795..>155187)
                     /locus_tag="LMJF_18_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682392.1"
                     /db_xref="GeneID:5650918"
     CDS             complement(151795..155187)
                     /locus_tag="LMJF_18_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682444.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650918"
                     /db_xref="UniProtKB/TrEMBL:Q4QE04"
                     /translation="MQQYVLEYLQERRRCGEKLPFYLSNALFSVYASALFSNWKISII
                     RAESAEMVDSSEMAQSIFSKLEAYLTTEETLDCVLEILTFFARQNSRLSILSVKSSFA
                     KQVLPFFFSAAANMLSSAPEKAALVCSTALECAPELEAPLVRLHHPSDTSITVLRWPA
                     WAPALSQVMNECGQALLNHPDGPCAVLYSRLLRQCSTVTSPQEEYIASRDDVANVLLD
                     VSGRLLLKVQENPERTELLRLACALLVNTFERNDETTVTYLARDPGVIRVWADATRYV
                     LGRPFDEEEADLRQALLHLFFMIAERMLLPKPRGGRGLDESFTGHYGACTPPRTREGC
                     LAEQGFSAERMGRQVQPQPHASPPSAPRGPLSTERTREVEQQVIDIFSTYVDLVINTA
                     HEREESQELRTGPTFVLQTERILQPIAEVLFCERIDLLPQLVDRLQQTIHQYELCVRA
                     RGEQQAVMHGSAAASGGGSDGFGLSARSLLQELYMTLAVQNMSVGAALSCPAETAEST
                     PLFFTYVCLSRLSVIVSIFAIALLQGTASRDDSVLGAIASFARQLLGQEDQVTENLLQ
                     CLSLLDDGNDDLNGFGGATAPAVSTSSGPAAQVHIGILRSLFFFCGCVYETNLSRREE
                     FYDITVNLLCYVYRYHSDQVALVVDANVLLTRIVDFGSSGTFFLGAGKLMGLIEAVKE
                     GQLPLLQTPSTPQFGAADLRLPSEVAEARHGFLTAFTFYVETRYYAGFPIADVISTLT
                     ERCFDDARMQVNPRLSFQDLKAITKGIHQPDTLQLMLESIIRHKDVCWAVVRCEAAAA
                     ADMIAWLSALCSRSCQYMDEENLSTTQWELTSFVMNVLCFYFSYLSYLSSPMTTASDG
                     APAFGAPSSADAGVMLPEIADSSFVMNGGSTSTFFSFPADAVEAAVVYDVSDILNTFC
                     SAPWCNLGIVLYYERATVEHFFCGAVELLTTTSVQLLMSEEGRARVFNAMSAAVNSCG
                     HTFQQLHLLYMRQGVWNRLVRQLTKCLSYMYAPDLIDILYAILRSDHQARQRVPHYKG
                     LEEYTLAATFNEICTLVAVAPHLTYREMSACFGLLQMCYDSAKILCGEYADRLLDLCS
                     AYHRVRLRLIINSLRRGDGAHLMTEYMTYFGQSSNVGVLTAW"
     gene            complement(<157835..>163057)
                     /locus_tag="LMJF_18_0390"
                     /db_xref="GeneID:5650919"
     mRNA            complement(<157835..>163057)
                     /locus_tag="LMJF_18_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682393.1"
                     /db_xref="GeneID:5650919"
     CDS             complement(157835..163057)
                     /locus_tag="LMJF_18_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682445.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650919"
                     /db_xref="UniProtKB/TrEMBL:Q4QE03"
                     /translation="MSSLHSAQSPLTTSTLAATGEAFATETPFSNSIEAIRARLQNAV
                     RNIDNIVGAAQRAPSPSAFRSAAAGADVSSPRVDRWEVKDPGDGRRLHGGPTSCAAAL
                     ALLRARQESAAPRSAEAGTLPACQSSSTPHSDQVSKGSPTPGPSVATPFTASYSRESA
                     STASAATEAGTVLSATYAAALDFWRVHGRRTYRPAPMAQAGLTAAPLADAALASAAAS
                     TVSPAPVAGAHNAHTAASITFAPPPYSKGQRSAANTNFAERAHTNTDILADTAVEPAR
                     LFNTLSTAAATATAQTDHRAIFAPLSWPPGAALPTSLAATTPSTTRSRSLTPDCSRTR
                     HTQPPRALADDSYFSTTAPAPLPLPSSVTTLSARLAALRAADTAQCSSMLAQQRQRQE
                     WPHDEKRHVSSGTSALATHATVPLADYGVRAHRGTEASTSEYFDTNTAPVHHRQKRAE
                     PQHLPQSSVAVDTSSTNATSDHNWLVCSPSSKPATSPTAKTRQAQRASRRDETSFIVS
                     LAQDMQAAREEAWRDAQDSVKLEPPVRPPPLPPLDTSGLARYTPPSRLPEQRGGGIVN
                     KPLCALATTADTRSGTAVATASSRALTSSTAPLDALQAGLLPSAIVMAAVGGGAAGNE
                     SLPMHEELAMRERLAARRQRQSEHALVVHDGAAEHQRQRYERLSDVRDRDVAEHLRGE
                     TARQTAVQVAAQARVAQVRAALPDQPEAVTSDELVAIRLHAQQLERMREQTQWMMGRS
                     PSLHVGAAPAPAVDAVSTTDSSSLLIPAATSGKACGIAAAQRGRIKEEVSTPAQQTRT
                     AAGKEKHPHNPSEKVVATAAATRTRYSDATIDPSVVAGDGLRSAGAPSASTPITAAAE
                     REATPEQTMATHRACPSSSQDLVQRHAAGSCQHCSATPAHATGQVAGEAVNETERSAG
                     GSLDEDLLTSTQLPPPSSDVQVKAVRRAKTSAPSTVKLQRSASSPSASRADGVGTGKP
                     TWAASVQPSISASSNAASSPIQRQNALTVSANDDAERDLISSPRSGRYSDRGGKATGS
                     TAPDRIASIQSTHLYVSASRGTAWQDDSTASDASSSSSSRLPVSVSPFRALRSASGAG
                     GSARPPVSRTRSPLYDGRVDSTRSASLHRCATLAGDGARRSGAGRTGSSALTSSCAAT
                     SPTLRSKATDPLQAHRRAVQHEVDKRTALRAQAMLSEHGVAVHVQLVGHRVPSLVKLS
                     KDEKELLFYLDRVEQVPLPTPRASPLTSLPASSAEFASRSSSPATVLSRLPGTGSAPA
                     TMSRVAQPSASSSPAAAQPPRFHPPRLPGAAASVAPSMQPHNGLVKTPPVDTFVKGKA
                     IAGRGGVVVGAPPRGIAPSLSSPQQQRLVAAAPPLRGGAVPFPFPSPPPLTPHMAAAT
                     LLRRDVSPCAAASTLPIRVRELHHFPCSYSRVYVPFGVMGYESDLGLGGPGTWEDVGG
                     ILCGPASFEVLRRYRCPLFAEVRGPLCAPYRVYLIIPQFKRIDVPQDAVLLVLDFQQR
                     IDWVLFLLAMQRDVADRGDCDIGVLADSSSLSDGAARSPVLSYGRALWMLAVQRLQRA
                     RALRGMNPFELDRMWPAHYLGQRESRGAARRSGRGAPSVAPSSLAKSMVYPLAGGAAA
                     TCGSDARPSTRSGRSRSAGPKARASSAERISVPPRGRNNSPARRRDPGVDLGWDVSAA
                     AEGVTRGSRRGSGSRFWNPRQCTSPARPQTFSTSRAGAAVVPVTSQGASKPRFELLKR
                     VSRSLGVSRHGKGS"
     gene            complement(<165716..>167401)
                     /gene="LPG5B"
                     /locus_tag="LMJF_18_0400"
                     /db_xref="GeneID:5650920"
     mRNA            complement(<165716..>167401)
                     /gene="LPG5B"
                     /locus_tag="LMJF_18_0400"
                     /product="UDP-galactose transporter"
                     /transcript_id="XM_001682394.1"
                     /db_xref="GeneID:5650920"
     CDS             complement(165716..167401)
                     /gene="LPG5B"
                     /locus_tag="LMJF_18_0400"
                     /codon_start=1
                     /product="UDP-galactose transporter"
                     /protein_id="XP_001682446.1"
                     /db_xref="GeneID:5650920"
                     /db_xref="GOA:Q5QHQ6"
                     /db_xref="InterPro:IPR007271"
                     /db_xref="UniProtKB/TrEMBL:Q5QHQ6"
                     /translation="MALIVHVFSMAMVSLVVLVVQNSLLVVMTRFSRKSVDAAHNYHT
                     STLVMNQEIAKMIMCLVLYGLDDVYRQYRRDAASSNCANNAVHKMVGLEVDVLLLRED
                     SVNDVERKACQAGDKEAQPLADEEPLEVHIHSSPVSLPQTMTVSNASGEGVRRVADEF
                     GASHDAPGVPQVTSTHDSSKILGIAALFDRQPRQPPYLTSSDRPNNASANAKTRAAGH
                     DEWSCSVDVPEKMRKRSFFMYRRMKTLCSLYCSMLSASVYKRDTLKLFVPAFLFNIQN
                     FLIFIGLSNLDAVSFQIWSQTKLLSTAIFSVWLLGRKLSPMQWLSLVTLTAGVLGAQL
                     GAPRASTEMLATAAPHLLHGTTTVPGLDRVGELRAGDDDESRGSALIGIAACVLSGLS
                     SSYASVYFEKVVKTTSPTLSIRNIQLSLFGIPIAFVSMLILAVFPNWYSSVQCGQRVH
                     WNIFSPPAAEARTLGTAKAYCPVRPFFFWQRYDHFLTWALVFIHALGGLLVAIVVKYA
                     DNILKGFATGIAVIVSGMMCSAIDRYELSLAFVLGAVFVIGSSIAFHTFEPKR"
     gene            complement(<170357..>170959)
                     /locus_tag="LMJF_18_0410"
                     /db_xref="GeneID:5650921"
     mRNA            complement(<170357..>170959)
                     /locus_tag="LMJF_18_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682395.1"
                     /db_xref="GeneID:5650921"
     CDS             complement(170357..170959)
                     /locus_tag="LMJF_18_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682447.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650921"
                     /db_xref="UniProtKB/TrEMBL:Q4QE01"
                     /translation="MLRRCLLLRSGHGDLFPTSKAAAHLTPDWVVSREVPHAPGKGRC
                     YADFTTPEHHSKFQMILPETHKVKVISTLNPSSAEVHHCTTKRPSAASVAATVAGVKN
                     ALDTHHPKTNDTPMARANIAAKLAAEQRAKTRDFMAHKRGPMKRNHKYNPTADYPSSQ
                     FYIENRANKLRKIENSNPNGYVPEHMPWETPPPSPAPPQK"
     gene            complement(<172456..>172869)
                     /locus_tag="LMJF_18_0420"
                     /db_xref="GeneID:5650922"
     mRNA            complement(<172456..>172869)
                     /locus_tag="LMJF_18_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682396.1"
                     /db_xref="GeneID:5650922"
     CDS             complement(172456..172869)
                     /locus_tag="LMJF_18_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682448.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650922"
                     /db_xref="UniProtKB/TrEMBL:Q4QE00"
                     /translation="MQMQRSMHARLCHTASVNISASLSSPPCASASVLFMTARYFIQG
                     GPPVPKKDVDKKRKRYLISPHTEEMEAKYQSRQRELHEYFATHEPNCPEPLPENSFVK
                     GQFGMRRRYYVDHRGKIDPHALGNAVDEGTNAMRK"
     gene            complement(174025..174110)
                     /gene="LM18Cs1C1.2"
                     /locus_tag="LMJF_18_snoRNA0001"
                     /old_locus_tag="LMJF_18_snoRNA0121"
                     /db_xref="GeneID:12982081"
     ncRNA           complement(174025..174108)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.2"
                     /locus_tag="LMJF_18_snoRNA0001"
                     /old_locus_tag="LMJF_18_snoRNA0121"
                     /transcript_id="XR_002460146.1"
                     /db_xref="GeneID:12982081"
     ncRNA           complement(174026..174110)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.2"
                     /locus_tag="LMJF_18_snoRNA0001"
                     /old_locus_tag="LMJF_18_snoRNA0121"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460147.1"
                     /db_xref="GeneID:12982081"
     gene            complement(174293..174391)
                     /gene="LM18Cs1C3.1"
                     /locus_tag="LMJF_18_snoRNA0002"
                     /old_locus_tag="LMJF_18_snoRNA0110"
                     /db_xref="GeneID:12982122"
     ncRNA           complement(174293..174391)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.1"
                     /locus_tag="LMJF_18_snoRNA0002"
                     /old_locus_tag="LMJF_18_snoRNA0110"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460148.1"
                     /db_xref="GeneID:12982122"
     ncRNA           complement(174293..174388)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.1"
                     /locus_tag="LMJF_18_snoRNA0002"
                     /old_locus_tag="LMJF_18_snoRNA0110"
                     /transcript_id="XR_002460149.1"
                     /db_xref="GeneID:12982122"
     gene            complement(174498..174589)
                     /gene="LM18Cs1C2.9"
                     /locus_tag="LMJF_18_snoRNA0003"
                     /old_locus_tag="LMJF_18_snoRNA0141"
                     /db_xref="GeneID:12982082"
     ncRNA           complement(174498..174589)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.9"
                     /locus_tag="LMJF_18_snoRNA0003"
                     /old_locus_tag="LMJF_18_snoRNA0141"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460150.1"
                     /db_xref="GeneID:12982082"
     ncRNA           complement(174498..174587)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.9"
                     /locus_tag="LMJF_18_snoRNA0003"
                     /old_locus_tag="LMJF_18_snoRNA0141"
                     /transcript_id="XR_002460151.1"
                     /db_xref="GeneID:12982082"
     gene            complement(174711..174778)
                     /gene="LM18Cs1H1.1"
                     /locus_tag="LMJF_18_snoRNA0097"
                     /db_xref="GeneID:12982083"
     ncRNA           complement(174711..174778)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.1"
                     /locus_tag="LMJF_18_snoRNA0097"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460218.1"
                     /db_xref="GeneID:12982083"
     gene            complement(175015..175100)
                     /gene="LM18Cs1C1.3"
                     /locus_tag="LMJF_18_snoRNA0005"
                     /old_locus_tag="LMJF_18_snoRNA0122"
                     /db_xref="GeneID:12982084"
     ncRNA           complement(175015..175098)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.3"
                     /locus_tag="LMJF_18_snoRNA0005"
                     /old_locus_tag="LMJF_18_snoRNA0122"
                     /transcript_id="XR_002460152.1"
                     /db_xref="GeneID:12982084"
     ncRNA           complement(175016..175100)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.3"
                     /locus_tag="LMJF_18_snoRNA0005"
                     /old_locus_tag="LMJF_18_snoRNA0122"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460153.1"
                     /db_xref="GeneID:12982084"
     gene            complement(175283..175381)
                     /gene="LM18Cs1C3.2"
                     /locus_tag="LMJF_18_snoRNA0006"
                     /old_locus_tag="LMJF_18_snoRNA0111"
                     /db_xref="GeneID:12982123"
     ncRNA           complement(175283..175381)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.2"
                     /locus_tag="LMJF_18_snoRNA0006"
                     /old_locus_tag="LMJF_18_snoRNA0111"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460154.1"
                     /db_xref="GeneID:12982123"
     ncRNA           complement(175283..175378)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.2"
                     /locus_tag="LMJF_18_snoRNA0006"
                     /old_locus_tag="LMJF_18_snoRNA0111"
                     /transcript_id="XR_002460155.1"
                     /db_xref="GeneID:12982123"
     gene            complement(175488..175579)
                     /gene="LM18Cs1C2.10"
                     /locus_tag="LMJF_18_snoRNA0007"
                     /old_locus_tag="LMJF_18_snoRNA0142"
                     /db_xref="GeneID:12982085"
     ncRNA           complement(175488..175579)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.10"
                     /locus_tag="LMJF_18_snoRNA0007"
                     /old_locus_tag="LMJF_18_snoRNA0142"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460156.1"
                     /db_xref="GeneID:12982085"
     ncRNA           complement(175488..175577)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.10"
                     /locus_tag="LMJF_18_snoRNA0007"
                     /old_locus_tag="LMJF_18_snoRNA0142"
                     /transcript_id="XR_002460157.1"
                     /db_xref="GeneID:12982085"
     gene            complement(175721..175788)
                     /gene="LM18Cs1H1.2"
                     /locus_tag="LMJF_18_snoRNA0098"
                     /db_xref="GeneID:12982086"
     ncRNA           complement(175721..175788)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.2"
                     /locus_tag="LMJF_18_snoRNA0098"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460219.1"
                     /db_xref="GeneID:12982086"
     gene            complement(176025..176110)
                     /gene="LM18Cs1C1.4"
                     /locus_tag="LMJF_18_snoRNA0009"
                     /old_locus_tag="LMJF_18_snoRNA0123"
                     /db_xref="GeneID:12982087"
     ncRNA           complement(176025..176108)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.4"
                     /locus_tag="LMJF_18_snoRNA0009"
                     /old_locus_tag="LMJF_18_snoRNA0123"
                     /transcript_id="XR_002460158.1"
                     /db_xref="GeneID:12982087"
     ncRNA           complement(176026..176110)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.4"
                     /locus_tag="LMJF_18_snoRNA0009"
                     /old_locus_tag="LMJF_18_snoRNA0123"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460159.1"
                     /db_xref="GeneID:12982087"
     gene            complement(176293..176391)
                     /gene="LM18Cs1C3.3"
                     /locus_tag="LMJF_18_snoRNA0010"
                     /old_locus_tag="LMJF_18_snoRNA0112"
                     /db_xref="GeneID:12982124"
     ncRNA           complement(176293..176391)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.3"
                     /locus_tag="LMJF_18_snoRNA0010"
                     /old_locus_tag="LMJF_18_snoRNA0112"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460160.1"
                     /db_xref="GeneID:12982124"
     ncRNA           complement(176293..176388)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.3"
                     /locus_tag="LMJF_18_snoRNA0010"
                     /old_locus_tag="LMJF_18_snoRNA0112"
                     /transcript_id="XR_002460161.1"
                     /db_xref="GeneID:12982124"
     gene            complement(176498..176589)
                     /gene="LM18Cs1C2.1"
                     /locus_tag="LMJF_18_snoRNA0011"
                     /old_locus_tag="LMJF_18_snoRNA0133"
                     /db_xref="GeneID:12982088"
     ncRNA           complement(176498..176589)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.1"
                     /locus_tag="LMJF_18_snoRNA0011"
                     /old_locus_tag="LMJF_18_snoRNA0133"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460162.1"
                     /db_xref="GeneID:12982088"
     ncRNA           complement(176498..176587)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.1"
                     /locus_tag="LMJF_18_snoRNA0011"
                     /old_locus_tag="LMJF_18_snoRNA0133"
                     /transcript_id="XR_002460163.1"
                     /db_xref="GeneID:12982088"
     gene            complement(176731..176798)
                     /gene="LM18Cs1H1.3"
                     /locus_tag="LMJF_18_snoRNA0099"
                     /db_xref="GeneID:12982089"
     ncRNA           complement(176731..176798)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.3"
                     /locus_tag="LMJF_18_snoRNA0099"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460220.1"
                     /db_xref="GeneID:12982089"
     gene            complement(177035..177120)
                     /gene="LM18Cs1C1.5"
                     /locus_tag="LMJF_18_snoRNA0013"
                     /old_locus_tag="LMJF_18_snoRNA0124"
                     /db_xref="GeneID:12982090"
     ncRNA           complement(177035..177118)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.5"
                     /locus_tag="LMJF_18_snoRNA0013"
                     /old_locus_tag="LMJF_18_snoRNA0124"
                     /transcript_id="XR_002460164.1"
                     /db_xref="GeneID:12982090"
     ncRNA           complement(177036..177120)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.5"
                     /locus_tag="LMJF_18_snoRNA0013"
                     /old_locus_tag="LMJF_18_snoRNA0124"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460165.1"
                     /db_xref="GeneID:12982090"
     gene            complement(177303..177401)
                     /gene="LM18Cs1C3.4"
                     /locus_tag="LMJF_18_snoRNA0014"
                     /old_locus_tag="LMJF_18_snoRNA0113"
                     /db_xref="GeneID:12982125"
     ncRNA           complement(177303..177401)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.4"
                     /locus_tag="LMJF_18_snoRNA0014"
                     /old_locus_tag="LMJF_18_snoRNA0113"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460166.1"
                     /db_xref="GeneID:12982125"
     ncRNA           complement(177303..177398)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.4"
                     /locus_tag="LMJF_18_snoRNA0014"
                     /old_locus_tag="LMJF_18_snoRNA0113"
                     /transcript_id="XR_002460167.1"
                     /db_xref="GeneID:12982125"
     gene            complement(177508..177599)
                     /gene="LM18Cs1C2.2"
                     /locus_tag="LMJF_18_snoRNA0015"
                     /old_locus_tag="LMJF_18_snoRNA0134"
                     /db_xref="GeneID:12982091"
     ncRNA           complement(177508..177599)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.2"
                     /locus_tag="LMJF_18_snoRNA0015"
                     /old_locus_tag="LMJF_18_snoRNA0134"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460168.1"
                     /db_xref="GeneID:12982091"
     ncRNA           complement(177508..177597)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.2"
                     /locus_tag="LMJF_18_snoRNA0015"
                     /old_locus_tag="LMJF_18_snoRNA0134"
                     /transcript_id="XR_002460169.1"
                     /db_xref="GeneID:12982091"
     gene            complement(177719..177786)
                     /gene="LM18Cs1H1.4"
                     /locus_tag="LMJF_18_snoRNA0100"
                     /db_xref="GeneID:12982092"
     ncRNA           complement(177719..177786)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.4"
                     /locus_tag="LMJF_18_snoRNA0100"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460221.1"
                     /db_xref="GeneID:12982092"
     gene            complement(178023..178108)
                     /gene="LM18Cs1C1.6"
                     /locus_tag="LMJF_18_snoRNA0017"
                     /old_locus_tag="LMJF_18_snoRNA0125"
                     /db_xref="GeneID:12982093"
     ncRNA           complement(178023..178106)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.6"
                     /locus_tag="LMJF_18_snoRNA0017"
                     /old_locus_tag="LMJF_18_snoRNA0125"
                     /transcript_id="XR_002460170.1"
                     /db_xref="GeneID:12982093"
     ncRNA           complement(178024..178108)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.6"
                     /locus_tag="LMJF_18_snoRNA0017"
                     /old_locus_tag="LMJF_18_snoRNA0125"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460171.1"
                     /db_xref="GeneID:12982093"
     gene            complement(178291..178389)
                     /gene="LM18Cs1C3.5"
                     /locus_tag="LMJF_18_snoRNA0018"
                     /old_locus_tag="LMJF_18_snoRNA0114"
                     /db_xref="GeneID:12982126"
     ncRNA           complement(178291..178389)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.5"
                     /locus_tag="LMJF_18_snoRNA0018"
                     /old_locus_tag="LMJF_18_snoRNA0114"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460172.1"
                     /db_xref="GeneID:12982126"
     ncRNA           complement(178291..178386)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.5"
                     /locus_tag="LMJF_18_snoRNA0018"
                     /old_locus_tag="LMJF_18_snoRNA0114"
                     /transcript_id="XR_002460173.1"
                     /db_xref="GeneID:12982126"
     gene            complement(178496..178587)
                     /gene="LM18Cs1C2.3"
                     /locus_tag="LMJF_18_snoRNA0019"
                     /old_locus_tag="LMJF_18_snoRNA0135"
                     /db_xref="GeneID:12982094"
     ncRNA           complement(178496..178587)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.3"
                     /locus_tag="LMJF_18_snoRNA0019"
                     /old_locus_tag="LMJF_18_snoRNA0135"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460174.1"
                     /db_xref="GeneID:12982094"
     ncRNA           complement(178496..178585)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.3"
                     /locus_tag="LMJF_18_snoRNA0019"
                     /old_locus_tag="LMJF_18_snoRNA0135"
                     /transcript_id="XR_002460175.1"
                     /db_xref="GeneID:12982094"
     gene            complement(178717..178784)
                     /gene="LM18Cs1H1.5"
                     /locus_tag="LMJF_18_snoRNA0101"
                     /db_xref="GeneID:12982095"
     ncRNA           complement(178717..178784)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.5"
                     /locus_tag="LMJF_18_snoRNA0101"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460222.1"
                     /db_xref="GeneID:12982095"
     gene            complement(179021..179106)
                     /gene="LM18Cs1C1.7"
                     /locus_tag="LMJF_18_snoRNA0021"
                     /old_locus_tag="LMJF_18_snoRNA0126"
                     /db_xref="GeneID:12982096"
     ncRNA           complement(179021..179104)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.7"
                     /locus_tag="LMJF_18_snoRNA0021"
                     /old_locus_tag="LMJF_18_snoRNA0126"
                     /transcript_id="XR_002460176.1"
                     /db_xref="GeneID:12982096"
     ncRNA           complement(179022..179106)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.7"
                     /locus_tag="LMJF_18_snoRNA0021"
                     /old_locus_tag="LMJF_18_snoRNA0126"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460177.1"
                     /db_xref="GeneID:12982096"
     gene            complement(179289..179387)
                     /gene="LM18Cs1C3.6"
                     /locus_tag="LMJF_18_snoRNA0022"
                     /old_locus_tag="LMJF_18_snoRNA0115"
                     /db_xref="GeneID:12982127"
     ncRNA           complement(179289..179387)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.6"
                     /locus_tag="LMJF_18_snoRNA0022"
                     /old_locus_tag="LMJF_18_snoRNA0115"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460178.1"
                     /db_xref="GeneID:12982127"
     ncRNA           complement(179289..179384)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.6"
                     /locus_tag="LMJF_18_snoRNA0022"
                     /old_locus_tag="LMJF_18_snoRNA0115"
                     /transcript_id="XR_002460179.1"
                     /db_xref="GeneID:12982127"
     gene            complement(179494..179585)
                     /gene="LM18Cs1C2.11"
                     /locus_tag="LMJF_18_snoRNA0023"
                     /old_locus_tag="LMJF_18_snoRNA0143"
                     /db_xref="GeneID:12982097"
     ncRNA           complement(179494..179585)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.11"
                     /locus_tag="LMJF_18_snoRNA0023"
                     /old_locus_tag="LMJF_18_snoRNA0143"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460180.1"
                     /db_xref="GeneID:12982097"
     ncRNA           complement(179494..179583)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.11"
                     /locus_tag="LMJF_18_snoRNA0023"
                     /old_locus_tag="LMJF_18_snoRNA0143"
                     /transcript_id="XR_002460181.1"
                     /db_xref="GeneID:12982097"
     gene            complement(179703..179770)
                     /gene="LM18Cs1H1.6"
                     /locus_tag="LMJF_18_snoRNA0102"
                     /db_xref="GeneID:12982098"
     ncRNA           complement(179703..179770)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.6"
                     /locus_tag="LMJF_18_snoRNA0102"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460223.1"
                     /db_xref="GeneID:12982098"
     gene            complement(180007..180092)
                     /gene="LM18Cs1C1.8"
                     /locus_tag="LMJF_18_snoRNA0025"
                     /old_locus_tag="LMJF_18_snoRNA0127"
                     /db_xref="GeneID:12982099"
     ncRNA           complement(180007..180090)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.8"
                     /locus_tag="LMJF_18_snoRNA0025"
                     /old_locus_tag="LMJF_18_snoRNA0127"
                     /transcript_id="XR_002460182.1"
                     /db_xref="GeneID:12982099"
     ncRNA           complement(180008..180092)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.8"
                     /locus_tag="LMJF_18_snoRNA0025"
                     /old_locus_tag="LMJF_18_snoRNA0127"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460183.1"
                     /db_xref="GeneID:12982099"
     gene            complement(180275..180373)
                     /gene="LM18Cs1C3.7"
                     /locus_tag="LMJF_18_snoRNA0026"
                     /old_locus_tag="LMJF_18_snoRNA0116"
                     /db_xref="GeneID:12982128"
     ncRNA           complement(180275..180373)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.7"
                     /locus_tag="LMJF_18_snoRNA0026"
                     /old_locus_tag="LMJF_18_snoRNA0116"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460184.1"
                     /db_xref="GeneID:12982128"
     ncRNA           complement(180275..180370)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.7"
                     /locus_tag="LMJF_18_snoRNA0026"
                     /old_locus_tag="LMJF_18_snoRNA0116"
                     /transcript_id="XR_002460185.1"
                     /db_xref="GeneID:12982128"
     gene            complement(180480..180571)
                     /gene="LM18Cs1C2.4"
                     /locus_tag="LMJF_18_snoRNA0027"
                     /old_locus_tag="LMJF_18_snoRNA0136"
                     /db_xref="GeneID:12982100"
     ncRNA           complement(180480..180571)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.4"
                     /locus_tag="LMJF_18_snoRNA0027"
                     /old_locus_tag="LMJF_18_snoRNA0136"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460186.1"
                     /db_xref="GeneID:12982100"
     ncRNA           complement(180480..180569)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.4"
                     /locus_tag="LMJF_18_snoRNA0027"
                     /old_locus_tag="LMJF_18_snoRNA0136"
                     /transcript_id="XR_002460187.1"
                     /db_xref="GeneID:12982100"
     gene            complement(180695..180762)
                     /gene="LM18Cs1H1.7"
                     /locus_tag="LMJF_18_snoRNA0103"
                     /db_xref="GeneID:12982101"
     ncRNA           complement(180695..180762)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.7"
                     /locus_tag="LMJF_18_snoRNA0103"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460224.1"
                     /db_xref="GeneID:12982101"
     gene            complement(180999..181084)
                     /gene="LM18Cs1C1.9"
                     /locus_tag="LMJF_18_snoRNA0029"
                     /old_locus_tag="LMJF_18_snoRNA0128"
                     /db_xref="GeneID:12982102"
     ncRNA           complement(180999..181082)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.9"
                     /locus_tag="LMJF_18_snoRNA0029"
                     /old_locus_tag="LMJF_18_snoRNA0128"
                     /transcript_id="XR_002460188.1"
                     /db_xref="GeneID:12982102"
     ncRNA           complement(181000..181084)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.9"
                     /locus_tag="LMJF_18_snoRNA0029"
                     /old_locus_tag="LMJF_18_snoRNA0128"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460189.1"
                     /db_xref="GeneID:12982102"
     gene            complement(181267..181365)
                     /gene="LM18Cs1C3.8"
                     /locus_tag="LMJF_18_snoRNA0030"
                     /old_locus_tag="LMJF_18_snoRNA0117"
                     /db_xref="GeneID:12982129"
     ncRNA           complement(181267..181365)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.8"
                     /locus_tag="LMJF_18_snoRNA0030"
                     /old_locus_tag="LMJF_18_snoRNA0117"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460190.1"
                     /db_xref="GeneID:12982129"
     ncRNA           complement(181267..181362)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.8"
                     /locus_tag="LMJF_18_snoRNA0030"
                     /old_locus_tag="LMJF_18_snoRNA0117"
                     /transcript_id="XR_002460191.1"
                     /db_xref="GeneID:12982129"
     gene            complement(181472..181563)
                     /gene="LM18Cs1C2.5"
                     /locus_tag="LMJF_18_snoRNA0031"
                     /old_locus_tag="LMJF_18_snoRNA0137"
                     /db_xref="GeneID:12982103"
     ncRNA           complement(181472..181563)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.5"
                     /locus_tag="LMJF_18_snoRNA0031"
                     /old_locus_tag="LMJF_18_snoRNA0137"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460192.1"
                     /db_xref="GeneID:12982103"
     ncRNA           complement(181472..181561)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.5"
                     /locus_tag="LMJF_18_snoRNA0031"
                     /old_locus_tag="LMJF_18_snoRNA0137"
                     /transcript_id="XR_002460193.1"
                     /db_xref="GeneID:12982103"
     gene            complement(181681..181748)
                     /gene="LM18Cs1H1.8"
                     /locus_tag="LMJF_18_snoRNA0104"
                     /db_xref="GeneID:12982104"
     ncRNA           complement(181681..181748)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.8"
                     /locus_tag="LMJF_18_snoRNA0104"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460225.1"
                     /db_xref="GeneID:12982104"
     gene            complement(181985..182070)
                     /gene="LM18Cs1C1.10"
                     /locus_tag="LMJF_18_snoRNA0033"
                     /old_locus_tag="LMJF_18_snoRNA0129"
                     /db_xref="GeneID:12982107"
     ncRNA           complement(181985..182068)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.10"
                     /locus_tag="LMJF_18_snoRNA0033"
                     /old_locus_tag="LMJF_18_snoRNA0129"
                     /transcript_id="XR_002460194.1"
                     /db_xref="GeneID:12982107"
     ncRNA           complement(181986..182070)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.10"
                     /locus_tag="LMJF_18_snoRNA0033"
                     /old_locus_tag="LMJF_18_snoRNA0129"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460195.1"
                     /db_xref="GeneID:12982107"
     gene            complement(182253..182351)
                     /gene="LM18Cs1C3.9"
                     /locus_tag="LMJF_18_snoRNA0034"
                     /old_locus_tag="LMJF_18_snoRNA0118"
                     /db_xref="GeneID:12982119"
     ncRNA           complement(182253..182351)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.9"
                     /locus_tag="LMJF_18_snoRNA0034"
                     /old_locus_tag="LMJF_18_snoRNA0118"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460196.1"
                     /db_xref="GeneID:12982119"
     ncRNA           complement(182253..182348)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.9"
                     /locus_tag="LMJF_18_snoRNA0034"
                     /old_locus_tag="LMJF_18_snoRNA0118"
                     /transcript_id="XR_002460197.1"
                     /db_xref="GeneID:12982119"
     gene            complement(182458..182549)
                     /gene="LM18Cs1C2.6"
                     /locus_tag="LMJF_18_snoRNA0035"
                     /old_locus_tag="LMJF_18_snoRNA0138"
                     /db_xref="GeneID:12982108"
     ncRNA           complement(182458..182549)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.6"
                     /locus_tag="LMJF_18_snoRNA0035"
                     /old_locus_tag="LMJF_18_snoRNA0138"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460198.1"
                     /db_xref="GeneID:12982108"
     ncRNA           complement(182458..182547)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.6"
                     /locus_tag="LMJF_18_snoRNA0035"
                     /old_locus_tag="LMJF_18_snoRNA0138"
                     /transcript_id="XR_002460199.1"
                     /db_xref="GeneID:12982108"
     gene            complement(182667..182734)
                     /gene="LM18Cs1H1.9"
                     /locus_tag="LMJF_18_snoRNA0105"
                     /db_xref="GeneID:12982109"
     ncRNA           complement(182667..182734)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.9"
                     /locus_tag="LMJF_18_snoRNA0105"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460226.1"
                     /db_xref="GeneID:12982109"
     gene            complement(182971..183056)
                     /gene="LM18Cs1C1.11"
                     /locus_tag="LMJF_18_snoRNA0037"
                     /old_locus_tag="LMJF_18_snoRNA0130"
                     /db_xref="GeneID:12982110"
     ncRNA           complement(182971..183054)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.11"
                     /locus_tag="LMJF_18_snoRNA0037"
                     /old_locus_tag="LMJF_18_snoRNA0130"
                     /transcript_id="XR_002460200.1"
                     /db_xref="GeneID:12982110"
     ncRNA           complement(182972..183056)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.11"
                     /locus_tag="LMJF_18_snoRNA0037"
                     /old_locus_tag="LMJF_18_snoRNA0130"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460201.1"
                     /db_xref="GeneID:12982110"
     gene            complement(183239..183337)
                     /gene="LM18Cs1C3.10"
                     /locus_tag="LMJF_18_snoRNA0038"
                     /old_locus_tag="LMJF_18_snoRNA0119"
                     /db_xref="GeneID:12982120"
     ncRNA           complement(183239..183337)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.10"
                     /locus_tag="LMJF_18_snoRNA0038"
                     /old_locus_tag="LMJF_18_snoRNA0119"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460202.1"
                     /db_xref="GeneID:12982120"
     ncRNA           complement(183239..183334)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.10"
                     /locus_tag="LMJF_18_snoRNA0038"
                     /old_locus_tag="LMJF_18_snoRNA0119"
                     /transcript_id="XR_002460203.1"
                     /db_xref="GeneID:12982120"
     gene            complement(183444..183535)
                     /gene="LM18Cs1C2.7"
                     /locus_tag="LMJF_18_snoRNA0039"
                     /old_locus_tag="LMJF_18_snoRNA0139"
                     /db_xref="GeneID:12982111"
     ncRNA           complement(183444..183535)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.7"
                     /locus_tag="LMJF_18_snoRNA0039"
                     /old_locus_tag="LMJF_18_snoRNA0139"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460204.1"
                     /db_xref="GeneID:12982111"
     ncRNA           complement(183444..183533)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.7"
                     /locus_tag="LMJF_18_snoRNA0039"
                     /old_locus_tag="LMJF_18_snoRNA0139"
                     /transcript_id="XR_002460205.1"
                     /db_xref="GeneID:12982111"
     gene            complement(183659..183726)
                     /gene="LM18Cs1H1.10"
                     /locus_tag="LMJF_18_snoRNA0106"
                     /db_xref="GeneID:12982112"
     ncRNA           complement(183659..183726)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.10"
                     /locus_tag="LMJF_18_snoRNA0106"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460227.1"
                     /db_xref="GeneID:12982112"
     gene            complement(183963..184048)
                     /gene="LM18Cs1C1.12"
                     /locus_tag="LMJF_18_snoRNA0041"
                     /old_locus_tag="LMJF_18_snoRNA0131"
                     /db_xref="GeneID:12982113"
     ncRNA           complement(183963..184046)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.12"
                     /locus_tag="LMJF_18_snoRNA0041"
                     /old_locus_tag="LMJF_18_snoRNA0131"
                     /transcript_id="XR_002460206.1"
                     /db_xref="GeneID:12982113"
     ncRNA           complement(183964..184048)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.12"
                     /locus_tag="LMJF_18_snoRNA0041"
                     /old_locus_tag="LMJF_18_snoRNA0131"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460207.1"
                     /db_xref="GeneID:12982113"
     gene            complement(184231..184329)
                     /gene="LM18Cs1C3.11"
                     /locus_tag="LMJF_18_snoRNA0042"
                     /old_locus_tag="LMJF_18_snoRNA0120"
                     /db_xref="GeneID:12982121"
     ncRNA           complement(184231..184329)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.11"
                     /locus_tag="LMJF_18_snoRNA0042"
                     /old_locus_tag="LMJF_18_snoRNA0120"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460208.1"
                     /db_xref="GeneID:12982121"
     ncRNA           complement(184231..184326)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C3.11"
                     /locus_tag="LMJF_18_snoRNA0042"
                     /old_locus_tag="LMJF_18_snoRNA0120"
                     /transcript_id="XR_002460209.1"
                     /db_xref="GeneID:12982121"
     gene            complement(184436..184527)
                     /gene="LM18Cs1C2.8"
                     /locus_tag="LMJF_18_snoRNA0043"
                     /old_locus_tag="LMJF_18_snoRNA0140"
                     /db_xref="GeneID:12982114"
     ncRNA           complement(184436..184527)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.8"
                     /locus_tag="LMJF_18_snoRNA0043"
                     /old_locus_tag="LMJF_18_snoRNA0140"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460210.1"
                     /db_xref="GeneID:12982114"
     ncRNA           complement(184436..184525)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.8"
                     /locus_tag="LMJF_18_snoRNA0043"
                     /old_locus_tag="LMJF_18_snoRNA0140"
                     /transcript_id="XR_002460211.1"
                     /db_xref="GeneID:12982114"
     gene            complement(184641..184708)
                     /gene="LM18Cs1H1.11"
                     /locus_tag="LMJF_18_snoRNA0107"
                     /db_xref="GeneID:12982115"
     ncRNA           complement(184641..184708)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.11"
                     /locus_tag="LMJF_18_snoRNA0107"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460228.1"
                     /db_xref="GeneID:12982115"
     gene            complement(184945..185030)
                     /gene="LM18Cs1C1.13"
                     /locus_tag="LMJF_18_snoRNA0045"
                     /old_locus_tag="LMJF_18_snoRNA0132"
                     /db_xref="GeneID:12982116"
     ncRNA           complement(184945..185028)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.13"
                     /locus_tag="LMJF_18_snoRNA0045"
                     /old_locus_tag="LMJF_18_snoRNA0132"
                     /transcript_id="XR_002460212.1"
                     /db_xref="GeneID:12982116"
     ncRNA           complement(184946..185030)
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.13"
                     /locus_tag="LMJF_18_snoRNA0045"
                     /old_locus_tag="LMJF_18_snoRNA0132"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460213.1"
                     /db_xref="GeneID:12982116"
     gene            complement(<187175..>187846)
                     /locus_tag="LMJF_18_0430"
                     /db_xref="GeneID:5650968"
     mRNA            complement(<187175..>187846)
                     /locus_tag="LMJF_18_0430"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682397.1"
                     /db_xref="GeneID:5650968"
     CDS             complement(187175..187846)
                     /locus_tag="LMJF_18_0430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682449.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650968"
                     /db_xref="GOA:Q4QDZ9"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ9"
                     /translation="MLLLLPLILPITVAISRTTDYRHNFDDILAGSICGSVLGVLSVV
                     ISFRPSMHGDWTLYDHPDDNVETQDLLMFPVTEGGEAVNESESMTAGYDSPSPPLCAH
                     SSFFRDRRELKGIAAPSPRNKQASGASASSDDKSHSCRSCVSGAQPSVVKVPPLTSAH
                     SLFGEQDFGVSRERLSTAAANELSPLDNRHSPSRRRKSAGENPVVVPVSPNGTDYGER
                     IERKQ"
     gene            complement(<189254..>190525)
                     /locus_tag="LMJF_18_0440"
                     /db_xref="GeneID:5650969"
     mRNA            complement(<189254..>190525)
                     /locus_tag="LMJF_18_0440"
                     /product="putative phosphatidic acid phosphatase"
                     /transcript_id="XM_001682398.1"
                     /db_xref="GeneID:5650969"
     CDS             complement(189254..190525)
                     /locus_tag="LMJF_18_0440"
                     /EC_number="3.1.3.4"
                     /codon_start=1
                     /product="putative phosphatidic acid phosphatase"
                     /protein_id="XP_001682450.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650969"
                     /db_xref="GOA:Q4QDZ8"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ8"
                     /translation="MASCTVATLWRFSIFFRLHDYLLCLICGFVAFGLSEVRPHCRPF
                     SWTDPSISFPFADASTFPSWTLPIISILPVFVYVLGEVARHLWLGRRRGAIMAHELCK
                     EPKRLDREGQRDGGGGAAQNAGEGQSCYDAGVSVTFSSESVESRLLMNREEEIEALVS
                     RALPPSDVETREAQVGSPTVSTALPNRQPGSLRTPFANTYHEHTGSRESAAVADALPS
                     RATASAPCRQKAHTYALVHPWQRFLLHVHIWFLTQAFSVVFALMVVSAIKVYAGRLRP
                     DFLSRLRNEGYSPQSTGVDWCAVPKEGRVSFPSGHSSISFSAIVPFCFYVLHSLRAFR
                     RSGVSLWRIFTGLLPLILPIAVAVSRTRDNRHYFDDIVAGSAIGIVSAVIAVGATMVA
                     DARTGHLVPRLVHRYSSGARAHTGGQQGQDR"
     gene            complement(<192734..>194122)
                     /locus_tag="LMJF_18_0450"
                     /db_xref="GeneID:5650970"
     mRNA            complement(<192734..>194122)
                     /locus_tag="LMJF_18_0450"
                     /product="putative serine carboxypeptidase (CBP1)"
                     /transcript_id="XM_001682399.1"
                     /db_xref="GeneID:5650970"
     CDS             complement(192734..194122)
                     /locus_tag="LMJF_18_0450"
                     /EC_number="3.4.16.5"
                     /codon_start=1
                     /product="putative serine carboxypeptidase (CBP1)"
                     /protein_id="XP_001682451.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650970"
                     /db_xref="GOA:Q4QDZ7"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ7"
                     /translation="MASFLSTTALLVALLVAMVPWACVPTVYASTPHHGYASCDSSVV
                     QSSGYISIPGVNKTLKHYFYWLFGPRKWPKDGREPPVIMWMTGGPGCSSSMALLMELG
                     PCMMNETSGELEHNTYGWNAEAYLLFVDQPTGVGYSYGDTFNYVHNESEVAEDMYNFL
                     QLFAQRFTSPSITGANDFYIIGESYGGHYVPAVSYRILMGNERGDGLRINLKGIAIGN
                     GLTDPYTQLPYHAQTAYYWCKEKLGAPCITEKAYEEMLSLLPACLEKTKKCNEGPDDS
                     DVSCSVATALWAEYVDHYYATGRNSYDIRKQCIGDLCYPMQNTIDFYHKPTVRASLGA
                     SAEAQWSTCNNEVSALFERDYMRNFNFTFPPMLDMGIRVLIYAGDMDFICNWLGNEAW
                     VKALRWFGTDRFNAAPNVEFAVSGRWAGLERSYGGLSFVRIYDAGHMVPMDQPEVALF
                     MVHRFLRGQSLA"
     gene            complement(<195993..>196691)
                     /locus_tag="LMJF_18_0460"
                     /db_xref="GeneID:5650971"
     mRNA            complement(<195993..>196691)
                     /locus_tag="LMJF_18_0460"
                     /product="putative tubulin-specific chaperone"
                     /transcript_id="XM_001682400.1"
                     /db_xref="GeneID:5650971"
     CDS             complement(195993..196691)
                     /locus_tag="LMJF_18_0460"
                     /codon_start=1
                     /product="putative tubulin-specific chaperone"
                     /protein_id="XP_001682452.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650971"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ6"
                     /translation="MSIVKVMITHSASQRVVPEKAYGLAQTVQSIREDMYSRFGIPAE
                     QIRLELYDTRDCKVEGNMKNEKLLGFYGCETGYRIHVVDLRPAAQVDNYDDVSKIEKY
                     EMTDEEWLKRPDNLRAYKERMLALQREEMAKAGIGVPTGPDDDSYKTEADRIRVGDRC
                     CCQPGERLGTVRYVGRVATLKPGYWVGVEFDEPVGKSNGTVKGVSLFECMPLYGGVLR
                     PNQVEVGDFPPQEY"
     gene            complement(<197783..>199648)
                     /locus_tag="LMJF_18_0470"
                     /db_xref="GeneID:5650972"
     mRNA            complement(<197783..>199648)
                     /locus_tag="LMJF_18_0470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682401.1"
                     /db_xref="GeneID:5650972"
     CDS             complement(197783..199648)
                     /locus_tag="LMJF_18_0470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682453.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650972"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ5"
                     /translation="MSRTTSTDFVTEAGGHPFSSPGVSPMATMQNAEDMDLDTLRRSV
                     QVQKQLDVPPPPTAQLLRVPEVMDDFVRNFLHRNGMTRTLQAFNSEWYGKSGSGTGTV
                     NVAPSNPMVPDNYRETMALQNRIELLERELRQHAELNTRVTQQWTQAKKDREYHRTSH
                     QRVVQENARLSRLLKQAGQHAELVNPTLTESRIRCEQLLKGKSLLTIERDKLRKEKEQ
                     LEARVAELEGQQQHQARGGAATGPKPPAATQRAGTSKSLHASGKSNAAARRGLASSPS
                     PATTKAVDAEVDGFVWPADDRPHPPEPTAAKSFSGNAGDGQPSFAPSESPVAEWVEQS
                     FFQAHTMAVTSVALHPFKPVVASGSDDGSWRLSTLPTGDAIVSGQGHSNWISCVGVHP
                     RGTMLATGSGDKTVKLWDFATSRCAATLSAHTDGVWDLEFQDTGVLLASAALDKTARV
                     WDVERGVCRQTLRGHQDAVNTVSWLPCTNLLLTGSADKCVAVWDVRQGTKAQSFTGHR
                     AAVLSVAAGPVGSSLFASCDTQGAVTLWDARRMAQLLRVECGPQPANCVVVDGIGHNV
                     AVASDDSTIKIIDVDEAVVTELVGHEGPVQSVTFDLASNHFLVSGSSDRTIRYWC"
     gene            complement(<200607..>201212)
                     /locus_tag="LMJF_18_0480"
                     /db_xref="GeneID:5650973"
     mRNA            complement(<200607..>201212)
                     /locus_tag="LMJF_18_0480"
                     /product="putative uracil-DNA-glycosylase"
                     /transcript_id="XM_001682402.1"
                     /db_xref="GeneID:5650973"
     CDS             complement(200607..201212)
                     /locus_tag="LMJF_18_0480"
                     /EC_number="3.2.2.3"
                     /codon_start=1
                     /product="putative uracil-DNA-glycosylase"
                     /protein_id="XP_001682454.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650973"
                     /db_xref="GOA:Q4QDZ4"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ4"
                     /translation="MAKGKVILPPATDIFNAFNSCPFRDLKVVLLGQDPYHDLHQAHG
                     LCFSVLPEVPLPPSLRNIYKELTTDIPGFQAPRHGYLQSWSEQGMLMLNATLTVEAHK
                     ANSHSKASGWTAFTDAVIQHLSQHHPNRLVFLLWGGYAQQKKKLIDASRHIVLESVHP
                     SPLSASRGWFGCHCFSACNEALQSMGHLPMHWQLPLNASLP"
     gene            complement(<202316..>203182)
                     /locus_tag="LMJF_18_0490"
                     /db_xref="GeneID:5650974"
     mRNA            complement(<202316..>203182)
                     /locus_tag="LMJF_18_0490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682403.1"
                     /db_xref="GeneID:5650974"
     CDS             complement(202316..203182)
                     /locus_tag="LMJF_18_0490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682455.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650974"
                     /db_xref="GOA:Q4QDZ3"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ3"
                     /translation="MSAAVTWLQNSLGIDVTGEWARHVHLNVGGTLYTTRRYTLRELK
                     DHRIFGPILDGHAHRCEDGSFLIDRDGSLFRYIIAYLRDGRLSVPENFAEWDMLLQEV
                     RYYELPAMEKSVMDHFEFQQSVFRRQLPHGVYVWWPPASSQIEEGATVKAAPCDCPAS
                     VPPPPLSLFALPITDSATGRCEARGATEDQTRALEKVHVEAAADAATRSSAGAAPSSC
                     SSASMSVRIVPPLPGLTVEMSSGRRVMFRETQVLQDLDQLVTVLLTAYGFSIQHWDTE
                     RGRVLLTLPGLM"
     gene            complement(<204049..>205311)
                     /locus_tag="LMJF_18_0500"
                     /db_xref="GeneID:5650975"
     mRNA            complement(<204049..>205311)
                     /locus_tag="LMJF_18_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682404.1"
                     /db_xref="GeneID:5650975"
     CDS             complement(204049..205311)
                     /locus_tag="LMJF_18_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682456.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650975"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ2"
                     /translation="MPPLTLEQVLARSMRLPRQRAQQQVSRLYKRHESGELGGSPGWP
                     PSTETGSSPVNSGAPRSSRIAALMGGRHAGKHGAADRSGVSETVANKAKLNFFELMER
                     EDAQRRASRLSIHSSGHLVRNSADLTTYLTTAQRTGDWEGGLRAFAEATALPAVVTML
                     AGSEATATPAASTAGTSITSASLPPAPSGSGINPNEVQITAVLEMCANAEKWDLVEKI
                     GVFFAPAYPDTFSRAVELLARRTPSDSSAGEGGWRSAFAYLTTRCPLPAAEITVEAFN
                     ICLRGCEAALDWRGAMEVVRAMGPNPLQGWRAAEEEEDEAGCAAAAASLGCPATASGP
                     TEADTVSSSPPTASASPARSMSTPPSPNVVSYATLIATLEQAGKESLASMVLNRLPAV
                     EKEEITASYAALIMVWSNQILHKQRRRF"
     gene            complement(<209236..>211926)
                     /locus_tag="LMJF_18_0510"
                     /db_xref="GeneID:5650976"
     mRNA            complement(<209236..>211926)
                     /locus_tag="LMJF_18_0510"
                     /product="putative aconitase"
                     /transcript_id="XM_001682405.1"
                     /db_xref="GeneID:5650976"
     CDS             complement(209236..211926)
                     /locus_tag="LMJF_18_0510"
                     /EC_number="4.2.1.3"
                     /codon_start=1
                     /product="putative aconitase"
                     /protein_id="XP_001682457.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650976"
                     /db_xref="GOA:Q4QDZ1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006249"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015934"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ1"
                     /translation="MFRTGVQLAKKGVSPNPFNAKFLASLQVDGGSAKYYKINEISAK
                     YNNLPFSIRVLLESAVRNCDEFDVTSKTVESIFDWKDNCTKGIEIPFKPARVVLQDFT
                     GVPCIVDLAAMRDAMKRLGGDSLRINPQVPVDLVVDHSVQVDCAGVQDAVVQNQSIEM
                     QRNRERFEFLKWGSRAFDNLLIVPPGSGIVHQVNLEYLARVVFNADGMLYPDSVVGTD
                     SHTTMVNGLGVVGWGVGGIEAEAGMLGQSLSLVLPQVVGYKFTGKLQEGCTATDLVLT
                     VVRNLRKLGVVGKFVEFYGPGVDALSVADRATLANMAPEYGATTGYFPIDNETIEYLK
                     NTNRSAEHVARIESYVKAVGLFRTGNEQIEYSQHLELDLSTVAPCVAGPKRPQDNVPL
                     TDVSRDFKACMSAKSGFKGFGIPEGEHNKKVKYTVNGQEATMEHGSVVIAAITSCTNT
                     SNPTVLIAAGLLAQKALEKGLRVPPGIKTSLSPGSHVVTKYLENAGLQKSLEALGFHT
                     TGYGCMTCIGNSGDIAPEVSKCITDNNFVAAAVLSGNRNFESRIHPLTAANYLASPPL
                     VVAFALAGRANIDFAKEPIANGVYLRDIWPSNEEIVAVVNKYVTPDLFKEVYSNITTM
                     NKQWNELQVENGEFYKWDPKSLYIHSPPYFDDMTLDPPGVKSIENAACLAIFGDSITT
                     DHISPAGNIAKDSPAAKFLMERGVERKDFNTYGSRRGNDEVMVRGTFANTRLGNRLVG
                     DGQTGPYTLYHPTGEKMFIFDAAMNYKAAGVPTVILAGKEYGSGSSRDWAAKGPFLQG
                     VKAVIAESFERIHRSNLVGMGVIPLQFKEGENAASLGLTGKECFSMNFAGELRPRQDI
                     VVKCDNGKTFTTTLRIDTEVEVKYVENGGILNYVLRTKIQ"
     gene            complement(<213788..>215686)
                     /locus_tag="LMJF_18_0520"
                     /db_xref="GeneID:5650977"
     mRNA            complement(<213788..>215686)
                     /locus_tag="LMJF_18_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682406.1"
                     /db_xref="GeneID:5650977"
     CDS             complement(213788..215686)
                     /locus_tag="LMJF_18_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682458.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650977"
                     /db_xref="UniProtKB/TrEMBL:Q4QDZ0"
                     /translation="MFAEDQDDADAHRSRMDESCGGAGIRRGSLGSHPSHSQRAVLQR
                     RWTLKDDNLEDIGVVQASSPRVLDNRLCLFSPSAAAVGSNKSGGPVSAYRAPLITALL
                     PDEASDTRSQTSLTDGRKEKEEDDAPSGASSLVAGAKMEAGSLPSSRPRSANHSRDAA
                     HTRFPTTSSRHKREKKAPMSYSPRGRAARSPPSRTASPRSPVSSPPSSSSSSASSSCS
                     VPGSPPPPHRSVKILHMKEDGHTSSPPGSTDYLDGPLFAGLGPLMVVHLDVLPDVAGA
                     QPIPSREGIAGEEAASLAAAASSSPSLSRSHPVHLDPYWGALVERQEMDAHEREVAAL
                     HARLETADQQVRITEQQAVAAAEARAAELVQGYKADERKRRAQFQAALDALREENREL
                     TAKLEAVARAPAMGAPSTTTCPLRTPSSDAAAEARGNAIATTSGPLTASAAAVSQAEM
                     TRQLQSIEGYWRDRLRTAERHWEDEMSRQTQQRREALDQVEELVRTVEQLQEELRYTR
                     RQAARLREENIRLCGAAQAASTGSTAGLAVPVAPVTTSPPEEVSRLRKALREHQHKEA
                     ALLAQVESYGEEATRVRLRYEAALQRAERELAAERRRSTEMVKLYGSQLESLHHQLRE
                     GKPPSAAR"
     gene            complement(219027..220595)
                     /locus_tag="LMJF_18_0530"
                     /pseudo
                     /db_xref="GeneID:12981460"
     misc_feature    complement(219027..220595)
                     /locus_tag="LMJF_18_0530"
                     /pseudo
                     /db_xref="GeneID:12981460"
     gene            complement(<224368..>225909)
                     /locus_tag="LMJF_18_0540"
                     /db_xref="GeneID:5650979"
     mRNA            complement(<224368..>225909)
                     /locus_tag="LMJF_18_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682408.1"
                     /db_xref="GeneID:5650979"
     CDS             complement(224368..225909)
                     /locus_tag="LMJF_18_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682460.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650979"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY8"
                     /translation="MQEPTSPRNGELREIQYRKHLSFKHTLKIVIRNSIYAAIGRVLI
                     GVVKALVKHGVSRAFLVRIPPEFLSLDPLKWAAVFGGFSSFRFCLQTLLRILTPFGVS
                     EKFVSLLAGCTSATPVFVMNKETRTDLCLYLFVRSTHAFSLRYLLPRMPKILQEFHYY
                     DVVLMCLSSSQIAYGCLFNPNTLPKSYQGFLNRASTFPEKLIRGHSGFCRERLLPDLV
                     DYCWSRKLPLIEDFGQSGANTLCKVGHGDYSCNAWAMIFIFKNMLTMGVPLYGPLRFV
                     SMLAFQRRRLMTNPVSTIMQNVRSMLISALFLALYTAVILRSACFGVQHRGGGTKTVT
                     ALCSIAGLATLLEPKGRRMDLALYCSMHALRSFLLTQNLRGRLPYPRHWFVCTVYLLS
                     VGFLCYQYEEEPKLLDRRVRTALRLLLDEQSPAALTEKETSPLASAAASTYDVAEAPA
                     ESRCGQSQGKESASREHRVLCVGTPRTVDLPEEMRVADGMGQQQGHYRRSVAAFPATK
                     FKEQQ"
     gene            complement(<226574..>227644)
                     /locus_tag="LMJF_18_0550"
                     /db_xref="GeneID:5650980"
     mRNA            complement(<226574..>227644)
                     /locus_tag="LMJF_18_0550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682409.1"
                     /db_xref="GeneID:5650980"
     CDS             complement(226574..227644)
                     /locus_tag="LMJF_18_0550"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682461.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650980"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY7"
                     /translation="MCLRGILVDHQLFCPHEQVQQPEDGDVEYASVSFEVQYATIRRE
                     NSERRFVFKGNKLTGVLSQVYFNGNAIYMEEDDAYIFLSTTINEAGDKKVVVFRSEDG
                     FAYNAISVIPNLQEAQQHFVIYEGGRMLSVVSSFDGSYYTSVSSGYAGRHWSAMKMLN
                     VSTPPASVMFSSGVKLQYACSNETSEKAKWYVVDDNGRHTIKKEAPELPAVSKATPHS
                     PFLAFSLKASDSDKKRLLVLQTEPVGDRQTNIRASLFSVDDSAEEKEKAERIENWKKE
                     QQKREAARFKAKLERLELEKVLRRERRRREAERKAQFITLDEPNVRAAKKFFEKDGEM
                     ILVRRVNKDYVAFERDVFFSDL"
     gene            complement(<228469..>229707)
                     /locus_tag="LMJF_18_0560"
                     /db_xref="GeneID:5650981"
     mRNA            complement(<228469..>229707)
                     /locus_tag="LMJF_18_0560"
                     /product="putative vacuolar ATP synthase subunit c"
                     /transcript_id="XM_001682410.1"
                     /db_xref="GeneID:5650981"
     CDS             complement(228469..229707)
                     /locus_tag="LMJF_18_0560"
                     /EC_number="3.6.3.6"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase subunit c"
                     /protein_id="XP_001682462.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650981"
                     /db_xref="GOA:Q4QDY6"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY6"
                     /translation="MFLKHPVISSLKIYFSSVHCKAYIGRIIFLGEMTESFIILALPY
                     LQQSQDSLQSAQYEALVRQMGPLGQTFRHFFIPNLKIGTLDSLMEASDELAKLDPTME
                     STLQKLIGLMEETSGKPRSVVTTFRINQTQEMSAAGYIKNFLWSTAQFDPKETIHNLI
                     EKISRINATADERVRVMLAEYNETRNKLIAANRKGEGNLSIRPIRELVALYHRDYQCF
                     VDTELLATVFVAVPVAAQKEWMATYWKMNEYVCPQSNRVVAEDKEYVLNSIVVFRKIM
                     DDLKTACRKKRYVIREVEGTDDLSSAELRSLQQRAEKEKKALYTLLWQQYCTCYVAWI
                     HLKAVRVFIEALLKFGLPPRFIAVVLQVPADKEAEIRKRIAQLYPDLTTPLANDMTVD
                     TGALQQEYPYVSLKVTNVQK"
     gene            <231533..>234727
                     /locus_tag="LMJF_18_0570"
                     /db_xref="GeneID:5650982"
     mRNA            <231533..>234727
                     /locus_tag="LMJF_18_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682411.1"
                     /db_xref="GeneID:5650982"
     CDS             231533..234727
                     /locus_tag="LMJF_18_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682463.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650982"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY5"
                     /translation="MDFLSFDNGVIKNPFYRKDLVDGDGGYSSRRKWNRQPRDAINNA
                     TPAYTRNLLSEDKTPFQCSPAAVCFADYDVGIEHKIVVAFTNTATVPKTFRVMPILPR
                     YANVVRVEYTVPPRISPGLSWNVTVKYRPRDVSDISTAIYVKTDEGYFAVPLTSSKKA
                     FVFSVEPRSVSFGTVIVGEKRAKVITLRNSGAMPGTVIVSGDFKSLLEQKHTNPVDGK
                     KMSVFRISPQQYKVEIPSFSKSLIVLSFTPLNLTQINSEITFTENSSQLSHTIPITGS
                     STNLPVFLTTGKLEFGACFYGERYWDEVSVVNKANIAAIAEFQVPPPLAGALAVSPSR
                     VCVQSGEEYSVRVVFTPSKDLPKDFSSVIKCVVQNQILPLTLNIDGVLSYRAPCLPFT
                     AFDIGTIPLQTMRSVQVPVTNESSVKQLVGFDNLPPWVVATPEVLALVPFETTSFTLK
                     MEAPQEGRFSHRLKLINEFGDTQYISLSGQGTRPPVALSARTLLLPPCNIGRSVFATT
                     VLSNTSGKLIQFSFLVPCSFFRVSPSAGVLQPGESVVVAIFFHAPMEFEYVESPQPAA
                     PPHRTRSKKDVSIGFASDAPPPQKQSMYDDWESGSEKKLWSRHKQFRIQCCLTGLEEE
                     CCFIVVRCCAVRPSVRIEDAEKAPSTPPTKQQKPTENDARWVSTKGSVVADRDENSAK
                     SQSYKGEVFIEFGKVPIHHSSVRSCKVHNTGDAPFMIRAPPLNPFSSFSILTVAFDEV
                     PPHTEAEIHFSFHPDAYGKFNELIKVELAMPDDTVAFVFVNMQGTCSPTQLTITPAEG
                     VSQQDASSIVSVEHMTFGCTQKSESTRKGLSFHNVGSFSLEILITSYTEEGERAHRGS
                     NAVLFDPSDILPFLVHPRAFTLQPNTKQIVDVVFAPSDAGVYSKRLSIAASGETRELA
                     LEGRSVCGGIYCFVPISDVKTGKPTAVSFEGGIGCRPDYPVSLPFAEEESKILILGNL
                     LKGLSVEYNVQNWEQTRPLEMPPEWSVTPLSQIIASGKEARLSVHRSFAEDEEGEGVL
                     CGINSLFPFRFTIVLRGEGAEPLAYRTLYVVCTD"
     gene            <235607..>236578
                     /locus_tag="LMJF_18_0580"
                     /db_xref="GeneID:5650983"
     mRNA            <235607..>236578
                     /locus_tag="LMJF_18_0580"
                     /product="putative peroxisomal enoyl-coa hydratase"
                     /transcript_id="XM_001682412.1"
                     /db_xref="GeneID:5650983"
     CDS             235607..236578
                     /locus_tag="LMJF_18_0580"
                     /EC_number="4.2.1.17"
                     /codon_start=1
                     /product="putative peroxisomal enoyl-coa hydratase"
                     /protein_id="XP_001682464.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650983"
                     /db_xref="GOA:Q4QDY4"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR014748"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY4"
                     /translation="MKGCCRLLSAAEAASLIRRIGPFAVHRGEATGVIEILSGDPNHP
                     VKKLNLLGLAYAAALTELSELLSEELNAEARVAIFAARDGCSFSAGIDLKELSGMRPP
                     SGSGAAATAAASSGPKAPAMLLQHQHRVVRTFQDGISSLARCRIPIIAAIDGHCIGGA
                     TSVASSCDVRYTTTRATFSVKEAAVGLAADIGVLQRLPAIIGEGRTRELAFTCRDFSG
                     VEAKAMGFVEEVCADYPALLAHARKRAAQIAANSPLGVQNTKLILNWERERAAQTSLE
                     YQAAINAFSLHCSDIPEAARAFAERREPVFTDYMVNPRGGPPHSRQS"
     gene            <241349..>242602
                     /locus_tag="LMJF_18_0590"
                     /db_xref="GeneID:5650984"
     mRNA            <241349..>242602
                     /locus_tag="LMJF_18_0590"
                     /product="putative RNA binding protein"
                     /transcript_id="XM_001682413.1"
                     /db_xref="GeneID:5650984"
     CDS             241349..242602
                     /locus_tag="LMJF_18_0590"
                     /codon_start=1
                     /product="putative RNA binding protein"
                     /protein_id="XP_001682465.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650984"
                     /db_xref="GOA:Q4QDY3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY3"
                     /translation="MERAATQSQSIYSNANTNSSNVNTYGNTVSSYLSNNSPNAVMYG
                     GGNSGNGGAPSSTSVATVYASPTQASPSQAIRQQAQGAAQQNMSQSQTSTSFNAYGGG
                     AASGSGSGFFYSTPSAQAPGAQTMYSANPSAAAMFPMRGGSTSMTPAQPTPTQMLTPQ
                     ANAAAAAAAVWTNAAANINAGSKLFVGQVPAVCTEDQLRPLFAQFGTLLEIKIMREPN
                     GRSKGSAWVRYELEESAQRAITALNEKHVVPPQTNPLRVQFAAPSTNRIPQPLSALGS
                     IMPPSAVMQPQPQPNYATAATYATPQGYAGTTTAYMQGQYATSPNLMAVRASPQQQAA
                     VQSASGKIEYLRSNHPGSLIYSTASPTAVDAMQQQQQQQSPQQQQVVYTTGGQMRAGV
                     MYTPDAFAMTNQMAAAPQQPHQWCS"
     gene            <248778..>249050
                     /locus_tag="LMJF_18_0595"
                     /db_xref="GeneID:5650985"
     mRNA            <248778..>249050
                     /locus_tag="LMJF_18_0595"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682414.1"
                     /db_xref="GeneID:5650985"
     CDS             248778..249050
                     /locus_tag="LMJF_18_0595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682466.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0595"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0595"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650985"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY2"
                     /translation="MPCALAFSCPPTKPSPPRPVERPRRCSRPVLPIVLLQAFDCLTS
                     AGKREKHQRGCSPRGVGKVAGTKGAYERAAAAWGLIEMQRCLLTKS"
     gene            <250746..>252656
                     /locus_tag="LMJF_18_0600"
                     /db_xref="GeneID:5650986"
     mRNA            <250746..>252656
                     /locus_tag="LMJF_18_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682415.1"
                     /db_xref="GeneID:5650986"
     CDS             250746..252656
                     /locus_tag="LMJF_18_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682467.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650986"
                     /db_xref="GOA:Q4QDY1"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY1"
                     /translation="MNPYYAAPPPPPQQQQSRPSVDLDDLFGGPTAANEHKPFHAAPG
                     EPAPPSYDALNGGYSSAPPPAHHAAASEPQQSHNGNISGNQSLYYGAAHQQQQQQQSY
                     GVPAAVPASASPYGMSSPPPAFSSSSSITPGTAPPLQPQPQQQQYGAYPAMPASGMAP
                     PAPPLQQQPPQVYVQPQPQPQPMPGPVHQQQQSFAQNSSSSVSPSGAAAVAGPTAAAG
                     VGSGAASSRSAEEEDRLQLERIIRLRRELELEQEREQRKKEELQTWGCPICTFRNKLN
                     EVKCEMCGSTRPGYTAPASTEPPAQHQQQQHQPRPAATPSQVNAGVTDWQCGMCLAPN
                     EAHAERCKVCYAYRSSGIPVPTASPSGAAANANHNGVVSNTPFTTNWKCSVCGEVNPP
                     SKANCKVCSGFQRNGTAVTDAVPAPSTGSGHGAQATSSADPPLPTVWSCSVCTFENSV
                     SAAVCKACESGQRPRHLAPKRDKEKSASSKQHDSRGSGAKDGGGDGEKKCSSSKSQWP
                     CGTCTFLNPIGRKKCDMCGAKRPESYAAEADTTEARAAAKQEAQDDAEEVAWQDDDSV
                     TECNNCHTTFTFLIRRHHCRLCGYVFCAHCSSYSVPLTMGSLPQRVCVNCYKARLEEE
                     KKTKKARRWLDS"
     gene            <258115..>259911
                     /locus_tag="LMJF_18_0610"
                     /db_xref="GeneID:5650987"
     mRNA            <258115..>259911
                     /locus_tag="LMJF_18_0610"
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /transcript_id="XM_001682416.1"
                     /db_xref="GeneID:5650987"
     CDS             258115..259911
                     /locus_tag="LMJF_18_0610"
                     /codon_start=1
                     /product="putative ATP-dependent zinc metallopeptidase"
                     /protein_id="XP_001682468.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650987"
                     /db_xref="GOA:Q4QDY0"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDY0"
                     /translation="MSFTDTQSPEYQRGVNDAERHRRATEENWIRPALGPIVWLGVPF
                     LLAWMYMRRVSLGSPLGSGSASGSGNPFTSMMEQMMPIKKRQFRVDVKGTRFADVVGL
                     PEAKAEVRQYVDFLTEPNKFTRLGARLPKGCLLTGEPGTGKTLLAKAVAGEANVAFFS
                     CNGADFIELIGGSGPKRVRELFEEARAAAPAIIFIDEIDAIGSRAGKQGGSVSSEENR
                     TINQLLAELDGLSTSADPIVVLAATNFQDNIDKALLREGRFDRKIAIEMPDLSARREL
                     FEHYLNRICTGDPNGRTKDEGGKELALDTSVSNKALADQLADLTPGLSPATVATVVNE
                     AALQSGIAGKPLVQLPDLLEALDNTLMGRKHRNRQSDQSARRTAIHEAGHALTAWMLP
                     IVQKVLKISVTPRGHAMGYTQRAGTEFHEYQTNATLFADMVVMLGGRAAEEVMLGDVS
                     AGAMDDLQRATDVALKQMLAFGMSTHTGLLSYHPDYTRAGRDFTTFSNEAQYRAELEA
                     QKLLAAAHSTAVDIVKRHKDKMEIMVKALLEKKELSTRDIEELWGPRPSTPTVEDIVQ
                     KVIEVTGSYAEITATVGPAAAAVATPSIAGVY"
     gene            <261282..>261926
                     /locus_tag="LMJF_18_0620"
                     /db_xref="GeneID:5650988"
     mRNA            <261282..>261926
                     /locus_tag="LMJF_18_0620"
                     /product="putative 60S ribosomal protein L10a"
                     /transcript_id="XM_001682417.1"
                     /db_xref="GeneID:5650988"
     CDS             261282..261926
                     /locus_tag="LMJF_18_0620"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L10a"
                     /protein_id="XP_001682469.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650988"
                     /db_xref="GOA:Q4QDX9"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX9"
                     /translation="MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDK
                     RFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVPTMNQEELKKLNKNKKLVKKMCN
                     QYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL
                     CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY"
     gene            <264602..>266290
                     /locus_tag="LMJF_18_0630"
                     /db_xref="GeneID:5650989"
     mRNA            <264602..>266290
                     /locus_tag="LMJF_18_0630"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682418.1"
                     /db_xref="GeneID:5650989"
     CDS             264602..266290
                     /locus_tag="LMJF_18_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682470.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650989"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX8"
                     /translation="MRAYIDSICNRKPPSKAPQVRPTKSALLLLSHQQAKRRQLGESQ
                     ADGSISTLKHPHPQPRAAAAKWPLKTTPSLGPPPRPLACRSPSPLAHDVLARTPPASS
                     VEAAESPWHPLFTSASQLPATSPRQQQRPAHRASEEESEAGVREEYWPTLARSLEAGK
                     DTSVAVAAYGDRRLYDGTAEGGEGGHRKAYVMHASAAERGSCATSSPTRTCRSAWTPW
                     HPPPHGAHQDLVRSDAASPFQTNFRLRYPSSSSCTSPAPHARSEMEPPRVPRASSARP
                     SMTSDTRSDSNLAALSHQCPTSPAWAVDLNEPPRRCHPVSAPQQQLLARVHARRESYS
                     SSAHCTTDADVIANTQHRPDSPPCRPSLSSLFSSGFFSRGPEAAMHRRAERYSTVAHR
                     AGNPCTRFLATAQSAASSLTKESQQASQPRPGADYRCRDVNNCSLRDLQEGLCTRLQR
                     RLHDLEPSHSSSTSPMDWKAAAGSTKSTPLLADMDATLRLWRDTRRALRQQVMHRSAI
                     HDVQRSTPLKGQWPNVEEDIVLDGVVRRILAERAASRAYLLAGAAAANREARTP"
     gene            <266997..>267812
                     /locus_tag="LMJF_18_0640"
                     /db_xref="GeneID:5650990"
     mRNA            <266997..>267812
                     /locus_tag="LMJF_18_0640"
                     /product="putative serine/threonine kinase-like protein"
                     /transcript_id="XM_001682419.1"
                     /db_xref="GeneID:5650990"
     CDS             266997..267812
                     /locus_tag="LMJF_18_0640"
                     /codon_start=1
                     /product="putative serine/threonine kinase-like protein"
                     /protein_id="XP_001682471.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650990"
                     /db_xref="GOA:Q4QDX7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX7"
                     /translation="MDPSVMVGQYTLGKQIGSGNFSKVRLGTDPQGRTWAIKIVDKRR
                     LKKENMEDQMLREVAIMRSLRQQNVVKLQEVLQSSNHYYLVLELVTGGELFDKIVAAK
                     RFDEPTARRYFHQLIAGMYYCHSKGFAHRDLKPENLLLDANGTLKISDFGLSNLQQDV
                     LLQTICGTPNYVAPEVLMERGYNGLSADIWSCGVVLYVMLAGRLPFEDRNMNVLLGKI
                     ERGDYQMIRHISDPAKDLVARMLTVDPRKRISMEDVINHPWFQIDWNPRLLST"
     gene            <272175..>276098
                     /locus_tag="LMJF_18_0650"
                     /db_xref="GeneID:5650991"
     mRNA            <272175..>276098
                     /locus_tag="LMJF_18_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682420.1"
                     /db_xref="GeneID:5650991"
     CDS             272175..276098
                     /locus_tag="LMJF_18_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682472.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650991"
                     /db_xref="GOA:Q4QDX6"
                     /db_xref="InterPro:IPR006730"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX6"
                     /translation="MQNITASSPSPYAGGGHCGDHSTRVGDAATAASVFRDFTWYSAT
                     LLSHLFALEHAQLERTAAAEENRRRAAAAHSPQLLMSAAFESLNASVVVAPASAATGA
                     ARATSRKISDGGSIGRQLDLGSNKAGGDDDSSQNSGAAAPSTPPLPPPANDGSEKLPH
                     LVTQHRPHVLVGFATVGDATVVGAGDPMIADAATRWVPPQATKAAGLSAASPAAAAAA
                     APTATAKTSASDSAVTSLLAVFDAYYFPSELFAAAGPAASAMAGQQGEKADNISLPDA
                     GASAMHVGADGAERVHGAGTSSAGAADPGPGSGTAAPRVTAEALREAFHDLLVLGQRC
                     AVFALTYRGIVGCGNDAAPSRAWLGGADVEGEDDAGQHYSPNIDGEHLSTAAFTAKMH
                     DAAGTGFSSEDDAKPGEAVQQAAAASLQFLLQLACSCPCAPLAYAAQLCIACALAVQP
                     PPCCATGWSARQQLMRYLPTLQPQSRAMAATDASVSSNTVGGPPQHGGVGVGGGSIAT
                     TSSSSVTKARYIPTTQHVRPEDAMLWFDSAGAVHLMTAERWWDTQQQHPAACLAYCGP
                     LPATTALPTVQRLLMEEEAYMGPNGSAAAVLKSVLEAVSAEVCLNARVISGSPSSTAH
                     TSLRRRRGVHRGGGVSAGGRRSLTGDGEEDAADGRVQSGSSTRAAACCAVAAARGSVA
                     PMGRAQGAAAAGASTRLSKAAKRRRALLFALAQSHLLPPVQQLATSKTLLYGVFTDGG
                     ECPSYYKLLSLYPEVLRAHHAALHYVLYGDGPLLVDMRLMIAVMAASRHRCEYLVSRF
                     SALLLRYAEEAMLEEYVDEDDCGAGSGSSALRGGHQGGLYSSSGRSSGGGGVRGHAAY
                     SHRDAADAYDYDNPHFAGPSVYPRQQKHQHSDTSAAGCFRGQTRQRWITHGPPARLRA
                     VQRFIALAAHTPWTLGEGEIRNVLACGWTVPEVFQLVAIVAQVVPLCGFVMGLFVPAE
                     PWAMTLLPLEVVERLGHRAVTGDALAGSLGGSGVSSGGMAGCCPDPAISHCNSVGRGG
                     GDERGSPTGGAAQPPHADVYRRLAGDDNVVSEQRIKGGTTAVNPPTLWRSRFTWNEVG
                     ATSMEQYYPGAATLLNEEIECYLDVVRQLTKADCVGLMSPDYDPSYAFRSLQLYVQNL
                     VGFMVEDYSYNDINKVLRRPAKWFAQVLTMRPETLSRSEVVRWYVPTTPPAGKTSDMS
                     AESSLVTHQLKREIELLSVVDSAQGGHRGGIESASAHQDNGDRPSPTPAEAARDAAEA
                     EALQTALTLQDERVLLLIALATMEARKEGLLHILLRPVCAVLSNM"
     gene            <279661..>281796
                     /locus_tag="LMJF_18_0700"
                     /db_xref="GeneID:5650992"
     mRNA            <279661..>281796
                     /locus_tag="LMJF_18_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682421.1"
                     /db_xref="GeneID:5650992"
     CDS             279661..281796
                     /locus_tag="LMJF_18_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682473.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650992"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX5"
                     /translation="MPTELLDDSTQDAEEEFIFNEYAIDDSLDPLNRLLMYYQSDFSL
                     QRLVLVRELASTAQFAGYAESARSIVPLLTTFTQDAEPVVRQALVEQLYPLAEFFVQQ
                     GSDAGYQCLLNAFLPTAFELLVDKNVEVGVVALEAIQKLAQLVHKEDVQSHLLNVVMT
                     LAHDERAEDYRVVAAQLFNDLAPQFGSEFSTTVVLGELELLSNDSSFTVRRTVGSNLG
                     GVCAVLTTEEAQRTVLSLYITLCGDEIWGVRQACAESIEKVASGLPESMRVQFIVPAF
                     QKLLEDDSRWVRTRAYESLGRLLHTLRSEDISPELLRLFTDMAFQSDNVESPLSEYCA
                     YCFPAVVQVIGPSRWNEVADAYATMLKDVQWKVRKSLAYSLHEMAALLGTTIAEEAIV
                     PAFELLLRDLDDIKRGAVLNAERFLALVTPATRDRLVPLLCHVPLESENWRLRNEVAK
                     RIGAVAVLLSPDSPSFPSVLALVSRLLDDSVMEVRTSTYEPVAIILKHLRAANDEKYQ
                     NYLASIVKLATAYSFRGRQMFAYVTEQVVKVGADDVLESALLDGIVKLAMDPVVNTRL
                     VVDSVAGRTILRNHKWAGNNKVQEAVAVLQQQAASQEEVDAAAEAAEAAVANTQILNG
                     NEDGGGEAGSMEMQQDEEQQADGGAPSPALQAGPDDVAPGAGGTGGEDEAVPPCGLWP
                     QGAPTVSTEASSGSSSVVSLGGTAVVGDI"
     gene            <284369..>286846
                     /locus_tag="LMJF_18_0690"
                     /db_xref="GeneID:5650993"
     mRNA            <284369..>286846
                     /locus_tag="LMJF_18_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682422.1"
                     /db_xref="GeneID:5650993"
     CDS             284369..286846
                     /locus_tag="LMJF_18_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682474.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650993"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX4"
                     /translation="MRRDDCSRAEPRRHRLPPLPHHPEASNGLCAGVDRQQPHSPLHF
                     AQPPTTSGAPSAHRHQSDSLQLRPVGRGDAVDRVAAELRHTGMKPLLSRRLSAPLTNS
                     SRAKARSSEFAPGVADAAATVATLNCGAALDEQPPVAAERAPSFKPHPPPSLTSPAED
                     GLPGRYRTTAMQFIKSIERLNNMTSTTCSADATSFFALTEERTASGKGGVRKMARVPL
                     LPLTLCTDGATVILVDSNGTERHGNYLKAVDGFHQSSAALTSAASSHGSAAPSVSPHP
                     PSNVLWWALNDLQQTPCAVPLTTARASLSVAHLISGHDSGNNDPSFTQLRPMHAVGRK
                     TLSTMWPAKTTATFAAIQPNRFTLRYGEPLALVFASAGARAGDEAPRHRIRGGRVGAE
                     AAADVPSWITANERACQRECTPHVGHNLLCDVYDGYLPSFLEFLYPNGGIMLRGCWCA
                     VSTSAADEPMAPPVKLFSQQQQQVSRATVSLGDGGGGAAPRPSSRSPPSRSAQESLVT
                     TVPMPLIDWSPQSAGAVLIARRDDDAGAVNAETLMQSFRPNAVPPPRRSPATNTAVDG
                     GETTCKRTTLPDAVLQLPPAVLRFLAQGGDRAASAILPVGPRAYLSSSPPPPSQPTAT
                     AAAPSLRLTLRRIESHSEPDVCPTDFGADEPAPAAYDFDSYRVHVGGDFRGIHDRNLR
                     RSQLQQQRQNRNVFGLVYVSALLRMPSQPPPPMGMAGKPSVACESVVVLTPAGRVELV
                     VPATSHAAARPITITDVKYSLLRSAVGCSLHLRDEEFAFIYAPGTPDIHGATVVDAAH
                     VVLRLRRRASRAYLEAAKQQVQGMGKG"
     gene            <287997..>289409
                     /locus_tag="LMJF_18_0680"
                     /db_xref="GeneID:5650994"
     mRNA            <287997..>289409
                     /locus_tag="LMJF_18_0680"
                     /product="putative citrate synthase"
                     /transcript_id="XM_001682423.1"
                     /db_xref="GeneID:5650994"
     CDS             287997..289409
                     /locus_tag="LMJF_18_0680"
                     /EC_number="2.3.3.1"
                     /codon_start=1
                     /product="putative citrate synthase"
                     /protein_id="XP_001682475.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650994"
                     /db_xref="GOA:Q4QDX3"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /translation="MRAVRCSLIRGVAGLRMASSALDEMKEQMLRRWKEDQKKIDDLR
                     KKHGHEKLCDATIDAVYGGMRGITGLVYEPSLLDPAEGIRFRGLTILECQEMLPKAPG
                     GKEPLPEAMFWLLMTGEVPTEEQVRGLNAELHRRADPEAIAAAQKAIAALPRNAHPMT
                     AFSVGVLALQSYSKFAAAYAAGKSNKKTYWEYALEDSLDMLARTPTVAAMIYNRETKG
                     QVELAAPSNSDLDWAANFAKMMGYQDEEFWECMRLYLSVHADHEGGNVSAHTTTLVAS
                     ALSDPYLAFSAGLNGLAGPLHGLANQEVLNYLLSMQERVKADGVNMHDEAALEKALSN
                     YTWELLNSGQVVPGYGHAVLRKVDPRYTCQRNFCLRHKFDDDLFKLVNTIYSIMPGIL
                     KEHGKTKNPYPNVDAHSGVLLQHYGLTEQNYYTVLFGLSRQMGVLAGVVWDRLQGRPL
                     ERPKSITTEMLAKKYLCNSL"
     gene            <293991..>295355
                     /locus_tag="LMJF_18_0670"
                     /db_xref="GeneID:5650995"
     mRNA            <293991..>295355
                     /locus_tag="LMJF_18_0670"
                     /product="putative citrate synthase"
                     /transcript_id="XM_001682424.1"
                     /db_xref="GeneID:5650995"
     CDS             293991..295355
                     /locus_tag="LMJF_18_0670"
                     /EC_number="2.3.3.1"
                     /codon_start=1
                     /product="putative citrate synthase"
                     /protein_id="XP_001682476.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650995"
                     /db_xref="GOA:Q4QDX2"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX2"
                     /translation="MASSALDEMKEQMLRRWKEDQKKIDDLRKKHGHEKLCDATIDAV
                     YGGMRGITGLVYEPSLLDPAEGIRFRGLTILECQEMLPKAPGGKEPLPEAMFWLLMTG
                     EVPTEEQVRGLNAELHRRADPEAIAAAQKAIAALPRNAHPMTAFSVGVLALQSYSKFA
                     AAYAAGKSNKKTYWEYALEDSLDMLARTPAVVAMICNRETKGQVELAAPSNSDLDWAA
                     NFAKMMGYQDEEFWECMRLYLSVHADHEGGNVSAHTTTLVASALSDPYLAFSAGLNGL
                     AGPLHGLANQEVLNYLLSMQERVKADGVNMHDEAALEKALSNYTWELLNSGQVVPGYG
                     HAVLRKVDPRYTCLRNFCLRHKFDDDLFKLVNTIYLIMPGILKEHGKTKNPYPNVDAH
                     SGVLLQHYGMTNQNCYPVLFGLSRQMGVLAGVVWDRLQGRPLERPKSITTEMLAKKYL
                     CNSL"
     gene            <301282..>306081
                     /locus_tag="LMJF_18_0710"
                     /db_xref="GeneID:5650996"
     mRNA            <301282..>306081
                     /locus_tag="LMJF_18_0710"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682425.1"
                     /db_xref="GeneID:5650996"
     CDS             301282..306081
                     /locus_tag="LMJF_18_0710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682477.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5650996"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX1"
                     /translation="MAYPPVPLVTAFYGHCARLRSPRHFCQSDLLALPANGCTTSLAA
                     AQGESTTVSVGSARVADWDVDGGGSGAALLLMLHDVATLPWAAGLRLNLTLHGAPTCA
                     HDRMARRELPVAAAIKRNRGGASRPSSASPAITRVGGGVSTQSRTTSVVPAEASLAKS
                     GAEGEEQGSVATSWRTTTAAGHQADRDAWQPFSEYSEPQACAETSALALRSFAVAQLG
                     QRVPLVALVAERGCDAKSTVSALTEDCVTHRTSAVYNEQCSNSPAWLPPRTAVHRMPV
                     EVYAERTPLLRTSGTAALQRALRQALSRVSTASAGHNSHGAAHLPATWRSSPSKPCGG
                     LRWPVSPLAHLVWNGECWIEETDVQVVEMEERLLGALLGDDDEDAADASADVARSTTN
                     RNTVMCGTPATRSSTREKSGAGRLEALRIGFNAQGPAYPRFWLPSCWRRASGLREVLT
                     PLFRDPDDSSAGIGAVCGRPAGAAAPAASRCAFSSRSYEAWEHTSENGRVAEAAVEAA
                     AGVAPIPAALRCSQWVLRLRKAWLVASPNVKSASLTRAGAEARADVAAQPGLGNAGVK
                     PLPSLLDAARCASDHSHAPSSGSPAPVPVRYPNYDLLTGLPLNLRDYDAAARRARGAS
                     RGSRASSCSSSASKSAKLSLWPSWTTQTPPAHECCVQAAQAATFQYADDPFFLAALSQ
                     KVGWIRLSPTCNPHTPHVGASSASVPTATPGTGPVSWQLPDVLRRCYKIPSSIADVPQ
                     RWLCSGAKTAAQTAAPSMAAASSTAPAHHLPSLPPPPVASVSVPQQEWWTGFFLHDAP
                     HWWHREVYKGAQQRWATKSTCKGRLAAPVRPRHERDAERTATAEEVARILSFLQEECR
                     VPPPPVSAASTAAAVASPCHDAPGLTSEPSSPVEMTQKTATLPPHVCVLRLAPVAPVL
                     RRPRRLLRRGEQGKQEHHCASTSATEALSLKLQWSLVSDTAAVTVNTFFSLQDVLNDA
                     GPSGTASCALPPTSSAGRAVLFYVEVKAGLEVLRRAAHAAAAREDSSDDAEGPSPAPS
                     SSTAWWEQLSAFYDANTFVGYETAPPATLSTTDEGNKGISSGGCEEVGTTHRDGVAHE
                     SAVPAFCHPAVTEVVRTCAQLMLRCGGPSHNCHVSDSPITLDSGGGEGNRVSAEAVAV
                     WSRVDYDALLRTAVVASARAAATPSSVACLRIKVADGDGGRSGADEEANEEWAEERAP
                     DQADEAAAHADNGSESSHAESAVTHETQRTRPASGAAAPSSRDHATSVGQDSPSSAQV
                     AQGSSSTSSCLAYGVEVYKYDEEGTRSAPCLSCGGLDVSLNDAQTPATEPADWSGVDG
                     RVPLERNGRLSEALQPHRNPDSFGTMAGAGSASSSSSSVDTCATSSAASLSSAGLPSA
                     YLSSGKSAQAVTLGEASVASILDARKESRQSGGDVGADDGSRAQRQLRSAELLVQNKE
                     FLYVGSSKDSTGSASPMPSGTDGGSPSPPLDVMGTLIAEERHRFKMEWQPWLRYLPPT
                     TTQQRNTPSTISEPTETPKNVSRVFGFLQSSAASEYCTGSSSRADTTSSRGNGGERNA
                     DDSAPPAAAAASDGAVAVLDLGLCVLHVCRTEVYVNAANLLCHRETH"
     gene            307133..307218
                     /gene="LM18Cs1C1.1"
                     /locus_tag="LMJF_18_snoRNA0046"
                     /old_locus_tag="LMJF_18_snoRNA0109"
                     /db_xref="GeneID:12981461"
     ncRNA           307133..307217
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.1"
                     /locus_tag="LMJF_18_snoRNA0046"
                     /old_locus_tag="LMJF_18_snoRNA0109"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460214.1"
                     /db_xref="GeneID:12981461"
     ncRNA           307135..307218
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C1.1"
                     /locus_tag="LMJF_18_snoRNA0046"
                     /old_locus_tag="LMJF_18_snoRNA0109"
                     /transcript_id="XR_002460215.1"
                     /db_xref="GeneID:12981461"
     gene            307454..307521
                     /gene="LM18Cs1H1.12"
                     /locus_tag="LMJF_18_snoRNA0108"
                     /db_xref="GeneID:12982117"
     ncRNA           307454..307521
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1H1.12"
                     /locus_tag="LMJF_18_snoRNA0108"
                     /product="H/ACA-like snoRNA"
                     /transcript_id="XR_002460229.1"
                     /db_xref="GeneID:12982117"
     gene            307619..307710
                     /gene="LM18Cs1C2.12"
                     /locus_tag="LMJF_18_snoRNA0047"
                     /old_locus_tag="LMJF_18_snoRNA0144"
                     /db_xref="GeneID:12982156"
     ncRNA           307619..307710
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.12"
                     /locus_tag="LMJF_18_snoRNA0047"
                     /old_locus_tag="LMJF_18_snoRNA0144"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460216.1"
                     /db_xref="GeneID:12982156"
     ncRNA           307621..307710
                     /ncRNA_class="snoRNA"
                     /gene="LM18Cs1C2.12"
                     /locus_tag="LMJF_18_snoRNA0047"
                     /old_locus_tag="LMJF_18_snoRNA0144"
                     /transcript_id="XR_002460217.1"
                     /db_xref="GeneID:12982156"
     gene            <309513..>312068
                     /locus_tag="LMJF_18_0720"
                     /db_xref="GeneID:5651000"
     mRNA            <309513..>312068
                     /locus_tag="LMJF_18_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682426.1"
                     /db_xref="GeneID:5651000"
     CDS             309513..312068
                     /locus_tag="LMJF_18_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682478.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651000"
                     /db_xref="UniProtKB/TrEMBL:Q4QDX0"
                     /translation="MSAPASSGPGDQGSLPPVEQLVDRQEQAYRTLRATIAASCALGH
                     RSCQVLWGPRGSGKHRILRLLAHDVRRTPNAFVMELHGRLLKDDEAALGVIAQQLLSF
                     LQSPQSAQLRAVHYLLRTGTFGFGQLFHFERHMQDGDMTVAAATAPGLTARAMDSADT
                     LLPPTSQHVAGDGGRSGASRRQRPSTVTSPPTKAPHRGARRARWRSSRPAPGDLADSN
                     ADGSAEDAEDDATEDEEDVQGSGVMVTSTTTYLTGGAASALPHLQQALLLLKSLGCSI
                     VVCIRDIDVFGIRCDQLLYVLSGLMHDNDGGGGGAGDGGGLSLVLASAAPDIRQLEKR
                     LSSRLTCETRYVPLLPWSLRNLLAATLHTTAQDASQQVCMKEVGRRRAELVATLRSGA
                     TKLRQGTEGSGKIQKHEQEALKKSMADLEARLHASEATLRELRAQRRHLLSLLDTETA
                     PMTLTLGANSAGSPTLGYYNASGWRSSLLPSPLQLQQQAPTSASSASPSFTTARTWYV
                     GSLLAHSSLTLEVQCVMCEELLRQLCCATRVRQARGPAGVDAVCGSGCPALAQLVTEL
                     STELEMNSSTSSTVLTVLANHLCKAASGAVDLLGRSGRRVLLSWLRTRLRHEPIPPVA
                     TSVNSAAQASTTRPAGVPPIILLRWREEAQSMVMSTPDRRAGLAEEAARNERCVGVDL
                     QPSLAFGGREPAATDGASISRSEYHRPLPGLPSLSLLPPNLHDLLADGQLVGMGYGSR
                     EVLLVLLYMHIHHISGVQERTVADLLEDVSSSLGTKAAAALDREAFRHAIHLLCRWRL
                     LRVVEAHSQLLEICGSGARLREFLLTVLSKKPAWCEAELGLDAREIMRFRSLL"
     gene            <312801..>313553
                     /locus_tag="LMJF_18_0730"
                     /db_xref="GeneID:5651001"
     mRNA            <312801..>313553
                     /locus_tag="LMJF_18_0730"
                     /product="putative dynein-light chain-protein"
                     /transcript_id="XM_001682427.1"
                     /db_xref="GeneID:5651001"
     CDS             312801..313553
                     /locus_tag="LMJF_18_0730"
                     /codon_start=1
                     /product="putative dynein-light chain-protein"
                     /protein_id="XP_001682479.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651001"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW9"
                     /translation="MADHSSENSTAAGTLNSDLDATRPGADAATLGGSSGADETSKNV
                     TTSGQDVSEDQQGSTAAGEADGANGEAAVSAEKATTANTDNNGSDSQEDGEADEDEEE
                     DDAGHWERVAASDVKNIILQVLSPYFDDDVGGGAAAAPGGDLASMPSALGPSAPAIEE
                     DRDGDDTAQRYDHFKAEEWVALVCDGIMERLVALGKPFKFVVHAMVMRKCGAGVHVCS
                     SCYYAPMDGWLSHAHDLSAHLYVVVTVYWCAV"
     gene            <314646..>316046
                     /locus_tag="LMJF_18_0740"
                     /db_xref="GeneID:5651002"
     mRNA            <314646..>316046
                     /locus_tag="LMJF_18_0740"
                     /product="putative elongation factor Tu"
                     /transcript_id="XM_001682428.1"
                     /db_xref="GeneID:5651002"
     CDS             314646..316046
                     /locus_tag="LMJF_18_0740"
                     /codon_start=1
                     /product="putative elongation factor Tu"
                     /protein_id="XP_001682480.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651002"
                     /db_xref="GOA:Q4QDW8"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW8"
                     /translation="MFRSGVHRLAPKAKEAFVRGKPHLIIGTIGHVDHGKTTLTSAIT
                     TVLAKRGQAQALDYFAIDKSPEEKSRKITINATHVEYESEKRHYGHIDCPGHMDFVKN
                     MITGAAQMDGGIIVVAATDGVMPQTREHLLICSQIGLPALVGFINKVDMTDEDTCDLV
                     DMEVREQLEKYKFPAEETPIVRGSALKAVEGDAKYEENILELVRKCDEWIPDPPRNTD
                     KPFLMAIEHVYEIGKDKKSVIVTGRVDQGVLKLNTDAELAGFSAKKSTVRVTGIEMYH
                     KTLSECMPGDSVGVSIVGTGDTTSLSKDNVERGMVMAATGSTNLYNKVKAQVYVLTKD
                     EGGRHTGFSPHYRPQLFFHCADVTADMSFPEAEKHREELNKKFGRGPEEDKKKEAEMK
                     EFESKLVCMPGDNRELILTLAYPMPIEKGLKFTIREGKITVGWGAVVETMGLDTKVSI
                     EGKRIGAKPVTGKKKK"
     gene            <317633..>319330
                     /locus_tag="LMJF_18_0750"
                     /db_xref="GeneID:5651003"
     mRNA            <317633..>319330
                     /locus_tag="LMJF_18_0750"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682429.1"
                     /db_xref="GeneID:5651003"
     CDS             317633..319330
                     /locus_tag="LMJF_18_0750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682481.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651003"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW7"
                     /translation="MSAPHLLSFLHPAASCSPPPIAVLTWMLAMEERLGRQAVHIAEL
                     EARHDITALLARSYFAMSTSCPRSEWRPVRSEPGSQLECLAAASSGHRENDGDAVTKQ
                     LCRAASCAEPLSPTAFSLRHTQASAQTGALARQDENGTRRSTPELPLSSFWQQLADLD
                     DRLTEVEWTTVHCEGSQPTAAARRPQQHRVDSSRPTMDDCVALLDSLLTSQEGTRTPQ
                     WNAMTADAELPRRQQRPSQETERHLPLQLHSRQQYILSVLAKLRDALRSTQASYKAAT
                     GIRTPVSLETLLQLPPETLPLLMCTDDGTRDVRQPQCSHPCDASGGTAACCGLLSSTS
                     IYTLWATLMDGVDTLPCFSRAVAEALWAAVLWMHVCATLAPPRHGETPASAPAGRRSN
                     AAGEDAAPHGQTFFAPIASGKGEIRSHVRPLRAEVQQQRAASASPLQRRPVRSEAEPR
                     QLRSPSEARQRLAVRQQRAIAPTLKSRLQEEEERWAYRDFPVRRGFTAPTVYDDLFPL
                     PTAVSAFVKPPVYTVPSPSLLAERSSGAAVAEAKEEAATTVELGFYTGPARRPRSLV"
     gene            <320131..>320421
                     /locus_tag="LMJF_18_0760"
                     /db_xref="GeneID:5651004"
     mRNA            <320131..>320421
                     /locus_tag="LMJF_18_0760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682430.1"
                     /db_xref="GeneID:5651004"
     CDS             320131..320421
                     /locus_tag="LMJF_18_0760"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682482.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651004"
                     /db_xref="GOA:Q4QDW6"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW6"
                     /translation="MSNSAGASSPPMSTDCYSFYCPVCDIQFSDSQAAEAHKASRQHK
                     RKSGELEWETRQYKKDADVTPDDVWALVRRKQAELHVIPWSELKHSEEESAT"
     gene            <321253..>326334
                     /locus_tag="LMJF_18_0770"
                     /db_xref="GeneID:5651005"
     mRNA            <321253..>326334
                     /locus_tag="LMJF_18_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682431.1"
                     /db_xref="GeneID:5651005"
     CDS             321253..326334
                     /locus_tag="LMJF_18_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682483.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651005"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW5"
                     /translation="MDNHNADGYSDAADVLKVLHDTVEMYVSSMQDSEDKERGCSMAS
                     ASASSSSLTTSAAIDLAITRQHIQENVPRLLGVCASVRSMLRRVAMLPRQPSRRSDSE
                     SLSASSSLGSSTTAAKRHEAVSGLIMRKLGDVMENAHMIRGLAKVQQQQQHLLPSHLS
                     RVSSLASPDDNDGPLLMKQLIRVTLYNLEDMERLLRAAYPNELFTDTVNWGGDEVDEA
                     DRPTLFPHSPRVRRTLTRSHGQRLGYNGGSSGHEGRRDSTGCAHSTSSGDGGGVNSSL
                     ETPRSSTHTAPYVRRSPSFDQANLLTGSWATANQEDHDGDSEAAPTVRLTDTTPTSPT
                     GAYPSASILARSQQADPLSSASSFVASAPGPSSPRVQFVIGEPPDSEGQDSSLAECAL
                     ASTAMPKQSSPCDSNLLSNPVVRLSSTDNDKHSRNVSDRAPADSVTASTLSTATTGGS
                     LGSSALQLGDDAPPRSRDGNSSVGSRGGIARALPPPVGLPPRSPRRYDPQQLATSLAS
                     SSGDQRLPLAPDPAWVDPNMRVRTYHMQRLPGELWGVIIEDHQAKMEAAFRADVVDLF
                     KYGEVSPALRGEDVREVYFTVVGTDLHIRIELEHLCSMAEPEINTRLNLCSYPHMTEL
                     YEEFFKAHQAKELDAVEDSTATPDSDTPRYSETYSNDGDGTGGDEEDEGASDGSDEQR
                     SLSLASDLNAAEAAADDSAAGVRTPPLLIATDSRTMSVVGSSAATPCVFSTPNLRAAV
                     GEDSGGLGETGREASASVSPCALVSVESHTHLQEGATSASASRHPHTVRIPGARWARL
                     LLSPAPEKSDLKYAFVKDTGVALGVLPSEAREACQEVRFSFGSLVVDFMWDNAELYPG
                     AVPLSAPEIDTALKNCLYPSVRAFYTDACAALHLDDDLAVVPAAKRASSSGGGSTAES
                     VVAQLILPDKSELDLASGTHSALALDMSGNAEKGEAASVPKSSREDDWSTARLPMAPQ
                     LAQAERSPSTFPSTATTVLYAADSAAAASRKVASSQQQRGAPLPPFNRTDSIMSNASV
                     EAEPRIAVPQPTVGSHIRSSRGQKQRRVHSPAGTPRVGAPATANANAADSQSSKAAAR
                     RAMPKSSQEPATLNQFALLHGVSVQVLCQWNPALAELDADAVIPATVTVYVPRLSLSP
                     GRARGQAGPGVTSEARRHRDPNDGALADMTNDTPHSRTARLPTPVARPNAKATAAAAA
                     SRAVSMPASPSHAVASPKLPAQASEPEKAKISTIITISKKDSTPAVVTSRWPPPLSVE
                     DVEKCRSFLTPPTVPSATVSAAAPAAELAPPVLPFPMTTSHSASKVLETPVAAGAKVP
                     RGAVSAAVAPAQPGAASTKPTAPFSSAKPTPTARSTREVLPQALQPDENTATVAPAGG
                     RVPPARTVYQLFKPQTTRVAEPREIEAVLAAHSVPRLHLDGVAFKAAAAADDGARGRA
                     VGEDHVDHENHKEAVEGSTMLLEWDLGLRLDNLTVVQVRRSSVAARANVQPGDTLRTM
                     NGQALLCRSDFEHAMAQQLQQHRKGSEERTLFVTAMTSRGIPTTYRLRIPTLRRDGAT
                     AQPDLPLQHDLHHTSALAAQQQAQPPPRRLGPLSARMSSAARGTPQQQRGLQPATERS
                     ARVPVERAGPASARTPVSSLGAAARVSRVVPINTNAVLLCTMQPLDMVGTSSIDAGRA
                     ESLSGSAWRTDCDGSASSRTRAYVS"
     gene            <327440..>328159
                     /locus_tag="LMJF_18_0780"
                     /db_xref="GeneID:5651006"
     mRNA            <327440..>328159
                     /locus_tag="LMJF_18_0780"
                     /product="putative DNA-directed RNA polymerases II"
                     /transcript_id="XM_001682432.1"
                     /db_xref="GeneID:5651006"
     CDS             327440..328159
                     /locus_tag="LMJF_18_0780"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerases II"
                     /protein_id="XP_001682484.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651006"
                     /db_xref="GOA:Q4QDW4"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW4"
                     /translation="MPAIGQEKLEFHKCFRILQTSAEMMSDRKYKVAQHVVPGSLGEF
                     IERYVEEVEVTEDGGAAVGGGPTDALPRRKQVIRRDKMTLACEREVGEGNTLKAVVYF
                     CPPNHLSSEVVKKIAEDALNEGYQRIVFVTPSKPNPIVRKTMDTYNRSEQDLRFELFE
                     EDELSVNITHHELVPKHTPLSEEELRDVLHAHALELNQLPRILSTDPVARYYGLRRGQ
                     VVRIERKSMSAGLYVTYRQVV"
     gene            <328835..>329863
                     /locus_tag="LMJF_18_0790"
                     /db_xref="GeneID:5651007"
     mRNA            <328835..>329863
                     /locus_tag="LMJF_18_0790"
                     /product="putative DNA-directed RNA polymerase II"
                     /transcript_id="XM_001682433.1"
                     /db_xref="GeneID:5651007"
     CDS             328835..329863
                     /locus_tag="LMJF_18_0790"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase II"
                     /protein_id="XP_001682485.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651007"
                     /db_xref="GOA:Q4QDW3"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW3"
                     /translation="MSSIEELKVVRLFRALNTMIQLCHDRGYVIRHPSAIAEAVQNPE
                     LYNNEEGLDHDWFLRHFVISPDRAARSIRAKQRGDGSSRSGPRREAKNEEDGGDADKP
                     GEYDVAADEDEALRRAANGEWVCMRNAMRLTCSVDPRRATLASSVLTGAPTNKAPSSA
                     PAVTAEPKDDDGDVPYAVAAAAVDAKSKEKAAKNALMVFFSGSPKLSMKEVHSFREKA
                     LKKKASSMIVVTNKIDPGVRMDVQELSGRMDEATGAELLSIQVFEEEALAFNVVRHET
                     VPRHVALTPAEAEAFLAERKLNVAQLPRMQESDPLVQYLGLQRGSIVHITREGKQSGP
                     YSMYRHVI"
     gene            <330714..>331649
                     /locus_tag="LMJF_18_0800"
                     /db_xref="GeneID:5651008"
     mRNA            <330714..>331649
                     /locus_tag="LMJF_18_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682434.1"
                     /db_xref="GeneID:5651008"
     CDS             330714..331649
                     /locus_tag="LMJF_18_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682486.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651008"
                     /db_xref="GOA:Q4QDW2"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW2"
                     /translation="MLLRRATRLARVYGGGATTAFVPGSSSSSSSSSSTASVGADYLR
                     GRSIGAKALLGRRARQGSLFAVANDVTVSEKRVRQQLNALLADERDPLAEARRQSSAA
                     EGFASSARPFPQRPLVNLPGVERVRDLPADPITRLFFQHQGDHALYYGTYDEPSRLDE
                     DRVQLEKREPKDWTFNVFTPVYDFCHRLREASEQRKRFVIVPSTIETRGCAKVLLDHG
                     LVAGFRDFRNDRAFAVELKYFQNEPTINIIEPCSYDGKTEFEWSPKMMRRLMNAHGIH
                     NRLIIYICRTADNRIIDHIQAVKECIGGRGLMMAH"
     gene            <333077..>334324
                     /locus_tag="LMJF_18_0810"
                     /db_xref="GeneID:5651009"
     mRNA            <333077..>334324
                     /locus_tag="LMJF_18_0810"
                     /product="putative ethanolamine phosphotransferase"
                     /transcript_id="XM_001682435.1"
                     /db_xref="GeneID:5651009"
     CDS             333077..334324
                     /locus_tag="LMJF_18_0810"
                     /EC_number="2.7.8.1"
                     /codon_start=1
                     /product="putative ethanolamine phosphotransferase"
                     /protein_id="XP_001682487.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651009"
                     /db_xref="GOA:Q4QDW1"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW1"
                     /translation="MCEEAMQSWISPAAPPGTPSLSADPSIMAEYLFFPFYDYVVQFY
                     PQSWVPNKVTLVGIFSTISASVLLLSSMPAGLQFQSGRMQLLPASLVEDAAMLQMPPL
                     SPTQMTPILSFISPNLMLILCGSLNVLYCVADNTDGRLARRDKKTSVIGEYLDHGLDC
                     VTSLLSTCCVFALVGSLCNMVTSVCLIAFVTVLCHTLHFEKNIFIWGNRIATVDEAMI
                     LFGVSMWLPLICPTVSTATVPGWILESIFGPNSSWTAYLRRLRMIELLYVFCSVAQTH
                     TIFSMARRCWSMLCRIHVIFSVLNSVLLVLLIGVHSEHIAAAAPATSVPGYTLGPFTY
                     PALWIITTACTSSTIIHIPIVARCARLPTTDPLPLAGVMLVWFAFVSCPVAGAILAVV
                     LHVGQLLLNVDFIQRHARRKGAE"
     gene            <335591..>343564
                     /locus_tag="LMJF_18_0820"
                     /db_xref="GeneID:5651010"
     mRNA            <335591..>343564
                     /locus_tag="LMJF_18_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682436.1"
                     /db_xref="GeneID:5651010"
     CDS             335591..343564
                     /locus_tag="LMJF_18_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682488.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651010"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:Q4QDW0"
                     /translation="MELAQVVHALQRAATVPLAVEVLLQYNNPLSEKEATQLRKFRHL
                     QREQLEGGLKVEEPSEEIVELSHRPGKGFHPLQVVQCVLSAMRLPCVRPDQQRRLRKE
                     VLPRVSATTPLSFVEWCTAVQVALHTCLQCFDNSPAALLCVEEVLRLAAPVLLHTPPP
                     PPLFADTVQRASWRKSSAAQQQLRKDTTVPRLKQYTDDEGLQLFLRALAALVQRRAAL
                     HARKKKHTLKQHPTNDEAFFTYAPIRHLRQLMQKNASHNMDAVCKAVKSLAPAEMIAL
                     TPVLQGGAMQLSLTKDQLSSAVKAQPLVAYHVLGARRPVAGTLKLENIDVVLQFVLYT
                     MGLASTPRDALLDYVAVLASAPTADVAAYMKAKGKDTLTQWITPFIVNADTLLPDVER
                     VSPVYARLMQQLCAAAPEMLTVLQQTIVYAVGTRCRTPREKEVAMRLLCDMLEALPSE
                     VRAQLEPMADVVSTLSREVAMPAVESAAQAFRLTSALRLEAAMEDGLMSALKNSRKEA
                     AIRRAMLVHLDVHRTPAAVVDGLLTELKDCEEVVVVRPDAYLALPFALARGDVATIAK
                     VHPLLSTAEVLRQLDGNVYEQTRAAQVAMELANSGYGVSLIQLLTSCHGLVRRPLLEY
                     VKSVASDASRATSLWSCLTQHVFGLESAGSPPMIVGQTAAPALVAVGTALLQHTSRLS
                     LSSALSELLLCAGHDNAQFADPYFYKASSCLLRRYRRAVLERPLRQTLACGEGHERLL
                     SQQAKAIVRHLIEAMNKGVEHQSIAACRALVLLLTQTSAAASRDVFGAIAEAVQASKE
                     WFMALSAEDAAIAAEDIEFMDAYETFTLREQQLLKVYPDRPPKGMSEDDFIDMKKRDA
                     AALAQGREALRAAVEKRSCVMMPAIHQHKSVYLALRLLGTHGHFDLEALPILYEPLQA
                     TVTELHAQGKATHVLAVLATDALTGLLTHTPFRYLAENMVRMVARLTPLKTLAVEDVS
                     QVSAMAHALRQSLTQMLPAPLFVVLMAFARIAFKAGRGANAVSTTIPVATQHQVLGML
                     MQNLGQANLPDPTAAMELLTSILQSFPSLYKSVQQGFYTLMSMVPGERLAAVEAGLFN
                     TVDSVRDVTAAAFSRFAHFDTCRRALVLAATLADDPASNVSKHARRIMEDAVVKYNFV
                     LQPSNWDDLVYFLRTYGGRNEASALRVTETMHQLFVRRPTTDEGTQLKWVEDLKALGG
                     APSVVSLEGLSSTYLGRVPAVVMDYFCQLLENPQTGEALLRQTLKAGRTVLVAADLAL
                     LKSISPQLQTRLAKPPKDVTQAHKEQYLATATVWLSIVSCRLQETALLETIIDQQSRT
                     LNNSQSAMVHRCVCESMAEISRNTHIRDSPKLDEFVEKCLKQAIHSGSYIKKKAHAWG
                     LVGVIKGLGLTALRRYNVMGILRKSAQEKHVERSGVMVLLEVLCSEMSPLFEPYALSM
                     ATELLEAVADADPNISECADDAAKELMAKLSGVGLRQLIPRLVEGLASDSAKKRVPPL
                     NFIGYVAFCSPKQLAAALPEIMKHIRCCLFDVNNAVSVAASNALRRVAGVVSNPEIQE
                     HVELILKAMRSPSTETESALDALLYTRFVNMVDPASLALIVPVLSRGLGVQVARTRPK
                     AAQIVAAMVSLVSDPRALLPYTEELVRLLEEASQDPSTEARTTAAKAIAALASAIGGN
                     LIDEICQWAFSVLQRVQSGTIEKAGAAQVFVEVVNACGAELLKLYFPKIQTGMTDERP
                     PVREGFLYLMVYAPSTLQTETFQDFLPISLPWVLEGLSHFSDRVRDVALAAGDSVVSL
                     YGTRNLELVLGPLLDGVSSEVTTLRQSSLQLAAKLMLHLVAHVRKKMRMQVAMADADA
                     ETRADLASAMDATMMGNEGNVAAVAGEGGEDGAILTMEAARDVEKRGVSILGSLEEML
                     GTDNLVRMLSAIFCGRHEHSANVRTDANMAWQACVASIRAAVNKIFDGLALLLVRFAS
                     SENPDCVEVAEKTIEFTIRMNETIERFVDAFCNMYKSGNRRVKLGSLVCLGTVVQFAD
                     PRRLVSMGGHIVGCVLPGMQEHDAVQEAAREVFARVSKLLGPRLIESAVEAQLTTSVR
                     GVVEVVKVKPAVALALVFKHLSSLETHTNQNVELLDAILDVEEAQEEMRRYHNDMVRL
                     LLQFCVEALDDAQELMNKYVMFAPREFEMIPVEAFTKAMNVPGRRHGALMAATAYGLG
                     TDLDNVDGITSVFRALIDALGDDTEATRSFAVRAIPELINALEERVLDTLEDEERDDI
                     MTSKRAAARYLLQFLHPFQTTLVATARAFISSSTPEFTVLGEGEPRLFDVLMTFYNRG
                     LDYGTPQQKVEAVECIQDLMRFAPRAISAAAANTVAGRCSKVLFTRNEGSVVLALVRL
                     CLQLMNYPASGKEKMVEGTMALAMFNAALCDSGEARVLALHVAIQLLARSEKYADLIL
                     GTVVTKKTAVDSTLLRTVMCRFISVVLRYAKFTKKFPHILKLLDLVRPMWEAPESPGL
                     AAAAGVAVGALCMSESVPEDVVGDIKERALSCTMTKGTQVLAGYALVYSLVKCAPQRT
                     DQAFLSASAEHLRSAASFGAADKLTSLWMLRAAAAVASTGCVPAATFKVEAFVPVLRR
                     VNQADEQLMSSAQYFRECVTAAYPAAASALEGMPGEYSTQWNSIGAFDADLDDEVDAD
                     VTL"
     gene            <344117..>346945
                     /locus_tag="LMJF_18_0830"
                     /db_xref="GeneID:5651011"
     mRNA            <344117..>346945
                     /locus_tag="LMJF_18_0830"
                     /product="periodic tryptophan protein 2-like protein"
                     /transcript_id="XM_001682437.1"
                     /db_xref="GeneID:5651011"
     CDS             344117..346945
                     /locus_tag="LMJF_18_0830"
                     /codon_start=1
                     /product="periodic tryptophan protein 2-like protein"
                     /protein_id="XP_001682489.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651011"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV9"
                     /translation="MQTVFQLAAVHGMLYTGGNVVFSPDGTQLYSPVHNYLSSIQLQQ
                     AGHLSLMCSNSSISCFDLSPDGDLAFVAGQRGLGFFYSISARVVLDTLSFPPNCSTSC
                     VRFSPCGKYVAVALESTLQVYTAPAKRVVSFHGCHRIEQLHAVLTRPITNLDWTADSE
                     HILVCGQDARMKIVPRQGKLQQKGMALQQNSLVGHRSAVLGAWFTNEDNSEVVSVAAD
                     NVVVTWHRAAVTRREMLQAIATAKLEARLGEQEDSDNAEGCDVEDEDSPSPKSFLERK
                     RLEQLRLDGVRVSAADDTYLPSILRYAFEIKDKFMLSHKGSVSVTAFHKPRGLLAIGY
                     SSGTFAIHALPETKGGELTLVHLLSISAQALTAAAFAPRGDWVAFGSAHLKQLLVWDW
                     KAEAYVLKEQAHYYDIACAAITADSTNIISGGEEGKVKVWKVASGQCFATFTEHTGPI
                     SGISTSASTNAVFTSSLDGTARGYDLMRYRQFRVFSPPEQTQLSCIAVDPSGEVLAVG
                     SSQVNKIFLFAVQTGRIIDVLQGHEAPIACVAFHPSGTTLTSGGMDHNLIFWDLFNQN
                     DSGERLKGDSEVLDIGTEVLCVTYSSSGRRLAVLTAKQEISVYETTIANDPQLIKTFL
                     TTFDAAGGWRKEVGPNSANYNTHFTRISFSPEGEKLIAGGDSKWLVLYHATQGYVLKK
                     WPITHNLDVQGAEEQYQWRNASEAGFLGDIDVDEDDMHLSRRKLLEMPGSRHRHFATG
                     KRKTELTARAMDVAFAATGSEFIAATTDGLLLFSTRVARPRFQPLQLNLRVTTEEVRR
                     QLANGQPVLALIGALNLGDATLGVECLRRMPRNSIPVAVTAVPSSLFPQLMQWVSEEV
                     EHCRGLEHALLWAQSLLLHSNEAFGGVGAQQASRALPVLKTLQRSLFQHRLLTEISRE
                     NYFSVKYLADAARMNSSKLEPVAEDATE"
     gene            <348339..>354494
                     /locus_tag="LMJF_18_0840"
                     /db_xref="GeneID:5651012"
     mRNA            <348339..>354494
                     /locus_tag="LMJF_18_0840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682438.1"
                     /db_xref="GeneID:5651012"
     CDS             348339..354494
                     /locus_tag="LMJF_18_0840"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682490.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651012"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV8"
                     /translation="MSHPAFSSGQPPGMIGSAGGTGSALLPNITAELRGEFYPLLSTL
                     ASCESGISATYVMELFFTLVRLDAVLKAKERHLFVSTAQQLITRLLQQLQRVHHMRQL
                     IDENERFVGELVERCTALERLCSDRDGDGECHTNNGEDADDMDVSGQALPTPQVEDDV
                     VDGHGDGEETVYSVATTRAAGTAATHLRTSPPAAHAGGTIVGPELRRFSFDNSLDEVA
                     NRAWTVQQSRQQQQLRDRPGGSVRSTSAETTEGGGTTASPSTSSSLHQWLLQRPPPLQ
                     RQSSGPPTASRRQQAGHAHSGATTPRVHGIITSPEQATGKTFDEDGARVETTSGSFAG
                     AATPTDVTPAVYMGVQLALQGHFRNNVRHTLTGSTLAAPRNLKELVQQQQPLPRGITA
                     RPSSHSCERVSTDGGVAEADVDLALQQQSLTLNPSLVSSPGVAQQPFLSSYTVNTLNA
                     NTSIFSLAGAPSAASTNNALGTDTGGSLGLKMDSGFSALYSPTTQDPVDTARVWDRTF
                     WRFLGGLTATGDLAVLLTLLNTENSAQTQGAAALTAVTSGVSAGYKGSFGTGRGGAST
                     KSGMTSNAAAATDAAGVSGKSLAASPHTPKCGVHLLMEALKRSGTYSHLLPAESTFQG
                     LSHSIASGAGAAGGARVADETASGRVATKGEREMLDDEVEQQQHAHGTPLSPEAQNPA
                     PAGSVWSTGSRMNNNGCTVLLSLDDFAREEEVRLHRDFWTHIPTILATLTEGVMYSGS
                     HGAAHPHKGSGSAPCEAGTGRGEVASLRDHHGSSGCWNSAPHHGSTNESGRGDEALQD
                     LAASAGVAASAAVDGEDESALAALHLPSVEALQLLPTFCPFLHNYTGAVARLIRSAPE
                     YARSTQAQHARALAVVAAAASQQQQQQQAALSPNSNDATGIGGECPGEFEHSVTASTS
                     SASVPLSNVRVGLTRTAAQRFSAAHMQELKDSHASLSGSDRRPGGAAAAVTGCTSNAN
                     SPAPAEIVEHGLLAAGSRTEVRAVDVVVHALVNAIYVQCVMAVAMQQQARAKATGYAM
                     AVRAPTAVAAAAGAATADGKTTLFEDGRTPGVGSSSHGNGPCARGSSGGSSAAEGGLG
                     TRSGSNNAIMVTDEGRVLDKSTANVSLNYAGVGELSGSKNGSPSGGLRDSGSGGGYSL
                     NASFGMSPNTFHSSLHTPHPMAMRAGGGGGGVGGAIGCMSNGSYHDPRSHHLPQALAH
                     HQQPQQPSQLLHNFSFDTTCSPTDAALSLLRMAREGKSNGNGAGEGEGRLDSAGSDGS
                     AAANLGLQPSLGLPTPCTNLHSIELATQDIVACANDFSWVSLPCIMKAELQHLQEQLR
                     GTSCAAQRMEGQVRGELALLIFRLLSIVLDWLMPAVYVADPRVWLFYRKWCCDLYRVL
                     CTDAALLEEFHSLLNQSDLAASSTAADVSGLPSGRRGPTKDVQGVSRAKARSVARAPT
                     FGPLRDPPSSPGSEMVQPQPQARLHLPGTPAAVSTAAADNSDYHDASAGFVALEGAAA
                     STGGAARHRSALCASPLTDNASAATSASIEDAFSFILPGSSLAVSVSHEMPPMQPGVL
                     NLLAQEEADRRGEALADMASLRAAQALLNDEGTVVPLPCPFLITRLVAATLRGIDADI
                     AESLLWVAGQTPASDSAVGAGVGSGVEDAAGGMLVDARRGRSVKSGMPQSQRVAAVGA
                     RGLLEDGEHRGTGGGGHARYAEEDEEEIALPGRHPSHAAHRTASGHRLPSHHQSRCVR
                     HHRSISADARVGGSASSAAASYYTVDSEEDDAGYGDHWYGVLARRERSQLAPSPLPGP
                     ATANGSGRGPAAGTASASSVLPHATTRNPFSDLASTGGPQRLSLQPQPSDGPTLVHHH
                     RFRYPSVHGYADVAKLYLSTLDDAELVLSSHDPVYASLVLSTADLHLHDLRDTAMAAS
                     LVSAYLVDVGEEHIQGPVWEELPAVVISDEGDGVAASPLNVAGDGAASSSTVRPAPGR
                     GFSVTRARQGNTQGPTSTTAAPSAAGVAAVTAAAASSQSAPLPPQQQQPYVPMVIPSW
                     NNEQEKEEFLATLQLLRQMQAFLAVEQTTLQHDVL"
     gene            <356125..>364731
                     /locus_tag="LMJF_18_0850"
                     /db_xref="GeneID:5651013"
     mRNA            <356125..>364731
                     /locus_tag="LMJF_18_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682439.1"
                     /db_xref="GeneID:5651013"
     CDS             356125..364731
                     /locus_tag="LMJF_18_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682491.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651013"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV7"
                     /translation="MRRTDLPSAPQSTGSGTAVVQSDDTVAAVFPDDPATAAAPVTPA
                     AAAAAADMPVVSPSSSILYTLLQDLGLTATAQALCEELQRQQSRAVTLSPPSAPSLPS
                     QASEVFVALSHGNGATSPNSLGASLLPPHTADVSPTLKTQAPASASVEPLPATVAMSS
                     TATAAQHANRVAASSNRTPDVSVELQRKAQSYCHVSQCTQAIASLAACAAEPLLGLSP
                     ALPSSHPSASAATIATPLQLVDTLTTLWRAELRAALPHRAASGMAVAAGAQSHRDGVF
                     QVAALIAHAAWCELRITELVFMQELHLAHTSAAATVPSAAAQPLQEAQRELVEVSGQL
                     VTALQELRATCGAAIARQRGVSAPPSGASDASPTQVGVVIASSILSRLHSKSIGWLRN
                     AECVMAWVLRRHGAFEPSADTAQASSVQQQQQQRKRRCLEAHSTAASAERSPDPACNS
                     VASPILQPLQDIILGLSTATSAPAPSYQQCLDAEIARSAAAQAKSGVARQTEPTPAVV
                     ARDACGLFSSIRIPITVRVAMTVQRVKLLHTLVGALVYNGDDSILCTLVVFAADRIRP
                     WWTRQSAMLAQFLVQCAHQLSSILTSFLVQSPAGVQTTPPQRLRLLSAASETVVLSLR
                     EQLEALAKEVLLCACPVTSHATPVPQDSGLTLFVRLMNALQQAHDARTARLDRYVLKT
                     CTAAAANPAMSANSPFSVAADLVFRPLSSASSPTFGSDGSPITSPVWTVRVPSPPGLD
                     LRGAAEPPASSTLVHQSSITSDTSSTFDSMEAARNAAQVLQWKPHFIQLLATIATGRW
                     QAQHDAPPAPYPGSHYHRLRLRIKDALRHAQELLRLQPRLQVGARGVVYPPHPTVGSN
                     PDASVPLSVVEQMPRMLQLATLQDARVLQRRLERRLARETRYDGRNAAPTETSTSGGS
                     SGDAAVAPAASSTRRRGVTPPSVSQPRATGLKINVSRSEYRSATSALAAATSTALRRP
                     HIAAEAEEPVATHRLASGNEGRVATSASARPLEGQRATSVRGPGASTSPTPEPAAVEE
                     ERESSPRLPGLSEVVTSGNETSSSSDEEAGSSASDVAGAAVATSPEPRWANDDEEQDE
                     EEDTEEGPQLGRWHLRDEEAQDELEEVDEEAAVVLDDDGDIDWAQSEGHNEEDEEEED
                     AEEVGSQASSADMDYDRAEDDMKEEVECVEATPDGRLLALLTARGRLMVLRLQAHDST
                     RHYEEEVLIDASLPNMPSREKRLQWYESLSSFVHFSPCHRFVLAAVQFAAVELKPNST
                     CAMARVQNEGAGQLSIYSLHREHDDGDEAGNDSRGDLEQEGQSSVPTPISDIRERLHH
                     LVGPATDRLYATFRPHDGPCLSARWVDTRWWGGGRRSRWANSAVEPLNSTNAAATVLM
                     QSIKTGEVAGKSVGVLPSAKGASSEQRAVPKSWRAAAGVLLSEYQCVSVGMDDLILRW
                     LPACGVVLQRVLTEPVQDIIVSPLMAAFYVASDRGDLYMYDAWDERNVTDGHPCSAGE
                     DADPCNMYSKSLSTVQTHRLVLPVTEEGHPRFHRVGRTLQHHQPYGYSSVSASPHSRP
                     SQQPQQQDRSLHHDTLDDSGIIDQVHSSRSSAHYTGPVTPVFQRVVDPSRGASGLHQH
                     APFYSLHPPYSGSTAAAQDGFDDDNGAQGDEASPSRLAGRSAQGSSQRRSDGQAKTGT
                     NSVGWTGLPRHLRWLLPHHWASHTPWDAQLGRRLIRNLLRQTHTATSTDTGELFYERD
                     EETAGVAAALAVAGAESDQPSLTDEQESPGGAHRGRRRGHLHRTSGDAEGGVHDTEEA
                     AYGSDGGQQEASSNDENSSRGSEEREYVYTAGADYDDDDDGARRPLPSHVIYGGGSSH
                     IASEATAAAAAAAKGTPVSVLECAAHPTPARGPLQRAYYPSGACLVYASVAKALCNAG
                     DLTDRQTQNEMGPGGPTHHLLSMAFSGEPQWMSEQRLWDREAEEAGAAQTWQRTPHRS
                     SAAADYDYGDAHDRSKLQQRDGDAGADSFNRPSAPLTLWSTAALARVLLWKDYFSSSH
                     HLAGPKAETWAVWESDVLATTYHADLLPPLHTRHAGSSREPRWSAAELLAARGYLGPR
                     DAWRRCAPASQRGLAATARNGRYLCIMASVGPYRKLVNPREPLRDMAGFYACVVFDVY
                     AGAVLRVIPVCPTELSGLRGRCMWTSERHESDPKAPIYRLPCSVTVVPLPASSAATAA
                     AGKGASQSSTARACVGASGSPTGLPSCSCLTAAPCDEGVVGDEEDGEPAEVVMLTVGG
                     LGSCVYVFDALSGRRLVCETEVARHCGESAAAAYEATARAAKARAKARGARSESVRSG
                     SIPVMPRVPATSAAAPTGPSAPPPLSTAFTSQILPASIRKPADVLASVAAWGRGTGFD
                     GITDRSSSTTSSPSPSPIRGIDGGMGEDNSIDVQPAHSSPEAQVAAATLAVSEAVAQT
                     GAPVPWLLQGTTFSQLSGWHLRGILWWVHEHPQPSTLYGGGAGVEQDASWNLGSASWG
                     EAGTRANGGGMNSNGSTRAAGAPSRGAAANGGASNNIAASSLSSASHISAASSVLSFF
                     YQTLLGASCMTGSGATPQHTDPYATSSQPHSRQQHVAGSSSLALSVAYPSYGSVWRQR
                     RRRLLERLLRHYDVGMLWQAYVTLFSASTTATSSLAPQSAVCALVQWALSTDKAATTA
                     AALLGPSDSHTRWIWCLTHDSRAGCKGPSAPSKQLRLSGNTGKCATTRSRDVEHVEVG
                     GGGASGGAGDRNTVPFAHILQQREDFMVELQALDTQQQQQQQATAGAVAAASPARSIA
                     NGHAKSLLSGVRAQAMAEGMLPATAKGRSAQQQQRSAAAARELSSSAAIKLPPSHHQN
                     QLRVDVVNCVASWFDANGGFYVCCGSEDGGLYIMGGHVVD"
     gene            <366269..>369040
                     /locus_tag="LMJF_18_0860"
                     /db_xref="GeneID:5651014"
     mRNA            <366269..>369040
                     /locus_tag="LMJF_18_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682440.1"
                     /db_xref="GeneID:5651014"
     CDS             366269..369040
                     /locus_tag="LMJF_18_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682492.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651014"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV6"
                     /translation="MLFGRDLCSLPTPHRPTHTQKKNTKTRTIHVSPALSHTRATMPQ
                     VSQPLPMAGDYLVTTFADMMHAPSFRKHVWAKMQQAERRRLEALRLQALYGDAPVTSA
                     APVGAADAVSGATTAGTVAVESKSTAQTSSQEASLSFAAPGSADGAADPTSRATAVKK
                     TPPASFSGRSSSTSRPPAPLRWFDIAGRARYSAWVALRGRMSADVAAECFCAEFLGFI
                     KKHPHPTLLPLVEAALSTAYGLARRSRATPPCLLVAPSSSTAAAHSTGAATAPSSSSS
                     SPTVVLQVRALQGDPAALALLWICRAYRLPCELIVEPLSKALGAHTAGAFTCASSTRG
                     VRHGEAADSRPTAPPTTNPYLSYTMADACYPFTVSLMQPTGAAAGASPPTVATTVTTP
                     EAAFVLLTDTFLADYPHWMGVPSDPVSAAALSPASRLVQRCAWLDELQHITRHVRTPI
                     LALLVHQAAQSQRLRRLSSSTAATERRRLLRAVAAHLHTYERWTMDRVLSRRVHQAQS
                     VLSPLLASTAVVDCLRHAYAPDTKVVSAADAYVSSCGYALCTHPFCADVFPFLRVPPV
                     PVAALHDTVQAQWPSPERPPGEALPRPLTSSATASYAPWALPLYLSGVSAEYNNTINR
                     LLRREANGAIRQEQHAQPVRLFINDESEVKVGRSRSASGGSGPSESVEVTTTDSPQQQ
                     QQQQQRPRRAGYYAISGSSITKEAAEAVEQLMLARMLSLRTDDLNPDSGVAGSTSSVS
                     GVPFLVLGHVFALTWALCQEQVPGFPYFMLDGNPHHYGGFSFLPEDAAKKPSTHGTAR
                     ARGQFQAALSPAPATAIMTTADHDASMLPTIDGRASAVSSASSQDGGVSLESRLRSGW
                     QAVAGALAVGAARLSRVRRSEAEPAGTGRGGKQSAGAHATQILRGEENCIGAAPSTTA
                     DAVVATSRL"
     gene            <369750..>371360
                     /locus_tag="LMJF_18_0870"
                     /db_xref="GeneID:5651015"
     mRNA            <369750..>371360
                     /locus_tag="LMJF_18_0870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682441.1"
                     /db_xref="GeneID:5651015"
     CDS             369750..371360
                     /locus_tag="LMJF_18_0870"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682493.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651015"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV5"
                     /translation="MQRPLSLVAKICGAVAVGFLAYRGVQLYFKNDITIYITEVAHLP
                     PAAVQRDRKPSPRSNANRSITIEGTVEMETCVMNSYRFLLKLAGHVRSSLFDAESALT
                     SPRSSRHRVLSLQASNAPSDDSFFTHLSSNYGLSASSNNHGSGGSQRHGPSLVLTAVD
                     PIVDVYEADATGALAFTPACVGDSVLCRFTCVASIGTAEGAGSTPVRSRGVPSSRSPP
                     PSMVNSTLPSGDTGLGNIVVRRCTFESDGETAYCQRLTVELELVRPVFGARVLIRLPS
                     RHCRLHHSHTGGVGSVTQLLHQPRKCVWDIGAVSEAMCTLSSDRTATSGTSEGVSEDD
                     LMPGAVIPTAPWSSAAKSLATLELVFERAPPALSFGEDDEEAEATDSDDDDNDNRFSS
                     TGNAGGGLTHSRRRQSVSSRSSSTRRALTAAASTTGRASKREERGRKASEKAARIREG
                     GSSTSMRAAGGEGVPAVELVFSVNQLLSGTSVKKLQVLEERPNWTPRSRLDRLLFRRV
                     VPGLEKLKLKKYAHYTTWFVQPVAVSQL"
     gene            <373113..>376175
                     /gene="CYP16"
                     /locus_tag="LMJF_18_0880"
                     /db_xref="GeneID:5651016"
     mRNA            <373113..>376175
                     /gene="CYP16"
                     /locus_tag="LMJF_18_0880"
                     /product="putative cyclosporin 16"
                     /transcript_id="XM_001682442.1"
                     /db_xref="GeneID:5651016"
     CDS             373113..376175
                     /gene="CYP16"
                     /locus_tag="LMJF_18_0880"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /product="putative cyclosporin 16"
                     /protein_id="XP_001682494.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651016"
                     /db_xref="GOA:Q4QDV4"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV4"
                     /translation="MCVHLDSLGALVATIDAAGVVRVWRKLPSGLFFITELDKIFLPA
                     RSAAAAGHERRTRHYWAHAYTTLQMLVFVCTEEEEVEVDHGNVRRTESNDNGSPSSAS
                     AAQAPLSTVRVHMRQVNPITLTVEERDSFTFQAPVQRVVSAAVTVADTAQCRNDDGAC
                     WTPRTSLAYNRRPAFLTHQYAPHIAFFVTLPPSPATPGATGGGNGVVLCPCFASAMSA
                     GSRPDHTAGAARSYVPTRLSVANAIVACAQQGWELERTGTSACVVVDSAGVVDYCTIE
                     AAAEAATTAVTFPSTASGRRTLKVMAGLAAVPPTSREARMWRRWICFDRRQRTGFFSL
                     VRDAQQALKARKEDENETAAGKAAGAVAAADVQVLPAAVQLTPDGRHVLVWSFRFLRV
                     AAVSSQPASRIPSTERRYDVTVESCIHLLDFTTGVCIGRHTEPLGVFATSEDIVFGAT
                     AWADYVQLRSRALALRLHVEPSAAANNQFYVLVPELPLEQLLGAAAVSREAAEVAPAE
                     VAGRVVHVYEVTLEAAAASSPSTAQSSATVRRLSHEPGEWEAIVRRGAEHPRHASHHN
                     VGDVRKDRCWSGLATSQPTWGVLRLLSPNEYALTVKEENHTRDEAHGCVTATAGVHPG
                     LAVCRAPLMLLRRAVTASQDLKNLVSASPVGAALGADARKHLFATPRAHDTASGAASG
                     EVLLLSSSTDVSAAALLVYSSELPWGSAALGRVLSEAVPPQTEEELTEEGQRLQEQLR
                     QKSFVDALRELHRGRDDACGTLLLAAVAPQSSSAAAAPGGAGEAASTSPSATADVAGS
                     TSGGGVQPGKTTEAAATTSVRVDAARRAAPVTNEEAAVCALLKDLTPPLSASLPPVAL
                     VHVRGYGSIRVHLLPSIAPLATDNFVRLARRHYYDRLTFHRVIPAAIVQGGCPRGDGT
                     GGESAFADGAPFSDEGLTLFPFFSHTANPLCCWLCMANAGPNTNGSQFFFTVPGGEAM
                     PWLDGHHTVFGYAVEGLDVVRAMSIAARDDEDKPLSPIIIERVDVLSA"
     gene            <376760..>377431
                     /gene="RAB7"
                     /locus_tag="LMJF_18_0890"
                     /db_xref="GeneID:5651017"
     mRNA            <376760..>377431
                     /gene="RAB7"
                     /locus_tag="LMJF_18_0890"
                     /product="putative rab7 GTP binding protein"
                     /transcript_id="XM_001682443.1"
                     /db_xref="GeneID:5651017"
     CDS             376760..377431
                     /gene="RAB7"
                     /locus_tag="LMJF_18_0890"
                     /codon_start=1
                     /product="putative rab7 GTP binding protein"
                     /protein_id="XP_001682495.1"
                     /db_xref="GeneID:5651017"
                     /db_xref="GOA:Q9N2P5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9N2P5"
                     /translation="MSMKRQLLKIIILGDSGVGKTSLMHQYVNRIFDNRYKATIGADF
                     LSKDVEVNGCVVTLQIWDTAGQERFQSLGSAFYRGADACILVFDVTQQESFAHVGSWL
                     EEFSIQAGRRDSVLVGNKTDLEDRRQVASKTVQAWCAKQNAEAANAINGACAGAGDSA
                     APEMKYFETSAKDNAGVEEAFIAVVQLALARKATVEEATPMPQTVNLSQAQHEQTPTS
                     SACSC"
     gene            <379853..>382477
                     /locus_tag="LMJF_18_0900"
                     /db_xref="GeneID:5651018"
     mRNA            <379853..>382477
                     /locus_tag="LMJF_18_0900"
                     /product="putative
                     dolichyl-P-Man:GDP-ManGlcNAc2-PP-dolichyl
                     beta-1,4-mannosyltransferase"
                     /transcript_id="XM_001682444.1"
                     /db_xref="GeneID:5651018"
     CDS             379853..382477
                     /locus_tag="LMJF_18_0900"
                     /EC_number="2.4.1.83"
                     /codon_start=1
                     /product="putative
                     dolichyl-P-Man:GDP-ManGlcNAc2-PP-dolichyl
                     beta-1,4-mannosyltransferase"
                     /protein_id="XP_001682496.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651018"
                     /db_xref="GOA:Q4QDV2"
                     /db_xref="InterPro:IPR026051"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV2"
                     /translation="MFQYEDLMWLISFPLVCAIMLWFSLDLAVLVRVGGGRRRRANAR
                     RAIERLIMSSPVLTTASVVPSPSPVSTPDTDRPSRRRSSSASPEHACMGGLGSSSGNE
                     EGHGVKHRAASAGAAGTPTAGTIPCHQQRVRQVVVPAALRIATRAVVRRAVVLVGGDF
                     ARSPRMQYHAASLARSSLFDEVLLVGLDYGNQLSEDLLMSGEPKPERFVSWDDPATPK
                     GMEHAVFDVQARLDSPDPGPGRGCIVSTQYLIAPPSPPEWLQTVFPLIHLHWVVCTLY
                     RIVTLTGLFFFQTMCATATRINEHGQLLVTDLILIQTPPAVPFVLLVKYLVCPLAFVY
                     NMLLYYGVVVPAAWMNPGAMRDVRQQCKLQSLHFTSATECSADGRQRALAILHGLAHA
                     SLSGKRRWVFYPAIVVDWHNFGYTILAQNQRPTAAVKVYQLLEMHMCAGHVNVTVSQA
                     MRRALEHAYPWLRCESAITAAAGVQPHCSASAAASASLQAEGAPSVAAVLPSAVTVLY
                     DVAPSFFRPVQRSRCVRDVLERLLRRRHRAVGPSPPLASASPLAKGTGNGAAYALVSK
                     ADLEEMGWGIAGPPAWVYADAAAESVAVSALPTPAAAPATMAAVLRRGIMVVGSTSWT
                     EDDDYSMLIQALQRLDHRLRHEVSYRSSNGEGSLSASSGPADLWVLITGKGDTRQRFE
                     DAVRVAKLSSHVVVSTYYAQSYQEYSLLLGAADVGLCLHFSSSGLDLPMKGVDMVGSG
                     LPIMAMQYPAIGELIGGVTRVLATQAMRLRNGAADAQGTPRVSSGYAKAVQPTLHECE
                     RGWSFSNDADLEFLLSSFIGLPSTSESVGDGASSLSRSPPTPLSVMKQRAYEARRHAH
                     TWEQNWRRVLLPVLKQVV"
     gene            <383603..>386923
                     /locus_tag="LMJF_18_0910"
                     /db_xref="GeneID:5651019"
     mRNA            <383603..>386923
                     /locus_tag="LMJF_18_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682445.1"
                     /db_xref="GeneID:5651019"
     CDS             383603..386923
                     /locus_tag="LMJF_18_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682497.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651019"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV1"
                     /translation="MSAATRCVAAAAALPYFLTEPLRCPHLLSIAVALQGRCGGRHGA
                     LLHQRCLLSSRASATPLIFSSTHTQRDWNPAENAAAAAQASAGSARAAPGTPVSAKAT
                     RRNVDRSRDTAARQNAATPPSSPEAVHPYSVRAYRARLLGGTYFSLRELTRAAYAPSP
                     LKVLTDLLQLSVGHSRRHAEASSSLAFAASSPAAPTPPAQSGSQNALSRARDVQHVLQ
                     LALTEAQDTVLAAQTIGDVASHAALEELLAQLEALANAMDACVQAPAWTMSVATHSAL
                     LHGLLRLAAATGSRLHALTALDDLLSLQERQLHRISARRGSDQHHAGDGDKDGDGDED
                     DGSFSMDDAVALVDAAAQQYIEPVTAQDHLWAMQACAKDQKRDFATALSLYRRFVQHA
                     EAGRFAATPNDFSDALVALAHSSRTTTDFTELRALLIESEAAAVVPVSVPLYTAIIDA
                     ASRAVEEPQRMVIALFMYRRLRDGGLTPTADTYAALIACCTSTREPTHAFAFYHEARQ
                     VCGVAHFTPQVYTNLLLSYVSAGYGADARKTLDVLVEAGAPLSRASFHAVLAGAVTAR
                     EAQEVVELMTERYHIAPTPHTYAYVAQAVARSPAGVSTALQLFDIHEDAMRALAPMAD
                     ATVRSPGRDDGGVAQIAVGQAMSTSADGVALEPILLERYPLYVRAMEQALMRLRVDLG
                     MDGRLRPYLMPLIRIAQQRMNAFTGMPPQSPTHVPDKERLCIAVLAADVLAKVDEWVL
                     PFISHYSVLVIPYSALVSLQRGGGRRVDGVMPKGVQAGRHDAVWQETAGGQEFDAVVE
                     HRRRRLARFLEQYKDVIHLVSLEEELRWSRETRRYGVGVTDLFARAAVTALHLARHSS
                     CRNGGTVYAQHANASIVLVSANYNGCGKYVVTLRQAYAGRTKGSAAGVGSAESAAGLR
                     AALSRVSYHNPRTNPSWTPPTLAIAQQEEGETKKEGDGRKHAPVHSAGATSETRIRGE
                     AKMREGSAARDATASAGRAPGCDDDGCGSAWYASAHDADAAGLLYRQALQLASARECR
                     GAPSGSSAKNSSSSDGVEWSVAMDEEEATPQLPSSQQAPTASTSSALPPLPLPAPPTS
                     ADADDKLDAFLLMSLLND"
     gene            <387666..>389555
                     /gene="ARPC1"
                     /locus_tag="LMJF_18_0920"
                     /db_xref="GeneID:5651020"
     mRNA            <387666..>389555
                     /gene="ARPC1"
                     /locus_tag="LMJF_18_0920"
                     /product="putative ARP2/3 complex subunit"
                     /transcript_id="XM_001682446.1"
                     /db_xref="GeneID:5651020"
     CDS             387666..389555
                     /gene="ARPC1"
                     /locus_tag="LMJF_18_0920"
                     /codon_start=1
                     /product="putative ARP2/3 complex subunit"
                     /protein_id="XP_001682498.1"
                     /db_xref="GeneID:5651020"
                     /db_xref="GOA:Q4QDV0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017383"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QDV0"
                     /translation="MVSVCCVTCAASDSDSGAKAPQLVPASPPPPPLAALAFSHDGTR
                     AAYAVRRGKALPRYGEREDSCSIFIAKTDTPAHCASSTSSGPGAAVAPFAQWTVLQVL
                     TGSHDAPITALAWCQRTGALLSTSADRGACVWVPRAGAAAAAAAAASKEANSAADVGG
                     GSANSPATVAADVPFRAVPQLVILSTEVRLCPTCVAWSAEGAKLYIGTSGGTVAVGRY
                     DTRHKWWICRLLSDHRRTTLVDPSVETAAPSSTRACSVTALAAHPVDNTRLAVARLDG
                     TVQVLSTHIKSVDGALGSAGRGTSDRNVGATAKPFHHVYLSHLLPCWVHGVAWSPSGQ
                     QLAVVGHDSGLHTWDWGPVRSPSLGGECSSNDDCSGAGSDKCEAVRTVTWLRQLPLLR
                     CEFVSEDVLVAAGFEGRLYAFESTAASPKPGVQRQRTWKLVPEDAATQRVEGLAQLPR
                     RETAHVAANDREKTAAACGRHTLPLQRATTAAMGVVTHEGQQPPARIVGESQAAVDGA
                     LVAKSVRQVALDFFERGRAAVAADAVVATSARGRSSVAGTHSSTENNAADHATGAARQ
                     HVTEHPPHTSPISLLVRIPSGKKSAAAESMDATFVSAGHDSRVHLWRVRHTTLTRSKD
                     VPVSP"
     gene            <390090..>392717
                     /locus_tag="LMJF_18_0930"
                     /db_xref="GeneID:5651021"
     mRNA            <390090..>392717
                     /locus_tag="LMJF_18_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682447.1"
                     /db_xref="GeneID:5651021"
     CDS             390090..392717
                     /locus_tag="LMJF_18_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682499.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651021"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU9"
                     /translation="MSRYTVTENTNRSAACQPAAAGAGATATTSPSPEVYFKKQVLKL
                     GMDGTSLSRLVVVTDTHVYVCVPSGGITRAIAVRRIERVTLCSREDVGNDEDGDDYAG
                     WNAASGSAGGAGSDDPAMPSAKSFFASVFSPRGGIAGRASLQAPHHSHPDSGGGDAGG
                     ALAVRSAAVGKTGCEVPASVAAGRRMTIVTLGIAREAALALQFYSGVDGEDFVAALRK
                     ASHISTAALFNLPAEEGPIDPAGRLLPLSARCEDPVVPRVLKRGAGDTNMGNHKPDAE
                     SIRAVEEVQLSPPRSPRSPTAPPQPAAHRALPPHDRSGSGNSDGSRGRHPSSRKSVNT
                     AVPGQAAQQKVGDRAPPAPSPAVYAPAAEETRWHSPPQALSRLQKSTDSSPSAWRTPS
                     PLRTAPHRKVPAPPSPAPSQQLQLSAPPPLKTIRDPAIEGKGGGGSHNRGSSATESLR
                     DAASEPTRTTSQERLPRLIYATASSAMCEGVPSCPEAAAPVSPTKAEAVPRRSLFADE
                     LDATQVVDPTASSLSAAAPRTAFMATENGACDAPVHVGALQAELAAQSAAVARLQRSL
                     QAHESLLIELADARADVRGLHATLAERNEQCEEWRSACSQAEQRATMLRHQHERMLAE
                     QQERLRRAHHAELEAVQAAFEEYDARMSAFLEQLQQDHREEAVRWQRERRALLLQLHE
                     QQRQQQEMGDVEGHRRVRAAEVAARAHYEAQRRRAPAPQVYQRESPHAQRQRQSSAVV
                     ASVVHSPRDSGTSSWRRPLASSAECDLASAAWSRADVNSPSDSLLSQRPPPRQPPSHA
                     TSPFSAHQLMNGNPDVDEEVNHVHPAARHGTAALIRRPHSYFQTHLEAPPPYPWDCRV
                     PDAHDVGTGAYTLSRRSYV"
     gene            <393424..>397266
                     /locus_tag="LMJF_18_0940"
                     /db_xref="GeneID:5651022"
     mRNA            <393424..>397266
                     /locus_tag="LMJF_18_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682448.1"
                     /db_xref="GeneID:5651022"
     CDS             393424..397266
                     /locus_tag="LMJF_18_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682500.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651022"
                     /db_xref="InterPro:IPR005554"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU8"
                     /translation="MALQNYNLSWSDQLIERVETHLRDVHSALLQYYESRGYPTEVES
                     RHAVTAEAAAAAAAGARDEGDRTTVAATAAAVPLDVVSPVGSFLLRTCVYDTPFPNLH
                     AQRGVGADLVLSIPADRCTTADLKGGLYLERRQSFLDEIQAYLQQLVSSAAAGEDSDE
                     DDEEGRGASFRSRQRSKKATEEAEKRLRNVAAAARLSRMEVRVVPIHGCYALTDKQIL
                     QLRFRRRRAAADIHETFFINLHFRPSVFPGHTVNAAGIRKHPYYSYCILEDYLMPHHL
                     KKLHEVCIASAGVRRAIVVLKCWAHHTGLMSAASGHPEALNGFVIAAMVLRLLEEGIV
                     TAGMSLGNIVRAVWVQLSRDFFLGTPEKAGGRGARPAKVSAAEERGEVSVLRLTGELH
                     NILFRTSAAFFKNVVCSSAEEALQHPFAVDVVDHVAFQPLPLRYDVALTVQLNQATAS
                     SVAAMDRTPAVIKKSTVWRAPRAEAIQDTLRVLKEALGVRCSYITVWQTDADRLQVVV
                     QLTSEAEGRNRLTRGPPIEDATAVERFNAFWGAGVTSTRQFSDGAIYRCVLWTFPEDQ
                     GTHTTVALSASTVLRRVVEFALRAHIAPEATVTVLLGGLDGYLVERVGGEWRDVAPLM
                     QRSLLEATKAVQYMLQNLPHGSVPCRIVSFDVIAASERHAEVFPVRPHLALTYTTDDL
                     SDASFAGLSTAPTIEPIHCVLSIDDNHKIPDTMEAIAMMKGAIVAQLAKTLQAHYGEK
                     SNTGTRSQTARRKAAEGASSSSDIVRSPIRTQCTSQSVDIIYRGYLFRVYAAHYREVS
                     LLRALKRDTEANVLEMKLHWTAQHAKFMRTIAFGHHSYSHAVRLAKRWMSAMCLYEFV
                     QPEAVELLVAHAYLQPAPHTPKTPAGGFLRFVQLLAAHDWSTPLVLPFTDDDSDKTAV
                     AAAALVRKLGDQQGMFIATPYAPAASPFTALTPRPMIMGRLVQLAQSVVAVLLRHLEG
                     HNAAAGEVEAFTSSPCAFDFSMKFHPRLLLQPDRALSIGAAAPSVASAQSEAAHRNGI
                     VPASSEADALVAEEAAAAANAVIRIWQLDELDADTNGREYINQLVEREPAAHAVRIVR
                     AALRERGMMFYDALAPSSLYVVSVSAERQVTKSRQLHDAILQVGRGALLPAPPSAFNP
                     VAETAHDPAAAARIQSESEENLEDDHDCNHHHHRAPAQRRGKVPLPLRQAASDTKSKK
                     SKAFARQYPLQDHKRSRSDNDCCSPAAAGVAEAAHAKKAKKETADRASPFTAASPTTA
                     AAEGRSQKAFKVKKASKK"
     gene            <398323..>399417
                     /locus_tag="LMJF_18_0950"
                     /db_xref="GeneID:5651023"
     mRNA            <398323..>399417
                     /locus_tag="LMJF_18_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682449.1"
                     /db_xref="GeneID:5651023"
     CDS             398323..399417
                     /locus_tag="LMJF_18_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682501.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651023"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU7"
                     /translation="MMLSRSGRGSLVRCVAVAVRSFAATTSPFLCYSSSRRKRRVSSD
                     QHRDSLLCHTASTTAPAPAAVPTQRTRPRSVLKRTSLLEQLRDRNDGESGTAELSKVP
                     AGSALVASGTAASLAAPVRYPAAAVSLPYISSSEFVSVPRPKQQQQVWSSHGTHSTAA
                     AAPLSSPTASAQLERQQQALRDAFTHARQYHNVRLAKDPGVYRAECRAFRQAHRGRSP
                     TQQEVSRTVAVPLAPVAALKTLAHTDATRSSLHAATEAAVLLHSAVVKNELVKSSTPQ
                     LVRCLRCFHVYIARPRTLWGGEVEQSGIEYEKAQKAHRLQRPAPGKRARSVGRRRRAH
                     EEDPICCPKCRSPRAQWMMEYVHHHTHERV"
     gene            <400056..>402170
                     /gene="GPI18"
                     /locus_tag="LMJF_18_0960"
                     /db_xref="GeneID:5651024"
     mRNA            <400056..>402170
                     /gene="GPI18"
                     /locus_tag="LMJF_18_0960"
                     /product="putative mannosyltransferase-II"
                     /transcript_id="XM_001682450.1"
                     /db_xref="GeneID:5651024"
     CDS             400056..402170
                     /gene="GPI18"
                     /locus_tag="LMJF_18_0960"
                     /EC_number="2.4.1.232"
                     /codon_start=1
                     /product="putative mannosyltransferase-II"
                     /protein_id="XP_001682502.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651024"
                     /db_xref="GOA:Q4QDU6"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU6"
                     /translation="MRHRESLFVLTDFALYPTGMAVLRCSAVTAASRPLAFVLAPYTE
                     PSFNLLDYLGTCTDTALVLCVAVARLLLLCLMWFSRAVAPIALGAPGGAFVFDTGEEL
                     YDDARFSMVRNWDGVHMFFIAQCGYLYESQIVFFPGLPALIRGLEHVTRRLIPVLHRV
                     APVAFYVCLVNIAASCLAGVVLRRLTILTFLGPEAVRCTCRWRPSKLSPSTPELEKPR
                     KYAKAQLDVAAETTMQSTTEATVCYRLMCRMIGTVLEAPDIHAPLPAAVAEAKADALR
                     RRRVVGGAALVWIITPAMVFAVAVYTESLFSLATMLGVYFLAWHEPLPQAVQLRIASY
                     LASVTSPGSAARATEKASVPARLVPPAPLVQQWALATNDVGDGAAARSRIPGIASLLP
                     SFTHGAPRAITVKWEQRFLSSTEVAAVLLFTLAGTFRSNAFTYAGFLIFPICVQVALP
                     AVYRAQASAVLAGVSARAVMSAAAKRGGARDGRATVVVRCPTLRPPLQRMPHPLRMCI
                     VALECICVALPYIVMNYMGYRRFVLQLWDAAAKKTMGQAFWRLYPMLQKKYWGVSLFS
                     AYTFANFPNVVLALPVAVLTAWCLHAHYLAPAWANLRATTAAAAGARRMRWQHLWIAA
                     MPLLSSSNVAHLVGLSTLALTLMHVQVTNRFVTTSPALYWLLGMQLASRPTSRATKLT
                     LLWCILWGMAGGILFPNHLPWT"
     gene            <403541..>409702
                     /locus_tag="LMJF_18_0970"
                     /db_xref="GeneID:5651025"
     mRNA            <403541..>409702
                     /locus_tag="LMJF_18_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682451.1"
                     /db_xref="GeneID:5651025"
     CDS             403541..409702
                     /locus_tag="LMJF_18_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682503.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651025"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU5"
                     /translation="MKDEIRKQRVTLPSKRRRHVSVAFSTSKPTPTKSTRSHTSNLKR
                     GSTSTTDTFTPRTKSGSRKHPHSGSATLSGGEPAAQPQSVRRARGASVATTGAPEGIE
                     TVDVAPVTRYWSSDCRRIPSASRIGSTLMAAARGRSDRSFSSRSSTATSTHLPISAEN
                     LASNSCSVVSRRNEDPSPGSPRASSGPLPAASSTLASSVGGNVAQLCRTPVTAPTPAA
                     PLHAAFTTPHFNGHTRGSGSEPGGAGSKGPPPRHIGSPGSGNLDTDSSSSSFRPSQNP
                     TSAQAATQVPSPLPVIQQRGGEMRRRSSFAPESPAGASRGLDAPGVVSDADPAQPSPA
                     SGVSTTNFPLVDTRYMQPPPAPQPPLRALAAAASMPELDVPSVKSVSTACQPLPPPPL
                     VHQRRQPMPALEDSQRGAWTVKGSLAPAGSPLSFGARSPSLMSTSRPSSRSDRRSPRE
                     RSDGGHRAVVFWFATTEQEEGAAMTTPQREQQESGDSDFAPQSRQLLGQRDHSISNSM
                     CLISMASAATSMVGELPPPPPPPPAQLSIGRGIKTDGGTPPQQPPRVSVPTSQLLHQL
                     DGSESRVRAPSGVHGGAYVGNGSAGGSVLDASIASSRRSDSASSSWRESTGHIKLFLL
                     SPVKSPPGSLTSSILVPSAAMPGGSEDGAIVADAKGLPSYSDARHSGAASQAQPSHYP
                     SSATSLHSAVVNVQSMDSADGVEEEDTLGLRQAVAPPLLLPARFPASASVSASAATSS
                     SVKVDALDADIDEQADAEPIAVDGAAAAVGGPAQSSESSTPRPSPPPPSMAVKTTQGA
                     GKSDSDKDHTSKPSSGTASGKGKAQIVTTILQAPLLVSSEISAHARLSKAQALSPRQQ
                     ELAQSFRNRIQVGVRPPRRQRSAHLVTSASRDRRRSSSGGGSTKRRESSLRRTKGQSI
                     QQPVAALSFIAVAVVAVAYAKILRPVHAFRARRHFDEVIAPAAAYRIQCKWRRRLQLR
                     RVEQKTAVQLLVPWMRLRLQRLRRAKDASARLLQRVFRGEVVRSLHRYLYEQIKRNHA
                     LDVIRRYVQRWEAQNLYRRLRMQRDERAIVVSQCVQGSLQLFRAEQVEWNAIVQDGAE
                     TLQSRPCVSMQDWVEGVAALTGVVLDPRASNRIRSPEASPVVSTSAGSTPTAQLRECL
                     AAFARLEHQVFRSLGIKDDKMASNSDASAPSSTVLPLRPLQPTPAPEMRATKLIQGER
                     KGGSVAAHDDDDHSYTGASTADDGASDSPAPAGSLATEDDLVAAYLQLLCRTEAAERV
                     ALERRLLDEHQELLREPLLRCKAICYATAMRVPPLFSPLLLSMPCDSLLLQAARLFKA
                     EREARCEIIQLYESMPLACLRRPMLNPAAKARHSELVRLLNGVDDPWSDAERSERRFY
                     CETAAYKHLASSTSKLEGSNSLSYTPQPSSIPLGADDAPCSRLTGPSHVATRTNGGDS
                     VPPLRPLPRPTPYGTPSGPRVCMRVTPHIHYYAKSLVTASLPAHATLLLPPSNNSAAS
                     LAPEGDGAAATDKDDRHANSILASGHRWRSEAQCKTAIPSPHRRPRGPPLPLLRKLLQ
                     SPGRVRGGTSRPPFQRVPVAPTHLLENREGASGPWPPLLSTYPNTTHLWLVGIRRPST
                     EQEGRNAEVGTAGSSQRYTNDVSQDADAGVAPRLPSPAIAEQGRCTTTAHATSAAPAV
                     AAGHFLNRRGLRARGSVTMSSHSSGNVTENTAVSTHEKAVPLLCAGFVECIPTAQPVG
                     TPDPGFIPLTTTVGSTPKMRCSTAAPREPLAPSSMLQELPVCRRQQNDTPISARLGKD
                     TSGDAALLSTPTPDFSSASVASALPIFTTAASTAVEAANHRRAAWRSSDWNLSLLYMP
                     LSVRSEVRDGDGEAGGAEADVELHQGQQQPSTTSATSAAQAPTPLAACRVEAVDFPPT
                     PTLSSSASTVVKKRADGWNRTPLAPQRLRPPTPPPRQCHTTQSAAHMGEAPERSAVRS
                     IVAASPADGAGHPVSHNGPASATSLLSPHTHRPHHWAAVHSDGGKANAMDVKSSGSSS
                     SAANRAMTSTVEALLSPAAPIASAVAAEMQPLSLSQG"
     gene            <410673..>411245
                     /locus_tag="LMJF_18_0980"
                     /db_xref="GeneID:5651026"
     mRNA            <410673..>411245
                     /locus_tag="LMJF_18_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682452.2"
                     /db_xref="GeneID:5651026"
     CDS             410673..411245
                     /locus_tag="LMJF_18_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682504.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651026"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU4"
                     /translation="MVNRRIAKGRRLARKKRLKTAKKSSVDGSAARAGAGKTAGKRKT
                     AATRVRVVNGVSKKQQHCFGEIESLKQKSKLLKQQAAERMVLKEHLRDLEARKERTRR
                     GETAKAERRELAKYIRQLKHEQQVKHASELSNLEVELKRLIGERDNVRAARAAAGMNE
                     DDADWEDVGDADDDDVNEDELQRMFAHLTM"
     gene            <412668..>414152
                     /locus_tag="LMJF_18_0990"
                     /db_xref="GeneID:5651027"
     mRNA            <412668..>414152
                     /locus_tag="LMJF_18_0990"
                     /product="UDP-glucose pyrophosphorylase"
                     /transcript_id="XM_001682453.1"
                     /db_xref="GeneID:5651027"
     CDS             412668..414152
                     /locus_tag="LMJF_18_0990"
                     /EC_number="2.7.7.9"
                     /codon_start=1
                     /product="UDP-glucose pyrophosphorylase"
                     /protein_id="XP_001682505.1"
                     /db_xref="GeneID:5651027"
                     /db_xref="GOA:Q4QDU3"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="PDB:2OEF"
                     /db_xref="PDB:2OEG"
                     /db_xref="PDB:4J18"
                     /db_xref="PDB:4M28"
                     /db_xref="PDB:4M2A"
                     /db_xref="PDB:4M2B"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU3"
                     /translation="MENDMKSLSAAAQACVKKMRDAKVNEACIRTFIAQHVMVSKGET
                     GSIPDSAIMPVDSLDALDSLTIECDNAVLQSTVVLKLNGGLGTGMGLCDAKTLLEVKD
                     GKTFLDFTALQVQYLRQHCSEHLRFMLMDSFNTSASTKSFLKARYPWLYQVFDSEVEL
                     MQNQVPKILQDTLEPAAWAENPAYEWAPPGHGDIYTALYGSGKLQELVEQGYRYMFVS
                     NGDNLGATIDKRVLAYMEKEKIDFLMEVCRRTESDKKGGHLARQTVYVKGKDGQPDAE
                     KRVLLLRESAQCPKADMESFQDINKYSFFNTNNLWIRLPVLLETMQEHGGTLPLPVIR
                     NEKTVDSSNSASPKVYQLETAMGAAIAMFESASAIVVPRSRFAPVKTCADLLALRSDA
                     YVVTDDFRLVLDDRCHGHPPVVDLDSAHYKMMNGFEKLVQHGVPSLVECKRVTVKGLV
                     QFGAGNVLTGTVTIENTDSASAFVIPDGAKLNDTTASPQQSTNK"
     gene            <415030..>416373
                     /locus_tag="LMJF_18_1000"
                     /db_xref="GeneID:5651028"
     mRNA            <415030..>416373
                     /locus_tag="LMJF_18_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682454.1"
                     /db_xref="GeneID:5651028"
     CDS             415030..416373
                     /locus_tag="LMJF_18_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682506.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651028"
                     /db_xref="GOA:Q4QDU2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU2"
                     /translation="MTTLASSSPPQYADGVAAAEVSGAVSSAAALPASGSLSTNAVTR
                     NFSDLHAPTWFALLSANIGARTFLFHPIQLAISRKRVTRESTPPTVIGLVKASYRGGC
                     TSAYGATCTKGQYDFGKGGIRGCYRGVGAALLCNLLGETSYLFTLEAMKEYVEAASLK
                     RAEENIFATSSYSAAVGAMCGDLVALLLVSPLVIVCNRQMTAGYSMASTNSYMSVPQT
                     FRTVWRLYQKKEVAAGRAWPGERVRWGLSGVYQGLGAGLLRIPSSGCWWGIYTKSKEA
                     LYVVAAPKLAVWEQEYRDAAAAASDTKPVPLWRQNWLLSPTDNPLLNAVASIIASVCT
                     TLLFNPIAVIQTRQQALSPGLWEEQTMMAAGGGGATSSLSPTVRKQTWKSSLPFRRVY
                     RVADDLARKEGVRGFFKGSLANVSIAVLDGIFFTLLFEFTKLGSDMQFLEKLHTD"
     gene            <417663..>418001
                     /locus_tag="LMJF_18_1010"
                     /db_xref="GeneID:5651029"
     mRNA            <417663..>418001
                     /locus_tag="LMJF_18_1010"
                     /product="putative dynein light chain 2B, cytoplasmic"
                     /transcript_id="XM_001682455.1"
                     /db_xref="GeneID:5651029"
     CDS             417663..418001
                     /locus_tag="LMJF_18_1010"
                     /codon_start=1
                     /product="putative dynein light chain 2B, cytoplasmic"
                     /protein_id="XP_001682507.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651029"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU1"
                     /translation="MAAAGSGPDIEELVKRITSHHGVRGFLIINNEGIAIRHSFTEAS
                     RELAVQYAALFQPLAMSAKTVLQEIDSNNELQLIRLRSKKDEVIVAPDSKYMLIIIQD
                     ADMDKAESKK"
     gene            <420113..>424084
                     /locus_tag="LMJF_18_1020"
                     /db_xref="GeneID:5651030"
     mRNA            <420113..>424084
                     /locus_tag="LMJF_18_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682456.1"
                     /db_xref="GeneID:5651030"
     CDS             420113..424084
                     /locus_tag="LMJF_18_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682508.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651030"
                     /db_xref="UniProtKB/TrEMBL:Q4QDU0"
                     /translation="MSGSRGSGSSTSQQRRSSVLGPDPRDCIDLYDDGIVEEEARESP
                     LPYDQQKQATHALAYNLAALVNAGTVDRCLSDSRGQVDLIGNNVADHVTKNAVDTCDR
                     IGSARSADHSNDAGDDNASYEFEQEYFYCPTTSPETVDPGASGEGAASVLRRTETPRC
                     AVCDSSSSSSSTPRWVLSLAEETPFTPFVLSATGVATAPTPLLHVSPAIRATTTAVAA
                     ATEEQLKQGHLGTSTGAQQQIRIPTQRLSVHKLVAAVLSSTSSTCTGDASGTASPVLA
                     AAPTPMASAADEAEDISESRPEEPLPRRPPGCDEGTLVERERLRQRIRDTRARLTHVD
                     QLIARFDIVLAARQAELERLREKQAVIAQQAESYKSRAATTTREVRRLRERQHGQDEV
                     RLLCNMMADTKNRLHVAQSQLSSLRNLWKQLQLLHTAAAGTAEGDAEEGADHVRCATA
                     NGATGGGSAEGPREKESTSSSPASSVASLDTCNAISDFLEELLGEVEGLAKVCIQLPS
                     APPAAALSSCNSMRRIAIKHLSGAADQGLQRAQPSQSRPTYTTLNRSLNNGNNGFFSF
                     FGGATEAHLDSKPLSTFLANLDRLARTSWEREEELQLRARELATEAEEDSLKARLALE
                     YGVKPQQPQLPQHLSGSSGGAGERMGALFPLSPVALSSEREEEHLSNGGANGTPALTS
                     PIGLLTPPNDAVAASTDCATRQISLSSPEHGRRSRGSSIGPRTSNGIAPLPSSASSSL
                     LHHRVTPAPFLLPTLVYAYPRVAAVSQHLDAEQQQIQADYAAVIEAERQGRRQLTMQL
                     RDTYRQHVAPVLRRAIDALRRHQTSLVRQLAELGVKAVTIQWEEEEESEEVNDAALLR
                     AIDSATAAGQKPLRGIQRRRATSGRSRSRASVRVSAREKEEDSYGNAPDSQCTSLARS
                     EYGGLQSGAAATPPPCRVYRRTLRITCAATCKRGSIGREDAAAMPVSSPPLSGRHPHQ
                     TTMRQRPSSTRPSAGHGCLSARSACKRPSSASCPSETAAEPNITTPLADSLAGTASKA
                     CAALQLCTHSPTKALYPDRRNAHAAAEETQGCARAAAVSTAVTPIATLPFRRSGGTPR
                     VSGATAESAMTRASTAVGSRRNSRGCASAVMPPSPRQSCGCAASPTFSAASRQHRCNG
                     GPRPRAVSARFGRSAAPCSSSQRPVVEDVRELAAAADSAFSAATRVTMSTSTAANVWS
                     PFQPTGQALADGAVRVTLTFTGEEARRRQAAQARQEAHQRKFWGLREELARIDEDTFQ
                     LRTRYTELQSTQQSIEAEHRTKLAEAEAKMKKYRAFYESLRRENKEWQSIRGELERVI
                     RGE"
     gene            <429853..>432186
                     /locus_tag="LMJF_18_1030"
                     /db_xref="GeneID:5651031"
     mRNA            <429853..>432186
                     /locus_tag="LMJF_18_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682457.1"
                     /db_xref="GeneID:5651031"
     CDS             429853..432186
                     /locus_tag="LMJF_18_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682509.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651031"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT9"
                     /translation="MSAMICSLLVLGWIAADDSNVFVDDFTAGDAWLNPNSNQKKWQK
                     ALLQSAKLNLPVPNSVAMNQVFFVSCNRHDRSQLYWAYMAVAAQCEMLSWKNATAAPP
                     CRRLYAGVSPLLRTAGTAASSGGPHGHTTDTDEGNWQEEVPLGACGSVYDSPAAAEQR
                     QRYRRTSPPLLLLDETPPPLHRDADPGQCFRAAPRDTVYSTGVPLDALIWLGDIIYAD
                     KFPDGRDAQSLLFHHVNTMVSIGRFWRIQRDAPEYNAFIGSCVAGSDHPYWTLHSPGE
                     VFLPAAAGNRERIMQLTPSPSSGTHRNVWATWDDHDMGENDGGREYTGRNSTQRFFLS
                     FLRAPSSDPRWGREGVYGAYTTDFRDVVDDAKGWGTPMRLLMQQLYEHAICVVLLDVR
                     SFRDRPNATQAGDMLGAEQWAWFEELLQNYTTLTRDGRERCAMVLIGGGIQFILDEKP
                     AENWAAFPRSRDRLLGLLHAYRVERVAFITGDVHMGELGADFTKHGIEEVLGYPIVEA
                     TSSGLTHSANMYFLPTFMPLLFPSPRRLGLYVGTNFGALRLSLDLRHLPLIRSYLIEM
                     EATVAAARFQTPQWRRKVRTAVEQVVNATFTIFSIPKGGQPVYRLNFPLSMLTYAHGV
                     AYRDATVDAVNGNVHKKPTSSPVTPEKNGGSKAAKDDTERTPSSPLRALLVLKNGTIM
                     DIAHYRNTEPAPLITQSARQLQYYISTNFSVSETLKLIILLELSVWALVLLLLMTTLC
                     RCLRRPRNSCGRFHSSHVASSPQVSLVTRCSKKRVNN"
     gene            <434093..>438127
                     /locus_tag="LMJF_18_1040"
                     /db_xref="GeneID:5651032"
     mRNA            <434093..>438127
                     /locus_tag="LMJF_18_1040"
                     /product="putative 5-oxoprolinase"
                     /transcript_id="XM_001682458.1"
                     /db_xref="GeneID:5651032"
     CDS             434093..438127
                     /locus_tag="LMJF_18_1040"
                     /EC_number="3.5.2.9"
                     /codon_start=1
                     /product="putative 5-oxoprolinase"
                     /protein_id="XP_001682510.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651032"
                     /db_xref="GOA:Q4QDT8"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT8"
                     /translation="MSTTVAAAEKLYPSFRFAIDRGGTFTDIIAHVTHADGTVTQEVT
                     KLLSVDPQHYADAPSEGIRRILRKHLPEKVAATGLVDVSHLDEVRMGTTIATNALLEH
                     NGERCAMVLTEGFEDILTIRDQARPYLFALNIVKAQALPEQVIAAKERIRPVSDKEQA
                     AYASQAGWPSTWVRCGESFVMDVLQPLHTGDIRQKLQVAYDAGIRSVAVCLLHSYAYA
                     VHEQQVKHIAQEVGFPSVSLSSELMALIKYVPRSITASVDAYLTPLILNYIASFKANF
                     AHNLAGVRLYFIQSDGGLTSSDTFYGYRAVLSGPAGGVVGYAHTCAEDLGATVQAVGF
                     DMGGTSTDVSRCEGPVVHHTVEAEIAGTPVQAPQVQVQTVAAGGGSLLRWENGMFHVG
                     PASAGAHPGPACYGKGGPLTVTDANLVLGHLHPDYFPKVFGPNADQPLDKKASVKLFK
                     ALAAEIARDCSSGSCESAGPVMSVEELAFAFVLVANEAMCRPIRNITEASGYRCAEHT
                     LAVFGGAGGQHACAMARSLGMNKIYVHRLASILSAVGASVTDVVEERMASVRLDLRTE
                     GLAPVVEQQFDELIGSVAAQLRRLGFDDNHIVIERFLSMQYEGTNTSLMIAEGDDQAV
                     PASTVFSAETFERLYLARYQQQYGFMLSGAHRIIIDGVRIRARGMLQSRSEREAQAAS
                     AATATQKQLQQPPYTTRAEKVPPQPVSMMRSYFASGWEEIPVYHVDPANGPLRGPALL
                     IMNGTSVLLEHECTAYTNDKGNVIIHTAQVVEQFTTELSPLPLSIFSHRFMSIAEQMG
                     NALQRTSISTNIKERLDFSCAIFDTDGNLVANAPHIPVHLGAMGAAVRWQRDHYGSEW
                     KEGDVMLTNHPVCGGSHLPDITVISAFFHEGKIVSYVASRGHHADVGGTTPGSMPPFS
                     KTLMEEGAAIKTLKLVQQGTFNEDGIREALLAPGKLPGMSGCRTIEDSVSDLRAQVAA
                     NNRGIQLLQGLIESYTLEVVQAYMKHIQTAAELAARRVLQRIARDYGEAAESDTADTG
                     LVTLQATDYMDDGTPICLRISIQSESGEATFDFTGSGSQVMNSTNCPTAVVHSSIIYC
                     IRCLVDSDIPLNQGCMKPITVVVPPNSILSPDEDLPVVAGNVTTSQRVTDVVLMALRA
                     VANSHGCMNNFTLGSSDFAYYETICGGSGAGPTFAGTSAVHTNMTNTRLTDPEIFEAR
                     YPILLRTFRIRRDSGGAGLHRGGDGVVRSVLALRDMIAVVLTERRVMAPQGLFGGGSG
                     KRGLNMLYVPIPPSHTATLGAPVWKNAHDMLHDKARGPWMGEEQTTLYHPRNIGGKNV
                     VDVKMGDIITLCTAGGGGCYAAAA"
     gene            <439294..>443637
                     /locus_tag="LMJF_18_1050"
                     /db_xref="GeneID:5651033"
     mRNA            <439294..>443637
                     /locus_tag="LMJF_18_1050"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682459.1"
                     /db_xref="GeneID:5651033"
     CDS             439294..443637
                     /locus_tag="LMJF_18_1050"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682511.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651033"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT7"
                     /translation="MPARTGCPTETPEKSPAAAPHGEDEPPLVHSGCPETPPSTTDSA
                     PCLQEEGSTATAPTPAESGTALVSRGEPRAAVHLRSPATVQQSSGALIPLNLTTHRIA
                     VGIAKAGISIADGFLLSNSALLNPVISASFVVYESVKVVQAYRHGELTSLGYRTTKGD
                     VALRIGKELATTGLGIAIGHGVGALIGLSTIPVAGQIAVATVLSVGLGTCIGTLLTHY
                     VDRFMVRLQLRNQYGYPMDERGTRRRFEVLMERRHDLSTLETCRVVQHYADYRVASGW
                     ESANDLDDYRASGDITRMPVSLQHFAVVQLQRKWGFVKERAQCRQIYRALLLLHHPDR
                     GGSTELAAQLNKDFEFFAFCQGWDSDCASLLRTAQSSSATAAPADGASRRRRGSVIVD
                     YLRSLFRPTTNSRVGANDLHQFGLLALEAGTPAEMHRRDVTAALSSLPAAGTAGDGSD
                     EAAPEKCGSLGDIDSFSDGDGDEYEDTVAVAAVRQRSVTRVLRALHEVYTATAEAITF
                     SGLIQVSDDTDRWLQLHQDVRLFQRLQYFISLHAQAPAAARHESAGQAAANDHREEVQ
                     PLCAAKQYIFRTFRWSTVPEAVAKREEARSAIVAAVFTPETSRQLTSLLELWRTAKAM
                     AESYFRACQQREADGRPATSRNEDEGRQTLDALLRIHTQIEAAGTAAREPWEERMEEW
                     ATRTVPGFSSFMEDVKEVGLTASNALAAEYAAHAFASVRQQCSEYFKAWSRKQDTLQT
                     LLTELQLEYDALRGAAQGSGGGNPSSTAPGFACDPEAAKRINDYQTQLLLLHKQMAEV
                     DVGVAEWANTCAAHFPELTTTMLQLPSTCVESVVRVRTDSAADASSPNEATLAGHDWT
                     PRFLAFERERTLLHYTRVEAEPVNPLDPPTSRMPAHHPSDAAEWEQAVSGEESDAIGA
                     LLRSFEANEAIEDAVVGRHGVGMTLLQALYNDPLTGESTPCWLKRYSFAGAQSKKGAA
                     SLRALAQRILAEEVAVSAACCSDRVVSARDIFYNRERHEIFVHYVRGATQQRFRSVNN
                     VRRQVEPLGLRWLHDVLECVACLHACQLAHGHIRLSAFTYDDFGNTALGIFHPAWEGL
                     NSVSPAPAEEPSVATTPAPSLAARQHNDVIDVGIMLLTELLPLFTARSGSSTPPPAAA
                     FSALTLSPTSRQPPPERGGSSTETDAVSDDMERVMEAVAAHLVGKEEPCWSLLDARQF
                     VRRFQQLRSGDLAIFSKQVAYPASWAIRCAVPPVQLVAVDATPFRFPATLTASAAAVR
                     VYHNRHVSLWETYWRCRHEMTTLHRGSHMLPSVVMQTPPLLLCSDDCEVHERYLWCAC
                     AHEEVAWERCQNGFRSLRRDATHLTLGKDMLPFSLVAPSVRPDGSTELWGVICRATLG
                     TTLEETEEEFAATENKMDMPTAQYNKLPYAAQRRSHLVTRPQAESPSAIWVPSPWARC
                     YPEYIVHISWL"
     gene            <450158..>452482
                     /locus_tag="LMJF_18_1060"
                     /db_xref="GeneID:5651034"
     mRNA            <450158..>452482
                     /locus_tag="LMJF_18_1060"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682460.1"
                     /db_xref="GeneID:5651034"
     CDS             450158..452482
                     /locus_tag="LMJF_18_1060"
                     /EC_number="3.4.22.33"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682512.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651034"
                     /db_xref="GOA:Q4QDT6"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT6"
                     /translation="MHIKRNKNWEPMTVTREQSYISVCKELNDAPLRQLQETLKYGDT
                     RLDVSGIYLPRKHFRCVLQFIEERPDIEELILDGANIGVEEVKLLKESLLRSCVSKLS
                     LQRIKLDSASANIIRQLCIENSNLVSVVLRDTCIPSYLVDEIMLIVDLNRLNAESLSS
                     TSTAGAQQKASAVARWMLFRGKNDRGFCATVKLSSSATRKVTDGFVTSYDSVFSDISF
                     QQDAFDHPVAGMETIRWNKYYALHSFQEAGLGNSKAPFSPSPHYNNQNLCAALNILSF
                     YDVLYKSLVVERYPEAGLYVFRLFVGESPVEVYVDDLVPCVHLDATCTIVGLNSCSSP
                     FYAAVLEKAVAKAIGGYRYIQELSLSDCIELLTGCTGFEVNLLSRSSFSTTFDTLRAL
                     SEYGHKLVACAIPHTSIEEQTFEESGVCCGIPYAILETDACQKNGSHYAFLIQVAAPS
                     SGRALKYAFEYEMYKTEEVNGNRVLWMTFEDFAATFERVFLLLWPFDDAVSDHKTTVE
                     FQVTSEFLSSSSQFAKNPSFLIQNKGKSSSPIMVSLSTSSAPDTTIGAKCLFYKAANT
                     ENGAFLRRYNVCENNASFGLEVFEGNEGSVFFNLLPTERLQMTLSSRVPSNFRIRISS
                     VENVDAMQLPDIMASSTFSAKWNTLFKAKRFSDDIFQLNRISGGCTLSLVLALSQATD
                     SSPPFPLGVLGWKGTSIDVVDAAKPHFSTQQERSTVCVHSFLLTLAAGESFFLLPYCC
                     GSRCPDGYDLTVFCKESFTQSRVKTASVLRCTKT"
     gene            <453209..>455698
                     /locus_tag="LMJF_18_1070"
                     /db_xref="GeneID:5651035"
     mRNA            <453209..>455698
                     /locus_tag="LMJF_18_1070"
                     /product="putative vacuolar protein sorting complex
                     subunit"
                     /transcript_id="XM_001682461.1"
                     /db_xref="GeneID:5651035"
     CDS             453209..455698
                     /locus_tag="LMJF_18_1070"
                     /codon_start=1
                     /product="putative vacuolar protein sorting complex
                     subunit"
                     /protein_id="XP_001682513.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651035"
                     /db_xref="GOA:Q4QDT5"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT5"
                     /translation="MTWNKAADHLIVVLNTGFVHFYNYCGATAATSLPMEIPVVCTSC
                     DNGFVALVDTATEAKLVLVHLGPQKEYSVRELSLPQSIRQFMRTIALVALDESADKRH
                     TTEVFLSYSPWSSNSFICRCIFGASNSSFLELDVPVEGGRVLEMCRSPTGRAVAFMML
                     DGSVYSTNSGFSEVSLLRRTDTTPESFVQMTWCGNHCVAYLQRMQYGSASGEGECEEY
                     SCSLFLMNVDEPDNSDCISDLPFDGCLLPEKDGVWVLSRESLYFLQIAPLAVQRVFSV
                     GSRAAGAMLVATYDEFMTGDASAVRMLRNLEHTSGALVEAVADCVAAAGFEFDAAQQK
                     RLLRIAAFGRTFCSLCDSSSFMAMSKRLRVRNHLRLEPLGMIVTDQELADLGEVRLLQ
                     RLTMCSEHQLAFCVAEALGSDLKPVMLDWAMCRLARVSVHSKDEEREVAKQIVKKLKA
                     CRFTAFAELAQQAKVAGRGAAAVVLLDAEVNPSQQVPMLLSIGEPDMALKRAIQAANA
                     DLVFTVMVHMIRSRGSAALATLTSHKISCDLLLQYVGVCEGNQQLMAEYFNKHPRVQA
                     YFHLRSYFREETRLGHALSQSMESGNWEMLQECKGVDIQAAIVSTKKAVEQSPRPQST
                     TTAVSPIVGGGIAFPASMIDERFLQLQSSLLDEQTQLMNEYKDYRFLQASAADTIRYA
                     LEHGRTSVAQRLKNAFCVPEKMFQRCMLSAYLCTSQWDLIDDMSGISSNKKTLLDGEA
                     FVTALLSYKRPQQAKQYISRIPKIETRMEYYVLCSDWFGAGADCKRSNDPDLLAQLKD
                     RAKGNPDALRQIEEGWNTLPHTSGISFPKFF"
     gene            <456651..>457649
                     /gene="PKAC1"
                     /locus_tag="LMJF_18_1080"
                     /db_xref="GeneID:5651036"
     mRNA            <456651..>457649
                     /gene="PKAC1"
                     /locus_tag="LMJF_18_1080"
                     /product="protein kinase A catalytic subunit"
                     /transcript_id="XM_001682462.1"
                     /db_xref="GeneID:5651036"
     CDS             456651..457649
                     /gene="PKAC1"
                     /locus_tag="LMJF_18_1080"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="protein kinase A catalytic subunit"
                     /protein_id="XP_001682514.1"
                     /db_xref="GeneID:5651036"
                     /db_xref="GOA:Q27687"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q27687"
                     /translation="MITKAEASQWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALK
                     ILKKQEILRMKQVDHVMAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFS
                     HLRKAGKFPNDVSKFYCAEVILAFDYLHNKTIVYRDLKPENILLDQDGNIKITDFGFA
                     KRVTERTFTLCGTPEYLAPEIIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKI
                     YEKILVGKVLFPRWVDSKARDFIKGLLSLDPTKRLGNLPNGTEDIKNHKYFAEVDWNV
                     VLSKKIPAPIPVRQHKEGDTHYFDKYPDSPLNPLRTLTPAQQDCFANFCNGQYTDE"
     gene            <460747..>462642
                     /gene="PDEA"
                     /locus_tag="LMJF_18_1090"
                     /db_xref="GeneID:5651037"
     mRNA            <460747..>462642
                     /gene="PDEA"
                     /locus_tag="LMJF_18_1090"
                     /product="putative cAMP phosphodiesterase A"
                     /transcript_id="XM_001682463.1"
                     /db_xref="GeneID:5651037"
     CDS             460747..462642
                     /gene="PDEA"
                     /locus_tag="LMJF_18_1090"
                     /EC_number="3.1.4.17"
                     /codon_start=1
                     /product="putative cAMP phosphodiesterase A"
                     /protein_id="XP_001682515.1"
                     /db_xref="GeneID:5651037"
                     /db_xref="GOA:Q6S998"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:Q6S998"
                     /translation="MLDFLEQLQQLASVYAICGNAVSVMAGMSDTAEELTFRSYDSLE
                     GASYICNLNEKALHTAKASLCDNADWSSFFREVQLAFNSGRVTVQPGNAHRVAVNAAA
                     PVSADSKGLACSMEVHCLSGSGEKCATFVLERTTEDQQKYILESMLQAHHMYNHPKEY
                     EQKLLHIMEAKEIACTKREALDRELVALNDNLTRNKHKQKINNERKEELLKKLGGYST
                     ENTGNPWQAIQEQQQRTAGENTKSRLPSPLGNRTCKDFDLVLFRMIKSRWLSPEQCDA
                     SSPANRVVQPYSKEDLAIQVSQLSGSRAAIWKALDSIDSWSYRVFDVQAAMSGDDYLS
                     LSTQTHGGSLLITMYALLCMHDFLQKFKIDEQIALNWISAVEASYHGNPYHNSMHAAD
                     VLQITDFIITQGGLAKRCDLSDIQVFSALLAASIHDFDHPGINNNFHIKTGSYLATLY
                     NDRSVLENLHVSSVFELMKNPAFNILASFSDEQHHEVRETMIEMVLATDMGSHGKYVA
                     SLKGKMQEHSSFTQTAEQNLCLAIALKMADISNCGRPLDIYLRWGAKVSDEFYQQGDR
                     ERNLGLECSPFMDRLQPSLAKSQIAFMNYIITPFFEQVAELLPDMRFAVALVEENKAY
                     WANHDDS"
     gene            <464960..>465652
                     /locus_tag="LMJF_18_1100"
                     /db_xref="GeneID:5651038"
     mRNA            <464960..>465652
                     /locus_tag="LMJF_18_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682464.1"
                     /db_xref="GeneID:5651038"
     CDS             464960..465652
                     /locus_tag="LMJF_18_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682516.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651038"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT2"
                     /translation="MQAPYNSPVLTEDEEWSTPFATACSVGAPLDLLREILDRSVVEL
                     AAHMKQKETQQNPTSEEQNSSSAAVTEPAEGSSDGKPTKFLSDMPGILQPVDGTPASI
                     SAVLVDAEDATGQTPLLLAVGRGHLSIVRFLLENGANLMHQNRRGQSCLHRAVNRGNM
                     ELVEFLVSTSENNAKSKAVHRVWMDLRDKHGDSALFYASMDNNEEIGRYLLRHGADRE
                     LRNADGKAFWEV"
     gene            <466459..>469008
                     /locus_tag="LMJF_18_1110"
                     /db_xref="GeneID:5651039"
     mRNA            <466459..>469008
                     /locus_tag="LMJF_18_1110"
                     /product="putative methyltransferase"
                     /transcript_id="XM_001682465.1"
                     /db_xref="GeneID:5651039"
     CDS             466459..469008
                     /locus_tag="LMJF_18_1110"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_001682517.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651039"
                     /db_xref="GOA:Q4QDT1"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT1"
                     /translation="MKRREQRRQREREQLPTALTKLVQLIPSDEDARRYLAREFADIT
                     QDEAGSNAPCSAEGSGHDAGAGDAWIYGSGLEKLLSVLGEEACPDGAFDIVRITRRVP
                     RSQSTIDRINVAELCFAVSQASGPVDVHERRRTAGATSGPLDETIPLLQYYRGSRFDA
                     IVRGEDPSSPAARHAAADAALLEENSSHLEIASAGNGSRKNVDSEWPAFVQSMSTPLP
                     MTLRLHHSERALEAIATRMLTTPDIAAVVRPVTAFPSSAGLYSCSNSDYHSHKRVEYV
                     CRTLHAASAVSFQEVVSAIPVFVLDVQPQHTVVDLCAAPGSKTVQALDTMLSGGWSAD
                     VCRGVLIANEKDRVKATQTLPARLKRYHAPNVMTTRCDGVQWPRLYFNDPTNPSSEPQ
                     ERRFDRIICDVPCSGDGTIRKECSIATTWSASYVKSLVPTQRALLCRGLDLLATGGIL
                     VYSTCSMNPKEDEEVVCVGLEAFGDSVELIDVNAVLQEKGFHLHSAGGILSPNVEGMQ
                     HPVLPPTYDGNKVLRILPHRDDTGGFFVAAFRKAKQPDRTAPTVIRHKLNHWTKGKLW
                     APVGVEDEAWANISTFYGFDRRDEANFVYYDATSSSSGKGLVPLYHLNPNGGPIRRIV
                     LSTPALADMVLRTRPYKGPGVEVVSVGMRAFEAYDGRFLPTAACRWRAVVESASFLAP
                     RFTARRLHFHVSKHKQLLEDLLRNGHVYTRDHWRTVLGGDPAVVAANANPKALVKPGS
                     RLEALLTQGSSESTISDEEVAVLLTSHVEVGCVLVGILFDEPTDAAAGPWYMSATLSG
                     HKLELAIDGSLRAFGLMTFFGIHDVERGSLAGNNIGSAVADEEPEEQAKEV"
     gene            <470107..>471177
                     /locus_tag="LMJF_18_1120"
                     /db_xref="GeneID:5651040"
     mRNA            <470107..>471177
                     /locus_tag="LMJF_18_1120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682466.1"
                     /db_xref="GeneID:5651040"
     CDS             470107..471177
                     /locus_tag="LMJF_18_1120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682518.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651040"
                     /db_xref="GOA:Q4QDT0"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q4QDT0"
                     /translation="MQVGVYDRDDQMCQYEGCTEIDLLPARCSNCDKRFCTHHLSHSA
                     HRCPAVTDVRVGTCPICYRVVPLEYPRQCMDEAVSRHIDRGCRDVPQGSLFYGGASAK
                     GRPGQARGRRLGGSARPCSIQGCHEASETRVKCDQCGQTFCLQHRGPLQHHCRAAAAT
                     RSAVAPSPSERDAGMLVSLPGDKAVSVACLLTHPANTPEKAVGKATELPSDMVTCLVC
                     FLIPTCVSKKDGNAGCEEFEPVPPFFMFMPKNTALGRLLDTAVDRAAMNSPAVRTGKP
                     WNLFAVTLPIHAEAEAAYYSPLTLSTVVKKSAVGMAERTIVFLSPLQALPEGVIKAVK
                     DLDRKGSWPSTSSSSSQGCQVM"
     gene            <472767..>473477
                     /locus_tag="LMJF_18_1130"
                     /db_xref="GeneID:5651041"
     mRNA            <472767..>473477
                     /locus_tag="LMJF_18_1130"
                     /product="putative ras-related protein rab-5"
                     /transcript_id="XM_001682467.1"
                     /db_xref="GeneID:5651041"
     CDS             472767..473477
                     /locus_tag="LMJF_18_1130"
                     /codon_start=1
                     /product="putative ras-related protein rab-5"
                     /protein_id="XP_001682519.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651041"
                     /db_xref="GOA:Q4QDS9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS9"
                     /translation="MNTHSPQLMEATSAKIVMLGESGAGKSSIALRFTRNEFLANQET
                     TIGAAFLSKTVMIPPPRGTAAAPGSATSAHALQQQMRALKYEIWDTAGQERFRSLAPI
                     YYRGACGALVVYDITNSESLKKAQTWIKELRANADPSLIIVLVGNKKDLGSLRQVSFE
                     DGQRLAAEEQLAAFYEASAKDNNNVEQVFLDLAAKLLDQGLGNRGGAAGGARGGVVAP
                     RGERVEESNESAAQSTCC"
     gene            <480061..>482898
                     /locus_tag="LMJF_18_1140"
                     /db_xref="GeneID:5651042"
     mRNA            <480061..>482898
                     /locus_tag="LMJF_18_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682468.1"
                     /db_xref="GeneID:5651042"
     CDS             480061..482898
                     /locus_tag="LMJF_18_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682520.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651042"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS8"
                     /translation="MPPVVPGGLRSASPTSTVDYIDIEHKQNELRHAVEHHVQSLERS
                     LALREEEVATLSSRLRKLEEDYQFNYNLIAERDAALEEASGQLQRLYRELKRLTEEST
                     RMEKMIDTAESDVKAARQRVREVEEERDAAMRQVQKDYIIKERYLAEAVRAKEAALEK
                     EQAEQHAWYKERAKALEEERAAMSDRSALVSMETEERFKQQVARLQSEVAGLQQALKD
                     ARQQKADAEKRLVATEEANAALAHESTVAQQRHEALAQEAALAKRNLEDRLVRVVGDA
                     EKRVLAAEATAREEAGRASRVELERTRLQSMLAEVQERLQHLTTRYDEDIARFMKERQ
                     QLLKSSDEAMAATTSVEQALHDTKRELEQQRRLAAEEATRLRREIERTQETSEAIHQE
                     LVTVKESCHKWRAQAQHLEAEVHRWKTEESKTAASGRQECSALEEKCRQAELRVQLLQ
                     EEVQQAKKARQGAVEQAQAEAMRLTRELHASEAARRALEDQFHLQEGAREGRDELQML
                     RMEKEQLQKRVAELEHTNAEVRLQVANFAAELQNDPVIKAAKETQQRAVALQQELEQA
                     RAEVQLLQDSLRDKEEELVRLQTELLRVQVLVTSDETELPPLDMQTRLASGAAHLSDH
                     VSRALQRQQQQMRSEYSRMRESYEEMVRELDRQRRRRRRPARRSRTASASSSSSTNSS
                     STREAELPGRHRKRGGEEPPAAAGASVPPALPDSRTTHLLQESEVWRQRCVQLEQQLL
                     TELRERDRLKKELQLAKQDAMALGAEKASLVDLNSLLKSQLREAYRLRAGDANVRLAG
                     GRTTATPAARASEVRISPELLAAALQALEDGTAAGCDTGGRSHARSATGAEATTTRRR
                     SRTDEASALKESPVVRSTRGYSAPSPSPAASQTISAQQAQERLTTLEHEIEAVREQLA
                     TASSTAQQQHRHGQGVVRRGNAAVRHYGLGD"
     gene            <483639..>484721
                     /locus_tag="LMJF_18_1150"
                     /db_xref="GeneID:5651043"
     mRNA            <483639..>484721
                     /locus_tag="LMJF_18_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682469.1"
                     /db_xref="GeneID:5651043"
     CDS             483639..484721
                     /locus_tag="LMJF_18_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682521.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651043"
                     /db_xref="GOA:Q4QDS7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS7"
                     /translation="MGGKNSTQRQGAQLRNGNGGGSTAPGRQAPSNMPPHLADQYDNN
                     STRQRNQPPGNANNTTPPQQNAPQPPPPPQQQNRSGNSVGNTAANNGNERGGVQEGQM
                     VKMLATIEASTVSYVPATQVLTFYITSTCGSLTYEIHTGVKEFVQNGTVCYRPNRPKL
                     EPVKTEIRGPQENRKITLKLDINSLEEKEKSFNKHYPKQMPCVIVLRYKTTEIRKRDD
                     GRDDNNQTEEEVSVEHTEHTSVDLAEKPKRRVISQIVTAGGNAYTVENLYGVDNDGTA
                     PASDNAGGAVMIGSTIEDEEDGLCVICLTNPKDTAVMPCRHMCMCKDCGEQLLKHKPV
                     CPVCRAPISTLLHMPSLSSKAAASAA"
     gene            <492329..>492658
                     /locus_tag="LMJF_18_1160"
                     /db_xref="GeneID:5651044"
     mRNA            <492329..>492658
                     /locus_tag="LMJF_18_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682470.1"
                     /db_xref="GeneID:5651044"
     CDS             492329..492658
                     /locus_tag="LMJF_18_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682522.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651044"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS6"
                     /translation="MGYDSCATCCAIFSLLGIVHLVLFGRMFSEKAISFALMAVEHGW
                     DGETKAKACYNGAIIYTVTLFLSVLARVYFRRNDAAKAALLHAQHIEEIQGLLVPPTM
                     STGSSQH"
     gene            <495553..>496161
                     /locus_tag="LMJF_18_1170"
                     /db_xref="GeneID:5651045"
     mRNA            <495553..>496161
                     /locus_tag="LMJF_18_1170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682471.1"
                     /db_xref="GeneID:5651045"
     CDS             495553..496161
                     /locus_tag="LMJF_18_1170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682523.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651045"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS5"
                     /translation="MEQFVQPLEGIFRDGIPAPVLRAFAPLFQALPSLQERVEASRDC
                     YYWRANPMKCLEEDIDTVTGFMQACEASFRMCPQQSATLLKCHMTEPARAVYFCRDEE
                     WEWRSCLMDQTGIRFWPYANAPIGAPWSNGGQTEDFHLEDRFFYENFSFWRRRGAMLA
                     VRERELEVAAQRKHWLDEQMDDTSLAAPKPTIAPVGISTKIN"
     gene            <498549..>502427
                     /locus_tag="LMJF_18_1180"
                     /db_xref="GeneID:5651046"
     mRNA            <498549..>502427
                     /locus_tag="LMJF_18_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682472.1"
                     /db_xref="GeneID:5651046"
     CDS             498549..502427
                     /locus_tag="LMJF_18_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682524.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651046"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS4"
                     /translation="MGPPEAQRTAGETWERAPRSTAALLRNPQGVPLVPAAATHAPPK
                     LMRPASTAAQQRPTSAFSPVSGSSLPAIAASSIAFAHTTTSTPPIRGIPLFTRTHRPA
                     GWASVSPLSSASSLRLSLDEYGRAQLQDEAVRWYHRCSELEQQLTKLQDAFNRQSRLL
                     AAQWRADGGSGVCAKPSADVTRASSVKASSAAATARSPSGRDPAFTSRSPDTLLRAYA
                     YTETEDGYYAGQTEMRSQRVGAEDSQHCPSEGRKRMRVDDRAPSREPVLGQMAEGEMQ
                     YRVAKAYPVTAEDEGPAQDLPKRDFGSQVHRGPTGADGTAVSSSPPLLRVSVGLQTDG
                     LASGDASFARETRGIPVEGLLSAFTEATKEDPSCLPSTPGPSVIMSKQYVAAMGEIEM
                     LRARVDAAERRSAELHEMCAAHELRCDELETQLLGKEEQLLRSEQRAQGPATPLSGGG
                     PGSPAEAAAKALLSEELNPLIAQLQDLLTLVHPDSQGALRELGALAAEDAGTVQATAT
                     DNLFSAAFEGLSAEGDVAAPCSTNSCPKSPHAEASTHLGGVAHLASLVTEVRSAIADF
                     SQRFAALQAELDVVRADRNELIGEQSEQVRLLQEQLLEKDTAQWRLLEDLHRAQEQLA
                     VARAQTTVAPADGEVGSGEPTASRHPQKRGGHSDEAATATASGSAAQRSSFLVSEAVA
                     GATQRLSPQQANSATHPAQTADTSAAEVAALQEQLAQVRAAAAAGQEAQRRVLSERLE
                     QAELQLKEARLRAEDEYDRMSGTIEALTRELADTKEALRVKEMSLRIALRESFFPPLL
                     ITAHGDKAMSDGVVAGAAVAEKLAQAAASSTLPSSMQLLRTTSRGSAASSSSPRPERE
                     STRTSMSPSPPIPPHLQSAAGMAKMRDVADTDMGDGWLGLASEEKKKAHRRFEDDGTL
                     RTLPSAIVVNGQDGEEGLGRTGQLFVSSAAALTTAITATATTTSSSREKSSRGLTMST
                     GGGSQGASSLPHGCGDGSAEMLEHVSIAEEAAPQEEMPTPSRQRSGATAPLFTQEEEA
                     ATVAFETHRTISSSPPRPPQRKSAPALLADIAADDELPLPPPLRGPLFGTAMLSGSPS
                     PVQQQRTPSPHRHEATYGARLGIYPSASQGPAEQRGPRDSSELSAQPLSPEAKLRKFL
                     SALSASPSPLEETVKESGRSLLTGQATRTRRSTLHNSSDASTALNDAIPSDVMVSALL
                     TAGTRSVPMMDRDETTPGRRPLSLYSASASPSSASTTTASRPSPTLLSGSPHSAEVAA
                     RHVQASLRRHREAWQQQELILHALQKSPSL"
     gene            <503423..>507238
                     /locus_tag="LMJF_18_1190"
                     /db_xref="GeneID:5651047"
     mRNA            <503423..>507238
                     /locus_tag="LMJF_18_1190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682473.1"
                     /db_xref="GeneID:5651047"
     CDS             503423..507238
                     /locus_tag="LMJF_18_1190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682525.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651047"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS3"
                     /translation="MRRAIGAVASQSPTQSVICLRHMHTNARALALTTPRVSRRLYAG
                     KASLPGWVAPPSQPQSAPQLQTPPGSSSRPSAPTSLNAFSKSVRSHLAAHPSPSSSAD
                     ELWVVDRLFALLLQPAKDDTYDASSTTASPLALEPLHPLLCVRVLQRLGHAVWECEAA
                     AQDCSTQHATAARKKGWTVRHTYPSLASSSGAIVTSAESLSSSRSVASAIYANTERVA
                     GAVLGPLMPLVGDGTAAHPPHSQVLPVLPLIVEWLCTLPIAESAVPLDRWLPWVVAIY
                     TEDHHNRRPPLQSPLLPPLLNLLPHLLSKLSVYLEDSTVAQREATRCSPNILCEHGLA
                     SLFALSLAGPAVTEDERVERGSRGDSGATGKATLSPAHRASHQHSRSALADALWWHGE
                     APLLRLAGVRRALKQAGETVPLASSAAAAVAAAKPFHTPATVTSGGLSTPLSHLQQDQ
                     ELSCSHSERVPHVAVALGDDDAYRRFLLRLAALQSTSFVIAAASAPREITPALVSVRL
                     TGAAALGATESCRGHAPAPLSEDPDMILRFIQPLHEYVLLLQESSAQWSSTAGLTAAA
                     TTASTAGVLPVQLTFAGVAHVLMAVFGRLEELKQQSRCRGAAAATPALRAQASLSAHA
                     GSSVATAFALLPQKARIHALKSLCELLLRHVRAVQASKTAPSTLPTGAAPDCAPWFVD
                     VELPQQEATLRRLCGAARALVRVVMEERRCSLDEEGPEGSVLTASSVVAAQQHRAAGG
                     GTGAFTTSTSSAATPLTSTISFERALRSLAFRVVEPALWRLHEVCAEAQTSVPVHVLT
                     FEEWRLYLRVANAHETERGILPGRLASAAVEHVDQVYSSVMASAVLLFDCVGGRAGLR
                     TAQQVLPHPGQQPVSALVEGIRLTALQCLLFDGLRSGGSFSSTSVVSSNTREEAAGYM
                     DWVLHHLPHAFFSVWQRTQPPPTLTGLPSAANEAEETAVAGQELLRRRLGLLTLLLHA
                     RVLSARELLRRDAALLPGTTPSRSAMNANPTHTWRWFGDVPSSLDSLLHCMTKGSATL
                     PISGDARDEWSLVLSAATLQACVMPPLPAGCTALWELVELLQDLAVASTKAEETLEPP
                     AAVTEWVWLGSPEALYEALDASLLNESGSDPAAGVTPRHGYYLLPWTTLAHSHQPWRV
                     YDESGQARRAAQEWEAMLQSWLTGSSSIDGGKGVPSRRRQQPVVRLVSLTEEVCFFTC
                     LQRVSALHLSTDVRVVRSDVQREESEVAPTVRRVLTASQAARIAASSSAAVTESAGWY
                     TEEDYDGLD"
     gene            <507837..>508652
                     /locus_tag="LMJF_18_1200"
                     /db_xref="GeneID:5651048"
     mRNA            <507837..>508652
                     /locus_tag="LMJF_18_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682474.1"
                     /db_xref="GeneID:5651048"
     CDS             507837..508652
                     /locus_tag="LMJF_18_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682526.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651048"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR026868"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS2"
                     /translation="MRGCLHFTRVARHKRHDKGGNAHNFAFDTLTKVYRDAVYLPQEK
                     YRRGLMHPERSPGAPPSQAALVAPSSSSDVTNHVGNIGVMSSVATKLSDWMEQQPHHQ
                     TKHHTNGGGGTGHASATASCATPIARRSVASSSPSPAPSAAAATTDESHVDDEAIRRR
                     LRAHLFSDKIQPGQPRTPPSTPVATASASPRRSGVQAEILSVYRSMLREVSRMQDADT
                     RRSLSAYIRQEYDKQCDIPRKNIMKIEWRLNYGKRKLEELQAMSKHTKFTMMR"
     gene            <510095..>512290
                     /locus_tag="LMJF_18_1210"
                     /db_xref="GeneID:5651049"
     mRNA            <510095..>512290
                     /locus_tag="LMJF_18_1210"
                     /product="putative prolyl-tRNA synthetase"
                     /transcript_id="XM_001682475.1"
                     /db_xref="GeneID:5651049"
     CDS             510095..512290
                     /locus_tag="LMJF_18_1210"
                     /EC_number="6.1.1.7"
                     /EC_number="6.1.1.5"
                     /codon_start=1
                     /product="putative prolyl-tRNA synthetase"
                     /protein_id="XP_001682527.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651049"
                     /db_xref="GOA:Q4QDS1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS1"
                     /translation="MSIEDCRGFDQVKALLQELGLDIPIVHHDEKATVEEVLDLLHKM
                     GIHAAGTKTLFLKSKKGELVMATAFKSTPTDLKFIQTVTNTKDLRFASSEVLQECLAV
                     VQGCVTPFALINNIEKRPITLLMDRSLEASAQPLAFCVCRNDYTAVITFEELKKYLEK
                     VGYAYKLVDFGAASADAAVTGGAAAPAPKPKKAPADAAAAKRGGGGGGAAAPASAQSG
                     ETKLGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKI
                     EKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVM
                     YPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAK
                     EVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSH
                     NLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVA
                     STQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHW
                     EVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQMYAR
                     AKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESKVAQAQET
                     REDARAPSMGAKTLCIPFEQPEEPAEGHECICKGCTKPATTWVLFGRSY"
     gene            <514549..>516744
                     /locus_tag="LMJF_18_1220"
                     /db_xref="GeneID:5651050"
     mRNA            <514549..>516744
                     /locus_tag="LMJF_18_1220"
                     /product="putative prolyl-tRNA synthetase"
                     /transcript_id="XM_001682476.1"
                     /db_xref="GeneID:5651050"
     CDS             514549..516744
                     /locus_tag="LMJF_18_1220"
                     /EC_number="6.1.1.7"
                     /EC_number="6.1.1.5"
                     /codon_start=1
                     /product="putative prolyl-tRNA synthetase"
                     /protein_id="XP_001682528.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651050"
                     /db_xref="GOA:Q4QDS0"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:Q4QDS0"
                     /translation="MSAKDCRGEPELLALLKELNIELPTISHGEMHTVEEANRELVQF
                     GTPCVGTKNMFLKSKKGELVLLTAVHTTKTDMHAIEKAAGTRNLRFAPAEILSENLAV
                     VQGCVTPFALINNIEKHNVTVLLDKNLKDSPIPFVLHPCRNDKSSLVVFEQLERFLEK
                     VGYAYKLVDFGAASADAAVTGGAAAPAPKPKKAPADAAAAKRGGGGGGAAAPASAQSG
                     ETKLGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKI
                     EKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVM
                     YPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAK
                     EVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSH
                     NLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVA
                     STQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHW
                     EVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQMYAR
                     AKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESKVAQAQET
                     REDARAPSMGAKTLCIPFEQPEEPAEGHECICKGCTKPATTWVLFGRSY"
     gene            <517755..>519614
                     /locus_tag="LMJF_18_1230"
                     /db_xref="GeneID:5651051"
     mRNA            <517755..>519614
                     /locus_tag="LMJF_18_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682477.1"
                     /db_xref="GeneID:5651051"
     CDS             517755..519614
                     /locus_tag="LMJF_18_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682529.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651051"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR9"
                     /translation="MRRSAQLQASLLLQHIHRSLPALQKLYACATSQQLAGGTAAAQL
                     CDGADGHCVRAAFSTFPPDPQTGEEGDRVLQFFCKELDMGEAPLRQWRQKLRKRSTQR
                     WGVPEGPSLLPRPPTSSLSSSQTLPGIRGAAVSGSTVPWTRVRCAHATAASAPLASPV
                     PSSAADAADSASSSSFLWLRPRLQDVAVVRSAMQSLKFIVSPLLLLSCPPVVVASPPR
                     AGSPGASAAVHHDTARPTSYEECSRWYATRPIPAGMFLMSLPTEAVLFANPPPATDPL
                     LTFYMQVEELVGQLVSAVADVTAPHHGYASYLCDSVVPSRNLPFLTTADVQQLFRTTT
                     DGSAAPLPHVPAHAADVGEDASGVAESPALSLVSFFREDMAGEPLSAYLRTRLSRPEY
                     AWWVSLVLSHRAGTTSLLPMIDKLNHSPFPNCYYTMATEDTMCGIDVLDNLLAGVPGE
                     LLYQPYVHVFALRDIPAGAELTLCYASASDGAYKPAGRHQPSPSSSLPSRKRGGARRH
                     ASATPAAAEDVEEVMRALFPDSDVAALMESCDGISSGGAEVDPAFTSQLRRLQHPGRQ
                     EVDTPEGKASWLLQWGFVPPCDALYSAQDLREMAALIAERRVDMRSSLFPRVE"
     gene            <521392..>523707
                     /locus_tag="LMJF_18_1240"
                     /db_xref="GeneID:5651052"
     mRNA            <521392..>523707
                     /locus_tag="LMJF_18_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682478.1"
                     /db_xref="GeneID:5651052"
     CDS             521392..523707
                     /locus_tag="LMJF_18_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682530.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651052"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR8"
                     /translation="MPLEHINLARDRLNSAAAASSGRGGGSGEAAARQGGEKFAATPE
                     EMRVIQEKMKDPVFAELMHEYMKSLEDPETRREEEAYLEQAEREAREGGDFSFEFVFP
                     RAAFVLELLEPSNTAVSAAELKKLGLDASAATRTAVKNSGARCFLNVCSSEKVKAFTE
                     HTTGDARGSNWEVPVSVSQRRVEAYQPVKSSPTASIPAEYAAACSIASASLSSPSVCV
                     VRDVVFHPSTLALAERSTRFMCFLTEIAVEHINNGYGESNGFQFRRLPSSIVSIGTPQ
                     NQTIRSSSRAGGSPFDVDPRAPVLTRPTKNWPTVKDSNCSRSAASPPPSTTSAKAPTS
                     SGTQGANAPRGVVSEAAAASAPSPRTSTLPPYTVTHRGSVDLTDAWQWRVSDKRVGVP
                     EELIVKITFAGVRRAAMLDITITPDGQAVRIDPTEGQSRYEGLLVLPFTVEEAPLKAQ
                     FDCSRGVLTLTLKVVPPPLPDGVPSAEQLRKTLQGEAGDAVDECIGEGSQQATGSRPA
                     QPQSPPAAPSPLAAAAEAEALAEEAAVSPASVTRAESPMAAPAEPPVPTTAAPTASGP
                     ELAHIGDQYRVAEMMAQVRAAREAREAAAAAVTATDDADVAKADASAPAPASAPAAAL
                     CAPTDSGSEKSAQKMQHAAVSTAGGSALLEITAAQETSQEAIPFICKGPAKTAALTAA
                     ADVSDEEGDDMATLRARQQAWVTMIETEMQVAKAREEAEAARAAQETAAQAAKARRKI
                     AAEKELERLTHVAKAKRDSLPLSNKYIFSID"
     gene            <525915..>528305
                     /locus_tag="LMJF_18_1250"
                     /db_xref="GeneID:5651053"
     mRNA            <525915..>528305
                     /locus_tag="LMJF_18_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682479.1"
                     /db_xref="GeneID:5651053"
     CDS             525915..528305
                     /locus_tag="LMJF_18_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682531.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651053"
                     /db_xref="GOA:Q4QDR7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR025999"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR7"
                     /translation="MSVTGPSSAAATPARGGRTSAADRPHREPQHGLGAGSTITISRG
                     DDSGSGDRLLTGAKHDVQYFDVLHPILLSHVRRANSDGVLALLSLPSIAESDVFWRTC
                     TYREGLVAAVLIHVMEHTGQLTVPASSPTLSTFASEAASPPGILVDSNERADDSRACS
                     PEPTPQTRRQPSLPSPSPHSSPAPSVPSDAIIVADDGLSPVSHSPRITPLTVDDLHVL
                     LHLCSREGAEAEASCGGRQSVSSPQRRKSSDSAERPCVLDRCHPPALASLLRVGRALR
                     QRRSSSSTSTTGAGTSSRQRRRAGALREAGSDMDLGLYIQSVMRRLEAMKGAQTQLGA
                     HSLDAPAVTTRKRPRSSDSPTTSSASASRGGKTTVIPTSSGPDSFCGMRGEVMAAAPT
                     DAVDLAALAAVLQERCHDMVYVNPLSERLAAPAAVEESTDSTTTTATTIMGISSSNSN
                     GSLTNTAHAAGSTTTHATAGVAAERTSMADVADAAPEAVSEGAEGADADAAEDIDAQV
                     ASGGLDAVALLRRIPAISATRWALPSGARRASNSGAGETGARAQRFFSVTETTAMARL
                     GGASVAAPSSSPSRPLPRSSTPTTAAVLPARDNEEEERVSAAIRAFDAFTTALEQSAA
                     TTAGVPAGPPQSSLALSAPPSSSAGNPSSRRAAARLATSGALHPRPPVLPPSSTSKVR
                     RRHKFSPQEDAAILHGVARFGQMSGSFQYILHAYRSVWRAGRTALHLYDHWRGALRRR
                     AVAAASGEATSHADRSAFNEALDGVDDAERVSPIYPATPDCGQDLSSDIEDFSDDS"
     gene            <529837..>530799
                     /locus_tag="LMJF_18_1260"
                     /db_xref="GeneID:5651054"
     mRNA            <529837..>530799
                     /locus_tag="LMJF_18_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682480.1"
                     /db_xref="GeneID:5651054"
     CDS             529837..530799
                     /locus_tag="LMJF_18_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682532.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651054"
                     /db_xref="GOA:Q4QDR6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR6"
                     /translation="MTASTKNAALTESKAPAPPLPIWQTLGVSGFAGMFGWCFTHPFE
                     MWKNTVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGCYPSFRDGILE
                     GEVALGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSML
                     QACNSVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDN
                     VVVNIASVITALFYSIVTMPVEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGL
                     LAMYDSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <532835..>533785
                     /locus_tag="LMJF_18_1265"
                     /db_xref="GeneID:5651055"
     mRNA            <532835..>533785
                     /locus_tag="LMJF_18_1265"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682481.1"
                     /db_xref="GeneID:5651055"
     CDS             532835..533785
                     /locus_tag="LMJF_18_1265"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682533.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1265"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1270"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1275"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1285"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1265"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1275"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1285"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651055"
                     /db_xref="GOA:Q4QDR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR4"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <535818..>536768
                     /locus_tag="LMJF_18_1270"
                     /db_xref="GeneID:5651056"
     mRNA            <535818..>536768
                     /locus_tag="LMJF_18_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682482.1"
                     /db_xref="GeneID:5651056"
     CDS             535818..536768
                     /locus_tag="LMJF_18_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682534.1"
                     /db_xref="GeneID:5651056"
                     /db_xref="GOA:Q4QDR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR4"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <538805..>539755
                     /locus_tag="LMJF_18_1275"
                     /db_xref="GeneID:5651057"
     mRNA            <538805..>539755
                     /locus_tag="LMJF_18_1275"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682483.1"
                     /db_xref="GeneID:5651057"
     CDS             538805..539755
                     /locus_tag="LMJF_18_1275"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682535.1"
                     /db_xref="GeneID:5651057"
                     /db_xref="GOA:Q4QDR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR4"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <541790..>542740
                     /locus_tag="LMJF_18_1280"
                     /db_xref="GeneID:5651058"
     mRNA            <541790..>542740
                     /locus_tag="LMJF_18_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682484.1"
                     /db_xref="GeneID:5651058"
     CDS             541790..542740
                     /locus_tag="LMJF_18_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682536.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651058"
                     /db_xref="GOA:Q4QDR2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR2"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYATARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <544775..>545725
                     /locus_tag="LMJF_18_1285"
                     /db_xref="GeneID:5651059"
     mRNA            <544775..>545725
                     /locus_tag="LMJF_18_1285"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682485.1"
                     /db_xref="GeneID:5651059"
     CDS             544775..545725
                     /locus_tag="LMJF_18_1285"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682537.1"
                     /db_xref="GeneID:5651059"
                     /db_xref="GOA:Q4QDR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR4"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <547763..>548713
                     /locus_tag="LMJF_18_1290"
                     /db_xref="GeneID:5651060"
     mRNA            <547763..>548713
                     /locus_tag="LMJF_18_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682486.1"
                     /db_xref="GeneID:5651060"
     CDS             547763..548713
                     /locus_tag="LMJF_18_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682538.1"
                     /db_xref="GeneID:5651060"
                     /db_xref="GOA:Q4QDR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDR4"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYTTARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFCSIVTMPMEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     DSYLPYFSRCASQTVICFFVIEYLTRELRERQKAKTNLIK"
     gene            <550750..>551676
                     /locus_tag="LMJF_18_1300"
                     /db_xref="GeneID:5651061"
     mRNA            <550750..>551676
                     /locus_tag="LMJF_18_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682487.1"
                     /db_xref="GeneID:5651061"
     CDS             550750..551676
                     /locus_tag="LMJF_18_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682539.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651061"
                     /db_xref="GOA:Q4QDQ9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ9"
                     /translation="MSPQTASAPKAPAPPLPLWQTLGVSGFAGMFGWCFTHPFEMWKN
                     TVMMAAPGTSQLDSLKATARKGFYTGLSSGLMRQLIYATARLGFYPSFRDGILEGEVA
                     LGLKRSADPAGATALDRALAGASAGVFASFLSSPVEVCLVLQTTSKGKERLSMLQACN
                     SVLKSRGVTGLWSGFGALASRAALVGVSQVAVHDQVLTMLRKRNVKRADPLGDNVVVN
                     IASVITALFYSIVTMPVEVARVRMSAEAKLSAGAERRYHNVVQCIGRIFKEEGLLAMY
                     GAFAPYFCRCAIHTMICFFTIEYGTRTMRERC"
     gene            <554789..>557206
                     /locus_tag="LMJF_18_1310"
                     /db_xref="GeneID:5651062"
     mRNA            <554789..>557206
                     /locus_tag="LMJF_18_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682488.1"
                     /db_xref="GeneID:5651062"
     CDS             554789..557206
                     /locus_tag="LMJF_18_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682540.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651062"
                     /db_xref="GOA:Q4QDQ8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ8"
                     /translation="MAPATVPGWGVGGRVALDLVLYGSDMGTIYEHRQTAAFLPLFGS
                     LTRISALIAASSPLCHRSHKGTHADAGVVRTSRSERDNTPLRKTRSPPSIHTATMTFS
                     PTATPHAASTGASSESLGVYRRYPAPETVQLPVKAAALTTTATSTAGVSSSPLSSTGA
                     CSGTEATAVAPELTTCVSLRLRWGVQATELRRLYEMHKDAYPISYTASYYEWMLDHDA
                     CMGLVALVAQETYREWVQRWRETEGNTPKTVTTQTARAASSSSSPSSASTAPPVPPPV
                     SQCSMTAEALQECAQVESIIAEQERIAARKAVDNAHKSTRSLHNSDGSDSAAHTVVVG
                     FIIGQIAYARHDAGHLLSNPTAYIGSFAVDPPFQTCGVGHALLQRFVTYVTQQRPVYA
                     QDYLHYDKRKLIALLAAAQVKKRKAGAETLLGGTAASAAGGTCEDGGDGSRHKRDAPS
                     GGPLPPSISPAAPSQSSSPAQAHSSIFQNLLTYLPELQSWIEDRQARLRLRNCGLTEE
                     EIDARRFRDRLAPDVLTDEEVDEVRREARCFVVQTGVQDVWLHCLPGNLQATAFYAHR
                     GFVLHRVLKAYYDIGGAPYDALLLHYVCGRDGPAALPGASAELSSTVADDTPGETDRV
                     VNRVENCAAPEEGAANPDGAAPLTAAAHASSLPPPPSSLTGLRRRRGASRVREVSGPT
                     AAAAALTEADKAAIPTPTPATPATAADAPAEKATPAKQISLQTALWLSPRTYPMVADI
                     ILLTAEKGQEEWRRRTDPKGSGDETQQRLGWWEMAREVVFVTNAFGLLCAVLWLAYNV
                     VVEGKVL"
     gene            <558187..>562596
                     /locus_tag="LMJF_18_1320"
                     /db_xref="GeneID:5651063"
     mRNA            <558187..>562596
                     /locus_tag="LMJF_18_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682489.1"
                     /db_xref="GeneID:5651063"
     CDS             558187..562596
                     /locus_tag="LMJF_18_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682541.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651063"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ7"
                     /translation="MPSGVAPSFTGQPPPSLLEAPHISDKSTPPAVLSRANVTKNSPP
                     ANSNHMKQIARVRLNPTTRVASMPMSSVPPYAGMPSGNGFRASFMPRAMTNTPISAPQ
                     THRDDHQVVKAVQAAYEKTEAHLKAIEAKLNFLHEEMQQTAPPTTSREAPTEALNSNA
                     TAQNALDFLAPIATTGAAGSKAAANHHLQPIPSAMATSLPPVPLTPASRSTEVARSKA
                     SAVASAVVEPPATAAAAAPATAKADGQRDPLHPHFFDDADMLDSPNASIGSDSSSSDS
                     SDGSRDAGHALPNGARHSFGKPARPPAQTPAAATDCKEPSNRTATPVRQRVDLKGVSH
                     ANARSSADAASNCRGMRFSEGGERTRTANAFPASLPSTTPPADRGSIWGTGETGEVVA
                     VGREFRQFSSQASTMPDAKACFLVGASGNHASDNAQTVDRLRSVTRRQANVVKHVRES
                     FFAPIPRFDDVLPRNKAGLFDKHDFEKLLLPGAPCSWLCCASLAISYVSGVPTPVEKV
                     LRANRMGVHYISLPTITLAELFDVVNDYIHICYHRTAVHNGSCTEDEFEDDEEAARCL
                     SEDELRQLVHIHCEMATFDKEVLDPESGEDMQGVGEHPPITNPTQLRKELLLHLEEEK
                     SMYIFYYNPHVLEQAQLRLRSNQCDTEEEAAAIMATARFSANAAGLFGILLDFDPVGH
                     EVKVLTPYLSAEQHPLHFKGDEGVASEDEEMGHARHNIRRFASTFSNLVMEEQQVSLH
                     ALYESVHPADKYLRLSRGFVRVFKSESFPPKVPSIFPLFVLDGSSAGGLMTSVLDVKI
                     APHVLGLAMLHHLSVTFLLTDSARRRQSSHNLLGKTNVCDVKLRGIPLTKVCQQLRLP
                     LSMIVCESNKGSIETAYVWYHVFLQQLQIDHEVRIGLILPSRRDGAADGQPNITDSEF
                     VHHLQLMVESKSVMLISFNIDIALNVRIDARSDPAHFAIVIGVDEERGFVRLADVNVK
                     RFRKTWHIPISRLYNAVMGYGYIVASKSRKIIKSLKGQHFHENALQCARNFLPPPTPA
                     AYQRFEYPSCPYPLTVLADAVERLGFAGTNVERFLNFCGFHISYFLSPNMPLEGAAFV
                     IQNYSHYALDDAVSVTTTHYDFYEGNPPPTEEAAETGGTPTYPVRSEADLLESIQYAI
                     AEPDKRKLIVKYDVSVLQADETVWNGNSGNSFAFVMDYVASKRMVVLSDASPSSFYRS
                     FACPLAVLFNAVCSWDSVSLRAHGTILLTTEVTQESVYEDTKGYDMAHALVHHPFKPM
                     FSAVCSCLALASTEMMMNIETPRLLGGAPISFEGDKRKYKRYNNIFSAEDFLYALPSF
                     SVCEWRTQAVDIQDIGSMANSAFATLKLPLRAVDVLQEQGSDSSTDPKALLHACSGIS
                     GLQTITLVAYDAGMLHGAPGSSAGLVNRVRCFDDENEEATAKQIVPGAPKKSVGSVQL
                     LEGDPCRWGACFERSAEELMRAIKGIYRVEEAM"
     gene            <566424..>568202
                     /locus_tag="LMJF_18_1330"
                     /db_xref="GeneID:5651064"
     mRNA            <566424..>568202
                     /locus_tag="LMJF_18_1330"
                     /product="putative cholinephosphate cytidylyltransferase
                     A"
                     /transcript_id="XM_001682490.1"
                     /db_xref="GeneID:5651064"
     CDS             566424..568202
                     /locus_tag="LMJF_18_1330"
                     /codon_start=1
                     /product="putative cholinephosphate cytidylyltransferase
                     A"
                     /protein_id="XP_001682542.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651064"
                     /db_xref="GOA:Q4QDQ6"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ6"
                     /translation="MPHLLEHSFLFTTEERQLIYHANSDVNTRPVGFVTRIFYPIWIC
                     ISKHLLSDLVAPNAITLAGLLSSMQAYQLINTYYHFGNQQHDPHAVLVDVKSSLQAFG
                     LRGAGQVPLAAEKTVVGEMASAYKAGPGAAAKTAKAMGAAAAAAAAAATSAASGQILR
                     PPETDYVDFFHTDRTVQTATVLAILLLVISITCGSLDGVHARRCRSATSLGDIFSRIC
                     SSMARVFMALTLLEVFQIEDVCTKWYFLLALQLIELNTVLGRISASNLKKDRVKNLAY
                     IATYCFRESELSFLMVLLLIARWFYPTACRDILGVILAKAQVGYNTLVVATFVSIALL
                     KMKKLYKGIILLCLAARVLPLFYLLPLSQYSLLSVIGDAMMVGLLSIEVYVSHLAQRR
                     IHAAVFFLCLGSLLNDVLSVAGSIMYLIAMLVDLSYSLNVPLFTPVRNVFIDGVFDLC
                     HAGHKKLMANALKFGNRLIVGVCSDEECASYKRPPIMTTEERINEVRLCKYVSEVIPN
                     SPVTGITAEMIRYYNIHVVVCGEEYNTPTDTYYAVPRRMGILCTVPRTPGISTSVLIS
                     RIRAASDSSIEAKDRKSDKPTVKDGA"
     gene            <573573..>575879
                     /locus_tag="LMJF_18_1340"
                     /db_xref="GeneID:5651065"
     mRNA            <573573..>575879
                     /locus_tag="LMJF_18_1340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682491.1"
                     /db_xref="GeneID:5651065"
     CDS             573573..575879
                     /locus_tag="LMJF_18_1340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682543.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651065"
                     /db_xref="GOA:Q4QDQ5"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ5"
                     /translation="MLNTDRSMTLNSHYSSSDSAAGMPAPGLAVSAAGQTGHKDMVSS
                     PSISVDQAPTTPGSDAINFFAKAPSSYKSHFGDSAAGVVASSTMPVYSAPDTPLQKGI
                     NSGYSARAPSRISLSGSVGASASSCGLTGSPAFASGNGVIGAGAGLHSNSSSFGNSPQ
                     TVSITPLVKLGLPSSVCIVAQPTSPSAADGVACGGEAAVASDIVNAPEPMGSTCIPNL
                     VDGVGAPLQAIYSSSSSSSTSSAPSPLAQTTSSPQCGGNTSCVSPSGTCSLLFEAEVN
                     ISSPNAETASAAQALDEDALGETHQCTFISPPENNAKVDDGRTRSPKTPSRGGPSKSC
                     GSAPSAKSNPRADHAASPPKNSPSHSKQRQQRAGAASRRQNVSASNCSLSTGQMAPES
                     LQKGCSSPASQGEFVSVYDSDFETLLSIPASQVLHRPNPALGVSRLVLCRKFNLENPQ
                     SCSKGEMCKFVHADIRKASRCSIHVNYAWRSLALCTYPRLPAGDEVTVLAPNERSPSE
                     VIPSERILVTRGSTNWREHTAPLSHCAHYYFNRMCNRGKRCNFIHAVHVDPNVQGDFK
                     HAPAPRAVAPIASKPSNSAASRAASGAQAASNEGHHQSSAHHGGAAARTAPLAKQPQL
                     LPPVQQNSANNVANAGGGIAYAFAPSIFALPPHGCMAYPLLNPTSSSTAMGVPQSPGG
                     VAGGAPYVMLMNSAGQQVGCSYVPATLMPSTPQQMGGSNGVFLIVPTANGSGGSLGGS
                     GAPLGSPGVPVSPLGQSFSSLGNGPVNW"
     gene            <586453..>588351
                     /locus_tag="LMJF_18_1350"
                     /db_xref="GeneID:5651066"
     mRNA            <586453..>588351
                     /locus_tag="LMJF_18_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682492.1"
                     /db_xref="GeneID:5651066"
     CDS             586453..588351
                     /locus_tag="LMJF_18_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682544.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651066"
                     /db_xref="GOA:Q4QDQ4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ4"
                     /translation="MFSPVYEDVSGLFGHPMPISGFGPSTELQFPQTSYMTTTTNAPQ
                     TPTQQQQQQLAGRATVYSLVDASGVQLHRQAAPPQQIPMSSVPFGAFDGASIVPYEVF
                     MQHQQQQQLAAAGKPTAVHAQDGVKYYLSSSTGAPVMASAGPAATTQANIMQMQQHGG
                     TLYTLESNGTTTALTSTPPAGGLFSGAAAANGAPPSGEYPFYAAATGFLSSGPLGMAP
                     ATVGSASVTPYAIQGHMPSASPRARGAVNRSPAATIAGNQHHSNSGNNSSSASTRREN
                     QATLQEMLTAKATLDVFDPDFKLIYNVPTNCVVHLPPARLNITRLVLCRNYRPHEPQS
                     CAMGSSCKFVHADCNYTMLEAHPIHVNYIWRHETLCTYPRMPAGERLEVVQPDGHSIA
                     IPSERILLTAGAAAHAEAGKTTLTCCDSYENSGMCNCGERCNFIHTVHVDPKVQGDFK
                     RAPRKRDGQSNSNSNSNNNNNTSSTSNNTIQCNHHNGNSGASNGGASGRAQRSGSSLT
                     LEQLPQHRQTNSPDTVNSNSSNATNATVLSGAKPNKATPTPVEGILNTSVSAKLQEAV
                     AQQLHAAGSMPMHSVTPSFSISLTPFAIQTLTSSQSLGTLLYLPRGALEATVLGPVGA
                     GEMSQSSP"
     gene            <604235..>607117
                     /locus_tag="LMJF_18_1360"
                     /db_xref="GeneID:5651067"
     mRNA            <604235..>607117
                     /locus_tag="LMJF_18_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682493.1"
                     /db_xref="GeneID:5651067"
     CDS             604235..607117
                     /locus_tag="LMJF_18_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682545.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651067"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ3"
                     /translation="MMSGKDAFIIPLQDADPSLFGSPADRSSVNGGTATTQTQRGSPS
                     RQGAAMGGGLHLQSSQHCGAHDDYADPSAALPPLSTQTLSTSLGAASLPYVSEASLDF
                     QRRLLQQQVQQAHRETERLKAELQEANARLVDTRHQLNEQKAAYTSLTHRYSATVEKL
                     TSTESDVKTLEEHLVKERNQRHQVQKEREEQRLALREAEWAQERLQRRLQQLEATKGL
                     DPKEVQLRLEDRSHFIPTVEVRRIQTEMHNTHQALVDRLLTSLESLTTSSEESQTNFF
                     VARSSVLSAATDVDARLKRAEAALDDIDKQWTDYRDGVERETHEFLLAVMSENKDLWQ
                     QLTLLQNEHAVVLSEMKLRSTQGGSVPVEEHAYVQRQLETMTERLGKAQQLVESQTVL
                     ARAHEAEMTELLEANGAMQRQLEELERQCTQHEQVSSQKTNALAEADAALRDAASQIQ
                     ELHNSLREERLRAEAVVAEMKATQRTMQDEYDARVRELEHDCEVADDTAMTLQHRLEE
                     TVAKLDVVERNLQAQSKEYKAHKVQTAAEQSAAMGRHRDDLQRVRAVMEEELASLRAQ
                     LDEAQEAARAAVRESEETAARESAALVEHRTAQRDLTHMQEELERLRGQCKEAVEQRQ
                     RAQVEADQLRAASGEGSTLAQELQRRCDIVEKEKAELAAALVNEKSRQEQRYATLHAD
                     WKAAEKARALIQEEVKTLRSRCTEVEKTRMAEDRQTQDKEQLMRENIRLHEQYQLIQK
                     ECTGLREEVKALKQRTVGDAQWHRQMEDLQRRLRELPELRQAAEAARRDALKAKEETE
                     LLRRERDQLSKKLDAFLEDAKLQARREDDFERVCREASAAAQRIGGQVSSAKENSARY
                     HVFRNTNPTGRCPTTSESVMAATGAAPASSSAAPASPAPAPRRAATKLSAAASLSSTP
                     QSMQHRSPVHTLTNASGHSNNAGGAGAESDGAGGRPSASSPFRPWH"
     gene            <608452..>610923
                     /locus_tag="LMJF_18_1370"
                     /db_xref="GeneID:5651068"
     mRNA            <608452..>610923
                     /locus_tag="LMJF_18_1370"
                     /product="putative heat shock protein"
                     /transcript_id="XM_001682494.1"
                     /db_xref="GeneID:5651068"
     CDS             608452..610923
                     /locus_tag="LMJF_18_1370"
                     /codon_start=1
                     /product="putative heat shock protein"
                     /protein_id="XP_001682546.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651068"
                     /db_xref="GOA:Q4QDQ2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ2"
                     /translation="MSVFGIDFGNVNSTVAITRYGGVDIVTNEVSKRETTTIVSFVDD
                     ERFIGEQGLDRYVRNAQNTVFLLKRFIGMRMDDSQLSRELKFLTCNIIGDTSGRLMFS
                     VNYCGEEKHFYPEQVLAMMLQRLRSYVNEAATTDPRVKADVRDFVITVPCYYTAEQRR
                     LMYQAAEVAGLHCMSLINETTASAVDYGIFRGASLKETMEEGQVVGILDIGYGATVFS
                     VCKFWRGNCKILARTFDRNTGTRDCDYLLYEHMLNEVKSRYNVDVSQNKRARLRLVQA
                     CERLKYLLSANQSAPLNVENLMDIDVSIPVFERATMESLCQDVLHSIKLVIERGFAEA
                     GVNRDDFHSIEMIGGGCRIPMMKRLVEEVLGRGPSFTLNASESTARGCAIVAAMLSPK
                     FQVREFKVSELPTYPILLGYHAENPRSPSSVPFLPQVNKVVKLLGAADSYPKKLDVRF
                     PCSSAPKIYAFYDYENEGVKEIVQPCNYIIGEWEMGLPSKAKGAVNEMRVRICIQPDG
                     VVELEKAEAIDVYEVEEAPDAAPAAENGEGPEKENEEALAEPPKPVKPVKKTKEAAIV
                     VSVKPNVEILGHSGESVLVFRKAEAEMCERDCRIVRTRIKKNELESYILDFRPRLSPG
                     GMLIEYAAPDAAANFVRQCDEDEQWLYEDGEFSTFEEYERRVQALRAIGDAAYNRLRT
                     REDVEFAAKGVQTRIMAAQQKALDLIGKKEHITEEELKEAAATAEQAKAWVDQQVAAM
                     LAAPKTQDTMLSKADLEKKASEVEQGIHKVMTKPAPPKPKESKKPENAEEDVAAEAAA
                     GAEAAPQQKAPEEEVPAPTNAPELD"
     gene            <613924..>615060
                     /locus_tag="LMJF_18_1380"
                     /db_xref="GeneID:5651069"
     mRNA            <613924..>615060
                     /locus_tag="LMJF_18_1380"
                     /product="putative pyruvate dehydrogenase E1 component
                     alpha subunit"
                     /transcript_id="XM_001682495.1"
                     /db_xref="GeneID:5651069"
     CDS             613924..615060
                     /locus_tag="LMJF_18_1380"
                     /EC_number="1.2.4.1"
                     /codon_start=1
                     /product="putative pyruvate dehydrogenase E1 component
                     alpha subunit"
                     /protein_id="XP_001682547.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651069"
                     /db_xref="GOA:Q4QDQ1"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ1"
                     /translation="MFKCATRCLLDTKTVPLKPQRPFKLHTAGRTDMAPLPTQAVYDA
                     EQLKQSLALMFRIRRMESLCDQSYKLKKIRGFCHLYIGQEAIPAGMENVLTFEDPIIT
                     GYRDHGWYISRGGKPEDVFAEMFGRQGGCSKGKGGSMHMYRVDNGFYGGNGIVGAQVS
                     IGAGLAWRFAMENRDSPKHVAVTFYGDGAANQGQIYESMNIAALQRLPVIFAVENNHF
                     GMGTSAARGSYQAEFYRRGDYIPGIKVDGMDVLAVQEGTRYARDYCMSGKGPIVMELD
                     CYRYMGHSMSDPDNQYRTKSDIQHVKQERDCIRKMREFMATEGIMTEDEMSKMEKDVK
                     KEVDQDLQKAQKQPMTKLDELFTDIYVGEQYEHRTCQGTVYHKP"
     gene            <617910..>618686
                     /locus_tag="LMJF_18_1390"
                     /db_xref="GeneID:5651070"
     mRNA            <617910..>618686
                     /locus_tag="LMJF_18_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682496.1"
                     /db_xref="GeneID:5651070"
     CDS             617910..618686
                     /locus_tag="LMJF_18_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682548.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651070"
                     /db_xref="UniProtKB/TrEMBL:Q4QDQ0"
                     /translation="MNPLMSFDKWNEKSKYDPEARAAERLLAAINGLNKRNSRRREPM
                     TVQLSDEQRQEIVNRYVSTRWYARLYAPFRGMTERRVRWGIRICNVVLLVLVSCLIVV
                     IVVGYFKEMDAVAHLSPEDQRDYTYMVRGMRYSDIYKLGAEVLKKEDPLEALPPAVRL
                     HMVIEACRQKKWHELDWNVELRRMHPASPLEEWDYLHLLYWAILQIGSLTGGGGVMFT
                     DRVLDVREVRHGNAESAEERERFVEMGPTSLPARTQRTFF"
     gene            <619271..>619777
                     /locus_tag="LMJF_18_1400"
                     /db_xref="GeneID:5651071"
     mRNA            <619271..>619777
                     /locus_tag="LMJF_18_1400"
                     /product="putative 60S ribosomal protein L34"
                     /transcript_id="XM_001682497.1"
                     /db_xref="GeneID:5651071"
     CDS             619271..619777
                     /locus_tag="LMJF_18_1400"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L34"
                     /protein_id="XP_001682549.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651071"
                     /db_xref="GOA:Q4QDP9"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP9"
                     /translation="MSCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIH
                     TPWVLGHKRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQR
                     IVKQALKEHSKMKLSHKRTANKKKSKQSKKEAIAKKISTKTVSKKKVPAKKATTTRQP
                     VGSKLVKK"
     gene            <620964..>624074
                     /locus_tag="LMJF_18_1410"
                     /db_xref="GeneID:5651072"
     mRNA            <620964..>624074
                     /locus_tag="LMJF_18_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682498.1"
                     /db_xref="GeneID:5651072"
     CDS             620964..624074
                     /locus_tag="LMJF_18_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682550.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651072"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP8"
                     /translation="MSCRRSTDSSSVTLPASMQTLLQRYTDRKLTKEERLVLAHATPN
                     VRCEALRLFFEMNDAAAGVEYVLASSGASPRSHGGISARASRSGGTTTTASAAAPVLA
                     ASKALKSLSTNTLTAANAGAKPSAAAASGANRPLAASAPTGNVAFRDEVRKPTGTGRA
                     VVPASGSTALSPVAKAGSCLHRTRVARSGESVCTLVTVSSMSSEDSDDAAELRLAKTP
                     AKEGAEAVMPPTVTPRSRDSRANAGAAAVVPAVPLLALDAVLKPHGSNSNSSASFPSA
                     GVVHSERRSSVSPTMTNTTTVTVTAQPRAVSPSVVPPPGCQHLSPAAPKPSTTVTAAA
                     PVSTPVAPPSLPSTVHEDAGDDEGPRKTVAAKPMGYYANPTAMHTAPVPHPRQQCYVG
                     FVDSKPTAVRGTHRRDRTSTLGHPQGGVDVAYRELPRNHSNPSPSCTPPSLAGSGAVS
                     VCGTDWAALVAAAPAPQLPTVPAAMATKPAAAVPASPWKDHLPAPKEATDVTPASGLC
                     SPRLPAEASHDQPNRTHGSRFGDTATAASNSGGAGKAQQPPRTPRVPLTDRKREAEGS
                     DGHSPCNVQNPDSGTPQLSPPPPPSKLGGASPIKRGAAWDETTGMYITHPNQLRRQRA
                     ARSVATAALTARPFAAVCGVSDSALEPPDTLHYHFARTASLTPASALPTSMPTTTAAA
                     HAAGSVPLRRLCSPAVHLAGGADATSVRSRAAALPSSKDNKQKKRKQETKWAKALTGA
                     STWKRAIETRKTATALAASLVVAPVVASPRLAGYQRLCREDVPIKYDFHGHSGETIML
                     QRQASQYPTQMLAAVTSGPPSKPHRTASASQTVRSAAPVARTERYYSMMKGGGVEVVE
                     VETAQPSAQAPCPSTIRTPRSARFRVQQRPRRLVGEPAAAMVSARGSAAERTCQVPGA
                     AAPVCAGLMPPAHCDVFERLTSNYYDVYSSEVVLQATSPPTVTAFPRGCRSSQEHRRS
                     ARRRQFSAPAASPRGRLVRCPATARVARDGCLRAEEMAECERERTTAPAARAFARSNT
                     SCNPVC"
     gene            <626121..>628793
                     /gene="PUF2"
                     /locus_tag="LMJF_18_1420"
                     /db_xref="GeneID:5651073"
     mRNA            <626121..>628793
                     /gene="PUF2"
                     /locus_tag="LMJF_18_1420"
                     /product="putative pumilio protein 2"
                     /transcript_id="XM_001682499.1"
                     /db_xref="GeneID:5651073"
     CDS             626121..628793
                     /gene="PUF2"
                     /locus_tag="LMJF_18_1420"
                     /codon_start=1
                     /product="putative pumilio protein 2"
                     /protein_id="XP_001682551.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651073"
                     /db_xref="GOA:Q4QDP7"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP7"
                     /translation="MASNWTAASGAHLRVEDIDWGSTGGDDMFTSNADDLLVSDPRAV
                     RRAETAPMVLTIMGTGGSLCVGGFEEVNPDEEYRYTEDYHQLYYSKNPRDPRMLPPLT
                     RRRHHLVREARAPGAFAVSSGDKQSVPSTNGAVGDRIENGENDCNTAAAATADAAPEA
                     TEHLSSQALVKLYVDTFRPDWDYAQIKSHVCTFSRDQDGSRLVQRLLEKPENIVSIFN
                     EVIEEFGELATDVFGNYVLQKMFDVVPKAENDANALQEIKEAKMLDRLTAKVRGHLLE
                     YSVQTYGCRVMQKAVENMRAADRNAIIRELDGKIVDFVFDQNANHVVQKVVEVCPSGA
                     QFVVDAFIPSLGDLACHAYGCRVLQRTFEKCHDVAGVQIRPLMEAVLSRVNEFTVHQY
                     GNYVVQHAMLNAPEDLRHRFVVQLTPQLYALSCSKFASNVAERIVTTATEEERDAIIK
                     ELKKPLSDFQGGNYLVNMMQDTYANYVVQRFFEAVSPTQREVISELVQPHIGTINQSV
                     YGRHLLRKMVSNNILTNTFLLSQGIDVSGPEYGGNANNSGHRSGGHRNTANGTNGSDN
                     RHNGGGSTSYANRNGNGRDNRPGGGVGSSSGGNNNGSGGRAGRGGRGGNNNNNSSNNS
                     NNQHSDGKNNAMRSNGGGNPNSMLVLQPQLQLQQPIMTGYMPMPQQYPYGTPYGIPQL
                     QQQQPQAPQPAYIYPAAAAAPQLYQPQQAYIPQIAPSGFGAFAGAATFSAPMPSQQQA
                     GNYSLRYGTSMQQSTPTSQPLQPPSQQQQQPTRRGGAQSPQVYVNGGYNGAGQAHQQQ
                     PSPNSTLFPASQQQQQQQQTFQANSDLADATLARGKGGCSGKGKTGAGASSASHANAT
                     SSDKACALLTNSTTSNQQQAGYGNQRTPQQEMGY"
     gene            <640281..>643640
                     /locus_tag="LMJF_18_1430"
                     /db_xref="GeneID:5651074"
     mRNA            <640281..>643640
                     /locus_tag="LMJF_18_1430"
                     /product="putative chaperone DNAJ protein"
                     /transcript_id="XM_001682500.1"
                     /db_xref="GeneID:5651074"
     CDS             640281..643640
                     /locus_tag="LMJF_18_1430"
                     /codon_start=1
                     /product="putative chaperone DNAJ protein"
                     /protein_id="XP_001682552.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651074"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP6"
                     /translation="MERRRHYEVLCIADFSSAEEVRLAYKSLALKYHPDKNLGDPTAA
                     ERFRAVCRAYEVLSNEETKRKYDLALRAALSEYGQRASGKTGGHGVANPYSMAAPSMS
                     DMYRELYQRQAARASTRNRTSSAPPQSGKASTSQYTKAQQEHFRKRERERQQELRRQR
                     EKERKEQRDREREALRREQERQEELLQQRWRLQQQQQRVYPARGSTRITSAAGAASPS
                     TGTTSDSTAHIDDGNGFSPRMRRGSPCVTTDGVRSGIESHAPNTVHLGTPARLTMLAR
                     NGVATTPQAFRAYSPLSLSPRPAAKPRCAEADAPGEPLSSSTWREEETADAEAVEGGL
                     STGWHTHPNALVNSGDLGERAAHYSSYSSCAGSPVGAEEQAMAQSAGVNRAFRPGSAP
                     LLRPACGVARASGVDARSAASAQPSTRNTHTTSEDCSEDGTAAGCGDNRHRTASSYRP
                     GTRITTVNRVAMPPASSTASTPRHWGTPRSFTNLHAAAAASPASLAASPRGQSITPRC
                     SSSAQMTANGRSYSSSAGAASTGVRVNQTLHNSSSINGATRRSNPAHASFLHRARPMS
                     SLADKDREVLDKQRRERLAKEKERQRSVRLAEEDRQFRRLARAAKHQRENAAAAAAKA
                     EAEEPLSFEKELEFLLHDEASEREQLIEREEQLAWRRLHRQQAKVIQAVLVRRRLAAL
                     TTEEMTWRNGLLQVCRVERDRYFVCFYERLDRLYLEGREGRDRRQLVGREAADRYHVR
                     RASQRRSSMATEEASQRRQLSGSAMQVVLGQGVLVAEAVDCASAPAAEAKARRSSFPS
                     VYDDAAQLEHRCDVGVRLAGNQPWHQQQSEHQQQHPDQWISPAALAAQATSALDAKRG
                     RARSATSSTAVTDISTTGYPESFLSATGTLEAASTMADRLSGGSAFARASGQASPCAS
                     PKKRSALGSSNSTDCPAIAVATSANGATKMLLAGTERRLLMLASDEIRQRRLLVKQQQ
                     QEEMTLRRRRATALHCVFAKEKENAVKHAQRCALVEVAALRAQLRTLQRQTRRFSSPR
                     SMEGGSSAAAASTASGSSANSVSLKMESSAVSRHGSPLPMLPRPTSEAAAAACASSPN
                     TARALSVASILTAAAALSGWTALPDSDGEED"
     gene            <645714..>646415
                     /locus_tag="LMJF_18_1440"
                     /db_xref="GeneID:5651075"
     mRNA            <645714..>646415
                     /locus_tag="LMJF_18_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682501.1"
                     /db_xref="GeneID:5651075"
     CDS             645714..646415
                     /locus_tag="LMJF_18_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682553.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651075"
                     /db_xref="GOA:Q4QDP5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP5"
                     /translation="MGGRISREQMNDYREVAKERISEEAIGFLHTRFMKAAPSGVMTP
                     LLFKQYVESVGVFKNRRIRQEQRRWQQGGIFDKLGASRYKGERQQAAAGANAGADKDA
                     AEEEGIDYYGHLFRGYDINNEGVITFKKFLMYHVAVVYSTDDLFYVVFNAYDDDGDGF
                     LSLTDIKAVITAATRYVGDYDVNDREVRRVIDEEARRLMGFLDIRKQGYVQMEDMRLI
                     TQKYPQVLEKMKNLM"
     gene            <653023..>658917
                     /locus_tag="LMJF_18_1450"
                     /db_xref="GeneID:5651076"
     mRNA            <653023..>658917
                     /locus_tag="LMJF_18_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682502.1"
                     /db_xref="GeneID:5651076"
     CDS             653023..658917
                     /locus_tag="LMJF_18_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682554.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651076"
                     /db_xref="InterPro:IPR022108"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP4"
                     /translation="MWLPDSLHNVAEATATTSPGTASHPPARLFRHRDSIMSMHSADA
                     PSAAVPLICMSSPPSPLARAECLRASESESFDTGNLNNVGGSRASTPRLCCDRKQAIR
                     ATSTTPPSRLRRSASLPTTRCNGSHIFSARLSTPSAAGGAGGGTGSCSSPTPLSERSG
                     KQSSTSTPQLLTVATPLLQRAPHAQDTARAKGGDTSHDGGGAQFSNAPDGRDPTPYTA
                     GASANSSPTAARSSPPLLPSYTLPVTDNTHCQDNVLAGDMGDTTAVVTPARKRKKKKN
                     KKKKSGAAVASSAVEEEDAAMPAEAIASTAGGTGTPIGGSTTVNSAVPATGSLPPPPI
                     PMMPGGGGNSSGVAHGALLGPGYSQGHGSGGGGSLLYNNLSQPQFHPQHLGGARGQFV
                     MMANGAQGGNGAGDPIMTGYSMNGGASGTDDGGGDYTSAATAVCAGGEGSTYGRGGSA
                     MMMMSMMASNYHHHHHHHIRHESSGSGGTYGYYHGGMSDCGRGGAAGMSPAHAQMSHQ
                     GVGRNLQEEQRQQQHVQQQQTPYPYPPQPVLMSSGGSTGSGSYPANSGHTRHGSAHRR
                     GGGSSGGTQCSSQSQQQYQQQQYYYQNLRYNSQPYFHGGVPSTNGADANAMQGGLIMA
                     TGEGSSCAEGGGRDDCAGFSNTQGQSSGGVGGSMQYKGEDAASRVPSQVPVEGMVPVP
                     QQPQRNVSFRPPMPAANASGMSYYPSSSAAPATVAAAAGVPNNGSVNSSYVSCGSRGG
                     VPGAMMARDGGAAVNGEGRLPREEVMAADIAADAAPRSLFQFTPEVSPRLCRLIEREL
                     LTYLTPSLACLQRRRSQLETLAGYITAALRHAGRQTGHDYGDISYYIFGSVNMRTVLP
                     DGDNDVTVEVDGLVARESTLTPPPSPPQPLSSSLLSDGGGGGAALDASAKAVMLPVTT
                     DSSTGSVDGTMQLTTTTDGCPRLVAPAVLSIASGEVLGRVRDYLRSFKTPVFVDSLVM
                     AEVRVLKLAMEGCNYDITIGQFGGVNCVRFLHEMDAVIGDQHVLKRTLLLLKAWCCYE
                     AHILGGQAGYIGSYAATVMLISMLNTVEFLEDADAGQTESDGDGTAAAAATAAVTLES
                     LMSGDSTAEEEEEESVLQNLASSSSAPATTAAKASTTKGAEADREGEGLLSDTTSPTS
                     SNRGGHCHDRDSAGQPGRSPSHPAGHDTTVAPPRPLSPLTLFARFLKFYAYFDFDRYC
                     VTAFGPLPLHKITSTPLDLSYLEVDAAHSKPLEGVAASNRAATDLSFLGLTPEGEAAI
                     GHLVRRRQQPLLTVSGVKHLLDQVNRSRRAERQARYEARQQPAQRPEQQTDTNAAQNA
                     SEHRSTSTSSLVQLNRAGCAAEDAGLMCPSCNTAVFPVRDMNVLDPLRWSSNMVRGVC
                     RNHLQRIQRAFLEGLRLLDVASQELGGDVMQMDVTSVGASASASRTAGGVGATGRRRA
                     GAAAAKAAASPTSQWSAFSAASSSSRSWTDSAANGVAGQARVQQGAMNGASVYGSPGS
                     AVETGGGGGGEVQLCPGYPAPHSQCTVRETGVLEMLFPRTIEAIRKHSHLNCPWSCEG
                     ADAAALTEVPQCPGCTKPSLLCTPAIRRMCQPQLIFHPPGTSEASNTAAKGGRQSKQL
                     QSTSGKATSSPTSTATPQQSPSLAISPTQSKHHQGSGGRRGNAAALEQVVSELEEAFA
                     GQDTSEEARNGGPLGEAMVPVTEQPLTRDSAVGGATGSQLPPPSSSTASASPLQGNVY
                     GPGAVEATMHHHPHQMYSPGGACNSGGVGGAYLSAYPVMSLSASTPEEKYYTVPVSAA
                     AGSSAGGAGSPGGYGLSPSHHGNRSMGPLSQQHQHHHYAQQQQHQHQHHAQQAHVRIG
                     SMSSPVIQGSYSVNNGGGTGNSGQRPYATNQTVSIPMEGSGYPSYGGHNYAPAVRQQQ
                     QQQYPYQHQHQHQQHHQHRSDDGTMSHSSGNHGYKGGGSNLHNINHHSNSSSDSNAQA
                     LLLQRL"
     gene            <663599..>666325
                     /locus_tag="LMJF_18_1460"
                     /db_xref="GeneID:5651077"
     mRNA            <663599..>666325
                     /locus_tag="LMJF_18_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682503.1"
                     /db_xref="GeneID:5651077"
     CDS             663599..666325
                     /locus_tag="LMJF_18_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682555.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651077"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP3"
                     /translation="MPESEEERRLRKEKRRSAARKAEEAEKKGAAASAEASSPSRIPS
                     QTTATASATTTAPSGDAQVERKETEEERRIRKEKKRAQREAQKQQEAAAAAASAAAAA
                     TATAPPIVDAITPNAKQSKEERRAARKKDLRSSDQADDADAALLNAIEAENSAVVAQS
                     IRNSRNFATAELKRSTEEKERKRLESAEERAERKRVEREERRLLRRAAAAGAAEGKGN
                     ADEGGASAADAAGRVALSPVTAFDPSELQRQAYRAQFQKDLARATALRRMVDFDSSGG
                     VVLDLAPQSAYDLYIRDFGQSGREQVGVQAPPEEERLDAGTQAERGKLRARGVQAPAD
                     LGLCPEEEAERQFFQLRRKALLRNGRSGVAAAGTGAEGAGEDDDGVDGEEDGEVAAKS
                     AGNGVGTKEIRSVDAALLERFLTNTLSVMIAALDENNSLASGAATGADAASVESSKPK
                     APTAFSSSCTTFCWRATRHRPVVQVLVNPSNPRQLIALHGAADGTGPSPTLDTFLSVL
                     LLWSVHDVTTPERVLVSCSAVTCMCVSPSRPHLVYGGTADGNACIWNLREPDRLHLSA
                     GCYERAVFHLPSYNTGWQVGGHTAPVRQVRVAGYNTTSVATRKEEQYEQLVSMDDTNV
                     MCYWALTEKRDPFEMSSGSPGAAAATGLGLLDSDYGLHPGSCVSLRLVKDSAAATAAA
                     SAVVQQQDEGGDAAVTYSAGVTGGFDFAPSDSTQCVLTAPQGVVRCSRIGGIASPSLY
                     GPSCGNSHLPYAAASGDKSHHVKTVAVPCCVQYSILDTRWFVVGYEDGTVRLYLQHEA
                     TPQVTVEVGNQPIVAVRCSGAIPWVVWALDEGGELHLIDFAYHRRQAPRLSHALTQPG
                     TGVCTCIDVLSKNEKADQHFLVAGFEKGVMQMHIVDVEKLRVVHSERDERWI"
     gene            <667125..>668174
                     /locus_tag="LMJF_18_1470"
                     /db_xref="GeneID:5651078"
     mRNA            <667125..>668174
                     /locus_tag="LMJF_18_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682504.1"
                     /db_xref="GeneID:5651078"
     CDS             667125..668174
                     /locus_tag="LMJF_18_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682556.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651078"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP2"
                     /translation="MGCLRGCAALIQHAPVKLPCDAPSGVSAPLHRRYPWYAVRHACT
                     TAAAAGGNAVSGGGGGHPTRSTSSAAAGVSELPNKFIYAPRLRYTAPWRSKQITDFLA
                     CKDDVALSIAHTYRNLDTDITITLIPLRHFAHPEFFKQVDDLCNQHESVLMEGRTPIS
                     GAPYSTVVPPRERVKCTRPMEHEDDEGWEPREVESFFQPFSWGVKDSPNHTVVHAADK
                     YDYEKLPWWCSVRFNAPVLGSFAREQHCLNMIYPLRENMYKSFAIPWGAAHMPVFHEM
                     LLDNGFENVGMCSLLVLNRTDGIISEGEFMKMQHWQRKRARRVWYLYGIGLVSLWRLV
                     YAHLTVEYRSGPRQM"
     gene            <669912..>670688
                     /locus_tag="LMJF_18_1480"
                     /db_xref="GeneID:5651079"
     mRNA            <669912..>670688
                     /locus_tag="LMJF_18_1480"
                     /product="NADH:ubiquinone oxidoreductase 78 Kd
                     subunit-like protein"
                     /transcript_id="XM_001682505.1"
                     /db_xref="GeneID:5651079"
     CDS             669912..670688
                     /locus_tag="LMJF_18_1480"
                     /EC_number="1.6.5.3"
                     /codon_start=1
                     /product="NADH:ubiquinone oxidoreductase 78 Kd
                     subunit-like protein"
                     /protein_id="XP_001682557.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651079"
                     /db_xref="GOA:Q4QDP1"
                     /db_xref="InterPro:IPR000283"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR019574"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP1"
                     /translation="MTDIAHGSRYDRDAAISTAAEQVAAGQYAENKPRAIMFVNKRPV
                     EIIPQEENVLEVLEREGITVPKFCYHPILSVAGNCRMCMVQVDGTQNIVVACSTVALP
                     GMSIITDSRLVRDAREGNVELILINHPNDCPICEQATNCDLQNVSMNYGTDIPRYRED
                     KKAVEDFYFDPQTRVVLNRCIHCTRCIRFLNEHAQDFNLGQIGRGGLSEISTFLDELE
                     VKTDNNMPVSQLCPVGKLYMGDADENNDIVRELEAAGATA"
     gene            <672949..>673503
                     /locus_tag="LMJF_18_1490"
                     /db_xref="GeneID:5651080"
     mRNA            <672949..>673503
                     /locus_tag="LMJF_18_1490"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_001682506.1"
                     /db_xref="GeneID:5651080"
     CDS             672949..673503
                     /locus_tag="LMJF_18_1490"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_001682558.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651080"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q4QDP0"
                     /translation="MSAAACSWRHTEWTPYEVLNVPPSAPIGDIRAAFKCMALHTHPD
                     KATVTTSARRASGSGATSCSEFPVSFHIVKEASEMLLDPYLRAAYDAARSQALTREVG
                     AISDTYSLMDDFVRVRMDGDESDRQRVHVYQRECRCGGVYEVAVFPEAPAGSGEDEDV
                     PLTYSARTLRCECDSCSLVVEVVA"
     gene            <674810..>677950
                     /locus_tag="LMJF_18_1500"
                     /db_xref="GeneID:5651081"
     mRNA            <674810..>677950
                     /locus_tag="LMJF_18_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682507.1"
                     /db_xref="GeneID:5651081"
     CDS             674810..677950
                     /locus_tag="LMJF_18_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682559.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651081"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN9"
                     /translation="MSGATGCTVRTYSAPAYEHEEGADDDEGDYLQAYEELLLNAASN
                     AVADDAAPQPGGTSSEGLAHVDEEAGAHVDGAFPYFESPASVPAPADALVEDTLAALP
                     ADGSTVLLTDLARSLDVEAISELFGSVRSFVQLHPHLLTCTQDPDTGRWHVARRCSST
                     SPLNADAATAAAPDLASAIGGGEEDDHKAVIVGLDVAAMVLAEDLRHLCGSRYSSKTR
                     THEAEAAHSAVKRSRRRLIPVAVPNPLSPTSDTGAAHDGASLTTPERAWWPTIASLLP
                     EDGTPLPISVLRASLPGPIAQELRARQVGLARCFKQTYATASHHVALTADSTALVRAA
                     VQRSNSCAAASVLLWSPERQKAAAWTNHKESSVAAFSSCLCDAGDGSYVSPPADYDAS
                     QDAEPWLVTISLDDGEEAGPEEVPPESGDVDEGALGRSADAATALAAATGLQEIPYNG
                     LSGASRRAATQVHGTGLQPHDLNLERLYDAPAPPTAVVRSKPSTATQLAGPAGAVRTA
                     RPTRPSTPAEWLALHTAMAEARGWITPMQMLDYLVECVPTFFIPVEELRPSDAILKLV
                     GARTSMRTLVSRVYMYFVERSEDKMQIRLAPTVEHAQRGAANAHYAAWNPDMATKCEQ
                     RGVDAAPSEAPAPADAFTGTAANPGDRQDSVTHSGARSGGTVLQSSDATKAFPVMRVR
                     RPIKSLLSVRSFKAMPATAKAAASPAALPTAVRLSSPDVQAGASTGSGSSSTPTVLKS
                     GGGFIALSSVPTGEIGYPFLALATQPVHTWPWWARLLCVLPFDTYVPLDHLRIHYCPD
                     LAPENVHLAWRAADASFLPTTSSDKACTPIPFSLLRAPTASRSVRLRPFWLSPGCTSE
                     LESTVMPVGLVKQLRPVWLPVSRLLSKLTPEEREESLALAIRRPSAAGLSVGEALVML
                     LRDCGRCCWVQEDGAKVRRYAASSALDDHFHASLSLLYGFSSARAWEPLPAVLDRASE
                     HVRSLFAHSQAPPLASPNTVGLIGMLRQAPPAELKGFLTRHAQWLEVKATDDRETSNE
                     AAAPLLVRRRAALVSF"
     gene            <679523..>682447
                     /gene="H1A-1"
                     /locus_tag="LMJF_18_1510"
                     /db_xref="GeneID:5651082"
     mRNA            <679523..>682447
                     /gene="H1A-1"
                     /locus_tag="LMJF_18_1510"
                     /product="putative P-type H+-ATPase"
                     /transcript_id="XM_001682508.1"
                     /db_xref="GeneID:5651082"
     CDS             679523..682447
                     /gene="H1A-1"
                     /locus_tag="LMJF_18_1510"
                     /EC_number="3.6.3.6"
                     /codon_start=1
                     /product="putative P-type H+-ATPase"
                     /protein_id="XP_001682560.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651082"
                     /db_xref="GOA:Q4QDN8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN8"
                     /translation="MSSKKYQLDAAAFEDKPESQSDEEMTPQKPQRRQSVLSKAVSEH
                     DERATGPATDLLPPSKGLTTEEAEELLTKYGRNELPEKKTPSWLIYVRGLWGPMPAAL
                     WIAIIIEFALENWPDGAILLAIQIANATIGWYETIKAGDAVAALKNSLKPIATVYRDS
                     KWQQIDAAVLVPGDLVKLASGSAVPADCSINEGVIDVDEAALTGESLPVTMGPEHMPK
                     MGSNVVRGEVEGTVQYTGSLTFFGKTAALLQSVESDLGNIHVILRRVMFSLCAISFLL
                     CMCCFIYLLARFYETFRHALQFAVVVLVVSIPIALEIVVTTTLAVGSKHLSKHKIIVT
                     KLSAIEMMSGVNMLCSDKTGTLTLNKMEIQEQCFTFEEGNDLKSTLVLAALAAKWREP
                     PRDALDTMVLGAADLDECDNYQQLNFVPFDPTTKRTAATLVDRRSGEKFDVTKGAPHV
                     ILQMVYNQDEINDEVVDIIDSLAARGVRCLSVAKTDQQGRWHMAGILTFLDPPRPDTK
                     DTIRRSKEYGVDVKMITGDHLLIAKEMCRMLDLDPNILTADKLPQIKDANDLPEDLGE
                     KYGDMMLSVGGFAQVFPEHKFMIVETLRQRGYTCAMTGDGVNDAPALKRADVGIAVHG
                     ATDAARAAADMVLTEPGLSVVVEAMLVSREVFQRMLSFLTYRISATLQLVCFFFIACF
                     SLTPKAYGSVDPHFQFFHLPVLMFMLITLLNDGCLMTIGYDHVIPSERPQKWNLPVVF
                     VSASILAAVACGSSLMLLWIGLEGYSSQYYENSWFRHLGLAQLPQGKLVTMMYLKISI
                     SDFLTLFSSRTGGHFFFSMAPSPILFCGAIISLLVSTMAASFWHKSRPDNVLTEGLAW
                     GQTNAEKLLPLWVWIYCIVWWIVQDVVKVLAHICMDAVDLFGCVSEASGSGPIKPYSD
                     GTEGNGVAPVKKSAATSAEKALNLSVSSASHKALEGMREDTHSPIEEASPVNVYVSRD
                     KQ"
     gene            <684689..>687613
                     /gene="H1A-2"
                     /locus_tag="LMJF_18_1520"
                     /db_xref="GeneID:5651083"
     mRNA            <684689..>687613
                     /gene="H1A-2"
                     /locus_tag="LMJF_18_1520"
                     /product="putative P-type H+-ATPase"
                     /transcript_id="XM_001682509.1"
                     /db_xref="GeneID:5651083"
     CDS             684689..687613
                     /gene="H1A-2"
                     /locus_tag="LMJF_18_1520"
                     /EC_number="3.6.3.6"
                     /codon_start=1
                     /product="putative P-type H+-ATPase"
                     /protein_id="XP_001682561.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651083"
                     /db_xref="GOA:Q4QDN7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN7"
                     /translation="MSSKKYQLDAAAFEDKPESQSDEEMTPQKPQRRQSVLSKAVSEH
                     DERATGPATDLLPPSKGLTTEEAEELLTKYGRNELPEKKTPSWLIYVRGLWGPMPAAL
                     WIAIIIEFALENWPDGAILLAIQIANATIGWYETIKAGDAVAALKNSLKPIATVYRDS
                     KWQQIDAAVLVPGDLVKLASGSAVPADCSINEGVIDVDEAALTGESLPVTMGPEHMPK
                     MGSNVVRGEVEGTVQYTGSLTFFGKTAALLQSVESDLGNIHVILRRVMFSLCAISFLL
                     CMCCFIYLLARFYETFRHALQFAVVVLVVSIPIALEIVVTTTLAVGSKHLSKHKIIVT
                     KLSAIEMMSGVNMLCSDKTGTLTLNKMEIQEQCFTFEEGNDLKSTLVLAALAAKWREP
                     PRDALDTMVLGAADLDECDNYQQLNFVPFDPTTKRTAATLVDRRSGEKFDVTKGAPHV
                     ILQMVYNQDEINDEVVDIIDSLAARGVRCLSVAKTDQQGRWHMAGILTFLDPPRPDTK
                     DTIRRSKEYGVDVKMITGDHLLIAKEMCRMLDLDPNILTADKLPQIKDANDLPEDLGE
                     KYGDMMLSVGGFAQVFPEHKFMIVETLRQRGYTCAMTGDGVNDAPALKRADVGIAVHG
                     ATDAARAAADMVLTEPGLSVVVEAMLVSREVFQRMLSFLTYRISATLQLVCFFFIACF
                     SLTPKAYGSVDPHFQFFHLPVLMFMLITLLNDGCLMTIGYDHVIPSERPQKWNLPVVF
                     VSASILAAVACGSSLMLLWIGLEGYSSQYYENSWFRHLGLAQLPQGKLVTMMYLKISI
                     SDFLTLFSSRTGGHFFFSMAPSPILFCGAIISLLVSTMAASFWHKSRPDNVLTEGLAW
                     GQTNAEKLLPLWVWIYCIVWWIVQDVVKVLAHICMDAVDLFGCVSEASGSGPIKPYSD
                     GTEGNGVAPVKKSAATSAEKALNLSVSSASHKALEGMREDTHVPNEGASPVNVYVSRD
                     KQ"
     gene            <691867..>695595
                     /locus_tag="LMJF_18_1530"
                     /db_xref="GeneID:5651084"
     mRNA            <691867..>695595
                     /locus_tag="LMJF_18_1530"
                     /product="putative kinesin"
                     /transcript_id="XM_001682510.1"
                     /db_xref="GeneID:5651084"
     CDS             691867..695595
                     /locus_tag="LMJF_18_1530"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682562.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651084"
                     /db_xref="GOA:Q4QDN6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN6"
                     /translation="MAPLTTFPSPRGPAAATASSQESVSVIVRLKGAPKFSSSTALLS
                     YTVEDGTLATPRVSCRPSSQDYGSASPRLHTPRGALGCGSAAEPSVATSTSFPGADGG
                     ADVAAAACTEASKSPVLPVSQPRVFASLPTQTSKQQPLTPASPTMNSSPRPSLFAAEA
                     PATHHQQEDRSPGASAVLSGAAVAGRSIGSHGRVLTITFPNMRERRKYEFGEVLEPEV
                     TNAAMCERLIPSVMEQMAAGFNVCVLCYGQTGSGKTYTMNALAPAVAEEVFRSLDVNN
                     EVVEMSYIQIYNNKAYNLLDGARSGKLGAELSRPLTSSTGTGNSGGNSCSASASEPKV
                     LIRSSAEMLAKTKAALRLRVTHAHTLNARSSRSFILLSLHITRFLDGALLTTTRVTLA
                     DLAGTERLKKSGATGEAADQAIFINKSLMALRQLVESRGTEAEVLHFRESLLTTYLAP
                     CMRSWHLTLLVTVSLEVGSSEETKSSLEFATNARRRKVMKVKSGVQQRLSSTVARLYG
                     RPSFLSAAGGVDSGSGWNARADNADSSELQEIIEVLQYRIRVLEEALKIEQERGAMMV
                     VQSPLTEVLASPSCAAPGAAVGAGVTPLANTEALQREFQYYRHLLQEREQDLRRLQSQ
                     LPETSAEAGCAPPVLPDSLEASSPLLDEGDAGARDDQEESATPPASARSSSSSDTQMR
                     SGEGGAADAHMQLRRCVRQLRSLRSRGSSEDRWCDDVLDHLRNAVLRATEEYEDVNEQ
                     LLVISSSLSGLRTQNHRLYDEVLRANKRLLAIDTECRERCAALQKVTLRATAAETALE
                     QLRLQLFQAYAEQSIREEMTRLYLDAAPIAANVDEAVSGNQQTEQQVELEKVQAHQQV
                     LCDKITELVDNVEQLTRAVSQKDVSLAALESLITPAQRALFHTLSNTSTAITDRGTAS
                     VGGSDGGLARTTAAAMAADSESSAADCFSLLQSRVSELSSLLTQEQQQHQLTQCELLE
                     AREDARRSRQEQRQAFFQQQEEMRRVGQLMAENYELRQQNERHQLYLDHMYVSFHETF
                     LQLRHEHEEEMAELRSAAKVAPSHPRGGDDTARQGCEDEDHDYGASSATARALVRDET
                     LQGVPSGEDRLPQGTVHSSTAVALSMAEVVDNGDAGRRASAPIQRSGRVRHRLTKSNV
                     QHRGEGGGTAPTTTDDTVVADTAVVPSQRVGLSSKVARRSASMSKARRHLFATYGESA
                     NPNDAPVPLAKSAVGASAPTATRRRARASGAARGKRRK"
     gene            <696350..>697438
                     /locus_tag="LMJF_18_1540"
                     /db_xref="GeneID:5651085"
     mRNA            <696350..>697438
                     /locus_tag="LMJF_18_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682511.1"
                     /db_xref="GeneID:5651085"
     CDS             696350..697438
                     /locus_tag="LMJF_18_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682563.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651085"
                     /db_xref="GOA:Q4QDN5"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN5"
                     /translation="MTDTALGLVSIFCGCQANVFLLELIITGSPNTYYALTCAQYVCV
                     ALFTLPLLLRFKEPHEQRKATLNMWPFQWRRLRVSLRYKLILAVVGWAMSVGNNIVFG
                     FHISIPLHATFRSSSMMLNMLAGYFLFGKRFTAPQVTSALVIFVGLIVLTIEKARRTS
                     SAGAETTCRTAAAASTPTWYWGCGVAILVATTACTTALSIFQEHIYRCTRANEAARKV
                     VPSSDDAPPMWTEALCFSHLFAIPLFFLQPIHLYTEFAQIDAGSHLHVALNCVTQVVC
                     ITGVYAMNDNTSAFTLSLTLTLRKLASFVLSVVYFGHYRYLSTVEWVAMVGALMAGTA
                     YPFLPKAQPNISGAVDASAATETSAKKK"
     gene            <698047..>699306
                     /locus_tag="LMJF_18_1550"
                     /db_xref="GeneID:5651086"
     mRNA            <698047..>699306
                     /locus_tag="LMJF_18_1550"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682512.1"
                     /db_xref="GeneID:5651086"
     CDS             698047..699306
                     /locus_tag="LMJF_18_1550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682564.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651086"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN4"
                     /translation="MAAPDTSVPPTADTASAVNNGDDVVAFVVGDGQHKLYFSKRALM
                     RHAPFFRAYFTEHAAEATAASGGGSGGTTVVLRHVKPRSAEAALRLCHSAHHSDDGLF
                     WSLQRECEKADAAHKPEALRAVLSLYAACVKFELHEHAKVASATAAGAVTAHTVYDVL
                     KTCARYATTLLPEMRRAVGLDVLLAACYAFVRTHSARQGERRWRRLYEQYPGLSEIVA
                     AASAATATPSAQGEGSASAAAGGSPSPLRRVFLSPPKEPATAGSSATVMPESAAPLPD
                     VFAAHLRQTEGLALAAQWRCRTMSAEVTALRESCAALEATAQRDEAAAAEVERYLGEV
                     RVYVQALWRAETEMQQLCAAAAAMCAAPSSSATAASTLHELRYALQRASAWAAERKAA
                     VDELLALEQDAVCELDAELARLRAVIC"
     gene            <699984..>701675
                     /locus_tag="LMJF_18_1560"
                     /db_xref="GeneID:5651087"
     mRNA            <699984..>701675
                     /locus_tag="LMJF_18_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682513.1"
                     /db_xref="GeneID:5651087"
     CDS             699984..701675
                     /locus_tag="LMJF_18_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682565.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651087"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN3"
                     /translation="MFPVDPAHESALADPLFMLRLYKRIAYGLVRRPHADGARALLPS
                     FLSVDARYVESNNAAVDAAELLTAVEPIFPTSLLTNKEVCLLLRVLPLGEEESTPSSE
                     NEDAFGAAQRGRCSTVHKGIRPGSVTLALREIIPFRTWQVSQTVATVRRTVQKSAVMS
                     PFEEHVVDLLDWQSSRRRQATEAAPPPLQRWEALAFMENTCGLSSSESRGLLHYCASE
                     EGDNSEDGAATGSYLGCEVQLLHQLLFSETIPGVAEYPLLMGRFAEATLEIGETDGCR
                     TGTLALLSVLELIELHYPERSRRLSPDLDIGALVRAELTPRHFFYVCTRLRTEFRQEE
                     SDQLYYYLKKDRETDDGVLVADLLAAYRQYFPSVTVSMLQLVQAAVVQWIRRNAKDAP
                     AFVQLYSALREWGAAHVPIKSFIKALRAAGVPDGISGVLDVELEWLRLKSPTRVDLLL
                     MLCSPVPPSRAAIIRKLFDRLDERRLGTVACAVVLRCFHPELIEGNALRRQGTMWKKA
                     LEAYAAELGEGELDYDVFAYFWYMISADIEDDPTFTMALWQAFGLSDDGQRSRRT"
     gene            <703571..>704035
                     /locus_tag="LMJF_18_1570"
                     /db_xref="GeneID:5651088"
     mRNA            <703571..>704035
                     /locus_tag="LMJF_18_1570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682514.1"
                     /db_xref="GeneID:5651088"
     CDS             703571..704035
                     /locus_tag="LMJF_18_1570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682566.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651088"
                     /db_xref="GOA:Q4QDN2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN2"
                     /translation="MSGLELIALVPIGIAGWKLLQKLGDQQSLIAQHELTINSQKEML
                     QSIVNADRAGPLSRLNLAVVAGTLVLAGTVTYKSWTLTKSFTVRPPPNYEPTPATFDA
                     EQCVICLENCKDTVFLPCRHLCTCWSCASRIGNSACPTCRAPIEAMQFVYQQ"
     gene            <706392..>707336
                     /gene="NH"
                     /locus_tag="LMJF_18_1580"
                     /db_xref="GeneID:5651089"
     mRNA            <706392..>707336
                     /gene="NH"
                     /locus_tag="LMJF_18_1580"
                     /product="nonspecific nucleoside hydrolase"
                     /transcript_id="XM_001682515.1"
                     /db_xref="GeneID:5651089"
     CDS             706392..707336
                     /gene="NH"
                     /locus_tag="LMJF_18_1580"
                     /codon_start=1
                     /product="nonspecific nucleoside hydrolase"
                     /protein_id="XP_001682567.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651089"
                     /db_xref="GOA:Q4QDN1"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN1"
                     /translation="MPRKIILDCDPGIDDAVAIFLAHGNPEIELLAITTVVGNQSLEK
                     VTQNARLVADVAGIVGVPVAAGCTKPLVRGVRNASHIHGETGMGNVSYPPEFKTKLDG
                     RHAVQLIIDLIMSHEPKTITLVPTGGLTNIAMAVRLEPRIVDRVKEVVLMGGGYHTGN
                     ASPVAEFNVFIDPEAAHIVFNESWNVTMVGLDLTHQALATPAVQKRVREVGTKPAAFM
                     LQILDFYTKVYEKEHDTYGKVHDPCAVAYVIDPTVMTTERVPVDIELNGALTTGMTVA
                     DFRYPRPKNCRTQVAVKLDFDKFWCLVIDALERIGDPQ"
     gene            <709770..>710411
                     /locus_tag="LMJF_18_1590"
                     /db_xref="GeneID:5651090"
     mRNA            <709770..>710411
                     /locus_tag="LMJF_18_1590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682516.1"
                     /db_xref="GeneID:5651090"
     CDS             709770..710411
                     /locus_tag="LMJF_18_1590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682568.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651090"
                     /db_xref="UniProtKB/TrEMBL:Q4QDN0"
                     /translation="MSCDAGLLISVKGKREGELEITHYPTKLTCSFCVSLAEKRRGEA
                     LFLLYRLRVKESSILFSKTYGLLGHDKAGQAQPSTWDEIALYAQPAVMEMGKLSTIRV
                     EYVTIAEAEARGLIERGEVEKEFCRPFFTRGSTKHYEVKCTFHDASPQTVAKNGTETR
                     DIGKSAGGSLVKSAATAVTLFTAACVVVGVVAARRRGVTWESAARAVHSWTGV"
     gene            <712420..>714810
                     /locus_tag="LMJF_18_1600"
                     /db_xref="GeneID:5651091"
     mRNA            <712420..>714810
                     /locus_tag="LMJF_18_1600"
                     /product="putative kinesin"
                     /transcript_id="XM_001682517.1"
                     /db_xref="GeneID:5651091"
     CDS             712420..714810
                     /locus_tag="LMJF_18_1600"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001682569.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651091"
                     /db_xref="GOA:Q4QDM9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM9"
                     /translation="MSQRRVEVAVRVRPDTESRHNSCVSLNHATRHISTQDDTGANAL
                     VGRRFYKEDFLFDEHVSNRAVFEELVLQKMRAATPEHPDTLCFLAYGHTSSGKTYTIA
                     GSEQEPGILALCVEELLRGEGVVEVAMLEVYLESVNDLLAHGEPRHIRRRQGMQGPVI
                     VVEGLTTCSLTSVEQWNAVAAYGMNSRRTAPTERNPRSSRSHAIFTIKSRGVRLCFVD
                     LAGSERQTVFSPQLNKESISINKSLSRLSTVLEALSNQKVAQDGTRSYVNFRDTTLTV
                     LLQRYLTGASMTTFLACVHPSADYYQETLSTLRYTQRLKRIRTRVTKADEGEWSGMRV
                     SEHQVLLDELSRLREQVKVSENTTKLVEATHRRRIAELEHTLAQQGGLHDGAAGASAP
                     LLSAPREVSARRARDTRRVAGWLLSRVLGDLPELNVGYDAYFDAYFPPSVQVIGYVSA
                     MASLVPRTAGDDPLAFLDVGDLAMGLSMLDAGVPPFVRLHKSLCSDPSSWEGCEWDGA
                     QNVVYVLAFFEYHPTAMSPAAGDAAGMEEALTCCGGYVTSAPLLPIATVLCVAASTTR
                     RVKEEVLQRLVDLQCEQHEAVAEQAKTRARTPSLSSSMLLSRQDGFPSEASLLDTSDM
                     RNVSEAESHDDASASTGSTSGGALLALELRRQTADTSHIVTPFQEEEEGSASDGRSCD
                     SREAARAEMRSAEMHRHLPGELTSLSRPSVPPPRACKAEEPSQVRGGSAAAVSSPPLM
                     PASCKSFSALRTSGTSSAPLPPADELPPARTSKRRNRIAGEGKTVNMQSCQGCSSM"
     gene            <715435..>717399
                     /locus_tag="LMJF_18_1610"
                     /db_xref="GeneID:5651092"
     mRNA            <715435..>717399
                     /locus_tag="LMJF_18_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682518.1"
                     /db_xref="GeneID:5651092"
     CDS             715435..717399
                     /locus_tag="LMJF_18_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682570.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651092"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM8"
                     /translation="MAVTKEKKSFKKFAKKHLAGVIETRRKTAKSKKEKLERLERKKA
                     REAKNAAREEKEHMDQLERLKDTDPEFYSYLEEEDPTLLEFGKEDIDVVEENDCSDAE
                     TEVDDEESRGGESDADNREADGGDEEGSDGAALRRGRITREELTQLTSAGSGVESCID
                     VFVSAVRELGYQVKEHPRPQSTRKFEEPALVKEALVSVAQHVGKQLSTFITGKGSFKS
                     HKTRMLVKRLLMALSSLIGEGNIDAVLSASLLHAIVPFVPLLHYVRGVTKTVLKASLN
                     LCAAPEESVRVAAYMVVRSVATRAAGTRSMYQSAAFKGIFLTLIRTAHQYNIHNQTTV
                     AFLMNCVVDLYGTDMEAAYQHAFVYLRQLAIYLRAALQQQTQSNVRAVVNWQYLNALR
                     TWGAVVSTYSEPNQLGPLIHPVVQIATALMDLFSSPRMFPMHLQIIEVLNHIASRADG
                     LYIPVAPYLLRILTSPSVALSQAQNGVSSSADRVDLLFTIRVKKSQARNGVYHRDIWQ
                     EALYLLTEHLSTHSHTVGFPEAFWAVESTLRKLRTQVRVPKVHSSINNLLRHIQATSQ
                     KIKAKRDQANFGPCDLAAVKQFEDELKQKGSALASYYHTMRQQRIDDLAAKHKDASGE
                     RVTLESVAGKHKSSGKAGGKRNRPQVRRDA"
     gene            <719270..>719701
                     /locus_tag="LMJF_18_1620"
                     /db_xref="GeneID:5651093"
     mRNA            <719270..>719701
                     /locus_tag="LMJF_18_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682519.1"
                     /db_xref="GeneID:5651093"
     CDS             719270..719701
                     /locus_tag="LMJF_18_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682571.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651093"
                     /db_xref="GOA:Q4QDM7"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM7"
                     /translation="MDSLYNWNDSTKIGVAFTGLGMFFTFMGIVMLLDSILLTMGNFL
                     FVAGVAMVMGPKRCKAFFIARQRASACFFVGILFVILRWCFIGLCIQGFGALNLFGNF
                     FPVLVRVLESAPVIGPIILSAPVQKVLSLMHVNDVRNLRNV"
     gene            <720682..>721359
                     /locus_tag="LMJF_18_1625"
                     /db_xref="GeneID:5651094"
     mRNA            <720682..>721359
                     /locus_tag="LMJF_18_1625"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682520.1"
                     /db_xref="GeneID:5651094"
     CDS             720682..721359
                     /locus_tag="LMJF_18_1625"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682572.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1625"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1625"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651094"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM6"
                     /translation="MELTVGNRQVLLTAHKTYIEPDGLDSLRAFAQYPPLFTYLAGCP
                     ESGPIPDAVVVRRLYCVAHRITGALVDLVYRDACSGTQTERALRLTNAHPAALLPIVT
                     VKGQRYALLARQAEVSQGLGIVTTAMRGVVNAEGGFASDTYASALERVGVRLADATPL
                     SSTAFTIGNEGEPAIRLFTLTSACDEEQAEQLHRDPRLALVALKDVFAAGDAAASLAV
                     SLISATA"
     gene            <723697..>724467
                     /locus_tag="LMJF_18_1630"
                     /db_xref="GeneID:5651095"
     mRNA            <723697..>724467
                     /locus_tag="LMJF_18_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682521.1"
                     /db_xref="GeneID:5651095"
     CDS             723697..724467
                     /locus_tag="LMJF_18_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682573.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651095"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM5"
                     /translation="MTTTMDPDAPSVLTSEVYNAAEAIFNMLQNKEKLVSFLDCTTLL
                     RGMGMNPTHDDMDKLKELMAQPILRLEQWRREEELKREKERRKEEARERKGKARASAA
                     HGRKSIVKKVTDPAAEAAPVDITPAEEIKNIDWNIFIRCTEMIFRDRMREERAVLEAL
                     KVFAGDSSAIMSRDRLIEIVTTNGDNVFTPTEVKMLVTMLPESCPVKEWASRIEGTYV
                     APTQEEIDAAAMREIEARRQQEAAEKQRETEKDPLEGL"
     gene            <725300..>725656
                     /locus_tag="LMJF_18_1640"
                     /db_xref="GeneID:5651096"
     mRNA            <725300..>725656
                     /locus_tag="LMJF_18_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682522.1"
                     /db_xref="GeneID:5651096"
     CDS             725300..725656
                     /locus_tag="LMJF_18_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682574.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651096"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM4"
                     /translation="MSEMNLIVNITCNPPVISIFGPIKESTIDRLNETIPNSCSTTNT
                     GKTPFALVRKEDPPHWFGELRTQFATEDIGTSMLFISVLDALEEERVWKLRGSTSLNH
                     DGNKTTYKFFFVRGAH"
     gene            <726872..>728614
                     /locus_tag="LMJF_18_1650"
                     /db_xref="GeneID:5651097"
     mRNA            <726872..>728614
                     /locus_tag="LMJF_18_1650"
                     /product="putative chaperone protein DNAj"
                     /transcript_id="XM_001682523.1"
                     /db_xref="GeneID:5651097"
     CDS             726872..728614
                     /locus_tag="LMJF_18_1650"
                     /codon_start=1
                     /product="putative chaperone protein DNAj"
                     /protein_id="XP_001682575.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651097"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM3"
                     /translation="MTAIQLSSLPLATQMLLDPAVVLDQDILEEWNAACAAAGSQSIE
                     HTGVDVSSTMARGGVARRREPRRLVDTNDFLKLAEALDTLADELNVNAALGGASPSLA
                     ADPPAKAARRNLNVDELDPLGVDGLMGVQLEDAHEAHRLFGAKEYTAAMAAFLRVSSA
                     CLAHELTPALLNNVAVCHFVMEQWSACEAATRRVLAVDRTERYPSARRLVRVFISQGR
                     LQEAQQAVSPHRDAIDWAAEVAAVKACTSYTNFYAAHQYSKALESLEVVLSLCPCGTL
                     EAAKARLLSLENAAQAVSYAAQRSRAYATSTELHFCLWSLTFHSVTSVVGLDTLLADM
                     QATPLGRSELRFRHLHTHIARCKEALAKLQVLKTARQWREAATFVTQVLAEPFLPDGL
                     KGVMYYERARALAQQASWYATLDDTHRALSYTEAVSLRANMLLLVARCEEALGRLRDA
                     VYHTEESLGLASNAAAVEQLRSLKARWAHVQASTDAPRTTPRTTSKETPKPNTNANAF
                     SPVSRASLDVHYKTLSLPRSAGAAEVKKSYRALAIKWHPDRWCSASTEAIRTAESTFK
                     TIQHAYEEIMKSAS"
     gene            <729902..>731965
                     /gene="GSH1"
                     /locus_tag="LMJF_18_1660"
                     /db_xref="GeneID:5651098"
     mRNA            <729902..>731965
                     /gene="GSH1"
                     /locus_tag="LMJF_18_1660"
                     /product="putative gamma-glutamylcysteine synthetase"
                     /transcript_id="XM_001682524.1"
                     /db_xref="GeneID:5651098"
     CDS             729902..731965
                     /gene="GSH1"
                     /locus_tag="LMJF_18_1660"
                     /EC_number="6.3.2.2"
                     /codon_start=1
                     /product="putative gamma-glutamylcysteine synthetase"
                     /protein_id="XP_001682576.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651098"
                     /db_xref="GOA:Q4QDM2"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM2"
                     /translation="MGLLTTGGAPIQWGTDANSKAIPHVREHGIQQFLNVFKSKKDLH
                     GMPFFWGEELEHQLIQLHDDTVTLSTEGAEVMNKLRARPDNCAVWNPEYGSFMVESTP
                     DHPYTLSVESLDSVQDNIARRYHMLNEEAPPGVVGTTFVTFPLMGQGNFVHCSDKSSP
                     YSQSLFVPDACINQTHPRFANLTANIRLRRGQKVCILVPLYVDSRTMQDTVDPRLNID
                     LTPHNKDIFHSRRENGRSMTDELYAHTDASAALLVPSSSLDPREDYPVTETLKQLFTP
                     AALYYYAQYFTGQHREHMQERYNACNYPVTLVSHPCIYMDCMAFGMGNSALQVTMQLD
                     NIHEARHVYDQLAILCPALLALSSATPFQKGLLCDTDVRWLTIAGAVDDRRVEEVPHI
                     LKSRYDSISVFISDRTENLEEFNDSQIAINRSYYELLKDSGVDVRLANHIAHLFIRDP
                     LVMYDKMIDIDDTTHTEHFDNIQSTNWQTVRFKPPPLGNDIGWRVEFRVMDIQPTPFE
                     NAAFAVFIPLLTKAIVNYKPCFYTKISIVDENMGRAHRINPCGEQYIMRKDIFAHKCT
                     ASDEETARMSIDEIFNGKEGGFYGLIPLVCRYLDDEGKRSPLVNSYLKFLSMRASGRI
                     PTPAQYMRKFVTTHPDYKHDSRLTDSIARDLVQRMHGLASNQIHDDDYLPISVFKATT
                     RESVK"
     gene            <735997..>737718
                     /locus_tag="LMJF_18_1670"
                     /db_xref="GeneID:5651099"
     mRNA            <735997..>737718
                     /locus_tag="LMJF_18_1670"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682525.1"
                     /db_xref="GeneID:5651099"
     CDS             735997..737718
                     /locus_tag="LMJF_18_1670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682577.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.18.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.18.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651099"
                     /db_xref="UniProtKB/TrEMBL:Q4QDM1"
                     /translation="MWPMSASDRDHLPRIHAMAASREDHISTMPSVAAACRVSEPLPR
                     LYTSAAMLGRIYAPSAPHRITNGTASTHGRATPGRRFHAVPAESRAAKTKYMHCRYPY
                     HLMPLGSSFHTPVCYYRDALRFAQTVEESQRTAIKFEERRCWSRLQKKCTSHAQRLAP
                     TSRQTPHLACSAKPPQPVKTVEPAAFPIVAYDSMSSVAESKLEDEDDNSFAPPSPRVL
                     QEKEANNIVENVMRASNVSAHAGESATGNSSTLPLFLGDEPSRRPCETKRHLPALPAQ
                     LTGPSRLAASKFDERDAGAQHEVLEQQSPLLVETPLTSHVTSLSISHHYTEPAPAVAP
                     ASEFAVYPLVPRAAAHEDSSTTLKTVTMSGTPHDNPGALIGLDTLRTERLLEALQWVE
                     AAIQHAAELKAHKSTAPPQPCLLDAAHRTAVRQGTKPIQPPQHTPQEEHPPWERTPMT
                     EVVPRRENVPFEGLEELRPLRRKEAVALVSSCFSAVLGAVSESMRSKGTPDTLHAAIT
                     APTEDETAASPSPSVPPRPTSAASEGILRQLRLDVSRTMVSSILSCTAAVHRPLVPCN
                     RIYSADR"
CONTIG      join(FR796414.1:1..739748)
//
DBGET integrated database retrieval system