GenomeNet

Database: RefSeq
Entry: NC_007261
LinkDB: NC_007261
Original site: NC_007261 
LOCUS       NC_007261             742537 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 20.
ACCESSION   NC_007261 CT005259
VERSION     NC_007261.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 742537)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 742537)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796416.
            On Jun 1, 2012 this sequence version replaced NC_007261.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..742537
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="20"
     gene            complement(<2300..>5698)
                     /locus_tag="LMJF_20_0010"
                     /db_xref="GeneID:5651531"
     mRNA            complement(<2300..>5698)
                     /locus_tag="LMJF_20_0010"
                     /product="putative DNA-directed RNA polymerase
                     polypeptide"
                     /transcript_id="XM_001682703.1"
                     /db_xref="GeneID:5651531"
     CDS             complement(2300..5698)
                     /locus_tag="LMJF_20_0010"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative DNA-directed RNA polymerase
                     polypeptide"
                     /protein_id="XP_001682755.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651531"
                     /db_xref="GOA:Q4QD43"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q4QD43"
                     /translation="MVTGAHAMSDFGDEYQRKKLEMLPALMGMRGILNHHIASFDHLI
                     EVELQRILLNESNVEIKSTVDPDFVIRYQNIRICRPQEIVGKGHIPKLVTPQECRIRD
                     MTYRGDMIVDVQYTSRDRSRAMLVEKDVKIGTIPIMLKSKCCNLYRKTREELVNMREC
                     PLDPGGYFIIKGVEKVCLVQEQQSKNRVIIEADEHGNISAHVQSKTHYSISKCAVTFK
                     KGSIVLTHRSFTEDIPIIVVLKALGLENDQHITQCIGTLPEFQKILFPCFEEARLLNV
                     VTQNDALQYIGEKRKETVWEAEETQQRQVNRSKADKAAEFLANVLLCHIREAQVQKDW
                     NFRHKAFYVCFMVRGMIEASFDTSLLDERDFYGNKRFETTGTLMALLFEDLLKQFNRV
                     VKTAMDQQLSRKDSTRPFNVKQLMESKMEVIQNGMRMAISSGRWDLKRFNMNRQGITQ
                     VLSRLSYIASLGMMTRLASSFEKTRKVSGPRSLQPSQWGMVCPCDTPEGESCGLVKNF
                     ATLSQVTLDLNDNYVRAAAHALGVEEIDTVTPTDFLHYCTVFLNGTLIGIHRYPNRLC
                     AGIRTLRRSGRLHPHVSISTQPRQRTVQIGSDGGRIVRLLIIVRDGKPAVTSAHLDRL
                     RDRLCTHNDFLAEGLTEYVDVNESNDCLIAVYPADIGPYTTHLEVEPLSLLGVVAGII
                     PYPHHNQSARNTFQSAMGKQALGTVALNQYIRADTVLLLGAYPQRPLCRTKAMSLTHY
                     EKLGAGINAMVCVMSYSGYDIEDAQVYNKSSLDRGYGRCVVLRKHEVDLEKYAGGEFD
                     VILPPEKNSGTGKFKALNPDGVAGKGALVQQYDVLVNKFTPVAGGDPRPAPLVYKYPQ
                     PAVVDHVIISPPGDYDRSLDVDQKIKVVTREVRPPEPGDKFSSRHGQKGVVGLIVNGV
                     DMPFNERGMCPDMIMNPHGFPSRMTVGKLLELVCSKAAALRGSMGDGTAFGGESADSI
                     SQQLLSFGYNYHGKDVFYSGITGELMQGYVFFGPIYYQRLKHMVTDKMHARSTGPRSM
                     LTRQPTEGRSRSGGLRVGEMERDCMVGYGASNLLNERLLISSDMFTADICHVCGNLGY
                     NNRCTYCKTKGTTSKVNMPYAFKLLIQELQGMGVSLRLTMDSPT"
     gene            complement(<6340..>7572)
                     /locus_tag="LMJF_20_0020"
                     /db_xref="GeneID:5651283"
     mRNA            complement(<6340..>7572)
                     /locus_tag="LMJF_20_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682704.1"
                     /db_xref="GeneID:5651283"
     CDS             complement(6340..7572)
                     /locus_tag="LMJF_20_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682756.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651283"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QD42"
                     /translation="MLFLARDGMRGHLVDVETQTVLRNYAIGEVATNALAYSPISQAV
                     IAHQTRNCALFLSAATQQPLQRSFTPELVTSCAVTQCGTFMVAGTANGTVFLWNLQSG
                     DLIKSCKGHLRAVHCAAISADDSLVATVSEDSVCKVWDLATLASLRMREVVPRCIFNA
                     HSLAVTCCTFLHHSNVLLTGSSDRTCRLVDPHTGEQLRSVTVGDAVTAVTVSLDDASI
                     VAGTQKGFLFFSELYEPSVGLAIESERDGGHREAILRPPSADGHHSPVIFLRCLPSAP
                     SLVLTASESGAVLWFDIQNGRLVKECISPQKGRLLGCCVVPQAALLVKGICAPLQKHP
                     VDPSRGNYRITQCALTACQGRRGVKRDRVREGDVRLGPGEKADANALEEVRAKVVELC
                     DLRAQLQRRLRKLSAAKR"
     gene            complement(<8574..>9413)
                     /gene="DOT1"
                     /locus_tag="LMJF_20_0030"
                     /db_xref="GeneID:5651284"
     mRNA            complement(<8574..>9413)
                     /gene="DOT1"
                     /locus_tag="LMJF_20_0030"
                     /product="putative histone-lysine N-methyltransferase"
                     /transcript_id="XM_001682705.1"
                     /db_xref="GeneID:5651284"
     CDS             complement(8574..9413)
                     /gene="DOT1"
                     /locus_tag="LMJF_20_0030"
                     /EC_number="2.1.1.43"
                     /codon_start=1
                     /product="putative histone-lysine N-methyltransferase"
                     /protein_id="XP_001682757.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651284"
                     /db_xref="GOA:Q4QD41"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QD41"
                     /translation="MHKRLRRADNAAPQPVKTPKLANREQPLSSPVEHGDGTSRSPYR
                     LPLRKTPNASGCLHCPTHTCHCVWFGAQLEHCYASLSLKRETERIKKRELCAKSILPP
                     FVTRLIRIANVAPGETFYDLGCGNGSVLFQVAALTGARCVGVEINPHNAEVANAAWAF
                     LRPIFEAQFKRELSVEIVCADFCTLLRDAVYFPTPCVIWAANLLLPRPVNHYLSERLR
                     SVPRGTRIMCFEDMYPHSRSLARLRDPDAFEKFDMLDYEWQPDSVEWCSNTGRFFLYV
                     KRT"
     gene            complement(<12206..>13177)
                     /locus_tag="LMJF_20_0040"
                     /db_xref="GeneID:5651285"
     mRNA            complement(<12206..>13177)
                     /locus_tag="LMJF_20_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682706.1"
                     /db_xref="GeneID:5651285"
     CDS             complement(12206..13177)
                     /locus_tag="LMJF_20_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682758.1"
                     /db_xref="GeneID:5651285"
                     /db_xref="UniProtKB/TrEMBL:Q9BJ45"
                     /translation="MMLSAADIHAFVRDERAWKRAAQKPGGGDALAAGMISSKESNWL
                     VFRRGTSDNAFSLKFSNTLRTSVFADSFDSAGLPNTRSTVPRQRWNSSVRCASEDAYA
                     DPLQQLLIRNMQKKGVAAVLNKRKLSQLARPSYISHAAQEARRRNDLTHAAQELIDLE
                     RYERHQLVATARSRFNTMVSAFFGAAVKDMTACELRGRRALFREWQEARRHMAASMDC
                     EFSKLTSTAPHEFKAICRLIRSEAVMRRRVQATEAQDRDLYARFMHLERLKALGKELN
                     ECPRREVLHEAAAVLALAQKDRARHVDAARWHGSRATSVGRVNGKRL"
     gene            complement(<14636..>15112)
                     /locus_tag="LMJF_20_0050"
                     /db_xref="GeneID:5651286"
     mRNA            complement(<14636..>15112)
                     /locus_tag="LMJF_20_0050"
                     /product="anti-silencing protein asf 1-like protein"
                     /transcript_id="XM_001682707.1"
                     /db_xref="GeneID:5651286"
     CDS             complement(14636..15112)
                     /locus_tag="LMJF_20_0050"
                     /codon_start=1
                     /product="anti-silencing protein asf 1-like protein"
                     /protein_id="XP_001682759.1"
                     /db_xref="GeneID:5651286"
                     /db_xref="GOA:Q9BJ46"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="UniProtKB/TrEMBL:Q9BJ46"
                     /translation="MADPVLQLLEIELLGANPDAYTNQFQWRMRVEATASLPQTVSVS
                     FVWVGSASSSQHDQVLDDFEVGPLEKGITEFTLECDAPQMELVPVEDVVGVTILLISF
                     QYRGQEFLRVGYYTQVAYFDAQLNRNPPPLPQRELLGRFVAMPQPAVTVNPIDWGQ"
     gene            complement(<16100..>19597)
                     /locus_tag="LMJF_20_0060"
                     /db_xref="GeneID:5651278"
     mRNA            complement(<16100..>19597)
                     /locus_tag="LMJF_20_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682708.1"
                     /db_xref="GeneID:5651278"
     CDS             complement(16100..19597)
                     /locus_tag="LMJF_20_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682760.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651278"
                     /db_xref="GOA:Q4QD38"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR002093"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015187"
                     /db_xref="InterPro:IPR015525"
                     /db_xref="UniProtKB/TrEMBL:Q4QD38"
                     /translation="MKPIACPHCTFINPPSKVKCGVCLRLLRKRERTVDDASPATPSR
                     GRKGTPSPSSTPPEHDAPATGASQVRCDTTKSPMPLAAPESSSTASAQAVQPPDVEAM
                     AAAPPLVPTLFSTASGKPVTVRRESLQKVAERLGDLAAPDMEARVPTLFETGRGKTVT
                     VQKRSLVKAKASMDSLGADGAPCTSAPALSATPGGAAVRVPTVPMQPPAEHLRLRSLS
                     DKDDTADTAPVLRTGAPRQTPLAEAPSTGLTTSTSERSLRALAPHRIGGQRRGFVPPQ
                     QRPTAQPLAKLTHAMPLVKTTGLTILRFNPDACTCRSITPSPSLSLITSLMFSFKGSD
                     CGKVLAALLDVSGGESVQPVHWHTMLLKLGASPKHCTIEWCRHALVSAMARVHFMTKA
                     PSGAVPSAFSPVTVLLCIMQMYNAEMVNGGRPALRKMVEGDISSASLVVLYMSSVREE
                     RSSPHMRIVTLSDGIYHLKVTCDIPLSNLIREGVLKPGQRMAVCGAKSLLHRQCAPTE
                     CEGQVVLSINYNCVRAVAQQTPLGVYHGEPLPLPLSLVHPLGGLVPAIEGVVARTLPS
                     FFMSEEVTETSGTADGARQARNRVFKTVRNAHAQLQVTDRLRREAESRADGEAAPSKL
                     LSRVTSLLIVKDNAEALVQQWETVDERALLADDDGGASLPVEGSWVTLYAVNPAKSRT
                     AAAPFTRAKLFFSSRKLYYVPSKNPPQHLRRIWMAATDNNSTTGVGDVADVCGLYVGS
                     HRNEQGTFALLLLCNDTYALLQIPVPSAGRALSLPLPTTERLSLVVLNATFLTGEDPV
                     AGSDCCRLFANEYTAVLQRSTQANLKGALETAAQLRGLVDAAPQKYAARKAEVFRCLD
                     EGEPRGGLGLGSSTALTDRDNPGVPEVPLNVWRDAPLASPSAAATSPVLAQRDGRLPY
                     YLRHDNGRVRAGNLTGVLLPSAALPTPAAPTVVQGPYSATTIHPGVREPLVQPANSVA
                     GARSRHYGNIADLMFLFDPRLNRRAWHPLTDPLQATASAAVGHGEGFRRAQLCWRLSA
                     DSADDMTCRVEESSILGTVLESVCPLQELCSVIADERHIDVSLARSERLVQWRRQDSL
                     SVWWRFFTDSRTLASPADLDGASSEHLWWLPAEWTEAMRTVSAKLQAAFFYFSLSGEV
                     LRHVRLISDCCSVAELPCD"
     gene            complement(<20661..>21272)
                     /locus_tag="LMJF_20_0070"
                     /db_xref="GeneID:5651279"
     mRNA            complement(<20661..>21272)
                     /locus_tag="LMJF_20_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682709.1"
                     /db_xref="GeneID:5651279"
     CDS             complement(20661..21272)
                     /locus_tag="LMJF_20_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682761.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651279"
                     /db_xref="UniProtKB/TrEMBL:Q4QD37"
                     /translation="MSSSRTPLQGVEWPSSLLRTVKRHLDHVEDAVRPSIPPMPSSAL
                     TIYDFFETHHDAIEAQMLGSGFDAALTECCTAFLIGVLEQSCSLSFLLSRERRIIAMT
                     VRQLEKRLLSKARSNAMDSKRRRLDERTASEPRYARVLTLEYLLRLYVSLPMILEHYD
                     KLGSARMPSYATAPLCCFINITMQILSADPRLFSPITEYVPLR"
     gene            complement(<22912..>24927)
                     /locus_tag="LMJF_20_0080"
                     /db_xref="GeneID:5651280"
     mRNA            complement(<22912..>24927)
                     /locus_tag="LMJF_20_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682710.1"
                     /db_xref="GeneID:5651280"
     CDS             complement(22912..24927)
                     /locus_tag="LMJF_20_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682762.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651280"
                     /db_xref="UniProtKB/TrEMBL:Q4QD36"
                     /translation="MPLCVRLPLSYEKLLSCVVDVAALFDFSLHIFLGVRQPIPVRLP
                     PSLAEATTATATLLSPSLCTCRLHIHTRSSRLQHTLFVLSCLSPSKGADPIRMNRGVA
                     VKIKYFDDNGGWSERKSAAASSAVFALKNITVANVDLNHVDTADVDRLQDLVVASAPT
                     AVVMQNVSPATLSRIKSYSQIRKAYAVMETSRCEQQEDSTIALLRLGLQCEPTEVPKT
                     DGKQAFRALVQVNIRIPNGPSLSITVLHMEPGASRRLTFAMALLRAHPNVDIAVLLSN
                     VTEGMVLTEDPYRELQANRATAGFVDVMEEGMERTSNWTTPWTVWLKSPKYSVVASAA
                     ELFVGQEPRYLSTTLVVRGQPNSTIAIPMPRSAKSCRGKSPSGPPAPGTPSQPLADPA
                     ILSAETVKTPMPAPQTNSSATEIIQRLMRQQQASQQRWKSTHSFLLKGSDTKLSTAEA
                     MYDVSSHFANANDAVDALNSKALSWPAEFCVVHNTVLCADTVVHCDRQAFRRYVRDNK
                     TNVNLNSQIFAATTAFAAAVAAAPVVTPVAAASAGLAASAIPNDKQWPKATNVRSEME
                     EFLNFQRQLKESARREWSESCCVSVYQITPREMKFNITPAIGLAKDNLKKAIHYLNHA
                     KTASKETNPLYDYPYDYALLFSVERQGYWLIAATHVPCDIVACRMVV"
     gene            complement(<27027..>30359)
                     /locus_tag="LMJF_20_0090"
                     /db_xref="GeneID:5651281"
     mRNA            complement(<27027..>30359)
                     /locus_tag="LMJF_20_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682711.1"
                     /db_xref="GeneID:5651281"
     CDS             complement(27027..30359)
                     /locus_tag="LMJF_20_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682763.1"
                     /db_xref="GeneID:5651281"
                     /db_xref="GOA:Q9BJ49"
                     /db_xref="InterPro:IPR003929"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:Q9BJ49"
                     /translation="MPLKGEQAGSFPRYLSPTHPRKGYVEDATSGADGVYPIDLTISH
                     RSGNQNLPPLKRYWRARSVRRNLAQTNELDDLENQAHVQKSLSWSNTRAAHARESDFT
                     YISGPKYFFQQFVRQYPIAAFFAWTFLFLVELSMVVLYMLQSTVSYNVTWVQYDTHER
                     SGWFYARSLLSFISLVQMFFAYSLSLMTITVVLITSIYQIIIFFVSIPSNLGWVSRMY
                     VPYFMRCWPMRQYFLFILDSVALMMPRNRKLDLLRLAAGPLTLFICMVFSASGFFRID
                     QCFRGYPMNVAVSIYFVIVTVSTVGFGDVVPKTPDGKAITIVIIFVFIAKMPTFIRVI
                     RSTAKILKAYRSYTGRTNHFIVYGHVNREEVISILDEVFCLYPMKSVCFCSKEFAPDV
                     LSIGRHPTYRLRSTFLIVDTLDTFALRRMKAQEASAVIIFPIREGYSSRVDDDVMLAA
                     IIFERFVPKVPQYVWLRYGLHAKLLKGQRSCVIDEHMKKNIMASALLLPGIVPFLVNL
                     VRTAWAEGEEPADLWTEKGIDQWKSQYEYSRRNVISTCPVPLRFLGATFGQVVASFKY
                     RDVLIVSVEDNASKTMRFELNYRLEEHDVLMAVYERTRNSLSRALEEFSSPGPLNEAV
                     RETYGAHFRQDLQKDELLHENMNSSFVFYPYKSSASLCDTVPLQSPAATGGGAADKEE
                     DHANLKSEDEVVSLEEVRQALMSLSDVVRAPCGIPLASLQLRRKITSQLWYLTRRHQS
                     LLSDSTLPDEDCEEELRRVMDQINATILKAADAYLSAISEQDRQAMESKHQDEVFLFI
                     DQTSSILRKTTTSVYEDVISQTIAQYELYVMMQCICAVHAHSRLTLLTLRKYPPQFLQ
                     TWKEIFGTPLRYIRGQGSLDAHLNYALTADTDVTNVRGILLYCSQMGPRDFGDVPICS
                     VENSVRDLLEWNEQTRNGPSGAREQNIVVELQSFLFSIKVSPFHTDAVWRSRGEGNFQ
                     ETLAFMMGRFFASNMLFTILIHSHRDSRIVKFFEMALNLTSTAEMFDKAVWTNRTAQS
                     QTLFKLCGNQSLHFETFGDAFEFLLSKRKCVAIGVFRLFPASEMLSGTPRYFVTNPPM
                     CMPLLMEDIIYCLDGSLNMMRT"
     gene            complement(<32976..>34415)
                     /gene="PGKC"
                     /locus_tag="LMJF_20_0100"
                     /db_xref="GeneID:5651282"
     mRNA            complement(<32976..>34415)
                     /gene="PGKC"
                     /locus_tag="LMJF_20_0100"
                     /product="phosphoglycerate kinase C, glycosomal"
                     /transcript_id="XM_001682712.1"
                     /db_xref="GeneID:5651282"
     CDS             complement(32976..34415)
                     /gene="PGKC"
                     /locus_tag="LMJF_20_0100"
                     /EC_number="2.7.2.3"
                     /codon_start=1
                     /product="phosphoglycerate kinase C, glycosomal"
                     /protein_id="XP_001682764.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651282"
                     /db_xref="GOA:Q4QD34"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="InterPro:IPR027250"
                     /db_xref="UniProtKB/TrEMBL:Q4QD34"
                     /translation="MSLVLKKSIDDATVRDKKVLIRVDFNVPVKNGKITNDFRIRSAL
                     PTIQKVLKEGGSCILMSHLGRPKGARMSDPSPEKGVRGYEEAATLRPVAARIAELLGQ
                     KVEFAPDCLDAAAYASKLKNGDVLLLENVRFYAEEGSKKEEERDAMAKVLASYADLYV
                     SDAFGTAHRDSATMTGIPKVLGAGYAGYLMEKEINYFSRVLNNPPRPLVAIVGGAKVS
                     DKIELLDNMLSRINYLVIGGAMAYTFQKAQGRKIGISMCEEDKLDLAKSLLKKAQERG
                     VQVFLPVDHVCNKEFKAADSPLVTESVDVPDGYMALDIGPRTIHMYEEVIGRCKSAIW
                     NGPMGVFEMPCYSKGTFAVAKAMGTGTQKNGLLSIIGGGDSASAAELSGEAKNMSHVS
                     TGGGASLELLEGKTLPGVAILTDKDVKERGASCRFAFGVGSPSREACPLRCGHIFGGA
                     SIVREIVKLVVALLIGIFIGRRMSTKLIR"
     gene            complement(<35830..>37083)
                     /gene="PGKB"
                     /locus_tag="LMJF_20_0110"
                     /db_xref="GeneID:5651287"
     mRNA            complement(<35830..>37083)
                     /gene="PGKB"
                     /locus_tag="LMJF_20_0110"
                     /product="phosphoglycerate kinase B, cytosolic"
                     /transcript_id="XM_001682713.1"
                     /db_xref="GeneID:5651287"
     CDS             complement(35830..37083)
                     /gene="PGKB"
                     /locus_tag="LMJF_20_0110"
                     /EC_number="2.7.2.3"
                     /codon_start=1
                     /product="phosphoglycerate kinase B, cytosolic"
                     /protein_id="XP_001682765.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651287"
                     /db_xref="GOA:Q4QD33"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="InterPro:IPR027250"
                     /db_xref="UniProtKB/TrEMBL:Q4QD33"
                     /translation="MSLVLKKSIDDATVRDKKVLIRVDFNVPVKNGKITNDFRIRSAL
                     PTIQKVLKEGGSCILMSHLGRPKGARMSDPSPEKGVRGYEEAATLRPVAARIAELLGQ
                     KVEFAPDCLDAAAYASKLKNGDVLLLENVRFYAEEGSKKEEERDAMAKVLASYADLYV
                     SDAFGTAHRDSATMTGIPKVLGAGYAGYLMEKEINYFSRVLNNPPRPLVAIVGGAKVS
                     DKIELLDNMLSRINYLVIGGAMAYTFQKAQGRKIGISMCEEDKLDLAKSLLKKAQERG
                     VQVFLPVDHVCNKEFKAADSPLVTESVDVPDGYMALDIGPRTIHMYEEVIGRCKSAIW
                     NGPMGVFEMPCYSKGTFAVAKAMGTGTQKNGLLSIIGGGDSASAAELSGEAKNMSHVS
                     TGGGASLELLEGKTLPGVAILTDRE"
     gene            complement(<39879..>41549)
                     /locus_tag="LMJF_20_0120"
                     /db_xref="GeneID:5651288"
     mRNA            complement(<39879..>41549)
                     /locus_tag="LMJF_20_0120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682714.1"
                     /db_xref="GeneID:5651288"
     CDS             complement(39879..41549)
                     /locus_tag="LMJF_20_0120"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682766.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651288"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QD32"
                     /translation="MRRVARLVTGVAARSASTGEAISNSFASDTERASEESHPLLYQV
                     PVLASRTVGREAEVRTLWQNLLRGRHYQVLAGPDGIGKSTIAAEFCDTVKHSHRFSCI
                     QWFNGQHALRSQLQHFFASMKGRKEKDVLLVVDDVASPGEVVALISGHSSVYVLMTTS
                     AANVTSSTKIACLSPSALSPQASQQLLPELTFSQELETVFYNLGYVPLLVHIASLLIK
                     GDVCCAHQLGRILTEKRVRQDDTLSISAALSVLADIGIVELEKTYPDARAMLRAISCF
                     HTGDVSDAVVGAIVGEAAGDFSIKASQLGIFSPKWEEGALALHPLVARVLRGPLDAHV
                     LAKAADALLSLWPRRWRGMGSRFAYNLVWHTFTMAQHFATCEVALTPAILTAMDRSAT
                     FLAHVEARDFAVAAQLWMQVYEQHVARQEEASPDSVRMLRECGRLLHFLKDPRAEEVL
                     QHAWKGCVVVHGKSSAESALILGCLALYLPANNDNLSLVEEAVAVLEGRLASVDLVLA
                     REEVRMLWQTIFVLLMCKGQYMTEMKLAIPDDLMRALERAEGEAKKVR"
     gene            complement(<42528..>43862)
                     /locus_tag="LMJF_20_0130"
                     /db_xref="GeneID:5651289"
     mRNA            complement(<42528..>43862)
                     /locus_tag="LMJF_20_0130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682715.1"
                     /db_xref="GeneID:5651289"
     CDS             complement(42528..43862)
                     /locus_tag="LMJF_20_0130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682767.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651289"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QD31"
                     /translation="MLRRLGSTLFCSVTLANGTVLKGDLNPHNPSLLLKGITILPDGR
                     VYSGSYDATSGFPLPGSQLEEDGDLYRGDFNTQWQREGRGEAWLADGTHYAGVFKNDE
                     ITEGIVRIPNGTTEVVFEGTLSDEAFVKGKLTQSDFVYEGEFSDNEPHGKGKLVFATG
                     AVQEGTFFHGKLHGPDCKMKLDGGFVYVGEFLDGQIRRGTLYTPTYTYEGEFNEHGRA
                     QGEGTQTYLINEPRLTFTGIWTNGALVRGVCMDEYGSAVDWQNNDELQAKVLGGATGK
                     GSESVGLNSYCSARMKEAAQLHSDMQRSYAEDAEAVAQSTGRFPTKMDLGYEGSIAHE
                     NEAVMQAQQRQMQDIERSKEVLSDRARDFGPIASGSRGNIIGEIDENMARIQFRRQVG
                     AEEVSAARVDEQFERFMKSFKKPSPLPGAPAQVAQKLNIDGNAPWKAFTPLK"
     gene            complement(<45714..>49373)
                     /locus_tag="LMJF_20_0140"
                     /db_xref="GeneID:5651290"
     mRNA            complement(<45714..>49373)
                     /locus_tag="LMJF_20_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682716.1"
                     /db_xref="GeneID:5651290"
     CDS             complement(45714..49373)
                     /locus_tag="LMJF_20_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682768.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651290"
                     /db_xref="UniProtKB/TrEMBL:Q4QD30"
                     /translation="MKCVLVVHSGGERMQRSCDLPDGVSTQEQLRAFVRSQDLRLESL
                     DFTFAASLVRLTAGAAEKKGEKVVLREDADVQQLLKTAKQQRATHVLTFEVTISMSSS
                     SPRNLGSFLSAEYAVDKDLVTLHVFAPLACPSRGKNPSYQEKMFIIPTRCVLESLARA
                     VEDTLSIKLTNSGMKLVLYTMPQQPNGDQVEIIDDTSALQLLRQHASQSTPVRLTYAT
                     HTRTPKTSSGQMSRRASQQQFTAPHPPSPPPAHSTETPSNPKPHLPSLSNLASEPPSQ
                     PSREPPSQAPPERKGAIPPPSPSRKAATPSSSAPLTSPPPAAKGAPFATESAHTPHRV
                     FLREAAIPATKYEVRVQVRPAAAEGAAAAASLHEMCFVYTKKEVQLWRRFATECEASV
                     GADTARHVPVLSNDSSVRLDSDSVLREWLALAKESQQPLRVRLSPRDSVQPPPAKADA
                     PAAPTPESPVADRDAAPVGSDAATPNAAESGSSLVGSEKLLRNRTLSSRSGSAMLSPD
                     TAAPAASSSLPPHNGGTSDSSQATQRHVSSPQQHSNTPLQDISASSAPPKGLPTKVGA
                     APPSTRHAPLSPNAASSSAGAERAKDATTKASEEDTADADAPPLVIRTAAGTSSTSVT
                     AACLPCVCEADSGDASSVRFQVSARWGAAQQLMLFRLREGTALDDLRRAVLDAFCSGV
                     AGTDDVPPLTMEVSYVAAGQLLRVLLDDEAQLLDLRGALFVDSAEIHVIAPTTPPPPR
                     RVEEASGNISGTAQVAAAVLQLLADAVAQHLGSRPSVSSVEIRDLVRTQLGKQAATDP
                     FRGFLDGAVATPFDAPTPDPDGAASWGAHVLPWLSSVLAGMQAPPPAATEVAVEVASS
                     LLRSLLCDGDFLLDQLAASVRVVGGNDEASDIAAPGTTVRPSLAALWTDAGLATPTSS
                     SRAEWNPFRAAYVGGASGWKAAYAASPAAMLDLIAAGVMDGVWAFPRRRDAQADMVWQ
                     RSLAKAHRDCCESIKPTELERYFKSGDCPNGDGALDHRRVILSCVGALLAPPSASVGD
                     YAEWLTQHFRGKVATVLYTNMIDYDGRSSLSVFHVTQMSWILLHPQLRRIGEAASSLT
                     TLQRLRAWAILATARVCQRLHVPFPPCPLLHIHKASPVPFAGPALPAAVAADTAAVDA
                     ATATPKPGALFRSPCDAAAADAPAAALLRPSPPSAGAPPLTAHQGAPRKVQYACKYKF
                     DALHRPVHRGSDDAR"
     gene            complement(<51369..>54095)
                     /locus_tag="LMJF_20_0150"
                     /db_xref="GeneID:5651291"
     mRNA            complement(<51369..>54095)
                     /locus_tag="LMJF_20_0150"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682717.1"
                     /db_xref="GeneID:5651291"
     CDS             complement(51369..54095)
                     /locus_tag="LMJF_20_0150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682769.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651291"
                     /db_xref="InterPro:IPR013618"
                     /db_xref="UniProtKB/TrEMBL:Q4QD29"
                     /translation="MSEGASKPLPAAECVRWRLVYPADGQIHSLLLLIAAVIFHNGIR
                     GDLTFDDHLAIGKNADAWADKKSLGSIFYNDFWGKSLDRFESNGSYRPITVLTFRIQH
                     WLMGYRHSPAFLHGFNYTIAYLNVCLVFYLARLYVYVVVPSAALAVENAKARSLTALL
                     ISPVHAVPLMAALLFLVHPVHVDAVTSIVGRCELLYCLFGLIGFFCIHRYLDQVDETA
                     DTAPVTTAVSAAPANAKTFSPASAAAKQVLRRRRLQMRSQQRIFPARYVLFAAYALII
                     SILCKDSGITFTAIYSVHACVMYACGRCQRRRPLLVIAVAVLELVGYIAFRRQFIGHV
                     DLQKNPLLRQTENPQYFVPKGLFHWLSIRWVIQVKNLELLFFPTSLCCEYSFNCIPHM
                     QGMQDPRVPYFMTVTGAALITLLGLLYGTLAFRSRVALVGLVGLLWMAISYAPVSHLF
                     IAVGTFIAERCLYVPSIGAVLLITFIVGAPGLRKGVVTRYFYGLLLLCVGWGIFSHRR
                     NEDWLTDERLFRSALRTCPNSGKAYSQLAALISSREQSINPEIVELANRSVQLDSKLR
                     DGYYYLAVNEVNNNRNLKKAYIYLRRCMEDPFALNMCLDSYEKVRRILFPNMTEVETL
                     VDYASLMLLESQKATHLRQAGVIALRMYEKPCLAQQLLGKAMSHWNHSQLYWISDEVK
                     RESGDETYCNALYWYAQSTLLCETQSAAGTVESRIAEDKEDGGADDADSSSSKLSGKG
                     VPLAPQEAAQRAVAVAERFRACGTDWHQVLSEPKYNLPTVPHRMTQYLTVGDAIGNVL
                     QHYVNYTALDTPERNEVLLMFLDITVQQYCHIHTLMNDAYVRKKVGSTFKSHLQSIEH
                     GFLRFRQERLADMHTVRRELNMTTTLNAKQQNTRRRILSMASCSSDLSFLAV"
     gene            complement(<55778..>58195)
                     /locus_tag="LMJF_20_0160"
                     /db_xref="GeneID:5651292"
     mRNA            complement(<55778..>58195)
                     /locus_tag="LMJF_20_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682718.1"
                     /db_xref="GeneID:5651292"
     CDS             complement(55778..58195)
                     /locus_tag="LMJF_20_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682770.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651292"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QD28"
                     /translation="MLFSSLQCTQKGRVRLPPGSRGGAVYADDFGGVWVISEDAQEVL
                     YYAPDTLAAAIEQQQRQACPPLSTHGTSATPLSTSSPAYAVVFRCDAQKGTADGVTRE
                     DRVYSLYSLRRHECVAGGPRRDLCIVTTRGTLAFVRIPADHRHDPPLREIAVQPYQEV
                     HLDMHVCAATVTNGAVQNLALCCHDGTFTEVIRVVAVSSAEQLDGVDSAAADTECELD
                     ATGLFRVEGRIEAVLHDAVLDVLVTVSDTGYVDIWDVASAKDVTAMYGSLSWDCDRYG
                     APTCALLCRNQLWVGLTTGQLLVFPLSNCHGGASPPLLHSAQLLRGHTSRVTGLISVS
                     LGTCVWSCAADSAKVNVWDAGTAAFRGSFVFPGSGLVAWQAGAAQVRTALWGIDGATG
                     EPSLLQVTQSLSDPSGTQARTREETCAQHHNEALLRAYQVFWRSMARTLRHLLLSDAK
                     DADEGAEEAMPTALQLIWQDASGAGDNRDVLDAIDAMWDTLRRLHAAHRRCDPEGSDN
                     ARDLPSLMEACATWYEQQGRVPREVEALLRALNASSSEATCLTSLEDVEEEVMLLRAR
                     VEELQVELARVNDRRDSDAVRKGGAATTDNAVAVELQDAQAALRDKMEENRELRAQLS
                     EAQREVTSLTSQHARAQQLLNASDEQVEQLKRSLLAAKRAAEVKASDVSSMFEMESRL
                     HESQGVIAELSAKVETLLNEADVARVSLHAFEERQAAAKEVLQRVLRTQNDLADDVGT
                     LVDDVSAAIATFKKHHRASLTEHFAALVGIVEEALYRLELSVEKRLRDEQLWFQSLSH
                     GLKAAMT"
     gene            complement(<59099..>60121)
                     /locus_tag="LMJF_20_0170"
                     /db_xref="GeneID:5651293"
     mRNA            complement(<59099..>60121)
                     /locus_tag="LMJF_20_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682719.1"
                     /db_xref="GeneID:5651293"
     CDS             complement(59099..60121)
                     /locus_tag="LMJF_20_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682771.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651293"
                     /db_xref="UniProtKB/TrEMBL:Q4QD27"
                     /translation="MICRRLRCTPLASAAVMFPDVSGTWDAVTTLDFSRTYVGSQGAL
                     PVIELCRCLPRLQSLVFCDNYLSNHTVWYLVQMALFHPSLERVDLSANEYISWSGAMC
                     LVELVLRNSRIIYVGLRGSAVSPEIAGCIEAQTRQNAVSRFRSEGMKRSPPVHPAAVY
                     IRSLKQLFETHQQHGQVSASLLDSGFEELLRVSGRTGELHLFTEKHFSKLKARAPPGG
                     LTFEAFLVLLLIDGSTYDETTVATLKRVFTLFNMDPSVPDPISDGYILGRDMADIMTH
                     VYGSRPSDADVTALQRRLGATADTTTLDWEEFLYVAYPHGPKAGDRLCGLTCTPLASP
                     IEAMHC"
     gene            complement(<61266..>63854)
                     /locus_tag="LMJF_20_0180"
                     /db_xref="GeneID:5651294"
     mRNA            complement(<61266..>63854)
                     /locus_tag="LMJF_20_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682720.1"
                     /db_xref="GeneID:5651294"
     CDS             complement(61266..63854)
                     /locus_tag="LMJF_20_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682772.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651294"
                     /db_xref="UniProtKB/TrEMBL:Q4QD26"
                     /translation="MSSPSLPQHNYRQAIIDLYKKHDPAKVWRVDELLRRFEGHEEAL
                     VNALERKFREDMTSAGAQDSTGHCADAAQAPVTLEGSSYSGPSPNSPLNINISIKCDD
                     SLPSVVAELLAASPSDPDAATVSENVDRSVYRTRLLRLYEAYAPLRVSQVDHELDNYK
                     GREEAYLCTMEKKLRGVQTAESAEDATEEASLPATLSPVETGLLDDRQRRTNNSSGYE
                     VSKAGLLLSYETDAPAPANHAERQLQRYLGRDEEVIQEAVAEYGPEPVASVVDTEATS
                     PGAAAGLKKKHTPTAPANSTGPLKTASPSAPLPILATSQEAAKAAKRTVDGVASPPSA
                     AAALPTRAEAAARPAAYEEAKAAAVFARIIEHKGGAVGDAAAPTQVPGLNAAVLGLAM
                     PPYSGGARHASSPPDRRAAAPVVTRDKPSPVAAVGPLQVVSARNAEMRTTASRLSKAA
                     LPARKGESARTVVLDRSEIDASLSSTMRRMALFDVTFYDFFRVLGSFHAHGCERVSLR
                     VASVLLGVLLQEASPAKVRCEHGNMSCVSEEEAGVSADEMRELILQGAARQLRSQASM
                     SNRRVAQFTHSLVRRMAKLVQTCRMAVVQLQRQPYPLSAGFWVYRSVRPRAVPHWRRC
                     WATTSADGDAISVCYEGSLKTELRIPFARVVRCDRERNPAGALPVYARNGLTFQLTTG
                     AQPLLVVVCPESGDVTTQLLSAFRSWSRSPRNVDEKSTATHVASSLAPAPHSQCDVAE
                     SSKHLGSNQVRVWVLVRATSTYESQRWCVEDLSIHMMSDRTRELHSCSVADVEGVVAE
                     IELPVTPPARCAHGFVLCFGNVSAPLMAFTERPQDRTRLLDRVYRGQALLQVEAKAAG
                     KVNGGG"
     gene            complement(<64903..>65511)
                     /locus_tag="LMJF_20_0190"
                     /db_xref="GeneID:5651295"
     mRNA            complement(<64903..>65511)
                     /locus_tag="LMJF_20_0190"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682721.1"
                     /db_xref="GeneID:5651295"
     CDS             complement(64903..65511)
                     /locus_tag="LMJF_20_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682773.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651295"
                     /db_xref="UniProtKB/TrEMBL:Q4QD25"
                     /translation="MRRKRSSYVTCTVNGNACQSDDGMYDVKTLYGPHTVLLRALTTV
                     PSSSLLSSAPSPAEASRRRSEPLASFTICAVDARGRFVVKQSGTYEVGAIGAVEEQAE
                     AGATARAEVQAAIHDVQRVPEAAPKTAGERQSAMKEVRRAPNKYSMFLSKFSKVFSKK
                     GFQAAAAEWRRFSAESKRSEEVDALIARVVRSGRYPMRQPKS"
     gene            complement(<66093..>68681)
                     /locus_tag="LMJF_20_0200"
                     /db_xref="GeneID:5651296"
     mRNA            complement(<66093..>68681)
                     /locus_tag="LMJF_20_0200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682722.1"
                     /db_xref="GeneID:5651296"
     CDS             complement(66093..68681)
                     /locus_tag="LMJF_20_0200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682774.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651296"
                     /db_xref="UniProtKB/TrEMBL:Q4QD24"
                     /translation="MLSSVLGNIAARASRLFARCAAPCPDSFPSSAQPSLTSSTLSDL
                     SDLVSCTRSLVALTQSCGSGAVDAHLQRCVRECTDATLDALSSLPPRAHVPADVCVVL
                     LVILRASVQFWQEDRCAALAQRLAEHVDAMALRTWRPRVLVATVHAFAKSCPSQAQLP
                     LVTDCFVRLQHCEAQLTEYDVATVLWCLATLQVGESQLPLWSSLCKRAALLFSRMNRV
                     NRLTVMQALLLQSSYLCESQAELLRVAHAANMESTELTSLDDYQRDGGWRCPARGPHR
                     TKSHNSESSLTSSSKPGSMGSTSQLLQCTTHALSDESLVRLLITLFERSAEATEELRL
                     VVAHLTLRSFLSDRLCLQLLRFTQSRSTAVSLHMAGQAEQRPRKHAFSTAQHSEMSVL
                     LRKARRHAARQLIGVLRSGVARSPRDIIEVLCVEHCSLRAGGASEGQPRPGGAVDAES
                     VESVESVWAAIVGLFCDTSADLARAFCFGSGEELWSWHCIAAYLRAVSPASGGLTSDV
                     PASLGTTLSALEHQLSSATHPSRYWPNTRERKTRCAEVVIAATHCVGTQLLTYCAETT
                     SPYDTALALLGECVRELATPPATLPAPTTLRLLSAVDEAPVVVAAPVQPLRKFLLAQL
                     ETHTARPSGMLPDLIQYLTSILAGPLAAWQAPSRVRVSDAVLDLYLRLLLQEQQQTLS
                     AVHSELLVRCLQERRTIAAELENAFMMLLTRRLGQTASFLNTVRLPIAALSGLVELAG
                     ALPRSKAASTTATATMIISTLLDLLIQQAIPACTTAEELIAGAIALRDDAVADLQRTS
                     AMAAAVQARGLSLLTSTEVTWTPVQKAYLIAALVCVNVDPTPELLQALRMDHHTQARG
                     ALKSTS"
     gene            complement(<69531..>70784)
                     /locus_tag="LMJF_20_0210"
                     /db_xref="GeneID:5651297"
     mRNA            complement(<69531..>70784)
                     /locus_tag="LMJF_20_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682723.1"
                     /db_xref="GeneID:5651297"
     CDS             complement(69531..70784)
                     /locus_tag="LMJF_20_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682775.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651297"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q4QD23"
                     /translation="MSLSSDARDVGREVTFHFRWLCGGSASRPSIMPRMTPPPGCCHS
                     LVGYQDRYLILFGGGSLAHFANDVYVYDMDSRRWSRKAPENSDMVPPRLAHSSAIHGD
                     KMIVYGGQDLCSPVVYDDVLELDLVTWRWSVLQHAQASPEGPGARRLHNAHVVGGRMY
                     VLMGTPTAPREAPLWYLDLHTNAWHHLKPTILHDGGTAAEPATMLSLCGCSSAVSGDC
                     IYLFGGYRAEDGERSPFPQREYMNSLFQYNTRLNTWRSVRLHPLAPRPSARYAASLAV
                     HDRYVYLFGGDANQSDVSLYFSDLWRIGVQDELAAWCKVNVAGALCPSARSGCAYTCA
                     RSSLFIFGGELPVGDLTIPWLYGADLFQLPLGYSGQLTLRASAARWLGAAAGQCRETF
                     SVCSLPEEIPLTLGARCALEEYSEG"
     gene            complement(<73535..>76384)
                     /locus_tag="LMJF_20_0220"
                     /db_xref="GeneID:5651298"
     mRNA            complement(<73535..>76384)
                     /locus_tag="LMJF_20_0220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682724.1"
                     /db_xref="GeneID:5651298"
     CDS             complement(73535..76384)
                     /locus_tag="LMJF_20_0220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682776.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651298"
                     /db_xref="UniProtKB/TrEMBL:Q4QD22"
                     /translation="MSSGDGSVAAAVAAVVHFTTHGDTASNQELMHAIDHSLDAGCTP
                     AAHTIAPQLLRWALEDSTARVSAGMTTYVSVLNRHFCVQVIPHRLAQPLDRRPAGLEE
                     LLQFYVMALHSFATEASRRQLTQCVACLLILLEDSLVDRLRAWVRGGDAASADECRTA
                     LQVFIAVVDLLADRRVAIGSIRRATQRRQLQKHLLIALESPLTDRADLPLLVRVTDAA
                     VRFLLEAMHGEPQEVAATFWEALPTSTVWQHCLRCLGAAAAASSPPATCPEEVLNVVC
                     NVLRCQTIVNAAAEALLSGALPLVLQPIAPSTAATVDWETISRVIASALEASTKAIVT
                     QQPSDVPLFRLFSSAADRLAQLLQAPTAPTTAVCHVCEGISALTQALQPTPLPEMEPD
                     DDPDDFSDFVEQTHAANAEKSSAVAQLRPFLHGCTRALAARLTHSKFAQEEWRNIAAY
                     VARQVADGDIDDYEVAHDDVHLAVFTTYERLTALLGALSVGEIGAAAPELGQRLVLVM
                     RDSGSTFQWLESIQPTDLLVQSALLPCCVARHVSSTSATGWAMESSAVRVMDVLVHAL
                     ATYQEHGLHCSGGSASGSVPAIMDVTRAAAAVALAIVRRVGPDNVAHLRERITPLVSA
                     LWQCVTAAVDAPASASTHHAAADELATLLEARLAVLPDAAVDPLKDQDAYTQAVLFAT
                     GGASTPSLNTLEALAHTLHCIAQLSSEEAEAVETRVCRGLAERSRRHCEAGEWAGEAL
                     ATLLDSWHAQHPRLLPCFLTLAVAVPAELQPALLLAGITRFFSLPQSLDTSTRELSAV
                     LEVRFVRPIAASPATAPSLHALVVWLLQSHPSFTAADGVRRVRALAACGRALCESGHV
                     PALSLTETLVTCVARWQEHKFASVLGGGEVDAAGEKDDTEGDVQLKQEVLKQLAMWSR
                     CVSAVSGLPPSAPPWLARLQSAQDDYERVEVLKSV"
     gene            complement(<77334..>77783)
                     /locus_tag="LMJF_20_0230"
                     /db_xref="GeneID:5651299"
     mRNA            complement(<77334..>77783)
                     /locus_tag="LMJF_20_0230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682725.1"
                     /db_xref="GeneID:5651299"
     CDS             complement(77334..77783)
                     /locus_tag="LMJF_20_0230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682777.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651299"
                     /db_xref="UniProtKB/TrEMBL:Q4QD21"
                     /translation="MRQSPTSLYVDSMHSNTLTDHPLTHRSSRDELAYRKRKLTERGQ
                     YEQAAKAEEEATQRDREGKAGAETKEYYWAILCAVLGYLAAHALVFNYYYPDDLRPNY
                     SPDRGYFDDVAARREELEAVDEMVGLSVLESVYSKRKAAVKRRLEGS"
     gene            complement(<78927..>79712)
                     /locus_tag="LMJF_20_0240"
                     /db_xref="GeneID:5651300"
     mRNA            complement(<78927..>79712)
                     /locus_tag="LMJF_20_0240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682726.1"
                     /db_xref="GeneID:5651300"
     CDS             complement(78927..79712)
                     /locus_tag="LMJF_20_0240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682778.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651300"
                     /db_xref="UniProtKB/TrEMBL:Q4QD20"
                     /translation="MASLWKTVSLLLTVLALLCSISVGAVSQSYVLERRVGSDGEWSR
                     IGSFAISRLSSQAPARISTQLGGEVSLNMEERNKLAAADLVYYRAYPHQEGKPAPKHS
                     TTVVVTPCSLIRGFEAMDSKTVVLHENINIVPGVSTSLMGLQVSSETNFFHAKMLKGD
                     ECDRSVVQKLFPTVHLNTKVGLVHPLKLTRKVRYEDLNALTEAEDAKKTKVRPQTEKR
                     MVRNAEGEVVEEEVPVEERSFLQKYWMYLVIPIVMSVLQNMKG"
     gene            complement(<80546..>81685)
                     /locus_tag="LMJF_20_0250"
                     /db_xref="GeneID:5651301"
     mRNA            complement(<80546..>81685)
                     /locus_tag="LMJF_20_0250"
                     /product="putative deoxyhypusine synthase"
                     /transcript_id="XM_001682727.1"
                     /db_xref="GeneID:5651301"
     CDS             complement(80546..81685)
                     /locus_tag="LMJF_20_0250"
                     /EC_number="2.5.1.46"
                     /codon_start=1
                     /product="putative deoxyhypusine synthase"
                     /protein_id="XP_001682779.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651301"
                     /db_xref="GOA:Q4QD19"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q4QD19"
                     /translation="MLASAPAPRPAKKDSAASRRKSASKSTGAAVKDDSSARVSASGA
                     AESPEQSCTQVHGVDFQSLVHATQEETLRAVVSSLPTTGLQATQIGRARQLVQQILHH
                     RSPEDRVFLAYTSNMISCGLRDTFTYLARERLVDCFISSAGGIEEDVIKCGGSTLLGQ
                     FGLDGRALRRRGINRIGNLLVPNDNYCWFEDFFTPVLESVQEAQRASRWKTHTAPSEF
                     IEAMGAAIAKNHPDTCTSSLVYWCYRNGISVFSPAFTDGSMGDMIYFYNFSHKGLVVD
                     PLEDVVRLRKLAAKEKGRNLAIVLGGGLPKHHLLRNVSMDAVVMVTTGLEADGCVSSG
                     VLADDVACGLLREETETVRVQGDATVVFPLMLIAEKAATLEGAAA"
     gene            complement(<83519..>97996)
                     /locus_tag="LMJF_20_0260"
                     /db_xref="GeneID:5651302"
     mRNA            complement(<83519..>97996)
                     /locus_tag="LMJF_20_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682728.1"
                     /db_xref="GeneID:5651302"
     CDS             complement(83519..97996)
                     /locus_tag="LMJF_20_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682780.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651302"
                     /db_xref="GOA:Q4QD18"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QD18"
                     /translation="MGMILTPTVARNLESIQLAVETSNAILIQGEIGCGKSASVLHLA
                     EKYAAKETMIQVNVDDTFDSKDLLGKFSATQTPGAFQWVPGPLTVAVQKGYWVLMEDI
                     DLASFDVFAVLLSLLESSTLFIPDKNKFLRAHSGFRLIATQQLYSSGAAVLTRKSNSV
                     PYAELWGTVIMENLPAEEMCAIVNHTYNNVPLSIIQSLATLASPTSGARLVGLQNLLR
                     WSKRVSKRLPSTPCIDNANSKATPAFISSRTRETMVKEAFDCLVAKYPPGNERAEVLK
                     MISEVCGVPINVAEPLVLECRPQESLATDMYSVGRVCIPLISTVSGLLRDSRIAFAPT
                     THAMSLLERLAAAVESHEHVLLTGETGVGKTFIVQYLADQLGQSLIVHNLNQQTDSSD
                     FMGGWKPLDVGVTVRDLYNGFTELFAACFSVEKNAQFLNILQQSVNGRKWGRVLNQII
                     KGCGCFRAKSAKVEYDAAMQQRWEDLEQKANELLDTLEKTRTNFAFCFEEGSLVKAWR
                     EGHWILLDELNLASTEVLERVSSVLGDVDRLFLTDKDSSEPIMRHKNFHVFANMNPPT
                     DVGKKDLPPSLRSRFVEYYVSEPFNRNDISIVVGAYIGFLTADAKVDEITDFFLDCVN
                     SAKTKLCALDGESKAPSFSLRTLTRALSYVRRATPLYGFAIALFEGLLLGFATPLQRQ
                     FHVVVEQLIVKNIFRGKRPNSPTLPAAPTNGSFIAYEHMWIPSGAEVPYCDEAFILTN
                     SVKGHLMNLSRAVFANRPVLLEGPTSAGKSSMVKYLAELTGNKFVRINNHDSTEVQEY
                     LGHYVTDELGKLRYVDGILVKAVRHGYWVVLDELNLAPTDVLEALNRLLDDNCELFVA
                     DTQETIKPHPQLRIFATQNPAGIYSGRKMLSRAFRNRFLEITVDEIPTTEISTILCRR
                     YLLPQSFADKMVEVMTALQMHRQSSQIFAGRHGFITPRDLFRWAERRPETYQQLAEHG
                     FLLLGERCRKSSERQVVRDVIESVTKTELDDKTIYHPSHWPFVQCYFSQVESGVIDEF
                     KIVWTESMQRLFTTVGICLEHKEPVLLVGETGSSKTTVCQLWAALLGIPLHILNCHQH
                     TEASDFLGSLRPSPPDRRDQALFEWRNGPLVQSMLSGDMLVLDEISLTEDSVLERLNS
                     VLEPSRSVTLAEKSSADCIVAHERFLIMATMNPGGDFGKKELSPALRNRFTEIYVRPT
                     TDVTEVGMILSHRLEAELAVWAPHMAAVLCRVSQSTTTSGAPQHISIRDIISWVSFMN
                     AAHGRCPPEVAFLQGLDAVIVDGIGVGTGHSEASCAVLKSSCMSQAVQEVMQFGHAPI
                     DDKALLAKPFWEVCEGMAEPQLPPSMQGRFFFGAPATRRNLSKLMRASLVKKAVLLEG
                     SPGVGKTSIVEALGCALDRSVVRINLSDQTDIMDLFGTYLPSPGDAAEQEEAAAEGEE
                     SAATAGDELERQQPCGGRGHVKGPQFAWSDGVLLRALKEGSWVILDELNLASQSVLEG
                     LNALLDHRSTVFIPELNEEFHAHADFRVFACQNPLLEGGGRKGLPCSFINRFIKVHVE
                     AFEVSDLIVIAQAVCPDIEEATLRRMVDFVDRLQHDIMVRRAYGLRGSPWEFNLRDVL
                     RWAKLLQSYEARERPTSFADMLFLQRMRTDEDAARCRLALESCFSKEEVERDVEHGCD
                     SDFLIHDSAVYFAKQRLMQRETATISASDAQKLSSLLLLPSQAHLVKSLLVCVEQNQF
                     ALLVGPSGSGKTFALRTAAALAGARLVTFSMTASCDTVDLLGGFDQVEGKQGEFEWRD
                     SLVLEAMVQGHWLVLDNVNYCNASVLDRLNPLVEPNGVLFVNEQGVVNDEVRVIRPHP
                     RFRLFATLNPRYGEISRAMRNRAVELYVKPVAIPSAESLALGAHASVVAQERHKSLQD
                     AKSADEAANSVASQSAPPVRLLSRLLRYHQTFVSVGFHADSKQTGTAQLSDALSAGAP
                     SVFTLLRTSCLLRPSSLVGDLERLILHRYIHNRSGHWASFKPELLELLRRIMDGDIKE
                     NDTAAFAEEAMELLWALRLDGRGDEMFDRAAAAEDEEAATASDPVARVLVCRRVGRAA
                     LALQRLLSESASATEHDMKDAAEAAKQEKRTLTNCHRLEDLVLCFILEQCSDSVPLHA
                     VTETRRLWISHHLPAELAQRALSLVRTGFCSPEMLAGLYTCAVLLLGPHADALTALRG
                     SRMQVVSSTLVNNALVHLCSVLQAAFASYNATPVPPATFQQLLRLAAPFARLVVQLAN
                     EEYGVHTDNYIPLVTYTALVCKAVSKMNPPMPHAMALVHAATSFLDSLQQHLGLPFPL
                     LGGKAPLHRYVPTPHITTAEERRLLQAWNTAANAASAARPTAQSNSAVDPQALLHRLW
                     ESAAFREGFACLQQLLYIRTTAATYASVTSADPAHTVHPFLPALQARMTAFVDTYTAR
                     LPLFTELELALWRSVHQLPLDKPADTTEALAKLTPLLLSRFASRHGVAGTRHLFAGAW
                     AVAAADCMRYGAQVPVMDIGLADNPRLQALAGLSTFLQTCPLAAASPLEEWATNSQLE
                     LVGVLCACFPDLASCVPTPLPPSRTSVTAVTRLSVFGQAETVVSSAAPMPSLVLERHR
                     MLMAALLRRLRSNGCDSADTLSAVTLLWVLKCRLLLPQSPVDPMYRRECKRVVATEEL
                     ELLDRLDGAFAWAEQLAIRHRSPQREILLMLRVQEKELLRQAQRKYVTRPDATGMKYA
                     TLIRQLYQVCTTLLSDARVLGLFEMPPASAGGLNAAAAAEIIASREAWSDLLYEQVMQ
                     LLAEYGGYEDVTVNFAEAALLASMAARASCTTDACLLAAAASADSSALSRTLFSRADT
                     LRLLQFPSPLVHVLPMPPMQHTASLLRHRVVYLDSCLSLLSGTAPQGTSRDFVEDIFA
                     QYRSLFRQIEEWEAQERQADQLAVMYKEKATMIEGDDEKLIRKLKELYPSYEAEFSID
                     ALEDDAADPPDRKKTEEQLEGRRAKFARILFKERDGFYLRHLVEVHRTFYWRLISCRM
                     EAAATASSACSETSPRSTALLTAFQNRFDALAAELHTFPASSGSTSGVAGAEEQLLLN
                     GFAARVSLLREEMRGTAVSLEERKEAAFNIFLDTDVYELSRFSTPLQTLLDAVQRLAE
                     QYPDTPSLQRCLRIGHKIAALPAMSTPLMKVMAGCEVLLRECYEWERNASHEVSLIRH
                     MTALSSFVLRWRRLELHCWAHVFQAKHAELELQAAQQWFTLYDLLLGEAVPCESDGED
                     HYTVAVWDAETPLLRRCRAAFQRASKFMWDAIFGDFSVRLRILQGFGFQLLAAESAQA
                     PLANTVLHVCDFFAQFEPLVQQQRDKAVQPIEEDIAEFAKIMRWEDANYYAVRATAEK
                     SHMKMARVLGTLEEVLRTPVLAVITAEEQRCEDDASLGFALPVKADSKSKKAKQARKP
                     AEAAGKGVKQGIKRQRNGKAVSAAADNPSLEAVATAEDSALQLLSRNVYLDQVHTFLR
                     DAAHEVIENVTALQKPKTPNQMKVRALKTLFGRLSEAGVPHTHENQVGDWDVLFFTTE
                     ALLGCRETHRDQTAAVARLGAAAAEQYRFARWLQRLREVERKPHHDLSAAQAKRGTGI
                     AESLFANAVHVATVLCELFHLHEQLRVLEVAVQHSVLASDGDTDGGVVSHAVPRVFLD
                     DAVEVACLVQSVCSGLGWMAQQPHMVAKTTAEAHGLVHELAGVSNELWSICTSQEPLR
                     RSAASTVPPGISKCYFDVLRRVLGVVCRIQACDVANIAAAAKPLVDAVTDILARHEQP
                     SAQMHERIATEAKRRRTEQLPKPWTQRLSHAIEEVRDALAPCGEGTSVVLEDDVQMSS
                     TTATTDAEAKASRHSDSESDVDAPQCESAVYARYTMHGAAVHEALQRLVPILEDLLAS
                     PASSEGATAATVATSSAPPSVCTLAAGEREKLLPRLSVCRREVQRARDAWCTVLEAQC
                     SFGVVVARLFTVLLKKGFCKTEDEEPDDGEGDGEGGQQQNGTGMDDGQGEKDVTDQID
                     NEDQLMNMKDKEEQQADEQRQGEKDEGEEDTAADVETDFNGQKEHRSESDGEGDEEGE
                     ESDKEMGDVDDGTEKERKKTKKDAGDADDMNEDAGDAAEEVPEDNLAEGDEHREDNEE
                     TGGFDDKADEIRDADEDRSCEHDMVGDDDKSEMDEDGSSGGDSVEHSDTDGEERDESV
                     RDDKLPSDADEEPEESDVASEGRVDSDAATDAERSELGEEEVEQQDNSESAGDVSDIE
                     NASDGPDENVYEGGQQDDREGDEATENQDKDKKDTSAKVRKEQAANEEEQPGTEQEQD
                     DAGQNWKQQQEKNEQAQRRDNAEQTRSQHNPYRAVKEALQRHQRQMQQLNLNQHVEVT
                     DEKDEPKAEKPPKPDQAGDQEDVEEFDFDEDGDREGLAAAEHTEAKPTETDAYEDEES
                     HSDASGDKDGIGEDEDESADAPQDTRRKRRQSRDELTELEAKEAAATSQRKRSKRKVR
                     TTAGDEDASASEDQEDDDSTKKDDEDAAAEANAKLERGRQLWLEQETAVQGLSQQLCE
                     QLRLILAPTLADKLQGDYKTGKRLNMKRIIPYIASQFKKDRIWLRRTKPSKRTYQILV
                     ALDDSLSMQCNNAGVLSCRAVALIAKALQQLEVGEFGVACFGKETHVVHPLEEPFLAD
                     SGPRLFSEITFEQKSTNMKLLLETTLGYLDDARDRMRGQTRSTTQQLQQIMFIIGDGQ
                     ITENRDDLRQLMVRAEENNQMVVFVLLDIRAAEGDTATPSARPSAAPAAAAQLRAKAL
                     QGLSTAERLRRLKADREARLHRVQSSSILDMQVVEFQAGRVVRRPYMEGFPFPYYLII
                     RDIQNLPEIIADAMRQWFELLNAGV"
     gene            <99316..>100104
                     /locus_tag="LMJF_20_0265"
                     /db_xref="GeneID:5651303"
     mRNA            <99316..>100104
                     /locus_tag="LMJF_20_0265"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682729.1"
                     /db_xref="GeneID:5651303"
     CDS             99316..100104
                     /locus_tag="LMJF_20_0265"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682781.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0265"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0265"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651303"
                     /db_xref="UniProtKB/TrEMBL:Q4QD17"
                     /translation="MHRASQTLWMAPASRAVAEDGQESMKRLALAPLTFLSLSGSTSS
                     LASILASAVGFLEGYSASDWDTNINLAKNSSGELVAHTKLTFVPYTFRRAPTLVSSTS
                     VLEPSPLSSEKALRVSRSLSISHVVADAAPRALSPMDVSQLQRFKDSFKGSATAADYV
                     ANDLLRTTGSVEVAKAVLQLAAQVGLTIPRSTLKDLVHRMKHKEASFASSVYQEFAFE
                     VNLEALHESSLISSRCVQHRLALPPRKRKESKLERVRRSTSPKW"
     gene            <100446..>101549
                     /locus_tag="LMJF_20_0270"
                     /db_xref="GeneID:5651304"
     mRNA            <100446..>101549
                     /locus_tag="LMJF_20_0270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682730.1"
                     /db_xref="GeneID:5651304"
     CDS             100446..101549
                     /locus_tag="LMJF_20_0270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682782.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651304"
                     /db_xref="InterPro:IPR026150"
                     /db_xref="InterPro:IPR027012"
                     /db_xref="UniProtKB/TrEMBL:Q4QD16"
                     /translation="MKEVVSTAKRLEFKMSGESIFSLYAKSAAEQKLLSKSESPYTGV
                     YDKHMAEPEKPSYSTFYEKGKEYDGTNVRFFKQREAVIGKNVGDSVDPQKYLRKGDGI
                     RCIVPATHEEKVYRKPPVDNSTPFSQGGRSGDGESASAGVQYDADGNPISNGNGSLDA
                     GRNGEDHSGVQGSANDGAAHGHGSGDYRADGRGGVAFSRDATKNFVASNIVEISNMVP
                     KRRKMQAPLPTSRKSFGETPAYMSRVKREIAEEKAFVESLQEAKAQRQQQAHAKYIYL
                     LPREEHDKLVQSMRRRNDECIYELQRMPFSKDTAGMRKRKTELEKTVEHIEVALKKLD
                     RDALFIYKDDPVNGQWCKEAALKEAQKYAAHSH"
     gene            <102051..>103409
                     /locus_tag="LMJF_20_0280"
                     /db_xref="GeneID:5651305"
     mRNA            <102051..>103409
                     /locus_tag="LMJF_20_0280"
                     /product="developmentally regulated phosphoprotein-like
                     protein"
                     /transcript_id="XM_001682731.1"
                     /db_xref="GeneID:5651305"
     CDS             102051..103409
                     /locus_tag="LMJF_20_0280"
                     /codon_start=1
                     /product="developmentally regulated phosphoprotein-like
                     protein"
                     /protein_id="XP_001682783.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651305"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q4QD15"
                     /translation="MRRLFPTAKLLGSTTGIRLASMKSSDKERLERLVEEVNGIKSKL
                     KVLEESKAANGLVDLYASRKMKRLDIKRILGIFNDRAYHAPIFCHKALPIILAHFITG
                     LDRLPSGLNAMPSILAVRATLLRSFQKLINCKIPATDDQVQHFRRVLEDIDEEHAERN
                     LLQTMAFGILELKEYVSSHRRALVDLKKTSERWASIPMTEENVLTYAEIQDIQAPLDS
                     VNRCMITYNFISRMFLNHDPDMTMSSNPRRIGMVDLEMNLEHVVRNAVDEAKQICTDH
                     YGDCPDTEFELTSDTKAFRFPYMSTTIRYIILELMKNAFRATVDSHMKRNDVGMVTCA
                     DMPPVRVLINLQEGTEHACICISDEGMGMTDEALTMAMAYSYTSVSKPALQLGESGER
                     CASTAPSPLAGYGYGLPMSRVYAQSLGGDLLLQTMEGYGTRAYYYIKIADAQPLCDEE
                     TK"
     gene            <105367..>107766
                     /locus_tag="LMJF_20_0290"
                     /db_xref="GeneID:5651306"
     mRNA            <105367..>107766
                     /locus_tag="LMJF_20_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682732.1"
                     /db_xref="GeneID:5651306"
     CDS             105367..107766
                     /locus_tag="LMJF_20_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682784.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651306"
                     /db_xref="GOA:Q4QD14"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="UniProtKB/TrEMBL:Q4QD14"
                     /translation="MLFSRERSPERGAVSNAQEWAALAEYERLEAVFHLLKRISGTCL
                     RHGHLRVIEREELMCCGAHAEPISSTRRLLLYGRVSYCHREALLAFVRQVRLHLVRDL
                     DTAVTVGLQAGDLVPHLLLEPLTPSLHTNAYALWHRVYCAMRCGIFRHMEVRQRKMKH
                     RLRQLIRESAVTSSTSETTNSKEAGTREDTVAASADKLSTSGHANTLRFYADEFAHLV
                     GEDAGALNDQSGADGSREPLALADFMATAKETRVSLACIAATVPSVFVVWSCRYPECV
                     DWLQRHLFNDSHLQAVLDETGLSGRYAVLLDKDPWLLFAAEQGEVLPRLPTKETFRIE
                     LLKSLPKRAQIVLLNVDEDVAEARTAYEHLKGGLQGWQSPEVDLLSLWCGHQGLQSDV
                     ATLFRVETLPFIVGARPGGRSRSSKASSQAKLFMNNSRQPVIVRTTRDTLEVAKDMYG
                     IADTPKMRRRRGERGAPTLALSENDNTWHNLTASERAHIADRLSKHIVQRRLPLCFTA
                     FVGQEYVIRNPYTSDPWKAVECVASSYVRLDGEYVTGQDLMPVATELRRMHQLDGFKF
                     NVSIIEPSAPLVSSLNLVTPQMRVEGRTHVVTCAHCQLAMDVDAVAHLRCLHCASSDK
                     SAILCEVCAFTALHHPLHHILLRIPAGVWAPSLPLLWGPSNVAPLAVLAERFKPNPSR
                     CHYGIYCNRCRSMIRGTRWKCARCYQYDLCDTCARIYSKRAASTKSKSDIIARGDAPL
                     PVMPSSSPSPLQPTPHVAPLCSEDATHPMLFIPHMQGCSANSFLKPPCTANLGEWLRT
                     L"
     gene            <108937..>109872
                     /locus_tag="LMJF_20_0300"
                     /db_xref="GeneID:5651307"
     mRNA            <108937..>109872
                     /locus_tag="LMJF_20_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682733.1"
                     /db_xref="GeneID:5651307"
     CDS             108937..109872
                     /locus_tag="LMJF_20_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682785.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651307"
                     /db_xref="UniProtKB/TrEMBL:Q4QD13"
                     /translation="MDNMDLSSISTSSSAPQLFHMSPTERAEVETGTWAWWHQELQNK
                     RVTKDGYHRVQLQDVHTRLTTQHEDNPSTVDLDFSSCYMEPTAPYVLGRLFASLQLKE
                     LRWITSLRLDGNYFTDDGFGTMLATMSAANEEQTILPLLRQLYLNNMNLDQHSVAGLF
                     AYLFPVDHKAMSDISHKKALRIAGRPASRPSEAYIAASRRGPKVPLFPSLTVLSLSDN
                     PGVGAEGLIQILRSLLAVHYEPHTISVMDLSRCGLDRATPKYFREYFGALSRAMKSGC
                     YPVVPRRFVLIGNQHSIANLNEVYSPHETGVQLVL"
     gene            <113125..>113379
                     /locus_tag="LMJF_20_0310"
                     /db_xref="GeneID:5651308"
     mRNA            <113125..>113379
                     /locus_tag="LMJF_20_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682734.1"
                     /db_xref="GeneID:5651308"
     CDS             113125..113379
                     /locus_tag="LMJF_20_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682786.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651308"
                     /db_xref="UniProtKB/TrEMBL:Q4QD12"
                     /translation="MLRRSLVMRGGFSQEAFHRMTKYITSRNPNEKYLRTGHIVLETL
                     KRYHSYILVVALISAFTVYDHHQNPEKMPGAVHDGRSLVL"
     gene            <114376..>116268
                     /locus_tag="LMJF_20_0320"
                     /db_xref="GeneID:5651309"
     mRNA            <114376..>116268
                     /locus_tag="LMJF_20_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682735.1"
                     /db_xref="GeneID:5651309"
     CDS             114376..116268
                     /locus_tag="LMJF_20_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682787.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651309"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QD11"
                     /translation="MTKSSPQAAKMFVESISLDVDVETTRQLLCSKKGFVALPSSIGV
                     LCRQLRKLDLSGNGLTDLSPLATLQHLSNLNVAHNGLLASLKGLSGTCLSVLNISFCA
                     VESLEGLEHTALTLRTFIANDNRLQLHSPLLADVVATAGEDAAEMEAAREHLPESLCR
                     SSSHSGADLRAVAQRNYAIFSTFQQCETVVLSRNTRLCQLFPTWGVEEVAAECGEVPG
                     RSSAAADDEGSDDAADGASTTMSADGDGGDSANRGKKHRASAAKRRDRRRIAVHPTDR
                     SASNTPAAAREPFGDSPEMATYNQRRHALALAHPLSVFERLSRLRKLSLSGCELHSLP
                     VRWFLPMVTELRLAQNHLTSLQPDGVILRSLHILDISNNLFASVASLRRCRYLEQLNV
                     RGNPLIEEGVLQDKAAGLTTAERIADVAATTPSSGTSAAPIAVQQRLLRLFPNMKLLD
                     GQPMMTAGQVRSAYMQRNARSAAERQDKLTEKGCSDGSAIVASLHEARDDVGNAHAAS
                     DDSERGSSSGDAPRTAPTARAEARSPARKARRADSAVIAAEADEKDNVVEAPLSVVKT
                     AHAQIVRRERVLLRPGAAAASGSNTGAAGQKRKAGQTPTSPAAVVYGQAAVAKLLEQS
                     RSRSAW"
     gene            <117070..>118023
                     /locus_tag="LMJF_20_0330"
                     /db_xref="GeneID:5651310"
     mRNA            <117070..>118023
                     /locus_tag="LMJF_20_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682736.1"
                     /db_xref="GeneID:5651310"
     CDS             117070..118023
                     /locus_tag="LMJF_20_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682788.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651310"
                     /db_xref="UniProtKB/TrEMBL:Q4QD10"
                     /translation="MFEEALRQAPREELVEHIRLQRELIHRLHRRVLELESSLENVYT
                     CSSDGGGAVGAGGQSAAPSERQRAVLSSNLRHGPPPPTVRQSLYGASGGAPPAKARAY
                     PLATFCEAPLGFSERWSTDNDEAAAAPEPRCRPPRPHIEEKAPVAFAHLSSSLQRQTG
                     ERAAMATSANGTDTAPAPFSAAAISTGITSSSVDHPTVLEGIKEINHVLAAHRAGRPA
                     LPLPVVEELEDIRTRLLRGLKQTHSMGDRDDEKAQEAVTARQAYGALPRGEEMVLNSG
                     PPDLLFERCADAFRAATHVCPRWVSPDSSRVVYGTSPRRHQ"
     gene            <118982..>120151
                     /locus_tag="LMJF_20_0340"
                     /db_xref="GeneID:5651311"
     mRNA            <118982..>120151
                     /locus_tag="LMJF_20_0340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682737.1"
                     /db_xref="GeneID:5651311"
     CDS             118982..120151
                     /locus_tag="LMJF_20_0340"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682789.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651311"
                     /db_xref="UniProtKB/TrEMBL:Q4QD09"
                     /translation="MQFVFVVKGQSSRVPQALPADRLFIVASRETAHRSRHVRAWGAK
                     KYSAAVPASGAPLQISGSRLRDLCWRESHLSSTLSLEKDDLTFNCVMVQTPYAGRAAD
                     ADLEPVPLRVIAADALEHIFFNINEDLLQDGRLVVFTYAENLLHLSIDADIWAEARVA
                     APGPRTGVAVGADGGTGDGGKAGSRAAEEDAKEGPSLNTDGAAEAGLAKRRRRVDLMW
                     GEEEPSRSSRRLDSPHSLLNKEEVLAVVPSAMSGDDIKELNELIDEGKLSSLDASLTD
                     FFCCQCYHLPLLTLTMSCCGAVLCQCCAPTPPTVEGVSAADRACPVCGEEPLDPPLSH
                     LERDVKVAKLVKELKVLYLPQLHALRNSRQASAEPSKPSPPPFLLPNTPVLGSPR"
     gene            <120371..>120748
                     /locus_tag="LMJF_20_0343"
                     /db_xref="GeneID:5651312"
     mRNA            <120371..>120748
                     /locus_tag="LMJF_20_0343"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682738.1"
                     /db_xref="GeneID:5651312"
     CDS             120371..120748
                     /locus_tag="LMJF_20_0343"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682790.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0343"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0343"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651312"
                     /db_xref="UniProtKB/TrEMBL:Q4QD08"
                     /translation="MTRCPIFQPACTSCLQPFFLPALVARGTFACGQGQAPHGARGGQ
                     SDASLRMSAVIPRTAWPQSELRQCRRVRHPWDGQCASLTRTNLTRSSHCPAGGGGGGG
                     GVLEPPRWLHCVATREAGMVGGV"
     gene            <121184..>122116
                     /locus_tag="LMJF_20_0346"
                     /db_xref="GeneID:5651313"
     mRNA            <121184..>122116
                     /locus_tag="LMJF_20_0346"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682739.1"
                     /db_xref="GeneID:5651313"
     CDS             121184..122116
                     /locus_tag="LMJF_20_0346"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682791.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0346"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0346"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651313"
                     /db_xref="InterPro:IPR028009"
                     /db_xref="UniProtKB/TrEMBL:Q4QD07"
                     /translation="MPAHEQFTDLDSDARALPSTWRSLADIKKHVFSPGYVVEGETGC
                     RTGEAESATPPLAAATVVLYDFFAERACRKRSRGKGAPAACAGCDDSADSAPGRHQKR
                     SKVRPSCCSATLRSAVLAVLHAAHESIGSPEAVSHGGCVVIVHVKAARDGVRCASAKT
                     ASRAPVWFVDGVCVAEDIPRAYRAVWTSPAIAFEPPMHSTPEDTTAVAAALCTPGSSC
                     PVTVEGQLRAQVTRVGDSWCTGTPLCGVRLMWVSPASRGRGVAYLMIERARHAVCYGF
                     VVPAEHVAFSEPTAMGSAFARRYQARQDFLVYHY"
     gene            122913..123028
                     /gene="LM20Cs1C1.20"
                     /locus_tag="LMJF_20_snoRNA0001"
                     /old_locus_tag="LMJF_20_snoRNA0230"
                     /db_xref="GeneID:12982183"
     ncRNA           122913..123028
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.20"
                     /locus_tag="LMJF_20_snoRNA0001"
                     /old_locus_tag="LMJF_20_snoRNA0230"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460233.1"
                     /db_xref="GeneID:12982183"
     ncRNA           122915..123028
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.20"
                     /locus_tag="LMJF_20_snoRNA0001"
                     /old_locus_tag="LMJF_20_snoRNA0230"
                     /transcript_id="XR_002460234.1"
                     /db_xref="GeneID:12982183"
     gene            123082..123135
                     /locus_tag="LMJF_20_snoRNA0002"
                     /db_xref="GeneID:12982302"
     ncRNA           123082..123135
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_20_snoRNA0002"
                     /transcript_id="XR_002460235.1"
                     /db_xref="GeneID:12982302"
     gene            <124390..>126582
                     /locus_tag="LMJF_20_0350"
                     /db_xref="GeneID:5651316"
     mRNA            <124390..>126582
                     /locus_tag="LMJF_20_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682740.1"
                     /db_xref="GeneID:5651316"
     CDS             124390..126582
                     /locus_tag="LMJF_20_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682792.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651316"
                     /db_xref="GOA:Q4QD06"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QD06"
                     /translation="MQATLMNEKGDPWRWVVLALFCLYSASNAIQWITYSSIATATRA
                     FFDLTTNQLNMLSSVYMIVFVVGAYFTCTTFERWGVRRGVLIGCGLNAMGSILKVAPG
                     LQKPSYLTLAVPQTLNSIAQLFVLSTPPLIAAQYFAPHQRTFATAIAATANSLGNAIA
                     LFAPPLIVRSSTGTTKEFMLLFCLEMGFCVLITVGVFLFLRPPSFKAPSQALLGELAS
                     AEGCAAVGRAQRPVAQPLHQRRGEREDEVASDELQSEAGSNGQNGDLSGVEGENDDSG
                     VGAGRGRAVAHGQRHTAPSEPIASHVSACAGAHGNNTSANRPAVEFADAEGMAKLGGG
                     AYSAQEDTRDPSPVFYTEFDRGSMSKHKAMTVWRRIRHNEHVITFLEVGHTIYLLLCR
                     RDFVFLLGAFSISMGSVWTYASVLAQILEPFGVAAELAGSIGAFNVIVGTVVSYLVGL
                     WVDRTRHYKHPLLVCLMGSVLCCIGLIIIMLKAPSHTRTMDGLCSFIYIFAGIFQNTA
                     IPICFEFAMEISYPLPESVPGALLMAGANLCSLIMLSIASMMLGNGVASISACVNVLI
                     LITCVCVVGAILAVFPREKLYRRDAEMEARQQLVAASADSYAASTAATRQFYENSLTA
                     LPQPPLPVSGLGNARRGAPAPLSGVTGKDAETEEEMLPRAARRPSETKAPPAVVAVCK
                     CVFADDELLDDALVDVRQSQNRMTRKEMNDGTPGMAQHREEEMCTRHR"
     gene            <127845..>128609
                     /locus_tag="LMJF_20_0355"
                     /db_xref="GeneID:12982184"
     mRNA            <127845..>128609
                     /locus_tag="LMJF_20_0355"
                     /product="hypothetical protein"
                     /transcript_id="XM_003721744.1"
                     /db_xref="GeneID:12982184"
     CDS             127845..128609
                     /locus_tag="LMJF_20_0355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003721792.1"
                     /db_xref="GeneID:12982184"
                     /db_xref="UniProtKB/TrEMBL:E9ACR9"
                     /translation="MHQWPRAYQSGIAGGANLVAKLQSDSRMSLSSARGIKTTVPLSP
                     LIRSTGTIPSLRSAAPTRVFAGISTADTLRRALRAPQLHMKPPASPLLRPPTQHPSCS
                     SSTLTTWSEFDESPFFQEISTFQFPVDLSGEPSAGADGSVLETGSVETVVVHNRGGGG
                     AQSPRGTADGFAEEGMAAMALHTGVVGAYRHVALHIHLEEVDELDGAPMPQRCRYRCA
                     GEKHRALLPSPTSPSCPRRYCEGDAALMSKTFRHRR"
     gene            <131276..>132223
                     /locus_tag="LMJF_20_0360"
                     /db_xref="GeneID:5651317"
     mRNA            <131276..>132223
                     /locus_tag="LMJF_20_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682741.1"
                     /db_xref="GeneID:5651317"
     CDS             131276..132223
                     /locus_tag="LMJF_20_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682793.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651317"
                     /db_xref="InterPro:IPR021333"
                     /db_xref="UniProtKB/TrEMBL:Q4QD05"
                     /translation="MKRSPSRIRTAALLVALLALLGTTAVRAYSVRYAGKTSANGIMN
                     FESLGYCAQDDSGHSMMPKLRSYQLSAEDVMLTNRFDMAPIGGESRQSACLSENCTWQ
                     FNHGLHYRNELTFFYGIVYKDTLRGGPVEGVYNNFASGQPLWWGNVSYWGGRQPYMAS
                     NGEWRNGNVVTYYTQWVCEYYEYQHSDASIFPTYPDGDVITEHFAGGYYHCGRLVERD
                     SQGRWIYQRCKEPFPWWAGLVIAVISLIAVVVIIITVCCWAFYCKRTKDSKERMHELE
                     TLADNPARVPTQTQVGLSRTPLYNGGDQSIHDEYSNAQA"
     gene            <135795..>139436
                     /locus_tag="LMJF_20_0370"
                     /db_xref="GeneID:5651318"
     mRNA            <135795..>139436
                     /locus_tag="LMJF_20_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682742.1"
                     /db_xref="GeneID:5651318"
     CDS             135795..139436
                     /locus_tag="LMJF_20_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682794.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651318"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QD04"
                     /translation="MEAPLGQLHHSEWYERVQVFLVLATERVTSLRSGIFWTLSYVLL
                     LALMYLFHSPFRSQLETRTDWYAQVTKGLQIWLAVVLLCFHVGPHLVESRSAAAASTT
                     AKSVASDATQHILAEDAVATIFFPTFCFTSSFCLLLHKIKRRYKLAFTYGPSFTVVMI
                     NSALLSSFALMHYTTCSEVFSTVESAVRAPEKTWSIPFVGSLAPPSTWLRASQVVCPQ
                     PVAKKPFACIAFVCSLCVAFVWIDYFYKKHLAGGDPSRGILWADMYPEKARNSNSPLA
                     ASSRASLIFRRWSLRRTRTRDSHVAKSLGLPEGDPRLQEAAPQTISLPSHAKHAKRRG
                     DSGADPTGWQDEHDRLGVSAEAYVSHPTNRPGMVPWFSTFIMRTTWQALARMSLEFLT
                     FDVRVLQHYAKPKIFELHFGSSLNQLPHFCIDGEHDTTYTDKEPAEAGTATLSVTSPP
                     TPLRCQATEALVPSPPKTSPERKEAEKGDTDIWFDWIADVGDGFNPTYAMARLLARPF
                     LKIRWHRPPSKRVGLSFLPTFDDPTPTDTPTIDRDPFALPRGSFVLVGGDLAYPSPND
                     ETYTTRLFEPYHDAMSSNVRLQSLFHAEQRRVVVADASDADVAHMHLLDAETVSRMAT
                     GRAALRTGHATAEEALRSVPLLFAIPGNHDWFDGLTTYRKYILERTWIGGWLMPQRSS
                     FFVLRLPHNWFVLCGDTGNMQDIDVAQRNYFLDVIEKYMDAESCVVLAAHEPGWIYDS
                     MLHKSELTQPELAKVSKALGTRLRLRLAGDIHHYSRHTPRDASSEAATLVVSGGGGAF
                     LHGPRNTPVVSQLTAYRRACAFPARNTLPTLLSRLLGFRVINWKFDFIIGVFSFLVVV
                     SLLPQSIKDVRRDSESSPLMTLPDAAAAWWERVCVYIVTLFTKGIASVLATLVFFAAF
                     AAAGAEKNTPVWMRLLHSSFWTFLTVFVCCGMLAYLICTLQYMVDNDMLVSADGHWGS
                     AVEDQVRASVDSLLNHTQRVLGEAHASVTAHELQRLQTSLYGGPLVSWCGVVLRCLDP
                     FEMLAYLSEKVSSPEMGTFTEDASRLDEVLYYLYFVFFYWILVTPLVSFVIGSYLMCC
                     VTLFDSLFDATYSAFQIEEYKNFVRFRLDAATRELHAYVIIMSHVPKSWSWDAAYQKE
                     LRSEKMQAAPPHLRAYPSRWHGKRFRTSARCDDGKHTELDEGMEEEVEILEHFVCAPH
                     RPPTSTFTA"
     gene            <141696..>145895
                     /locus_tag="LMJF_20_0375"
                     /db_xref="GeneID:5651319"
     mRNA            <141696..>145895
                     /locus_tag="LMJF_20_0375"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682743.1"
                     /db_xref="GeneID:5651319"
     CDS             141696..145895
                     /locus_tag="LMJF_20_0375"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682795.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0375"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0375"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651319"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q4QD03"
                     /translation="MSEWWHWSVRGANPFVDFSTVWIEPLIQNAVDFSHRIEPDVLCT
                     LAYLACMGSAYLFHSPFRAHSTAAMDTYGRVTKVFQTWSTIIFFCFHLGPQFFKEKQQ
                     EMSNAHAQGTGPILFFPLFIIFTIWFGFIHKMKRRWGLGVTYGSRFSVIALNSLVLAA
                     LGTVHYAYCYTLHENASHHVWRSILYYLMPSSVATQPFWCVSKLLCLSACFIVADYHY
                     KKWMGFDPARGILWAELYQLNKGLYKEALMTENDGKEDRRDWRELVAPPRVYAPAALS
                     SRSTAVQAAAAAAVGVPAAHTPHTPRTLYHECPPDVNLDLLESSYAADDADLRRICGG
                     GGVGGVSMTRANPTLSTSAADGSSWPHAPFAGAIGRVVSTMDLSGPTLPALMSFRAPQ
                     LLVKEAQKAQHPVNRPGMVPWWSTFVLFTAWQTVAGATLRFLAFDVRTIQGYTTPKIF
                     HLHFSASLRDTVRGAAEALGRSTATQPPASCDTSASSHSFGSLDATEGHAAASRGGKA
                     TGVSRANGSVREHSAPAAAATLPHTEPDVWFDWIADVGDGFNPTYAMARLLAQPILQL
                     PLKAARQAKRWQQFARGLHKVTSACSCDTSSVMASGSVSAPSTPTARPRAETAKEAAA
                     LELRRSASFSSISYSDRDDADTITTATCTLPPLRSARTSATAAAQGSTLSPGQGARED
                     PRADGAATTDAVVSNTSAHSPGTPRRRTASHEGQSAKDTPFRSLPKVGTDDFVTLPRG
                     SFVLVGGDLAYPSPNDETYTTRLFEPYHDAMSSNVRLQSLFHAEQRRVVVADASDADV
                     AHMHLLDAETVSRMATGRAALRTGHATAEEALRSVPLLFAIPGNHDWFDGLTTYRKYI
                     LERTWIGGWLMPQRSSFFVLRLPHNWFVLCGDTGNMQDIDVAQRNYFLDVIEKYMDAE
                     SCVILAAHEPDWVLDAMERDDKARQPELHRVVEALGTRLRLRLAGDIHHYSRHTPRDA
                     SSEAATLVVSGGGGAFLHGARNDVIISQGTRYVRACAFPEQNTFMNMASRLWGFRVIN
                     WKFDLVVGFLCFVLLLSVLPLPMDVDLNSRGTTGSGGGKMRLAQVFSLWVGYTTDIMS
                     HVITRGVISLVSLVFFLVCFSFAGADRHAPLLWRLCYGGGWAFAVLLCCSGAMAFLHV
                     QLLYLMGHDLLQSAGGHWGTELENQVVLMANALVVHLRHITGGEASWLSRHVGRTRDF
                     ALAIIPTGWLRVLLRCFDPFESLSFLSMTVSGGEVACFSANASRLQILLYYVYVLFFY
                     WVLITPIVSVLIGTFLLFSVTTFDYMYNATYSAFQMEEYKHFVRFRLDAATRELHAYV
                     VAVQKPSKVYQLDRGYLWSLTSPGLEEHRPPHLKQHPSRWGPVLSDARRKRPMTEVLE
                     HFTVHPHRVPQQTKQPMMDSE"
     gene            <146683..>147924
                     /locus_tag="LMJF_20_0380"
                     /db_xref="GeneID:5651320"
     mRNA            <146683..>147924
                     /locus_tag="LMJF_20_0380"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682744.1"
                     /db_xref="GeneID:5651320"
     CDS             146683..147924
                     /locus_tag="LMJF_20_0380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682796.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651320"
                     /db_xref="GOA:Q4QD02"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q4QD02"
                     /translation="MSAKLTVAVPRLASTVLLLARNPKHAISEQRPATGDNAARENDI
                     HVLIMKRHGKARFMPGVYVFPGGGIEGSDYAAATHYLAEHYNLHLQDAADKKVTTQDF
                     IESCGQPSAEEAELEAWACRVGALRELAEEAACVLRRDGCIFSEAEWIKWQKSRSDAG
                     ATGGASTDPVSSRPATLLPIYDLPAVSSLRPVARWVSPRQSRYRYDTYFYAALVNSAL
                     VSAEAHKAAHAPCSTQASSCDEANAGMGVRCIPPQELPLLEQASEVSELLWISPLEAL
                     RRHEDPSDVFSLAPPTYLLLHALSLQPSFASLAAAWAAAPASPEDPAAKPLGDLPHSS
                     VLPCVEPLSTMTEDGRRIMKFVLPARYFHETGWSVAEGEYLFPGECCAGHRHFIHVFV
                     GRAGATTGDGATADKPCTILH"
     gene            <150065..>151153
                     /locus_tag="LMJF_20_0390"
                     /db_xref="GeneID:5651321"
     mRNA            <150065..>151153
                     /locus_tag="LMJF_20_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682745.1"
                     /db_xref="GeneID:5651321"
     CDS             150065..151153
                     /locus_tag="LMJF_20_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682797.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651321"
                     /db_xref="UniProtKB/TrEMBL:Q4QD01"
                     /translation="MSIYCRLASPPVFLRALHTVSVSRDGWATVVFTDSHVVLHVEGT
                     DENMTATCTLPKNLFAEYAVVETRFALHIPTLIDALLMLGPSVATASTRAVLAYPTDD
                     AKLLVELTPTDRVAGGGSCGGFSGGGPMTQSDLGVGGSRMLQSLLVTRNVRDHLLDLR
                     FSEAALSAQVTLQGDTVRDLIADITAAQSTEVSIRIDPKVGVILRGEGGPYGEVEAHV
                     HATSEALLSLSREQSASTRVYTHHLALACGARGGTGGGGSSGSSAGAGGTGGGRLRGT
                     GASVRDGRLSNADYILMGLAASAAGAGSSGGGGGAAVGTLFGGFERLTLQINAQRQLS
                     VLHTQRDHELKVFVTVVVMPLSSVCDML"
     gene            <151989..>153695
                     /locus_tag="LMJF_20_0400"
                     /db_xref="GeneID:5651322"
     mRNA            <151989..>153695
                     /locus_tag="LMJF_20_0400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682746.1"
                     /db_xref="GeneID:5651322"
     CDS             151989..153695
                     /locus_tag="LMJF_20_0400"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682798.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651322"
                     /db_xref="UniProtKB/TrEMBL:Q4QD00"
                     /translation="MSEFQLILSPAQLTKHYEVLQFLSRHPNQPYTLAQLDSLLPRGV
                     AVQRFPAEWFALVEDGACWHRSIELHRTHGTVATASSPASSTPTAEERARYVLLCARA
                     EVNTLDELRARIESPSTLLDPEGCVALHTDQIVISAELIRRAVHMGLVYYFPDTYDKA
                     EYKQFGIRDASSSASGGAAAGSGPDGGTGSGSSSRASIGQATASLRESFLERDEAYGG
                     GSNVGGDRTYVALPPGVCVQHRLLTRRGVPEQEAYSLPTRFYVGERVLLLFDNLVAVK
                     KLGLPNKLHVEWSLAGVRLTNTGDTSQATGEGGTSRLEALAAAQPQPLRIRRENVAVR
                     STSAATTASATIDAPAPIVVSTKVKVEIEAVQPCTLKLILIVNGLENVLNLEVRESAV
                     SLPGVLVLRDRHLDSFALPQKSVLEDPIVNPSPSWRYPYESVLHSANSSSSGECSDDA
                     AAQWATAAAEPWTELVPLPWTQNPSPAVLALREATYPAQDITVRAATRAVFSAQSLAD
                     AARLRETKERMRREADARAGAGGGGKRRRRQQPRSNLVLSNRHLLHFGLDFSIPFVNR
                     RD"
     gene            <156393..>160433
                     /locus_tag="LMJF_20_0410"
                     /db_xref="GeneID:5651323"
     mRNA            <156393..>160433
                     /locus_tag="LMJF_20_0410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682747.1"
                     /db_xref="GeneID:5651323"
     CDS             156393..160433
                     /locus_tag="LMJF_20_0410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682799.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651323"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ9"
                     /translation="MTHSVYNKHDIPRELQRLIDHTDRGIEQLYQLAGRSTAASTGVV
                     DRQPIIAKEGERRQKRRVQYHSRGDQGSLLEERRAGVWHDDPHRSIRKGNSGGRGGAR
                     ADVQPRATARFSSRRSRDAYDHGGTSNGWRRSCASPREGTAQMQHGEYDNIDGNYFDD
                     DAGDVRPDVTESDDDTDVYERGKTGDENDSCKDEGDDCEPPSVSRQHRQWRASGVLRQ
                     TSVAAAGSSLLQSQSPSLRPLSPASTPHRTLNFSNGTAPSSPASLAKPPRHSRRRDLH
                     PPPSHVPGSFPPPPWQQRHTHQDHGDLLLAGGPSYTLSSSSFSGLRGSSAASSPSPTA
                     TTADTAAYRAHMAAQQSTQRPNTSSAAHRRRSQKQPLSGASMPTPSTSLFMSPGSTHS
                     RSRDESSLHTRSGLQKTSDTVSSGMLSRFGRRWNTIFKTMLTDPPPPAPSAASSTPRH
                     SAAAATSAPHPRSPPVPLSFSSSSSTTSTVGNVRAHGEGTPERGALPQLNELIPHPRA
                     DPATSPSTVADLANIAPTALPYSVASATAFADARITEQLRAELQAKEEAMLRLRMDHA
                     REMAELRQSLTHERANAAKQTADELATSFSIKEQLLQSSLQTERERLTEAEEQLRLAR
                     REAAQRKMDLEDSAHALQALQNKYATLAHSQGEHAAQAAQWRERAEKVTAEVAQLESQ
                     VKVWKAREVDWQAREAQLQLLAHAAEERREKEETSAQTALAQVEAAFTQTSQDYQDLL
                     AEATRRMSYLEKNHRKYKLLKEVHTALKTEYEQLVDSSVHRAQQSEAELVSLRAEAQE
                     LRQQLRQRDSATQEETASHQEMLSDYKRRLELQEANAAEQVKTLQHHIDTANHTIELL
                     RSQMDSLKQDLLDEQSQHQQMQMKAAQAELQWKEMEHEQQRTAAAYKVRTEETIAQLK
                     RQLREKDTKMQALAASAAEPVQRLRQQLDDERGRRARLEEQFRAYKKKAKEAEEQAAS
                     EMRREQLRAALLTPMSSATSSRARFAHSATATPSPPSSSAPCFCGWNGMGGGRKASSE
                     CAARSDGPAHPAVRVSTRGARDDQRESRFAYPAVLRAATAPASSVLAKASAAHAGEAD
                     AGGGGGGGRVTAAHSLATPRTDATHFSAEEGGRLPRPAPSAALPPHTSTRTIPASGDG
                     KGEQDARDRWTSSPSAVVAASVATDASAISPSATVESLSGISRTSPCTSTLMPGEDDA
                     VGVAETEGPASARAAEPTLSLQPRTANSPARTDAAAAKVPAADEDAMTTHVYADSMAQ
                     AHEHRMSTFHTSASEVLRRIAGSREEFLAQCAAIVKSTAAASRRGAQARQRFSDGDVR
                     AAVSGDNASASEASPSDDETDGQKHL"
     gene            <161340..>162464
                     /locus_tag="LMJF_20_0420"
                     /db_xref="GeneID:5651324"
     mRNA            <161340..>162464
                     /locus_tag="LMJF_20_0420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682748.1"
                     /db_xref="GeneID:5651324"
     CDS             161340..162464
                     /locus_tag="LMJF_20_0420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682800.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651324"
                     /db_xref="GOA:Q4QCZ8"
                     /db_xref="InterPro:IPR007823"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ8"
                     /translation="MLGGRHFQRKYEKKQKKKEAKKASQGPLRGAGGSSGVRAAVAAA
                     AGAAVKRKDGSTLKGPVVSHGDFMASRDSANNRKNVPFSSKMEEKVYRKEHRVPKYNS
                     IVDPERQNLAKAAGASSAAQRRRVLRQKGGDDLLDHFRERLNASTFRLLNEQVYNAPT
                     TLASRLLREEATFRDYHTGYHQQLMQWPINPNKLIVESLLGDRRGRFLANKGKSMPGH
                     IPPSWVVADMGCGEAQIAAALKPKGYTVHSFDFFALNSLVTVADTTKVPLADNHVDVC
                     VFSLSLMATDYVKSLFEAFRVLKPKRLLKIIEVRSRVPFPRKFAELVEDIGFDVDYSD
                     VAGDYFVAFDFIKKDGQAAANTQLRHEPGDVLVPSLYKKR"
     gene            <163808..>166183
                     /locus_tag="LMJF_20_0430"
                     /db_xref="GeneID:5651325"
     mRNA            <163808..>166183
                     /locus_tag="LMJF_20_0430"
                     /product="glycerol-3-phosphate dehydrogenase-like protein"
                     /transcript_id="XM_001682749.1"
                     /db_xref="GeneID:5651325"
     CDS             163808..166183
                     /locus_tag="LMJF_20_0430"
                     /EC_number="1.1.5.3"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase-like protein"
                     /protein_id="XP_001682801.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651325"
                     /db_xref="GOA:Q4QCZ7"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ7"
                     /translation="MSRHSRRLHVRLLRAAAVVAAGTLAYRRWRLRASSALPASAYRS
                     ANGAEHYHDSPAPRSSRWSALQRSSAADPFDLLVIGGGLTGLYTAVDAAQRGLRVALV
                     DAADFGGGSAASCMPSVSPGALPYVQRALRQRDWDWLRMAATVLVEETTWRNVAPRCV
                     VAPDTLLRRWQSWHWRGAVGRSGCEAASKAGATEDGTTAVLHSAEPSAREPSLLPFDL
                     THATTTLLPALHSTEMVEYVCAAIVSTAMSIFCGPLRLNLVLPRSVVEARLPALAPCS
                     GPSPSPAHLRGGIIANDFALRGNTVAVSLARTAEELGVTVLSYAPVFAIQEVSAPTAT
                     GMKMSSQSSSTGASSCAGVMLVSVRDALAAKAVAASLPASPDRSWSRFLQRRLRQSSA
                     SSPSSTADSTARPRSAVSSPDAATTTHVYTRSVVNCTGCWADTVKAMYDGNASDTVPA
                     AFAGYQAYSYLIAPANTVHAAPLPSTSSTDGHDAGQGTAASLPPLSETLQAAALLFSS
                     PRLSFASVMVLPWWDQCVMLGPSISSLPPLPATVAANTNAPLHSVDGYAAQRQRTLSM
                     LSSSGVSVDASRLLSCVSQIVPHVKGPKEVPWTGALLHRGYALHFSSVPLPKGGGQGD
                     VQEPVSLVSNCADAAGGVVAVARRDVPLLHVYGGIPLLARRIAEEAVDALVCHEPPLF
                     LEKTRKQLHRCRTRQLQLTTPASLCTTTDSGPMSARARLETLVKDTYAERVVDVVARR
                     THAAYTSPVEALQAIPTLANFMGRLLEWDEARRFSEVEAARRLVHSVAVTV"
     gene            <167747..>169210
                     /locus_tag="LMJF_20_0440"
                     /db_xref="GeneID:5651326"
     mRNA            <167747..>169210
                     /locus_tag="LMJF_20_0440"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682750.1"
                     /db_xref="GeneID:5651326"
     CDS             167747..169210
                     /locus_tag="LMJF_20_0440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682802.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651326"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ6"
                     /translation="MASDTSSNFYYFAYGTYVDAAELQRSLAAVSGSVASIIHSARPA
                     LLPGYRLVLDAVSAEGPRLGCINIAPLSLVARDPSTARHSPSKDRDGTSHEFKAAFRD
                     GARGIVYELSANMREPLLQAVAREGSFNAYAMLTCYVMSDVHRGVRAPDSQMLTSLVI
                     AALDMPLMEREFSEETLMQLRWQPLPKPQGVQAQPGLVAVVAPSPAGTPNGADSPLQP
                     RWPGLHWCNCTQSVRVAPSQAYAALLEKAYREYLHLNIAADQDGSSSTEVATHSSASS
                     DGGDVDSYATAIHRMVYQQVRNVSKDRQEAKTWYLAYGSNMSWEQVCVRIGPPYQRRP
                     AKLLGYVLVANTVSIGHSNGGNFGYYNVEPVALRKKKEAQGMVKHPSTMPPYVCGAAY
                     EISQAQLEIMDTYERGYSRELHRCTDLSDATAAPLECWTYIAQQTSEDLLPSHEYRSR
                     VLEGADILPPEYIECIRAVPTNPLRSPRQDKRLRKEL"
     gene            <170960..>171250
                     /locus_tag="LMJF_20_0450"
                     /db_xref="GeneID:5651327"
     mRNA            <170960..>171250
                     /locus_tag="LMJF_20_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682751.1"
                     /db_xref="GeneID:5651327"
     CDS             170960..171250
                     /locus_tag="LMJF_20_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682803.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651327"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ5"
                     /translation="MQDEHKFNAEDRRRAPPPNTPERALDYHERTNDDKLIAHASQVN
                     HLSKPRHRNCLTEFIIVETPVVSFLVDSSDPSLCLLRRSGRQGTKNEEKGVH"
     gene            <173904..>175031
                     /locus_tag="LMJF_20_0460"
                     /db_xref="GeneID:5651328"
     mRNA            <173904..>175031
                     /locus_tag="LMJF_20_0460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682752.1"
                     /db_xref="GeneID:5651328"
     CDS             173904..175031
                     /locus_tag="LMJF_20_0460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682804.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651328"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ4"
                     /translation="MIHLSLYHEHYGVRYAPRGLASWLFYVLCLLAIVVAPFAIAFFM
                     QNFWVKANYFYDMPEVTFTGRCAVRVSTVLGREYLWTCTDLFHGALQGTSLRILPYFS
                     TYEDDRDGDGKIDYANFLMSFPLGDALEVSSLYEPTSAATGGGADAPTSQRDAILEAS
                     FLPEFVYYINHHLVKVNLTAAPLLRYRRTPMHKGFGNVTTATSSTYSWSGTPVCALTK
                     ADMLFYTTHSLINSPYVSYMHTYTSSPLQELARQPADLLDLPRFSGNYAARNQSVVLR
                     PYVEAAGGLDVLRRDVSIVRGLWEDLDDLNTFTWYVQLRIPPAEVQYVPSYAEVLKWG
                     WIQYFAIAYIVQWLLWKLRMVLVTMGLINSRARFSTMRRQY"
     gene            <175922..>177739
                     /locus_tag="LMJF_20_0470"
                     /db_xref="GeneID:5651329"
     mRNA            <175922..>177739
                     /locus_tag="LMJF_20_0470"
                     /product="putative zeta tubulin"
                     /transcript_id="XM_001682753.1"
                     /db_xref="GeneID:5651329"
     CDS             175922..177739
                     /locus_tag="LMJF_20_0470"
                     /codon_start=1
                     /product="putative zeta tubulin"
                     /protein_id="XP_001682805.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651329"
                     /db_xref="GOA:Q4QCZ3"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR004058"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ3"
                     /translation="MAIVVVLIGQCGNQLGDELFTQLALCTSSAASSAGDKPPARVAD
                     PSPFFARDGKARCILVDTEPKVVLGVQQRHPDFIRAENVIYGQSGRGNNWGLGYYGVK
                     TEQSKRTERNAAVQRAFRNIARDQRDEDDNVLAKALQAIHRETRRTSDAEDGSGGFES
                     ILVLHSLVGGTGSGLASKLTARLRLYFTEPPPGQQVDEVYESKMMHYDGFDSSVQGTQ
                     RRARHLVNITVAPQALGEVATQGLNAALTLQHLQRHADAILLLRNDDAMAPGEPSGSS
                     ACSGASLLTRCVTFKEANEILVALLLPVLGYGQQPSCIANLLIQCIPPTYKQTTGGNK
                     ILTLLAAPQRSYATMRQCVHRAMFFTIKGGRTFMPGYVPTVPIDEMLSCTALRIHEGG
                     GDHVRRGSDRSSTRNVRGNGDDGDAQYRLFDHNTKKLGSRRLGSDSGGEARAGIAATA
                     ASSLASRRRQRSTLLSAPSPPSPPSARTRGGEGRFGSCEHDESSSATWNREDLEKLNQ
                     RVYLECVTTISPALYLHYLQLRRAPVTRMFEALDGVLVLNQAAELNRRVLLPLLRSAA
                     LKVSCGAFMSAYEDVGVKSEHVRRAYREVAEVLATAEEL"
     gene            <178566..>180224
                     /locus_tag="LMJF_20_0480"
                     /db_xref="GeneID:5651330"
     mRNA            <178566..>180224
                     /locus_tag="LMJF_20_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682754.1"
                     /db_xref="GeneID:5651330"
     CDS             178566..180224
                     /locus_tag="LMJF_20_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682806.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651330"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ2"
                     /translation="MQRWPCRRCCRAATLGSRTFVLVRRRAPSAFITTASHASSGAAP
                     PWTVAHQRVCIIIPPVEKLTTPPSPRLSRRYVDSQTLDDSRTQQADAQEPDHFRFAIK
                     NSERGLLDHGVTPDAIAFIAEAEEEYRASSSYLHDRPGGAGMPESETHVDEVTGQQTT
                     TTRIAAPFGETYVPSNRERFAERQRVGELSRQLNLVDKPFMLDEHAQLNLRKERQLCE
                     LLASPMPQLAKADEVAHFLLNGVYAQNLALQPRSCESVMLLYSHASFLRRLEGPTKQL
                     TGRAHDAARLAAPSSGADTRAVPRTPQDVPFLDDMRRLYTHQKRCFISPTPLSLEHFM
                     TTLSVITAPSTTAFHLANRLLLDADKFVLLPTRTTYTAYFTVCHVNNAMQFAMARYTD
                     AVQALQLPVDAPMLTALLKGLNESGYVEEAVSLLSRIGHVAVSTPLLNASLETLLLSE
                     QALACFSLYDAMRGSSVKPNAETYTLLLLACEKSQQWRRVTAILAEMQRRRVRGNEQT
                     LNLLLKGLLQERLHSYAAQLYHTMLAKKVPLWPALELGVRPLLR"
     gene            <180789..>181256
                     /locus_tag="LMJF_20_0490"
                     /db_xref="GeneID:5651331"
     mRNA            <180789..>181256
                     /locus_tag="LMJF_20_0490"
                     /product="putative RNA polymerase subunit"
                     /transcript_id="XM_001682755.1"
                     /db_xref="GeneID:5651331"
     CDS             180789..181256
                     /locus_tag="LMJF_20_0490"
                     /EC_number="2.7.7.6"
                     /codon_start=1
                     /product="putative RNA polymerase subunit"
                     /protein_id="XP_001682807.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651331"
                     /db_xref="GOA:Q4QCZ1"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ1"
                     /translation="MLHTTMHTRAPPPSCPRVCAPARSRTNKQPGRHPIDGTRARLRL
                     WPNSECGRTKAIERRTMSGVPIKTEVKQEEGKYGATAATQESKPGIFATQETLGDVVR
                     EDKEGTLYICGNCTAQLYFKPDSRLVCPICSHITGASTVFYKIRTEPTTYDTV"
     gene            <183007..>184665
                     /locus_tag="LMJF_20_0500"
                     /db_xref="GeneID:5651332"
     mRNA            <183007..>184665
                     /locus_tag="LMJF_20_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682756.1"
                     /db_xref="GeneID:5651332"
     CDS             183007..184665
                     /locus_tag="LMJF_20_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682808.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651332"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q4QCZ0"
                     /translation="MSIELLVEAIHTSPIRLSLCICGAGAGVIRRLTRVPECSRTLLE
                     ANVLYHRGSTQRALDGLPLHIVSADAARQLAQHAFHTSRAIVFAEAREQQRQQQPPEP
                     ASTLPKQTATLLFGIGATSAVKTSRSRRSRDEVHVCVWGGSVGLPEGSSHQSGGSPAM
                     LGAVRYYHMDMPDWLSRAEQDEQVELVVLHAIARTVESCIPADAEVVSRDTNAPGQRA
                     YPRSVFQALLPSAAESASARGDKVRISSSPPSLSVVTDAARLWSVPSESAPEPVCLDP
                     SGEVRWALQNVLGAGASAAASDGSVRDVCALWNRHGELHCSGISPYSAALRNAAAAVM
                     EHQQEGGYDRSAAPAASSNVIRLLYPGSFNPLHYGHTELVQAATRVLRQRQQQDVEQT
                     SLPTSVEVTYEIAAKVVDKGAIEMDDLARRVHQFLRRGERVAVTAAPLFVDKARLFPG
                     HGFLIGIDTAVRVLDPKHYSTNEDPADAEAAMVAALTHDIAGRGCYFVVGGRKMSDPA
                     GWRELSSLRIPESVQHLFVGIPATEFRVDVSSTELRAQRKGCSA"
     gene            <186077..>187366
                     /locus_tag="LMJF_20_0510"
                     /db_xref="GeneID:5651333"
     mRNA            <186077..>187366
                     /locus_tag="LMJF_20_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682757.1"
                     /db_xref="GeneID:5651333"
     CDS             186077..187366
                     /locus_tag="LMJF_20_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682809.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651333"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY9"
                     /translation="MLSYTSTLLRVFNRKNKAPQRMSNFTKVTNLNKAEKVKIETVDG
                     DVVKGRGRVHRRSHSGLKDAIEEMEHPAIWLWYPWRKNPEPPTPFMPSQRALKNIHGA
                     IFANLSPIQKKKQEQMLYGVNIPETRVMRFEQQHPLLSTALTQLDGQPKGFPFWYKKY
                     PTRRHAYEQRFSVPTEMLEGYNDSIKKAFSMSMMTIQEKQFAQEAMYMERYAEHDFDT
                     TSPAVLAVKRALKVRVLRNHLLTNPHNNIVKTILANTERKLNHTLRRLRKVDFKRYWE
                     IIRDHDVQDVLQPPNLVTYRQGSYWRYDWNAGLAISTQLADVLDPRGLNGCVETGRSR
                     SEVARDLGLSYTRPLQENEKKQLSEQAVYYERLAKFKMEQPEAARAQERERFVRKFSG
                     MFLKLDMKSGVPDFPSTYRKLLGTQVARWSSKRHGPM"
     gene            <188312..>191194
                     /locus_tag="LMJF_20_0520"
                     /db_xref="GeneID:5651334"
     mRNA            <188312..>191194
                     /locus_tag="LMJF_20_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682758.1"
                     /db_xref="GeneID:5651334"
     CDS             188312..191194
                     /locus_tag="LMJF_20_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682810.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651334"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY8"
                     /translation="MPSVPNKILVGPTTYVHLRRKHRDYYVPDFLCGADGESKSPRLP
                     DDSEHVWRYSVSKAHHNTVFFFNAVTRKSVWVLPVVHRDGRTEPLGEGEVMRAIYSSI
                     VADEGVEAIPEAAGNGLTKARVHQEKSMDARGKLDIGVTGSLSSTPQLLSAVAGQSTS
                     AEARSLGDPPSETAAPHVAGPSTHPAAALQAVARERVHAAVQRAREAEAQRTSAAPSA
                     IAEREHHRPTLQDRLAAWRARQHDPASPAEAQQQQPASTARGPTAATTETLSVVVNDP
                     YAYTISSTMPTNKQCESSSAEGALHAKENEMLPRTPDATQRHSPMHTQAPAAAFASTD
                     PEDALHALVLKQAQSLENINTAPLVNVAAPTIQERELARAAALLHREKIAAMQQEMAA
                     LESRRRALAVEQAEAEERARLAQARAAAERARLEEIERTTREQAQRRAAMDASAAAEL
                     RVQDVNEYLSKQRQLQEAAQSAVADSFTYASRIAAQLVAAAPRPESVCIPAEGKPSKS
                     GSEARAPLTPPDYRAHQVGRVAPTAAGPPAASPVAREPGPRAEAKKESGGASVGAPRG
                     ALTVAPTSTGAATAQRREGRLAYALPHLYEGELITYRPSRSFTRQAVLNDRAAAIENQ
                     PPRALSSSAARPTTPVILAAKRDGTGTQYYDAAHEHFFHGTWSEDKRDGAGVLSLPST
                     AVQGGWHDDQLVGPAIVQTRHSKGAVTFASGKPAGSLPAPGTGPTATLSRDNGALPST
                     ASHTSRTAAGTTTLTGNAVMELDNKALFVGALEEGRVRAPYVLQLGQGDYIEWLGAPA
                     RRRGCARSPAGTSGELIKHTPAHATSSSSAPASKAGTGECRIRFRNDDTYVGHVCNFQ
                     LHGFGYYRFAEDGHSYIGRFEAGLPHGEGLLIIANGDVYRGGFAKGLFDGHGTYDSHM
                     GHYVYEGDWVAGKMSGQGSLAFANGDVWKGTFRDDTRVVGVYTTLV"
     gene            <192103..>192537
                     /locus_tag="LMJF_20_0530"
                     /db_xref="GeneID:5651335"
     mRNA            <192103..>192537
                     /locus_tag="LMJF_20_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682759.1"
                     /db_xref="GeneID:5651335"
     CDS             192103..192537
                     /locus_tag="LMJF_20_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682811.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651335"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY7"
                     /translation="MGYTRERTNRHFFVSRANAFFSRLPISRIQRALAMEAIKKGSMK
                     PWKHTKEQIIGSPITCNFEYNPRPVRLIGTVMDAHTEETSIKGGLKVYARSEEANMML
                     WIPAGNPKLKYEVTAAKGSFEHYLDERSKWDEAWLTGRARMK"
     gene            <193462..>194160
                     /locus_tag="LMJF_20_0540"
                     /db_xref="GeneID:5651336"
     mRNA            <193462..>194160
                     /locus_tag="LMJF_20_0540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682760.1"
                     /db_xref="GeneID:5651336"
     CDS             193462..194160
                     /locus_tag="LMJF_20_0540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682812.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651336"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY6"
                     /translation="MPPPTEMQEMEMEMVQGMYDTYERLSDDPPSYCVSLAATQDEPP
                     QLRVIITYPTEEYPESAPCVVAVECISKARRIQVGAITKQVASICEENIGMHSVVLAL
                     QQVQDFLSRAVEEEEKTDLLRRGEVMAAEAAQRTGAVEEDPTIRVGTAVTRELFEEWS
                     RKHNAAKAKERAEREKKAVKVSASKLSGRQLWDNSLKSADWALFGGEAEEDGVENVDF
                     GSMKDLDEDEFDLE"
     gene            <195193..>196830
                     /locus_tag="LMJF_20_0550"
                     /db_xref="GeneID:5651337"
     mRNA            <195193..>196830
                     /locus_tag="LMJF_20_0550"
                     /product="chaperone protein DNAJ-like protein"
                     /transcript_id="XM_001682761.1"
                     /db_xref="GeneID:5651337"
     CDS             195193..196830
                     /locus_tag="LMJF_20_0550"
                     /codon_start=1
                     /product="chaperone protein DNAJ-like protein"
                     /protein_id="XP_001682813.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651337"
                     /db_xref="GOA:Q4QCY5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY5"
                     /translation="MLAPRSVRWCGGNRRSSGSASVRVGPHVRTTGPWVPWHTLLYQR
                     RCFQVIQRGHDRPQESLYNKLGFAKDTEARLVRRSTTELRQALLRRVEALTDPVNDPA
                     DKKRLSELKNAYTHLQDDRFRTNYASHYYASNDARLHVLCDGGQVAANFNPEHQQFTY
                     VDHAIDRESTRSGVGGCLPTGKAGGSASCSGPSGRSEVPTAEALGDAFRNATGVGESA
                     GGTTSSSATAYKAADAAGALNGTDITHLLRVTLEQSLAGCEVEVAIHKNVRCATCRAS
                     GRQQLRTPRKCPQCLGRGSAHMPSATYHIERRCLYCGGEGTVPAPPCRACDGRGVQLH
                     QAVQVPVSVPAGTLSNSLFRLRHQGHDGVRGGHAGDLLLTVLVSEHRYFYRSPERSHE
                     LHAMLPLPLSVALLGGRVKVPTLNGFGTVHVPPCVRSGEVLPLNVYGVPDATNRASAA
                     AAAPHTILYHALVMIPKGDALSGRQKAALQLYEAHHSYPSATAAEVEAVGRPRTFGAE
                     ASQQQTLSSSAGTVSREQLMASCAALKSSYKHWFHAD"
     gene            <198150..>199931
                     /locus_tag="LMJF_20_0560"
                     /db_xref="GeneID:5651338"
     mRNA            <198150..>199931
                     /locus_tag="LMJF_20_0560"
                     /product="putative cytidine triphosphate synthase"
                     /transcript_id="XM_001682762.1"
                     /db_xref="GeneID:5651338"
     CDS             198150..199931
                     /locus_tag="LMJF_20_0560"
                     /EC_number="6.3.4.2"
                     /codon_start=1
                     /product="putative cytidine triphosphate synthase"
                     /protein_id="XP_001682814.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651338"
                     /db_xref="GOA:Q4QCY4"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY4"
                     /translation="MEERKTASGSAYYLPSPLLLSQNQGEERVKFVVVSGGVCSSLGK
                     GVTTSAIGALLHASGYRVCSIKIDPYINIDAGLMSPYEHGEVYVLEDGGEADLDLGNY
                     ERWMSVHLTRDHNITTGKMYQKLLTKERAGGFLGKTVQLVPHFTNEVVNHIFKICQTP
                     MGGSNKRPEICMIELGGTVGDMESQPFVEALRRLRYSILPEDFCLVHTTYLPVFGGTQ
                     KTKPTQHSCRALLSLGLQPDFLVCRSEQPLAADVKAKLSDQCGVQSKDIIGAPDVNCL
                     YQIPVKFVDQGLIDRLLHKLRLRPNMPPTDAPTYQTFKKFSDILQNPNNQKVRIAFVG
                     KYVTGGSDAYFSVLQCFEHCQLALGINVEVFYLESEQLEGENAEEAEAALLECDGIFV
                     PGGFGVRGIDGKVNAVRLAREHNIPYFGVCLGMQVALIEFARSQLGWEDANSEEFDAS
                     STRQVVRIMDADRERMGANMHLGAREVHIVEPHSRMSTIYSGAKVVLERHRHRYEAHG
                     KYLNHLRKQGLVISAVSDPDAGENLRVEAIENPSLKFFLAVQFHPEFVSTPLDPSPPY
                     LAFFAAAAGKEVNWPAECTARRLPASA"
     gene            <202344..>203984
                     /locus_tag="LMJF_20_0570"
                     /db_xref="GeneID:5651339"
     mRNA            <202344..>203984
                     /locus_tag="LMJF_20_0570"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682763.1"
                     /db_xref="GeneID:5651339"
     CDS             202344..203984
                     /locus_tag="LMJF_20_0570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682815.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651339"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY3"
                     /translation="MHVGSTVRALRTRAMDAAEGGGTHVIELVSDDYFPSEIDERETQ
                     QQLSGSGPGDGGSSAQLGVTATSWRNLEAYIYSDAAVLDLQSHAWIPIPSAEARRRRW
                     RLVNCMHEQSPPITITITDLSSSVKPGTAPFPVAPQEATADHQTAKAPPHAAAAPPPS
                     ASSTPLPSSSPTASTSILATTTSQHSAASPHVARESENVTVGGSSQDVCLLGDGTVKA
                     EDWHPPMMASDSAGARNTTKWRLANAPYLARGFTLDVFPLECRQLLEDFPTGAQTESW
                     SMFVVAATLSFYQRQVPAWAATWWTWSAKLAGSGGSLSSRWLTAPSTAAPVHGSVLGM
                     AGSVSSAAVDTTTADAAASAVLAPLAGMVYVVRILLLCVLYALCSLLRTGQLACALLL
                     RFETSSTLPAKDSIMWTLATNKLWRLQVESMLASTAFILLVLCVLVLMRYRTYTQALE
                     SWETEMARYTAEEAAKWAAQMDVRQRGVRTPTSAAVYAGEPLHDSASSGSGDSIFQAP
                     MKASSTPLSGQGNFREESLEKTLRGASGSAAKRQDQPF"
     gene            <206770..>208065
                     /locus_tag="LMJF_20_0580"
                     /db_xref="GeneID:5651340"
     mRNA            <206770..>208065
                     /locus_tag="LMJF_20_0580"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682764.1"
                     /db_xref="GeneID:5651340"
     CDS             206770..208065
                     /locus_tag="LMJF_20_0580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682816.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651340"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY2"
                     /translation="MSEPHVPTAAAQQPSAEATANAALTADSTVHTSPQAPPPPAASG
                     ASTVSANVAEVKSVTATLSDVADSTEPLLVGKVVSSEIAQARSQPCTSDLNTAQSGAG
                     APVDANVGEQDRCSPPAKSTSSSSSSHSGEESSDEAADFETKELMFAFGRYVGQVNPQ
                     TGLRHGHGCQYYNNGNVYTGEWRDGAPDGFGEKRYRNGDVYRGNWRQGKRSGRGVYLF
                     VQGDTYEGMYADDKPEGQGTYATLKGDRYTGQWKAGQRHGTGRETLANGQVFVGNWRY
                     GKKQGRGKLYLPGSEKCIYGIWNNDRFFRELTANEMGADGAEDVVDELGTQRRPSALS
                     VALPGAKAPPPSASLADRVRMGVTALENRMESLGKALERVITGGDGDESAHVPRAAAM
                     GAASSTAGDVAVSEECTEPPAQGFVVNSHQANDEDGEQG"
     gene            <212476..>214326
                     /locus_tag="LMJF_20_0590"
                     /db_xref="GeneID:5651341"
     mRNA            <212476..>214326
                     /locus_tag="LMJF_20_0590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682765.1"
                     /db_xref="GeneID:5651341"
     CDS             212476..214326
                     /locus_tag="LMJF_20_0590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682817.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651341"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY1"
                     /translation="MLATVLHVLLFAAGLIGLLAIKKQRLRHIPTRRTHIPRRHAEGT
                     LWLQRFVNAVLDMLHGALAEQQTREAAEAAAARGGASVSFPPPEQVPGAPLESDASTK
                     CAAPASSDGTVCDGDADSVSSAEVLSELPFLNALKAQLEEQISALLEDKGIASFADFR
                     VKDWGGKPPVIKALYLSHGGGGGSGNSAASVTGATASSSAAPAAPLAGALGSMTSLDS
                     AGAGGAAAVAQQRAAAGMPLGNPCGLGKQTPQQQQPQNPHIQSPVSVGSFSYTNSMQP
                     LAASTVSAEQQSDVGGDAVNATVRSAMAPSMLASLRYRSAGKESSAAAGAGTAGRERN
                     VTGAMAHSACLGSSSGAHGGADSSSPVAGPSSTVAAAGVTAAHTCGARHATDTTRSLS
                     VLDAEVEVEYSGNFSVSLNADLPIARGRYLQVYVSLSDVRMLAAHVRLRLSLEYEPAT
                     VESPQPQPYLSGTLWLLSDPMFDAAFHSTLTQYRIHDFFMVPMLVKFFLLRFVRTKLR
                     PSAQAGTSSWPPASHRRRAGAQASGTIGTAAGGGASGTGGKQSTGGSTGMPDDVNEDA
                     QHGASDASGLSFRVQLPADVVDGGEHWWSSIARGSVSEQPVPFTSAYFVR"
     gene            <215214..>216443
                     /locus_tag="LMJF_20_0600"
                     /db_xref="GeneID:5651342"
     mRNA            <215214..>216443
                     /locus_tag="LMJF_20_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682766.1"
                     /db_xref="GeneID:5651342"
     CDS             215214..216443
                     /locus_tag="LMJF_20_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682818.1"
                     /db_xref="GeneID:5651342"
                     /db_xref="UniProtKB/TrEMBL:Q4QCY0"
                     /translation="MQAGRRKLVAESIAAYRASQRTSIDKEVVDDLRLRVVDLCSRCV
                     NKVELQLFGSLATGFCTTGADADLSLTFRNFSPWLSGIEAVDAQNFKRLARVGREAGE
                     MGMKNVRLINACIPVVHFQDAVSGIRCDLSIGNVNGVANSKILAEIHRVLPDFYGAYV
                     YLVKEWAKKCEVVAPDKSMFNSFTMTTMSLMVLQELGLLPIFVPTGTYGELTLPDVRN
                     ALDTFQLPPVYEGIGQDDERLGEAVYFCLLRFAEYYSKFDFRNGTVSLMCPRRHRSLY
                     AQIVKQHIELLGERKRKEWSAYLLGDHGDRAASTSSSRFPQKSFEESMRHEALQRQAD
                     TAFVVEDFVNYVNCGRRVPPGRCSKIHLEFKRLYEQLRDEANVSFRDVFHETHAIPLT
                     HKPNRSDSRVETFETKQ"
     gene            <217848..>222362
                     /locus_tag="LMJF_20_0620"
                     /db_xref="GeneID:5651343"
     mRNA            <217848..>222362
                     /locus_tag="LMJF_20_0620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682767.1"
                     /db_xref="GeneID:5651343"
     CDS             217848..222362
                     /locus_tag="LMJF_20_0620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682819.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651343"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX9"
                     /translation="MVSYDVDGDGLEEVIVGTTEGLLCVVKPDHREPLFLRVLAATIS
                     VVLYTPIQSRLVLVTLEGQCEVIDHFLKPTQQQQAGSEPANMNATLSMEGGDGGAACV
                     GGPLYQRTDGTSSLPHTSPPLNGGGRAAGGARASGRGTATSPHSAGRPWGAEGAMPTR
                     VFHVPSNCLCADLSPDRDDDLVFLGSYDRHFYVYSIINGSCLLSLFVHDPITSLKAFA
                     IPTCAADAHPATTLSPISVCDKRVSHRGSRCGSTTGSQRTCTSSSTCTGASILVDSLR
                     EMETTPDRLAKASALSCIPLVFISTPTHLILLPAGLGDIQRWRKLQPKSAHLPLTVQL
                     HSDDPPLTPHQPQHSKLQQAQQKCTRRRSSLNTDSGTASMGAALATSATGRLRSGDNH
                     PLEGESAVPPHMTRVPPASSPGLRQPVSMSADAGFRGVLAGKAPGGRASSRPRRLGGA
                     AAERRCDSAAVLTGGAHRTSAVSVPAAMTAAAVGAGVAAGLPLSSSQLRREARRHAIQ
                     AAEMGRPVLVKPLWALHIGRHALDVSLLQPMVSPDGHVGRRFVSAAAAAGSPQPSPVP
                     GAIAQEAVPGTAAGNPSARQPYRGGRSSIIPIQDSVGGTTTIQRAANSSVFYVSLPSS
                     TSALQGSAVAGNNTCNSVVRRRGTVAGSADLWHRRVHGHSCDGGEDTEASNATPTLSL
                     MSVAAAQSTRRSSLRTLTDSLPRRLRQCSTNDSSDDDGSAVGGRRCSSGDDDEDAGRL
                     SDDGTLSYVGGSAPAMRAGDMADRAPKEADNGDGYYGTATDEDFGLDRSGASITRSYS
                     SGSDASDRSSSIEVDEGIANGGRRALTSSSMRRSRHHHHHGTDTAEPALLARSLSHRR
                     AESAPTILLRRTRIADGADSGSGNAGGVGLRETPTPRKAAAHVSLVDLAEQKSERRAR
                     QCHRWASSRRQGEREGRGLLREGHTQVSVSRQQYAQPHLSAHSTSPPLATVASAPVGA
                     EVRLPTSVDVSVGASQVAVALSCEDGLAVELRFAIVRLSSLSRCERRLPRGTVRLYDV
                     QNPWGLHAEAGAARRKGGGVTKGSRPRGEVHGRDGGDGSNMRPASSSTSPEDARLFQP
                     HRSDGSQRRQPQRKGASLVTYNIYLPTPAAGQARTTAALSSLSHISGSSFISSHQRQC
                     SRSGRRGCGDAGGALGTTTVISTPAVTNVAGATGASLAQDDTACPASAAASHPLGVSA
                     GDAPILDADSGLGRNSRGAYVQHYGEDALVLRAQCLWAARLSDSPLVQRSRVFSVRDH
                     HLDNAFCTVFVAANGTCFVIDGDTLSVVECCIKEDCSSFTLMVGPLSTTPMLPTRASA
                     TTLQEAPAATMSFNVLRGAVGRRISCVCVGLDELCVYSVGEMNQLWGHRDCPTGALAT
                     SGANEPISLLSRCLPDKSCACVADAADAPPCEAGQGTDAHAGCSLASMDSEEQALLRQ
                     LAVRLRQHEQYASPPSHHDRGTGAGAASGGEHVIETDEEALMRVKKLLLYDYSEQEWE
                     RLQWLEHALA"
     gene            <223960..>227592
                     /locus_tag="LMJF_20_0630"
                     /db_xref="GeneID:5651344"
     mRNA            <223960..>227592
                     /locus_tag="LMJF_20_0630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682768.1"
                     /db_xref="GeneID:5651344"
     CDS             223960..227592
                     /locus_tag="LMJF_20_0630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682820.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651344"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX8"
                     /translation="MLRQALAPLGVNGASISHDTASVAPHSTSDGGGSCTTRAVAGIT
                     DGGADVSKHLEFAKHGHHSQKHNQRRPPSSSSASKASALVQTIREHQVSHARETHVPV
                     LDSISPHTDAARASTEEHVGISCRTAHAPAPHDITASPVAATSATPSPHSARGTKVVD
                     INPHPSVAAAVMVAAAHPPLSNKLNAPSRRSSMARLRQQVKAQLKGVEVAEPADDTSP
                     ASACDSDAVAAALRNGAAQGGETEEQLSLYSHQPALPSTLLAFSTSAEVASLKGSGMV
                     TEALAMPAVPSVGAAKVLPHGLRSPSAITDVGAAPLDYSELGTEESEPVSNVSPARYY
                     YQQQQKRSASLHKQRTDSVPSSHIGGALQPNTPFHALQFGSCAPANSVGSPPLLCPSE
                     EPPHLHSLHQCHGLRLDSEEGADASFRQGSRASRESINTVTLRSRPARTTKAAAGGRS
                     STSSPAVSDCELPSLIVCPFALMGCCAEGAHRIADLHKGTTLHHHLMAVTTCVQRMRG
                     RQQELERLVRGLQQQVHKQALMLREAREVERARQRPAASPSVLISSRGSSMDGCLCPA
                     STPAGGTNALNSCKDRKALPRDVSIREPLVAEYGIGDEDDVRAGKHASEIDAGGDSPG
                     RRAQPPRGTQMQRGGSHSVRRSDGDRDGARVYARQLRMRTAAGQQRLHLVDAPSSASV
                     SLTPVWCGLRSLASAGTATAAQKTTAAEVQGLGEKMRRATAVQQKQQEQQQGSANGGE
                     QAPSCTPKQNNLHRDGIEDLSTVSGDGLGDDDDSVQGKRCMTTLSAPRLSGADIGTES
                     GCSPTRHGRCAAAPYVHYGAYPRQQPGAGGSTEVSGMSNVPPYQVPNESVSPIRSASL
                     DLDDHEDDTDAGAMCQQLLNLTSTEIPVATRAEESCITGRTGQPGARAKWTTDPQLSP
                     AASPRSAPSLVSVTYRPSELACAEGSDDEGAVHLTGRVSPTRGGSASAVAAANRQVRA
                     DDASRRLLLDSVRLAAPLQRPTLVRKSDVVRPPPTARDGADGSKTVLPLLTPPSLATL
                     ADASVAAAATSILSKSDVQRPRQMSAPESGGTRGPLSGINFDAPSSALPVRASLLVAS
                     ASGGFIVNHSSVHASYNGTSEATPLPEPVSKRSSASKNHLVHAHSYRVDKDATGEHCG
                     ALAGSASYALGGPCKSGGRRSGSQTRRGAAMRRPLHVTSVLSPQEAVDQGVAVHPLGL
                     PPRRES"
     gene            <229848..>233033
                     /locus_tag="LMJF_20_0640"
                     /db_xref="GeneID:5651345"
     mRNA            <229848..>233033
                     /locus_tag="LMJF_20_0640"
                     /product="putative kinesin heavy chain"
                     /transcript_id="XM_001682769.1"
                     /db_xref="GeneID:5651345"
     CDS             229848..233033
                     /locus_tag="LMJF_20_0640"
                     /codon_start=1
                     /product="putative kinesin heavy chain"
                     /protein_id="XP_001682821.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651345"
                     /db_xref="GOA:Q4QCX7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX7"
                     /translation="MYGQTGSGKTHTMFGEVNGGAWATSFDSGRPPAGVAFNADTNEE
                     DVNERPKAEGGPAHARLTEEEHGEVESHACERQEAQVEGEDEERHEEQKQQQTSQQAL
                     QAASTSPRETRLKLSSYHTQTGHPATSVTATTRSTAAVPPPSTAATSFCRTRATVTPL
                     GELHQINTLQNGTGSDAVEYCYAAVNKSTKMCAAATASTSCASPSSSAAPVSPSSAFS
                     RSGPPRCTGRSATGMRPAFTGDAVSGVIPRAVHDIFDAIAHADPSKEFDVQMFFVEVY
                     MEQIRDLLAPNPSAAMSSSSAGVAPTLPIGPRKLQLREDVSTNSFYVDGCCNPHVSSA
                     RDVLHLVKSGLKQRVTSATAMNETSSRSHCLLNLTVKSVDRAQGVSTVGKLYLVDLAG
                     SEKVGKTNATGLRLEEAKLINKSLSTLGMVIMSLTDHNATHTPYRDSVLTKILKDSLG
                     GNSHTALVICCNPSPCHAQETLSTLRFGARAKAIENKAVVNRDLTAAQLRRMLETAKE
                     EIERLHVKVQQLSMTSGAVDSCKGTPDFPVAASRKLSSAATATASSMASEADTSRISE
                     LLEERATEQARLQNLRAEVAQLHDSLNSAQDIISALQEERDGYIDKVQSFQEEISVWE
                     DAHSASLKRAATQDTLLQQCTVLLRAQASEIRDLMQCMAAYGQPLQQARQAVDQLHAY
                     VYGPDASRERWRMLFPAEACQEKTIAAAPQLSLPRHAPSVSTNECTLQGLLSHPLASV
                     HGFDVSAVGRVTESSGRHITGSSNLPDGQSPNPRLQSGVDADPPQPSRSRSQPQNCVA
                     SDYCDSLMSGSIRVSPGTATAQQWVSRAASVGQNDSGASHVGSCGQGGMTAAAPAECV
                     RLLEEQLASLQSGHSALLQQHKEALAELQSKQRILDLRRGHLATVKDELKREYMINKE
                     LRERLEKGQASLRGPLEMARNDANYWRRRYEELASRKDMPFPAECQRGSPYFVFRPPP
                     PAPPPQQQHEAGCSGTVDADVLNRMVVHASADLASGGAVIERRNRFSIPDISSGVLSS
                     RASGENVLLSLSSATTPLRSTVARLTTELED"
     gene            <234193..>236409
                     /locus_tag="LMJF_20_0650"
                     /db_xref="GeneID:5651346"
     mRNA            <234193..>236409
                     /locus_tag="LMJF_20_0650"
                     /product="rRNA biogenesis protein-like protein"
                     /transcript_id="XM_001682770.1"
                     /db_xref="GeneID:5651346"
     CDS             234193..236409
                     /locus_tag="LMJF_20_0650"
                     /codon_start=1
                     /product="rRNA biogenesis protein-like protein"
                     /protein_id="XP_001682822.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651346"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX6"
                     /translation="MSRTSSSAATSASPLFREYRVHHVTTDGILVQLPETRGFGRLTT
                     ATLGDDLLAKRLLTSLSAREQVIAMPMRSRDAQGYRLLTVDLKEGFSAILTYPEPVRR
                     LVQRLLRKHMLVGLGTTAEARLVRGSAKGSVLTIQPRMTAVAALEDLTKGASSASLKS
                     FSGAAARAQQRQKSRGGSGIISDDDEHHVDHAREDSSLGASTERNKAAADGNTVEVRI
                     LNYDVNADVVNVTAKAKVVEGTPVDTAVSAAALATLHPGDIVSCTVLLSSTDDGCAVV
                     QIPVQSVTVDPHDSSSGCVTVLGYYVYDWDGNGVPAAPVVGHAVDLVIEFCPEIAALR
                     DVAPFAILSNRLRQFHCLPAVRHFAGSTIEASTSASASDPSAANPTSPAAARGLLGFF
                     PWRTEYAAKARRAEESEDDEDAAEGHSGHGSAQDRRQRTRRRKLEEAIDAYERGMETA
                     VPTSPEEFQRLLLANPNSSYVWMQYMAYHVGLQQYEAARQVAEKALSTIGVREQEELL
                     NVWVAYLNIENLYGTEESLSAVFRRAQQRQLNQLTLFERLADIYAASRKPNQLLALCR
                     AMTGKFRTERRTWERLGIVLVDQGKRDQLKRTLKDMGDVLKRDDATLAIVHIAIHEYK
                     HGSPENGRALFEGLLRKVPKRSDVWTIYTDQEMGLLNRKDPMGSTLQVRQILQRTVAM
                     NFSAKVMQQVLTRFLSFEKLHGTPADVESVKKCARTYVESKIQALSDSGVPDTATA"
     gene            <237698..>239497
                     /locus_tag="LMJF_20_0660"
                     /db_xref="GeneID:5651347"
     mRNA            <237698..>239497
                     /locus_tag="LMJF_20_0660"
                     /product="putative serine/threonine protein phosphatase 2A
                     regulatory subunit"
                     /transcript_id="XM_001682771.1"
                     /db_xref="GeneID:5651347"
     CDS             237698..239497
                     /locus_tag="LMJF_20_0660"
                     /codon_start=1
                     /product="putative serine/threonine protein phosphatase 2A
                     regulatory subunit"
                     /protein_id="XP_001682823.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651347"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX5"
                     /translation="MEQFDSVKTMIDKLRSEDPEARLSSMRGIHLISTTLGPERTRDE
                     LLLYLTDYLDDNDEVLRVFANALGTMVPEVGGVEYTSSLLAPLEILGSLDEVTVRDEA
                     VASLQLIGSQLFSPGSITGSSGASSADNKRKDSNAKARGEFISMVRRLGEGMPQCRST
                     ACSLISTVYPCADASTRADLIKLFQKLCEDDEILVRRAACVAMGKHLAGVLGSKGCSE
                     LVPVLNAFAKDESDGVRLQAVATCASLLQVLPETQHSAILLAVRSLSSDSSWRVRYMT
                     ADSLGNLAAALSPPDVVKYAVPVFRALCQDSEPEIRASAVFNMANVLAACRDATGKKD
                     ILVTGTRLVSDDVSHVRMSLASAVLKSVAHVAKDLWGTTIVPACTALLRDAEADVRLA
                     LVSGFSSMGNTPEAKELAPSLVPVVISLAADSKWRVREVVVAQVPYVITSLGRSAEQV
                     LQVCVNRLTDRVAAIRDAAVQSCCKLVAEHGSGWAASTLLPQVQTLVTDPNYLHRVTL
                     CHLYAALADVAAFDAATCESALWPQLVTLHTDAVPNVRLNVAKAIMALSRSDKVPSRV
                     AKPVLRALSEDAEVDVCDAAVAAPALKSFMSKK"
     gene            <240727..>241473
                     /locus_tag="LMJF_20_0670"
                     /db_xref="GeneID:5651348"
     mRNA            <240727..>241473
                     /locus_tag="LMJF_20_0670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682772.1"
                     /db_xref="GeneID:5651348"
     CDS             240727..241473
                     /locus_tag="LMJF_20_0670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682824.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651348"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX4"
                     /translation="MLRRTLARCNRPKGPPGLRPGKEYRLTVPYRSEVTMIRQAGFKK
                     FNSNIRELFKKPLEQNNIKAVPRDLGELPRNYVVKLLFFHQPIRLLDLWELCKQRNDV
                     PLDSARHLRLVLKIAKLQKWVYAEKNQTDNLYYYYVHQSRTHEVQQMVRQDEFVKRAR
                     ETEAKVQAMRKEEERQARQAESLDDRIIALQNTLVSNVGHIRAFDPAFVDAKPYAMES
                     GAVNCAWHWEGAAAAAAQSSLSHTQENSKL"
     gene            <243071..>243718
                     /locus_tag="LMJF_20_0680"
                     /db_xref="GeneID:5651349"
     mRNA            <243071..>243718
                     /locus_tag="LMJF_20_0680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682773.1"
                     /db_xref="GeneID:5651349"
     CDS             243071..243718
                     /locus_tag="LMJF_20_0680"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682825.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651349"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX3"
                     /translation="MQWQQAPPGLAAPFATAPSSTPPPLFGVIIPGDPVQTNISPVDT
                     GRWAVHLGVAPESFVVFLTMSEPLPPGHGIGLFLAREDTMSFQYVGALTQQRASFIVE
                     VPAVFLNAAQPIRIVLGLALEREEELKNLGFTHEQPLQQSQAATKVAIAERILEDLYG
                     FVVSYARTITLGGGSGTSDATSIEPGDYVVMPTSFVDKWRARLQSKITKDNAFWA"
     gene            <248512..>252477
                     /locus_tag="LMJF_20_0690"
                     /db_xref="GeneID:5651350"
     mRNA            <248512..>252477
                     /locus_tag="LMJF_20_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682774.1"
                     /db_xref="GeneID:5651350"
     CDS             248512..252477
                     /locus_tag="LMJF_20_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682826.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651350"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX2"
                     /translation="MGGYPSHDAPNFLFATAAQHPNNGGTTEVCLVPLLRRHFNDTNR
                     RLKDAVAQLYFDGPPNTTALALQAMQNGISSNCTTPDLSAQTSLHNISDTAGGVIPSA
                     GPPPPALNATFASSGNLDASAETKRKAVHAYKAMDQLLNEIEASFFTATRVVYDSAGQ
                     ANAKLHEKRMASIKGMDSATSPKVGPEVGGSVKGDLAAPRAIGSSSRASLSSQQSMTP
                     PQPPMLRPVPCAVCTIEPDTSGRRGSSGQQNSTSPNGAKGNNTLTALNVPTPTTGPNG
                     LQMSGSSGSVGSIPSSPEWVTVQGRRLRCIGYLSCFSKPRTVDHESKEVYGPESKPPL
                     HVLRINECGSKGLDVAFELIFENEYKYMHLLEPVVFLASIMFRSQYLTSSMLQRPVHS
                     PEVENAYYTHLQLLNIHVMLPKDRVHQLKVLQEQLPLLDFVEEMGLSERHLAASVGGE
                     MASCGGGAPSLEKALTVGSISAEIITAATADGEAPTKTDSDTLVQTVVSDGGEVAKPQ
                     RQARGDDSEDREHSDVDDDGHRSGEAGAVTDVAAVEKAVKKREDGENEDGDAADSTRN
                     TTADWEKDAKPSNASAPTASRRTRRSRRRQRKQKTAEPQDEIYRRTHCTMPEVSLYEL
                     SSGERGIEVIFDGALLARMMKLIAETAAYETVKNSFIRCDMGPLMKERRHLNQSRREA
                     LQEEGSLEREEHVMGSTIVAATVRHWVKEGLAAEEEKRKKAQAAAAHAEQAQHAATTQ
                     AAAAAAAQTHPLPPPQAAQMLHNLPAMHANIVQGVAPNALTGPAAPTTAGHPLLAAQA
                     AAMGQNPTMLRMGMVPSNQSTAAAAPTTAATAGAPMLMYVAGVGYVQVPSNSRVLTAP
                     AAPTQAAHPAYVINPATGQPMMVAPQAASAGATSASGTPPQPPQMMAFPSMMHMYNVP
                     QQQQQMIGASQQYFAAQAAPQAVQQSQQQYQYMMGPGGQLLMVPVASAPTAQAVQQPQ
                     QQQPFMMTTIPPQQAPQMQPQQVYMNPYMMPGVMNMAAAQQQAQQQGQQAQQLAQQQA
                     QQQAQYHAQQQAQQQAQHQAEGQKAYQQFMDAQEELQLLRQLQQQAQLAQQAPLNEQQ
                     QAQLLKQAQMMLQARRAQQAHAQQQQAQHQAQQMAQQQQAMASMAAGGSSQTFSPQSA
                     SRTPASTPPQQGSAAAPPASYNAVPGSVMPPLPHMQGMQHTSMQNMYAHAQQQQQQPA
                     PTSNASGKEVSASGPAASAANTSAKSTATNAGAASAGVAEVIGDQVTTPAAANPHLKT
                     NPYSFAAINDDEDDAAVALAAATAAMEAIRGHGGIDRDDDEDEDGSQFFSNGQFFFRA
                     Q"
     gene            <268471..>271653
                     /locus_tag="LMJF_20_0700"
                     /db_xref="GeneID:5651351"
     mRNA            <268471..>271653
                     /locus_tag="LMJF_20_0700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682775.1"
                     /db_xref="GeneID:5651351"
     CDS             268471..271653
                     /locus_tag="LMJF_20_0700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682827.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651351"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX1"
                     /translation="MGATPSREAKPTIRSLRYGNHEIGLIPITRAYFNDQNPQLRQQF
                     IRVRNDPNVRYSHTRPRGYSMAEVPPANYTEADLEAFLDTVERSLFDTNEEMLDAGAL
                     QTPTISMAHLQHLMQCDGEVDVYDPTLEEEAEDSDKSSQPPTSVEPFFLGAIGTPSLP
                     PHNTVNSGHATSPQNPYPPRETTSWLRSTSLSLRASSSDEAGNSPAHSVSAVSATLSL
                     NATASHMLLPPATPTAPPQDEKTPKMPSAEDCAIDWFLRLKGFLQAHHRRVDESCSPS
                     DSDTHNHHERSPCASQFKSEEYMRFKRAVQPVPCAVLFIYVSNREEHDCFTFQGHRVN
                     VIGSFDMRSHDDDRDAFTPTLQIRKAILKAAGDRTLERVLALSTKYYLDSFTEIVLQQ
                     LQRRPVAELLAGLGEEARKLLCELPPSSLVGGTDGCSSMHDPVSVARALFYERITKLP
                     LVVSSPFNNYPALKFIYDFTSLTHSIENSQFVRPGDLRLCTYDREKGERGIVFLFHGR
                     ALALTWLWATTQTQTSTVRESWTQYTLCEHTQSRERRVQHWLATDPRAKTLLGDSAIT
                     TCFEQHLGHLHSEIVRARSTPTDDATSWSGVQEYSHDMKLYRIFLSPLCGPLLTTVKT
                     AKPEKAKERGNVKRASAPSSIPSAANGGNASTGSRSRVTSDLRLMMMSPSGNVSPANN
                     RSCMQARGKRSPNSPLTGLSTSGRIPSTSNFSTSAATLGGGSSSSSAPLCMSGTANCT
                     FLHPPPHAPSSLSGDGATRVTMTRGLMAPAAFKSQAAPIAGMHAPMPIYFTDTLQPPS
                     MASPSNSLHLLSQTVPPSSEPPQTGCASPMLVTSPPTGLPFSVPSAPWSVHSFIQSPQ
                     PSQSMMPSPGQPPTAVSTSYVVQVSSNGVQTLMPITFAPTQSSTIPSVSFFQADTTQT
                     SSANASHTAQPPPPPPFSAMRMASGKGDTSSLSSSQQSFSSKGTPQAGASVLGSVSSS
                     YPHPAHNLDGAASVPYPNMIATGHGGAQMATAPYQMAQPQSTSSMFATMHQVPAQLVS
                     DPTACFATPKTYVPVGYFSTSVPGPASMPQ"
     gene            <285659..>290593
                     /locus_tag="LMJF_20_0705"
                     /db_xref="GeneID:5651352"
     mRNA            <285659..>290593
                     /locus_tag="LMJF_20_0705"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682776.1"
                     /db_xref="GeneID:5651352"
     CDS             285659..290593
                     /locus_tag="LMJF_20_0705"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682828.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0705"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0705"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651352"
                     /db_xref="UniProtKB/TrEMBL:Q4QCX0"
                     /translation="MGAVPSRECTSLFSYFRGSYEVGMVPLTKYYFGKDTDATTAPVD
                     VDVSVHISPLQHTTTAGRKPQQHPSSLLSHAGSRSHMRQQLRQQLLLMRRDPAVLYAN
                     ARDAQNILQSLSRHENNAHHRSNSSSEARTTSAETTSLSPAAVVGKEASTSAATGVAT
                     AADHSVNENSGAATPEENSRTDSLTGASDSERSGSNLPVHQQDGSSATDSCATERLFR
                     NYWSIMPDSNFAEADLDRFLDLVDATLFDTNDELLSADPVLSGTAAAPGTSSAKPFMP
                     VPCALCLAYPDGKEREGALALDGRVINIIGYFGLMTREMQDAFKVVKRFPNESEKRRQ
                     HADEADSASGPIMFLNTAILTSAGDRTLERVLVLAAVMLRQQFHTIGRRHVLQAKLNQ
                     LLHEQREHKHNVDPQMVRYLQTLLALPPRVEQQQPFFDPLLGIPLPSIPSGIYTPTQY
                     VNAASNEASQRPHVSSLSSCGRPALGSFPGDGKLQNATMGLCAGVAGESSPLCMRSLP
                     HDRPSSMGHAHSASGAGSGHVLLYPQQSASGVPAGGVLGVALNASGPGSGSEGMCPPL
                     MDSCGGSLGANAAMPSPPVLGPLPLNQSDEDAITLALCRRMQRGCVVIETASNNYSAL
                     KSLTENFAFLCCQILLDQSLITMELIELPALVETPSFKPAEFAKTVATTLGSTASEEA
                     RSSTGVTQPAADDEKPLRTAQPSQPQLPPFSAVLIKLDPQHVCQATMWASSFFHCPTL
                     LPSGGWVKYKLKDECEQLRHVLQNKDMLIAHWRKTDVDQAGHYLGKHTARLLEHVRAL
                     QAETEEARALSAEYWMQRPLYVNQDGRKYGLYQSRYGTMLIGVRAFTAGSGSSAAAAA
                     NAREERSGSTKAAVGSNATSFSGCSTSLAAHAGQASTISGNLHNTNSGSGSGLAIAPR
                     GAAPRTGGVDGSRTGHHSVFSSNNDGGMSLQNVSNSSNISERYGRGVGGDMAGGGAGY
                     SNNGRYVNYPPHTTNDNNGNGTYAPAPFMQPQVYTSSNNSGRPGEAVPYCGSPSVPGY
                     LMEMASGYNTLPPKQPQQRVHIMSVTPDSHKSKSAHSSGHSRVGSSLAYGMAGWPAVQ
                     PNNAQMSPPPTSSHMKCTPPGQQQGKAMGRPSGFAYAAAPSSMSYKPAPLTYLAASHN
                     THPPATGTCALASSPQSPPMSGEQENGSPLRADVAASPPLRLQSAGNTDPQHGRPMDA
                     AKNAAASRPQPDVKAPGANDKKGEVPRSSEPAKSATSSTPHGHSATATHAAVAPFLHG
                     CIGMNCDDVGAAGNCLAASQCNGSVTQQATRSSSDPHATKAVDENTTADQATAPKAAV
                     LRSVMPWSLQSGIGWESNDDATDDTTQFLLRSTELLHVDDDDAKKEPAGGNRNNAASN
                     GTAGDEPGARRVTRSTAGQDMFVDNAARQLPQPAPAKNLNLSIMNMLLAAAPQSQPSD
                     AAMSSTAAARQLTFPTIAEPPNPVPAPSFQPGGVFPVYVLQLPAHAPQQQQRQSQPQP
                     QLTSTSQLPAAAPPSDKPLYYTMASGVPLLVQPATTPGGLAIAYPNGQPFPQGGDSFV
                     PYPAMPQPPPSQQPQQQSIPMMQHGQAMMSVPGLDGRPVARFSVQPGASWGNQYRFFS
                     NSPSNLAGAYANSRTPAYSNNKGNNPFRTGNDFS"
     gene            <301502..>313501
                     /locus_tag="LMJF_20_0770"
                     /db_xref="GeneID:5651353"
     mRNA            <301502..>313501
                     /locus_tag="LMJF_20_0770"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682777.1"
                     /db_xref="GeneID:5651353"
     CDS             301502..313501
                     /locus_tag="LMJF_20_0770"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682829.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651353"
                     /db_xref="GOA:Q4QCW9"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW9"
                     /translation="MSDFFSSSSDSSSDDGIFTRRVEFQPRQRGASSSSSSVSASGSS
                     ATREVVTFISESAPPCTVDAVEAPAAAGATTSRARSQLPNVAPVVLLEKVAIQTSLQS
                     ASTGSEDKSSPGESPAQQRRRRRVAETRPSAIKGTLGSPIERATEPKQHRGRRSSLSN
                     PGSPLELPRPSRSSSRQRRTSVHSMSTVDLVAATLVRASSNTLSTFTNKRAGGRSGGG
                     VRRRHPRGTATTSLGALSLVSASPTVSAVNARLLSDEAYLDMFHIPALIAQLSLSLMA
                     AKPVDPRAFTRDWLADRLVSEEDEDDDNVDEGGGSTNSGSGAREQESQAPPSGTAVLT
                     RSTELPSSTSFLFQASGSTMGDLASDSGATRPCWTEVSCRQGCSGRHSRQRRRTNTSG
                     EDEADDIAKSPLTADGDGDTTGTAIERPASVGHPTRKRRAFERRAQRKDQKSVATPMA
                     SQQRGVHGISNDAGSRRNEMSESSRYSTSDDAGSRSPRRGSLLTTLAPPPAEAGEHKE
                     SQAAECESSSPMQRSEETERNATAAAPSSLPPKPKTSSSSSPSSSSSSFTAFRCPEND
                     GVEGARVELQSRRTTVAGSSTSADVDIPSSHRRMTMESESSTSTDGLSAPHEAAHSGR
                     EVRQSSSSSRAAETAVNDVPALVTAEHKGIHKSSSSSSSAGDRYTGDKGAFTSPPQRR
                     ITVISAASASTVASAIGLLGANAEVNLSPAVQQQEQQQCDGAHGPAALARDRVGHTSG
                     RATELSTDASSIIRTEASAAKRGAAKEEFSRSDSEAEEGGEAERHGSHAAADKTEPVH
                     STARGSEKDAADLAEAAAEGDGRDGDDDVSFAMFVPILAVDATTNEVIDYREAGVSPP
                     SAPAFSPTSGGACALPSYPTVSASGVGGGHLAQTHTSTAVTQSSGFPPYATRPVSSTF
                     SVLPTPMLADLVVGGGMTNTSFGRRGVPNTSFGRRPAPMTGAAGRYVDPATGVMTGSS
                     SPPAPFITPHAPMDLPALGVGDGVVGGESLENLQLLGFPKLHSNLAAVSAGSVTGVRA
                     SGSAVVAGEATSVQERKAVQDDDVADSNTAAPSAFCQSAGLHGATDGARNTNLSLTKD
                     KLGPVAALSTASSPLSSTMKLESARRLGKLLDQLPAAKYAAAIVFLEGLLSSSGGSSD
                     AAATPESESISMMATIGDASNRNRGLLNVTNAAADTTLGGVGLSGDGSSPLVGSITPG
                     RPWSGAFGPDRSPTGRAPSFAHLVGGGNGQAPALAASGRNEDGVGALAMVGRAPEGGH
                     SRSRSKGGSTSVEALVRDALSQSVLRSLPPTHEEVPGSVPSLPLHLEVSGRGASDGTS
                     IGMHRVPSPTRLENTHGEQFANAATSTARANTSRGNSPVPVVPGGGSDGVTSQHPTSQ
                     SERSNLSFYKQPSSTDMSNLRRRSSSPSPGGYVLTATALQQWQQPQQQSATKKTTEDR
                     LGSAAATRRPQSLSGPPPLSHTGHSSLATTGISVSGQKLMGVADPDEATTPEHSTART
                     ATVADARGADSGNEDHQGAAFGGSDTCDLGSYAAQQRQNHALQHDHGIVSSSDQSLAA
                     HAKDQNTVDQFATTGVAAAAAEPSATVAPEALEGTQQRCSNGNSGSLSLLEQRGARGD
                     GNESTLLPQCGTHEQFMPLEAAANPISLHAYSAESVSSLPSGSAQITNSGDDGGGGRR
                     SDNAPGYWPGTFGNSQVSGSSAAEAPQERLQSGRELGSSAAKSLSASAWGGSGVVGWG
                     GMGSDSLSPPLHAQHLHSAGSELEFEDINLGATLRMAVALAAAAGTQSARTVYGSHRS
                     SKDSMNGPAIMSSIPSQSAGAAVVSGTNVVTAEPVASAGVNEELSSLATADEAHVNDL
                     FVTHSSQSPPTLQGNNHKTLLRMVDGSGAGEDCASLPSSQTVSLLNTCSGTVAEGGDV
                     SAATASILPSAIAPVADSADGAVLATPITAAMSPISIEPSTQSPPLSELPMVTSSVVV
                     AMNSFFSREDHVAPEELEVVREVVAHYDAFASLDETQLETLVRTMGRMELQRGATVVR
                     EGDSTLGQLLLIVSGKLTISRKGLVTRTLARGQFYGEMEMSYHVERSRVTLTAATPTV
                     VLYALKKVDYQKLVLHEKDARRYMFLQYVNECVLFKGLSPSIKMRLADSFRVCRLRKG
                     AKLTEQGASVEWMHLLMSGNVRMTYQAPPSSGGETSNWPFPRRCAAPEEEARHAITTS
                     HFFSHFAGLTTLSEAHMSSAASAAAASTVAGTSTTRHGAAPSAITGSLSSSLTPLAVA
                     SQMPSSTLLFSQAAMASLNTGAQQQNLLAERAASSAEACKGSPLISMVSPSPVANAAT
                     PRTPQLLHLPNAKAAHANNRGKTGDHLAEQGADDGSPRPNSSHPRSCRLQSQQDRSVS
                     GWQGLSQPNASTADSLDTDNTKPPSPLSTSASVRQSANTLLDTTLRSNAASTVTTSLT
                     STAAALAGAAGAPKTVVVVDRSKGQLVGETEFVFKCKGLFTAVATTPVQAARISRLHF
                     EAIMTRAVVEEMKRSMLLNPDYYFFEFTVPEALKEDMRRMLFRLNVGPAARRRTHHVQ
                     QQQQQQQQRFRHSVMGVEGMISGSRSRGGTTGGNRDSEAGRRHCRQSMVLSHRIQREH
                     NRASLMDNITGGPGGSSNGPNGTTGSSGSNSHSTSPPLVAVCVHDGSRESNDGNTSQP
                     GGKRHQAGNRRFRTAPLEISPTMARLSTERATADSVDAVGMESSTLHYLAAPTVCGGP
                     FASPAVASTAVISSGSAGEDSSSFTPAPAATMGNMGNVKGKGSSSDGDHNRYSRATAR
                     LTTAGRRTSFTKHSSTTTSLRRRVSTRGEIVFSGSRNLYRFTAEAMSMNESIVIAVVV
                     DGTIIRWNSVAQSVTGYAPFEAIGKSVFDFIGSEDGRQHMRDTLAVAARFAGRWEQYN
                     MRGLQEQRVFPFRQNTGLYQVGLALSVIPSNYAKTAEVLLLIGREGKYRAASTYAADV
                     AKWLEGSLKPQLRQFQRRMVQIESHGWQLTAEDALQVRGNLDACMSMVEQFTKFSLLN
                     MDVVSQSWRPVRVSALLRRFAVEAMAFARQQQHEYYCNIDLVEPKAEVFLDSPQVLAI
                     LRLLLGDALQCPNMGDNGNAIVVHAELRVTVVEPQDTNQVPLSIGSPVGRVSSGGSSA
                     GGFASLFAPPNMSSMAPPENHSSSSSSAAAAHKLRNVVASPSGSVKPSYPVIHIPVSA
                     VQSSSEVAPLIPSGVSLPHRPLPRGHSPPLHAQKSHQHHGSDMVLPSHSHDSPLVALV
                     GEKPPGSGGSAQGGADGSQNSAAVGPTPGSTASSGAGVRGLSSAPISNTLTATLRRIR
                     FELRDDGPTIPSLRGPEAVASERTRDHASPESASVDNSAALNSTSPKSTSCTSERVAG
                     EGAGAGGGPRAGLEASRSLTFAAVSARRGAELEQVEKILANLGGVVYGFTRPEVPGNV
                     VRVELPLLVVPGSTDDGRDEENGGGGGGGGTAAPPSSATRTFTVIVADSNRLHQQQLC
                     RVLWARQHAVVPVTSFRDLGRKLEMNTADILLIDPLHIDIASEDYESLLGDDPFDDIR
                     VLSARLALVVMASDFSDWRVQKLLNRHAVVELPKVGSGALVHIAMQEAEQLVTEMRDE
                     EERLDLIRRTFTNSSTERHKIGKRIGKGAFGDVFEVEDTLTGGKMAMKRMRLHDGLLA
                     DEVVQEILAMTTLTHENIIQYFYCEKESDTLLRLYMELAPGGTLRDKIRETPGVPLPF
                     EEIVHHLSCICHGLAYVHEKSYVHGDLKTANLLLGTRNRTKIGDFGTAKHLAPHQLLY
                     TMVGTPQYMAPEVLTADVEQRLGYDFKADIWSLGCIVLEMATGSPPFAHMECAQGMGI
                     IKYLTELTDTPDLSPLFSGNPLVYEFVKNCLDVDPQNRPTAQELLHFDILEGAVASQR
                     AERLVRRAEMLYKLNKYAAMRADGGGSRGGAARGRGHDGSEDSEEAEGDDGNHSSLYD
                     SGVLFSSNGSTAYEEEYDEEDDYDENDELSEHDSAEDVMEGDSALREQRDQQHSPPTS
                     SSPAFMPEGAK"
     gene            <314893..>316971
                     /locus_tag="LMJF_20_0780"
                     /db_xref="GeneID:5651354"
     mRNA            <314893..>316971
                     /locus_tag="LMJF_20_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682778.1"
                     /db_xref="GeneID:5651354"
     CDS             314893..316971
                     /locus_tag="LMJF_20_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682830.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651354"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW8"
                     /translation="MPVEREVITLAFGNYSSLVAAQWANGTSHYDAHHSTLYSECRSA
                     DVLGGGSSGNGRVRVPRLLLLDAPYASAFDDIDVWARKYKDDAKIGEEGDAAYNPSEA
                     SPSPVHRGDATEEKDHLFASVVKAVQRHVFEQHGLDDDDSHGGNDDAGGADDAQNDDG
                     EDADAHLLDEDEEDDVSKNAGRRGSATIPHSRAQRQARLKRKLFDEHNTTIPWWQYIT
                     TGLGPNSVTSVKPLQHVDAAGDLPALHSFGYGLAYLRDGGRSSEVVDLNDALRRNLEA
                     ADQLQGIQCFTDGDGLFGGAAANVLEQLWEDAGPKTPVVQACSFARLPALVADPAYRA
                     EVAFRERRMDEVALNQLLATLHLSRHTSAVYIPVPLSDWDVLFKGAATAASPTEAPPW
                     LQDERATAQLLAAVIDTALYGLRDGSRASGVSSQGPQWYMDEWCRVVRPAPSLRVAAA
                     MGALPQSVSASSELWEFLQANPLLPDAPQLDERMVRANDSAEDDASSGQARQQAKFFP
                     LTHTMSTYSTAHTAGQVLGHVASLRGAGCLPATVYPAREAMLRYALPLRTSTYLPLVT
                     EVSYPISDTFPTELLFADPAAMAKVPGGASGSGGSEGITSLRRVLQSVDVGAHVLSTY
                     ATAPMLHDISTKAQAALRNKMDRYCDAYVMEKDDWREALDEGLALFDDYNHAPLSDAQ
                     DGGGSDGDDY"
     gene            <317706..>319883
                     /locus_tag="LMJF_20_0790"
                     /db_xref="GeneID:5651355"
     mRNA            <317706..>319883
                     /locus_tag="LMJF_20_0790"
                     /product="putative tubulin-tyrosine ligase"
                     /transcript_id="XM_001682779.1"
                     /db_xref="GeneID:5651355"
     CDS             317706..319883
                     /locus_tag="LMJF_20_0790"
                     /EC_number="6.3.2.25"
                     /codon_start=1
                     /product="putative tubulin-tyrosine ligase"
                     /protein_id="XP_001682831.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651355"
                     /db_xref="GOA:Q4QCW7"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW7"
                     /translation="MPPSVVLDPSSTTTSADENAGLTSTDVYLVDSPYKRRRPTIAFV
                     PYDKPAAGDHRHHSGEETGGGTTVMHADVLVQPHRLPLGAADGVLGGSGGSDPAASLL
                     GDAQSQRRVVARASAGPYSRLSYIMDESCTPFTALLATLRAAGFTRVSGRAALLHKTH
                     SLLWVKHLLPSMVDQLQQPQSGAYQKVNHFPGTHALGRKDKLCMLLRRAGRRWQASGE
                     VSRALSGACTTNTAAARAAAWASLTPESWLLPQEAEACVRAIRQPCPSAAAAPLFIVK
                     PTNQAGGQGIFLICGGSEAGVASLKAAVGGLGGGHGSTSREEAITVSAAVLSKSSPGA
                     APCRKTLTESFCGGSAVRAAVIDTPAPETGRSQYIVQRYIANPFLLEGRKFDLRLYVV
                     ATSYDPVRLYLYREGLVRIASSPYTRTVETTSAAVTALADVSDLKAHLTNFTVNKGWL
                     PGPAAEGDAGAAASGAATSGQDTKWSLSSLEAYVASMGYDWSGTLQRIHELLRLVFLS
                     VTPEVRAALRASSVCRRNSADNNAARSLPSSPAVSSHPTVNGTSPFFEIFGVDVLLVN
                     DGSEDSSPHDSSAASASASTLRPVLLEVNIMPSLSTHYSLFDQRIKANFIADALTLVG
                     LMPPPSKVASSAAGVRETAGGKRSGYNDAFLDRLSDSEVVNVCLATEEERRRADNFTR
                     LLPTRDSASKYRALMEVSGGDGTSTPTPSRLDAVLSTWLASSS"
     gene            <320459..>321535
                     /locus_tag="LMJF_20_0800"
                     /db_xref="GeneID:5651356"
     mRNA            <320459..>321535
                     /locus_tag="LMJF_20_0800"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682780.1"
                     /db_xref="GeneID:5651356"
     CDS             320459..321535
                     /locus_tag="LMJF_20_0800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682832.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651356"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW6"
                     /translation="MGQSAPTLSPRTQRPARLTPQQRRQQLKQQEMRKSLQAVEQVRR
                     RQPTLKEQWQAQREANAAAREAKAMERKRKKEALHAALMAQQKQAEDEQENVDDVDDD
                     ADSAGGGSNGDDGCLQNAEEEAMLAQARINAQLAAFQTFMQSNPDLEEDLVSVDANRA
                     SMLDREATPAAALKIAQHGVCTGGSSGLGDRDDDEAIANVSVHSSDYADEELMQGLDD
                     LDEELEQEFLNRIDALQQQVAEHKQQSLAYLREHNDKAAALQELQKARQIEAHIKQLL
                     DEHATPLRVQIEEQQTKIVELENLVATRKQQSVATLRGGDKPTALTLLKEARGFESQL
                     EEANATLATLKKEKEKQLRSKGED"
     gene            322533..322610
                     /gene="LM20Cs1C4.1"
                     /locus_tag="LMJF_20_snoRNA0250"
                     /db_xref="GeneID:12982219"
     ncRNA           322533..322610
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.1"
                     /locus_tag="LMJF_20_snoRNA0250"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460387.1"
                     /db_xref="GeneID:12982219"
     gene            322712..322827
                     /gene="LM20Cs1C1.1"
                     /locus_tag="LMJF_20_snoRNA0003"
                     /old_locus_tag="LMJF_20_snoRNA0211"
                     /db_xref="GeneID:12980396"
     ncRNA           322712..322827
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.1"
                     /locus_tag="LMJF_20_snoRNA0003"
                     /old_locus_tag="LMJF_20_snoRNA0211"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460236.1"
                     /db_xref="GeneID:12980396"
     ncRNA           322714..322827
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.1"
                     /locus_tag="LMJF_20_snoRNA0003"
                     /old_locus_tag="LMJF_20_snoRNA0211"
                     /transcript_id="XR_002460237.1"
                     /db_xref="GeneID:12980396"
     gene            322897..323028
                     /gene="LM20Cs1C2.1"
                     /locus_tag="LMJF_20_snoRNA0004"
                     /old_locus_tag="LMJF_20_snoRNA0174"
                     /db_xref="GeneID:12982303"
     ncRNA           322897..323028
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.1"
                     /locus_tag="LMJF_20_snoRNA0004"
                     /old_locus_tag="LMJF_20_snoRNA0174"
                     /transcript_id="XR_002460238.1"
                     /db_xref="GeneID:12982303"
     ncRNA           322898..323028
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.1"
                     /locus_tag="LMJF_20_snoRNA0004"
                     /old_locus_tag="LMJF_20_snoRNA0174"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460239.1"
                     /db_xref="GeneID:12982303"
     gene            323047..323135
                     /gene="LM20Cs1C3.1"
                     /locus_tag="LMJF_20_snoRNA0005"
                     /old_locus_tag="LMJF_20_snoRNA0231"
                     /db_xref="GeneID:12982476"
     ncRNA           323047..323135
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.1"
                     /locus_tag="LMJF_20_snoRNA0005"
                     /old_locus_tag="LMJF_20_snoRNA0231"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460240.1"
                     /db_xref="GeneID:12982476"
     ncRNA           323049..323135
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.1"
                     /locus_tag="LMJF_20_snoRNA0005"
                     /old_locus_tag="LMJF_20_snoRNA0231"
                     /transcript_id="XR_002460241.1"
                     /db_xref="GeneID:12982476"
     gene            323396..323486
                     /gene="LM20Cs1C5.1"
                     /locus_tag="LMJF_20_snoRNA0006"
                     /old_locus_tag="LMJF_20_snoRNA0193"
                     /db_xref="GeneID:12982305"
     ncRNA           323396..323485
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.1"
                     /locus_tag="LMJF_20_snoRNA0006"
                     /old_locus_tag="LMJF_20_snoRNA0193"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460242.1"
                     /db_xref="GeneID:12982305"
     ncRNA           323398..323486
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.1"
                     /locus_tag="LMJF_20_snoRNA0006"
                     /old_locus_tag="LMJF_20_snoRNA0193"
                     /transcript_id="XR_002460243.1"
                     /db_xref="GeneID:12982305"
     gene            323592..323669
                     /gene="LM20Cs1C4.2"
                     /locus_tag="LMJF_20_snoRNA0251"
                     /db_xref="GeneID:12982306"
     ncRNA           323592..323669
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.2"
                     /locus_tag="LMJF_20_snoRNA0251"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460388.1"
                     /db_xref="GeneID:12982306"
     gene            323771..323886
                     /gene="LM20Cs1C1.2"
                     /locus_tag="LMJF_20_snoRNA0007"
                     /old_locus_tag="LMJF_20_snoRNA0212"
                     /db_xref="GeneID:12980407"
     ncRNA           323771..323886
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.2"
                     /locus_tag="LMJF_20_snoRNA0007"
                     /old_locus_tag="LMJF_20_snoRNA0212"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460244.1"
                     /db_xref="GeneID:12980407"
     ncRNA           323773..323886
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.2"
                     /locus_tag="LMJF_20_snoRNA0007"
                     /old_locus_tag="LMJF_20_snoRNA0212"
                     /transcript_id="XR_002460245.1"
                     /db_xref="GeneID:12980407"
     gene            323948..324079
                     /gene="LM20Cs1C2.2"
                     /locus_tag="LMJF_20_snoRNA0008"
                     /old_locus_tag="LMJF_20_snoRNA0175"
                     /db_xref="GeneID:12982307"
     ncRNA           323948..324079
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.2"
                     /locus_tag="LMJF_20_snoRNA0008"
                     /old_locus_tag="LMJF_20_snoRNA0175"
                     /transcript_id="XR_002460246.1"
                     /db_xref="GeneID:12982307"
     ncRNA           323949..324079
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.2"
                     /locus_tag="LMJF_20_snoRNA0008"
                     /old_locus_tag="LMJF_20_snoRNA0175"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460247.1"
                     /db_xref="GeneID:12982307"
     gene            324098..324186
                     /gene="LM20Cs1C3.2"
                     /locus_tag="LMJF_20_snoRNA0009"
                     /old_locus_tag="LMJF_20_snoRNA0232"
                     /db_xref="GeneID:12982487"
     ncRNA           324098..324186
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.2"
                     /locus_tag="LMJF_20_snoRNA0009"
                     /old_locus_tag="LMJF_20_snoRNA0232"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460248.1"
                     /db_xref="GeneID:12982487"
     ncRNA           324100..324186
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.2"
                     /locus_tag="LMJF_20_snoRNA0009"
                     /old_locus_tag="LMJF_20_snoRNA0232"
                     /transcript_id="XR_002460249.1"
                     /db_xref="GeneID:12982487"
     gene            324445..324535
                     /gene="LM20Cs1C5.2"
                     /locus_tag="LMJF_20_snoRNA0010"
                     /old_locus_tag="LMJF_20_snoRNA0194"
                     /db_xref="GeneID:12982309"
     ncRNA           324445..324534
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.2"
                     /locus_tag="LMJF_20_snoRNA0010"
                     /old_locus_tag="LMJF_20_snoRNA0194"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460250.1"
                     /db_xref="GeneID:12982309"
     ncRNA           324447..324535
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.2"
                     /locus_tag="LMJF_20_snoRNA0010"
                     /old_locus_tag="LMJF_20_snoRNA0194"
                     /transcript_id="XR_002460251.1"
                     /db_xref="GeneID:12982309"
     gene            324641..324718
                     /gene="LM20Cs1C4.3"
                     /locus_tag="LMJF_20_snoRNA0252"
                     /db_xref="GeneID:12982310"
     ncRNA           324641..324718
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.3"
                     /locus_tag="LMJF_20_snoRNA0252"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460389.1"
                     /db_xref="GeneID:12982310"
     gene            324820..324935
                     /gene="LM20Cs1C1.3"
                     /locus_tag="LMJF_20_snoRNA0011"
                     /old_locus_tag="LMJF_20_snoRNA0213"
                     /db_xref="GeneID:12980408"
     ncRNA           324820..324935
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.3"
                     /locus_tag="LMJF_20_snoRNA0011"
                     /old_locus_tag="LMJF_20_snoRNA0213"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460252.1"
                     /db_xref="GeneID:12980408"
     ncRNA           324822..324935
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.3"
                     /locus_tag="LMJF_20_snoRNA0011"
                     /old_locus_tag="LMJF_20_snoRNA0213"
                     /transcript_id="XR_002460253.1"
                     /db_xref="GeneID:12980408"
     gene            324997..325128
                     /gene="LM20Cs1C2.3"
                     /locus_tag="LMJF_20_snoRNA0012"
                     /old_locus_tag="LMJF_20_snoRNA0176"
                     /db_xref="GeneID:12982311"
     ncRNA           324997..325128
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.3"
                     /locus_tag="LMJF_20_snoRNA0012"
                     /old_locus_tag="LMJF_20_snoRNA0176"
                     /transcript_id="XR_002460254.1"
                     /db_xref="GeneID:12982311"
     ncRNA           324998..325128
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.3"
                     /locus_tag="LMJF_20_snoRNA0012"
                     /old_locus_tag="LMJF_20_snoRNA0176"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460255.1"
                     /db_xref="GeneID:12982311"
     gene            325147..325235
                     /gene="LM20Cs1C3.3"
                     /locus_tag="LMJF_20_snoRNA0013"
                     /old_locus_tag="LMJF_20_snoRNA0233"
                     /db_xref="GeneID:12982488"
     ncRNA           325147..325235
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.3"
                     /locus_tag="LMJF_20_snoRNA0013"
                     /old_locus_tag="LMJF_20_snoRNA0233"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460256.1"
                     /db_xref="GeneID:12982488"
     ncRNA           325149..325235
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.3"
                     /locus_tag="LMJF_20_snoRNA0013"
                     /old_locus_tag="LMJF_20_snoRNA0233"
                     /transcript_id="XR_002460257.1"
                     /db_xref="GeneID:12982488"
     gene            325496..325586
                     /gene="LM20Cs1C5.3"
                     /locus_tag="LMJF_20_snoRNA0014"
                     /old_locus_tag="LMJF_20_snoRNA0195"
                     /db_xref="GeneID:12982313"
     ncRNA           325496..325585
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.3"
                     /locus_tag="LMJF_20_snoRNA0014"
                     /old_locus_tag="LMJF_20_snoRNA0195"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460258.1"
                     /db_xref="GeneID:12982313"
     ncRNA           325498..325586
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.3"
                     /locus_tag="LMJF_20_snoRNA0014"
                     /old_locus_tag="LMJF_20_snoRNA0195"
                     /transcript_id="XR_002460259.1"
                     /db_xref="GeneID:12982313"
     gene            325692..325769
                     /gene="LM20Cs1C4.4"
                     /locus_tag="LMJF_20_snoRNA0253"
                     /db_xref="GeneID:12982314"
     ncRNA           325692..325769
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.4"
                     /locus_tag="LMJF_20_snoRNA0253"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460390.1"
                     /db_xref="GeneID:12982314"
     gene            325871..325986
                     /gene="LM20Cs1C1.4"
                     /locus_tag="LMJF_20_snoRNA0015"
                     /old_locus_tag="LMJF_20_snoRNA0214"
                     /db_xref="GeneID:12980409"
     ncRNA           325871..325986
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.4"
                     /locus_tag="LMJF_20_snoRNA0015"
                     /old_locus_tag="LMJF_20_snoRNA0214"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460260.1"
                     /db_xref="GeneID:12980409"
     ncRNA           325873..325986
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.4"
                     /locus_tag="LMJF_20_snoRNA0015"
                     /old_locus_tag="LMJF_20_snoRNA0214"
                     /transcript_id="XR_002460261.1"
                     /db_xref="GeneID:12980409"
     gene            326056..326187
                     /gene="LM20Cs1C2.4"
                     /locus_tag="LMJF_20_snoRNA0016"
                     /old_locus_tag="LMJF_20_snoRNA0177"
                     /db_xref="GeneID:12982315"
     ncRNA           326056..326187
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.4"
                     /locus_tag="LMJF_20_snoRNA0016"
                     /old_locus_tag="LMJF_20_snoRNA0177"
                     /transcript_id="XR_002460262.1"
                     /db_xref="GeneID:12982315"
     ncRNA           326057..326187
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.4"
                     /locus_tag="LMJF_20_snoRNA0016"
                     /old_locus_tag="LMJF_20_snoRNA0177"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460263.1"
                     /db_xref="GeneID:12982315"
     gene            326206..326294
                     /gene="LM20Cs1C3.4"
                     /locus_tag="LMJF_20_snoRNA0017"
                     /old_locus_tag="LMJF_20_snoRNA0234"
                     /db_xref="GeneID:12982489"
     ncRNA           326206..326294
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.4"
                     /locus_tag="LMJF_20_snoRNA0017"
                     /old_locus_tag="LMJF_20_snoRNA0234"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460264.1"
                     /db_xref="GeneID:12982489"
     ncRNA           326208..326294
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.4"
                     /locus_tag="LMJF_20_snoRNA0017"
                     /old_locus_tag="LMJF_20_snoRNA0234"
                     /transcript_id="XR_002460265.1"
                     /db_xref="GeneID:12982489"
     gene            326539..326629
                     /gene="LM20Cs1C5.4"
                     /locus_tag="LMJF_20_snoRNA0018"
                     /old_locus_tag="LMJF_20_snoRNA0196"
                     /db_xref="GeneID:12982317"
     ncRNA           326539..326628
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.4"
                     /locus_tag="LMJF_20_snoRNA0018"
                     /old_locus_tag="LMJF_20_snoRNA0196"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460266.1"
                     /db_xref="GeneID:12982317"
     ncRNA           326541..326629
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.4"
                     /locus_tag="LMJF_20_snoRNA0018"
                     /old_locus_tag="LMJF_20_snoRNA0196"
                     /transcript_id="XR_002460267.1"
                     /db_xref="GeneID:12982317"
     gene            326735..326812
                     /gene="LM20Cs1C4.5"
                     /locus_tag="LMJF_20_snoRNA0254"
                     /db_xref="GeneID:12982318"
     ncRNA           326735..326812
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.5"
                     /locus_tag="LMJF_20_snoRNA0254"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460391.1"
                     /db_xref="GeneID:12982318"
     gene            326914..327029
                     /gene="LM20Cs1C1.5"
                     /locus_tag="LMJF_20_snoRNA0019"
                     /old_locus_tag="LMJF_20_snoRNA0215"
                     /db_xref="GeneID:12980410"
     ncRNA           326914..327029
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.5"
                     /locus_tag="LMJF_20_snoRNA0019"
                     /old_locus_tag="LMJF_20_snoRNA0215"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460268.1"
                     /db_xref="GeneID:12980410"
     ncRNA           326916..327029
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.5"
                     /locus_tag="LMJF_20_snoRNA0019"
                     /old_locus_tag="LMJF_20_snoRNA0215"
                     /transcript_id="XR_002460269.1"
                     /db_xref="GeneID:12980410"
     gene            327091..327222
                     /gene="LM20Cs1C2.5"
                     /locus_tag="LMJF_20_snoRNA0020"
                     /old_locus_tag="LMJF_20_snoRNA0178"
                     /db_xref="GeneID:12982319"
     ncRNA           327091..327222
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.5"
                     /locus_tag="LMJF_20_snoRNA0020"
                     /old_locus_tag="LMJF_20_snoRNA0178"
                     /transcript_id="XR_002460270.1"
                     /db_xref="GeneID:12982319"
     ncRNA           327092..327222
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.5"
                     /locus_tag="LMJF_20_snoRNA0020"
                     /old_locus_tag="LMJF_20_snoRNA0178"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460271.1"
                     /db_xref="GeneID:12982319"
     gene            327241..327329
                     /gene="LM20Cs1C3.5"
                     /locus_tag="LMJF_20_snoRNA0021"
                     /old_locus_tag="LMJF_20_snoRNA0235"
                     /db_xref="GeneID:12982490"
     ncRNA           327241..327329
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.5"
                     /locus_tag="LMJF_20_snoRNA0021"
                     /old_locus_tag="LMJF_20_snoRNA0235"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460272.1"
                     /db_xref="GeneID:12982490"
     ncRNA           327243..327329
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.5"
                     /locus_tag="LMJF_20_snoRNA0021"
                     /old_locus_tag="LMJF_20_snoRNA0235"
                     /transcript_id="XR_002460273.1"
                     /db_xref="GeneID:12982490"
     gene            327573..327663
                     /gene="LM20Cs1C5.5"
                     /locus_tag="LMJF_20_snoRNA0022"
                     /old_locus_tag="LMJF_20_snoRNA0197"
                     /db_xref="GeneID:12982321"
     ncRNA           327573..327662
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.5"
                     /locus_tag="LMJF_20_snoRNA0022"
                     /old_locus_tag="LMJF_20_snoRNA0197"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460274.1"
                     /db_xref="GeneID:12982321"
     ncRNA           327575..327663
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.5"
                     /locus_tag="LMJF_20_snoRNA0022"
                     /old_locus_tag="LMJF_20_snoRNA0197"
                     /transcript_id="XR_002460275.1"
                     /db_xref="GeneID:12982321"
     gene            327769..327846
                     /gene="LM20Cs1C4.6"
                     /locus_tag="LMJF_20_snoRNA0255"
                     /db_xref="GeneID:12982322"
     ncRNA           327769..327846
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.6"
                     /locus_tag="LMJF_20_snoRNA0255"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460392.1"
                     /db_xref="GeneID:12982322"
     gene            327948..328063
                     /gene="LM20Cs1C1.6"
                     /locus_tag="LMJF_20_snoRNA0023"
                     /old_locus_tag="LMJF_20_snoRNA0216"
                     /db_xref="GeneID:12980411"
     ncRNA           327948..328063
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.6"
                     /locus_tag="LMJF_20_snoRNA0023"
                     /old_locus_tag="LMJF_20_snoRNA0216"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460276.1"
                     /db_xref="GeneID:12980411"
     ncRNA           327950..328063
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.6"
                     /locus_tag="LMJF_20_snoRNA0023"
                     /old_locus_tag="LMJF_20_snoRNA0216"
                     /product="LM20C1C1"
                     /transcript_id="XR_002460277.1"
                     /db_xref="GeneID:12980411"
     gene            328133..328264
                     /gene="LM20Cs1C2.6"
                     /locus_tag="LMJF_20_snoRNA0024"
                     /old_locus_tag="LMJF_20_snoRNA0179"
                     /db_xref="GeneID:12982323"
     ncRNA           328133..328264
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.6"
                     /locus_tag="LMJF_20_snoRNA0024"
                     /old_locus_tag="LMJF_20_snoRNA0179"
                     /transcript_id="XR_002460278.1"
                     /db_xref="GeneID:12982323"
     ncRNA           328134..328264
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.6"
                     /locus_tag="LMJF_20_snoRNA0024"
                     /old_locus_tag="LMJF_20_snoRNA0179"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460279.1"
                     /db_xref="GeneID:12982323"
     gene            328283..328371
                     /gene="LM20Cs1C3.6"
                     /locus_tag="LMJF_20_snoRNA0025"
                     /old_locus_tag="LMJF_20_snoRNA0236"
                     /db_xref="GeneID:12982491"
     ncRNA           328283..328371
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.6"
                     /locus_tag="LMJF_20_snoRNA0025"
                     /old_locus_tag="LMJF_20_snoRNA0236"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460280.1"
                     /db_xref="GeneID:12982491"
     ncRNA           328285..328371
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.6"
                     /locus_tag="LMJF_20_snoRNA0025"
                     /old_locus_tag="LMJF_20_snoRNA0236"
                     /transcript_id="XR_002460281.1"
                     /db_xref="GeneID:12982491"
     gene            328616..328706
                     /gene="LM20Cs1C5.6"
                     /locus_tag="LMJF_20_snoRNA0026"
                     /old_locus_tag="LMJF_20_snoRNA0198"
                     /db_xref="GeneID:12982325"
     ncRNA           328616..328705
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.6"
                     /locus_tag="LMJF_20_snoRNA0026"
                     /old_locus_tag="LMJF_20_snoRNA0198"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460282.1"
                     /db_xref="GeneID:12982325"
     ncRNA           328618..328706
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.6"
                     /locus_tag="LMJF_20_snoRNA0026"
                     /old_locus_tag="LMJF_20_snoRNA0198"
                     /transcript_id="XR_002460283.1"
                     /db_xref="GeneID:12982325"
     gene            328812..328889
                     /gene="LM20Cs1C4.7"
                     /locus_tag="LMJF_20_snoRNA0256"
                     /db_xref="GeneID:12982326"
     ncRNA           328812..328889
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.7"
                     /locus_tag="LMJF_20_snoRNA0256"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460393.1"
                     /db_xref="GeneID:12982326"
     gene            328991..329106
                     /gene="LM20Cs1C1.7"
                     /locus_tag="LMJF_20_snoRNA0027"
                     /old_locus_tag="LMJF_20_snoRNA0217"
                     /db_xref="GeneID:12980412"
     ncRNA           328991..329106
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.7"
                     /locus_tag="LMJF_20_snoRNA0027"
                     /old_locus_tag="LMJF_20_snoRNA0217"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460284.1"
                     /db_xref="GeneID:12980412"
     ncRNA           328993..329106
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.7"
                     /locus_tag="LMJF_20_snoRNA0027"
                     /old_locus_tag="LMJF_20_snoRNA0217"
                     /transcript_id="XR_002460285.1"
                     /db_xref="GeneID:12980412"
     gene            329160..329291
                     /gene="LM20Cs1C2.7"
                     /locus_tag="LMJF_20_snoRNA0028"
                     /old_locus_tag="LMJF_20_snoRNA0180"
                     /db_xref="GeneID:12982327"
     ncRNA           329160..329291
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.7"
                     /locus_tag="LMJF_20_snoRNA0028"
                     /old_locus_tag="LMJF_20_snoRNA0180"
                     /transcript_id="XR_002460286.1"
                     /db_xref="GeneID:12982327"
     ncRNA           329161..329291
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.7"
                     /locus_tag="LMJF_20_snoRNA0028"
                     /old_locus_tag="LMJF_20_snoRNA0180"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460287.1"
                     /db_xref="GeneID:12982327"
     gene            329310..329398
                     /gene="LM20Cs1C3.7"
                     /locus_tag="LMJF_20_snoRNA0029"
                     /old_locus_tag="LMJF_20_snoRNA0237"
                     /db_xref="GeneID:12982492"
     ncRNA           329310..329398
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.7"
                     /locus_tag="LMJF_20_snoRNA0029"
                     /old_locus_tag="LMJF_20_snoRNA0237"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460288.1"
                     /db_xref="GeneID:12982492"
     ncRNA           329312..329398
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.7"
                     /locus_tag="LMJF_20_snoRNA0029"
                     /old_locus_tag="LMJF_20_snoRNA0237"
                     /transcript_id="XR_002460289.1"
                     /db_xref="GeneID:12982492"
     gene            329643..329733
                     /gene="LM20Cs1C5.7"
                     /locus_tag="LMJF_20_snoRNA0030"
                     /old_locus_tag="LMJF_20_snoRNA0199"
                     /db_xref="GeneID:12982329"
     ncRNA           329643..329732
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.7"
                     /locus_tag="LMJF_20_snoRNA0030"
                     /old_locus_tag="LMJF_20_snoRNA0199"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460290.1"
                     /db_xref="GeneID:12982329"
     ncRNA           329645..329733
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.7"
                     /locus_tag="LMJF_20_snoRNA0030"
                     /old_locus_tag="LMJF_20_snoRNA0199"
                     /transcript_id="XR_002460291.1"
                     /db_xref="GeneID:12982329"
     gene            329839..329916
                     /gene="LM20Cs1C4.8"
                     /locus_tag="LMJF_20_snoRNA0257"
                     /db_xref="GeneID:12982330"
     ncRNA           329839..329916
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.8"
                     /locus_tag="LMJF_20_snoRNA0257"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460394.1"
                     /db_xref="GeneID:12982330"
     gene            330018..330133
                     /gene="LM20Cs1C1.8"
                     /locus_tag="LMJF_20_snoRNA0031"
                     /old_locus_tag="LMJF_20_snoRNA0218"
                     /db_xref="GeneID:12980413"
     ncRNA           330018..330133
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.8"
                     /locus_tag="LMJF_20_snoRNA0031"
                     /old_locus_tag="LMJF_20_snoRNA0218"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460292.1"
                     /db_xref="GeneID:12980413"
     ncRNA           330020..330133
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.8"
                     /locus_tag="LMJF_20_snoRNA0031"
                     /old_locus_tag="LMJF_20_snoRNA0218"
                     /transcript_id="XR_002460293.1"
                     /db_xref="GeneID:12980413"
     gene            330195..330326
                     /gene="LM20Cs1C2.8"
                     /locus_tag="LMJF_20_snoRNA0032"
                     /old_locus_tag="LMJF_20_snoRNA0181"
                     /db_xref="GeneID:12982331"
     ncRNA           330195..330326
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.8"
                     /locus_tag="LMJF_20_snoRNA0032"
                     /old_locus_tag="LMJF_20_snoRNA0181"
                     /transcript_id="XR_002460294.1"
                     /db_xref="GeneID:12982331"
     ncRNA           330196..330326
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.8"
                     /locus_tag="LMJF_20_snoRNA0032"
                     /old_locus_tag="LMJF_20_snoRNA0181"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460295.1"
                     /db_xref="GeneID:12982331"
     gene            330345..330433
                     /gene="LM20Cs1C3.8"
                     /locus_tag="LMJF_20_snoRNA0033"
                     /old_locus_tag="LMJF_20_snoRNA0238"
                     /db_xref="GeneID:12982493"
     ncRNA           330345..330433
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.8"
                     /locus_tag="LMJF_20_snoRNA0033"
                     /old_locus_tag="LMJF_20_snoRNA0238"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460296.1"
                     /db_xref="GeneID:12982493"
     ncRNA           330347..330433
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.8"
                     /locus_tag="LMJF_20_snoRNA0033"
                     /old_locus_tag="LMJF_20_snoRNA0238"
                     /transcript_id="XR_002460297.1"
                     /db_xref="GeneID:12982493"
     gene            330692..330782
                     /gene="LM20Cs1C5.8"
                     /locus_tag="LMJF_20_snoRNA0034"
                     /old_locus_tag="LMJF_20_snoRNA0200"
                     /db_xref="GeneID:12982333"
     ncRNA           330692..330781
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.8"
                     /locus_tag="LMJF_20_snoRNA0034"
                     /old_locus_tag="LMJF_20_snoRNA0200"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460298.1"
                     /db_xref="GeneID:12982333"
     ncRNA           330694..330782
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.8"
                     /locus_tag="LMJF_20_snoRNA0034"
                     /old_locus_tag="LMJF_20_snoRNA0200"
                     /transcript_id="XR_002460299.1"
                     /db_xref="GeneID:12982333"
     gene            330888..330965
                     /gene="LM20Cs1C4.9"
                     /locus_tag="LMJF_20_snoRNA0258"
                     /db_xref="GeneID:12982334"
     ncRNA           330888..330965
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.9"
                     /locus_tag="LMJF_20_snoRNA0258"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460395.1"
                     /db_xref="GeneID:12982334"
     gene            331067..331182
                     /gene="LM20Cs1C1.9"
                     /locus_tag="LMJF_20_snoRNA0035"
                     /old_locus_tag="LMJF_20_snoRNA0219"
                     /db_xref="GeneID:12980414"
     ncRNA           331067..331182
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.9"
                     /locus_tag="LMJF_20_snoRNA0035"
                     /old_locus_tag="LMJF_20_snoRNA0219"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460300.1"
                     /db_xref="GeneID:12980414"
     ncRNA           331069..331182
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.9"
                     /locus_tag="LMJF_20_snoRNA0035"
                     /old_locus_tag="LMJF_20_snoRNA0219"
                     /transcript_id="XR_002460301.1"
                     /db_xref="GeneID:12980414"
     gene            331244..331375
                     /gene="LM20Cs1C2.9"
                     /locus_tag="LMJF_20_snoRNA0036"
                     /old_locus_tag="LMJF_20_snoRNA0182"
                     /db_xref="GeneID:12982335"
     ncRNA           331244..331375
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.9"
                     /locus_tag="LMJF_20_snoRNA0036"
                     /old_locus_tag="LMJF_20_snoRNA0182"
                     /transcript_id="XR_002460302.1"
                     /db_xref="GeneID:12982335"
     ncRNA           331245..331375
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.9"
                     /locus_tag="LMJF_20_snoRNA0036"
                     /old_locus_tag="LMJF_20_snoRNA0182"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460303.1"
                     /db_xref="GeneID:12982335"
     gene            331394..331482
                     /gene="LM20Cs1C3.9"
                     /locus_tag="LMJF_20_snoRNA0037"
                     /old_locus_tag="LMJF_20_snoRNA0239"
                     /db_xref="GeneID:12982494"
     ncRNA           331394..331482
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.9"
                     /locus_tag="LMJF_20_snoRNA0037"
                     /old_locus_tag="LMJF_20_snoRNA0239"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460304.1"
                     /db_xref="GeneID:12982494"
     ncRNA           331396..331482
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.9"
                     /locus_tag="LMJF_20_snoRNA0037"
                     /old_locus_tag="LMJF_20_snoRNA0239"
                     /transcript_id="XR_002460305.1"
                     /db_xref="GeneID:12982494"
     gene            331743..331833
                     /gene="LM20Cs1C5.9"
                     /locus_tag="LMJF_20_snoRNA0038"
                     /old_locus_tag="LMJF_20_snoRNA0201"
                     /db_xref="GeneID:12982337"
     ncRNA           331743..331832
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.9"
                     /locus_tag="LMJF_20_snoRNA0038"
                     /old_locus_tag="LMJF_20_snoRNA0201"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460306.1"
                     /db_xref="GeneID:12982337"
     ncRNA           331745..331833
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.9"
                     /locus_tag="LMJF_20_snoRNA0038"
                     /old_locus_tag="LMJF_20_snoRNA0201"
                     /transcript_id="XR_002460307.1"
                     /db_xref="GeneID:12982337"
     gene            331939..332016
                     /gene="LM20Cs1C4.10"
                     /locus_tag="LMJF_20_snoRNA0259"
                     /db_xref="GeneID:12982338"
     ncRNA           331939..332016
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.10"
                     /locus_tag="LMJF_20_snoRNA0259"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460396.1"
                     /db_xref="GeneID:12982338"
     gene            332118..332233
                     /gene="LM20Cs1C1.10"
                     /locus_tag="LMJF_20_snoRNA0039"
                     /old_locus_tag="LMJF_20_snoRNA0220"
                     /db_xref="GeneID:12980397"
     ncRNA           332118..332233
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.10"
                     /locus_tag="LMJF_20_snoRNA0039"
                     /old_locus_tag="LMJF_20_snoRNA0220"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460308.1"
                     /db_xref="GeneID:12980397"
     ncRNA           332120..332233
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.10"
                     /locus_tag="LMJF_20_snoRNA0039"
                     /old_locus_tag="LMJF_20_snoRNA0220"
                     /transcript_id="XR_002460309.1"
                     /db_xref="GeneID:12980397"
     gene            332303..332434
                     /gene="LM20Cs1C2.10"
                     /locus_tag="LMJF_20_snoRNA0040"
                     /old_locus_tag="LMJF_20_snoRNA0183"
                     /db_xref="GeneID:12982339"
     ncRNA           332303..332434
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.10"
                     /locus_tag="LMJF_20_snoRNA0040"
                     /old_locus_tag="LMJF_20_snoRNA0183"
                     /transcript_id="XR_002460310.1"
                     /db_xref="GeneID:12982339"
     ncRNA           332304..332434
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.10"
                     /locus_tag="LMJF_20_snoRNA0040"
                     /old_locus_tag="LMJF_20_snoRNA0183"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460311.1"
                     /db_xref="GeneID:12982339"
     gene            332453..332541
                     /gene="LM20Cs1C3.10"
                     /locus_tag="LMJF_20_snoRNA0041"
                     /old_locus_tag="LMJF_20_snoRNA0240"
                     /db_xref="GeneID:12982477"
     ncRNA           332453..332541
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.10"
                     /locus_tag="LMJF_20_snoRNA0041"
                     /old_locus_tag="LMJF_20_snoRNA0240"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460312.1"
                     /db_xref="GeneID:12982477"
     ncRNA           332455..332541
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.10"
                     /locus_tag="LMJF_20_snoRNA0041"
                     /old_locus_tag="LMJF_20_snoRNA0240"
                     /transcript_id="XR_002460313.1"
                     /db_xref="GeneID:12982477"
     gene            332786..332876
                     /gene="LM20Cs1C5.10"
                     /locus_tag="LMJF_20_snoRNA0042"
                     /old_locus_tag="LMJF_20_snoRNA0202"
                     /db_xref="GeneID:12982341"
     ncRNA           332786..332875
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.10"
                     /locus_tag="LMJF_20_snoRNA0042"
                     /old_locus_tag="LMJF_20_snoRNA0202"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460314.1"
                     /db_xref="GeneID:12982341"
     ncRNA           332788..332876
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.10"
                     /locus_tag="LMJF_20_snoRNA0042"
                     /old_locus_tag="LMJF_20_snoRNA0202"
                     /transcript_id="XR_002460315.1"
                     /db_xref="GeneID:12982341"
     gene            332982..333059
                     /gene="LM20Cs1C4.11"
                     /locus_tag="LMJF_20_snoRNA0260"
                     /db_xref="GeneID:12982342"
     ncRNA           332982..333059
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.11"
                     /locus_tag="LMJF_20_snoRNA0260"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460397.1"
                     /db_xref="GeneID:12982342"
     gene            333161..333276
                     /gene="LM20Cs1C1.11"
                     /locus_tag="LMJF_20_snoRNA0043"
                     /old_locus_tag="LMJF_20_snoRNA0221"
                     /db_xref="GeneID:12980398"
     ncRNA           333161..333276
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.11"
                     /locus_tag="LMJF_20_snoRNA0043"
                     /old_locus_tag="LMJF_20_snoRNA0221"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460316.1"
                     /db_xref="GeneID:12980398"
     ncRNA           333163..333276
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.11"
                     /locus_tag="LMJF_20_snoRNA0043"
                     /old_locus_tag="LMJF_20_snoRNA0221"
                     /transcript_id="XR_002460317.1"
                     /db_xref="GeneID:12980398"
     gene            333338..333469
                     /gene="LM20Cs1C2.11"
                     /locus_tag="LMJF_20_snoRNA0044"
                     /old_locus_tag="LMJF_20_snoRNA0184"
                     /db_xref="GeneID:12982343"
     ncRNA           333338..333469
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.11"
                     /locus_tag="LMJF_20_snoRNA0044"
                     /old_locus_tag="LMJF_20_snoRNA0184"
                     /transcript_id="XR_002460318.1"
                     /db_xref="GeneID:12982343"
     ncRNA           333339..333469
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.11"
                     /locus_tag="LMJF_20_snoRNA0044"
                     /old_locus_tag="LMJF_20_snoRNA0184"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460319.1"
                     /db_xref="GeneID:12982343"
     gene            333488..333576
                     /gene="LM20Cs1C3.11"
                     /locus_tag="LMJF_20_snoRNA0045"
                     /old_locus_tag="LMJF_20_snoRNA0241"
                     /db_xref="GeneID:12982478"
     ncRNA           333488..333576
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.11"
                     /locus_tag="LMJF_20_snoRNA0045"
                     /old_locus_tag="LMJF_20_snoRNA0241"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460320.1"
                     /db_xref="GeneID:12982478"
     ncRNA           333490..333576
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.11"
                     /locus_tag="LMJF_20_snoRNA0045"
                     /old_locus_tag="LMJF_20_snoRNA0241"
                     /transcript_id="XR_002460321.1"
                     /db_xref="GeneID:12982478"
     gene            333820..333910
                     /gene="LM20Cs1C5.11"
                     /locus_tag="LMJF_20_snoRNA0046"
                     /old_locus_tag="LMJF_20_snoRNA0203"
                     /db_xref="GeneID:12982423"
     ncRNA           333820..333909
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.11"
                     /locus_tag="LMJF_20_snoRNA0046"
                     /old_locus_tag="LMJF_20_snoRNA0203"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460322.1"
                     /db_xref="GeneID:12982423"
     ncRNA           333822..333910
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.11"
                     /locus_tag="LMJF_20_snoRNA0046"
                     /old_locus_tag="LMJF_20_snoRNA0203"
                     /transcript_id="XR_002460323.1"
                     /db_xref="GeneID:12982423"
     gene            334016..334093
                     /gene="LM20Cs1C4.12"
                     /locus_tag="LMJF_20_snoRNA0261"
                     /db_xref="GeneID:12982424"
     ncRNA           334016..334093
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.12"
                     /locus_tag="LMJF_20_snoRNA0261"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460398.1"
                     /db_xref="GeneID:12982424"
     gene            334195..334310
                     /gene="LM20Cs1C1.12"
                     /locus_tag="LMJF_20_snoRNA0047"
                     /old_locus_tag="LMJF_20_snoRNA0222"
                     /db_xref="GeneID:12980399"
     ncRNA           334195..334310
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.12"
                     /locus_tag="LMJF_20_snoRNA0047"
                     /old_locus_tag="LMJF_20_snoRNA0222"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460324.1"
                     /db_xref="GeneID:12980399"
     ncRNA           334197..334310
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.12"
                     /locus_tag="LMJF_20_snoRNA0047"
                     /old_locus_tag="LMJF_20_snoRNA0222"
                     /transcript_id="XR_002460325.1"
                     /db_xref="GeneID:12980399"
     gene            334380..334511
                     /gene="LM20Cs1C2.12"
                     /locus_tag="LMJF_20_snoRNA0048"
                     /old_locus_tag="LMJF_20_snoRNA0185"
                     /db_xref="GeneID:12982425"
     ncRNA           334380..334511
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.12"
                     /locus_tag="LMJF_20_snoRNA0048"
                     /old_locus_tag="LMJF_20_snoRNA0185"
                     /transcript_id="XR_002460326.1"
                     /db_xref="GeneID:12982425"
     ncRNA           334381..334511
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.12"
                     /locus_tag="LMJF_20_snoRNA0048"
                     /old_locus_tag="LMJF_20_snoRNA0185"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460327.1"
                     /db_xref="GeneID:12982425"
     gene            334530..334618
                     /gene="LM20Cs1C3.12"
                     /locus_tag="LMJF_20_snoRNA0049"
                     /old_locus_tag="LMJF_20_snoRNA0242"
                     /db_xref="GeneID:12982479"
     ncRNA           334530..334618
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.12"
                     /locus_tag="LMJF_20_snoRNA0049"
                     /old_locus_tag="LMJF_20_snoRNA0242"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460328.1"
                     /db_xref="GeneID:12982479"
     ncRNA           334532..334618
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.12"
                     /locus_tag="LMJF_20_snoRNA0049"
                     /old_locus_tag="LMJF_20_snoRNA0242"
                     /transcript_id="XR_002460329.1"
                     /db_xref="GeneID:12982479"
     gene            334863..334953
                     /gene="LM20Cs1C5.12"
                     /locus_tag="LMJF_20_snoRNA0050"
                     /old_locus_tag="LMJF_20_snoRNA0204"
                     /db_xref="GeneID:12982427"
     ncRNA           334863..334952
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.12"
                     /locus_tag="LMJF_20_snoRNA0050"
                     /old_locus_tag="LMJF_20_snoRNA0204"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460330.1"
                     /db_xref="GeneID:12982427"
     ncRNA           334865..334953
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.12"
                     /locus_tag="LMJF_20_snoRNA0050"
                     /old_locus_tag="LMJF_20_snoRNA0204"
                     /transcript_id="XR_002460331.1"
                     /db_xref="GeneID:12982427"
     gene            335059..335136
                     /gene="LM20Cs1C4.13"
                     /locus_tag="LMJF_20_snoRNA0262"
                     /db_xref="GeneID:12982428"
     ncRNA           335059..335136
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.13"
                     /locus_tag="LMJF_20_snoRNA0262"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460399.1"
                     /db_xref="GeneID:12982428"
     gene            335238..335353
                     /gene="LM20Cs1C1.13"
                     /locus_tag="LMJF_20_snoRNA0051"
                     /old_locus_tag="LMJF_20_snoRNA0223"
                     /db_xref="GeneID:12980400"
     ncRNA           335238..335353
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.13"
                     /locus_tag="LMJF_20_snoRNA0051"
                     /old_locus_tag="LMJF_20_snoRNA0223"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460332.1"
                     /db_xref="GeneID:12980400"
     ncRNA           335240..335353
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.13"
                     /locus_tag="LMJF_20_snoRNA0051"
                     /old_locus_tag="LMJF_20_snoRNA0223"
                     /transcript_id="XR_002460333.1"
                     /db_xref="GeneID:12980400"
     gene            335407..335538
                     /gene="LM20Cs1C2.13"
                     /locus_tag="LMJF_20_snoRNA0052"
                     /old_locus_tag="LMJF_20_snoRNA0186"
                     /db_xref="GeneID:12982429"
     ncRNA           335407..335538
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.13"
                     /locus_tag="LMJF_20_snoRNA0052"
                     /old_locus_tag="LMJF_20_snoRNA0186"
                     /transcript_id="XR_002460334.1"
                     /db_xref="GeneID:12982429"
     ncRNA           335408..335538
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.13"
                     /locus_tag="LMJF_20_snoRNA0052"
                     /old_locus_tag="LMJF_20_snoRNA0186"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460335.1"
                     /db_xref="GeneID:12982429"
     gene            335557..335645
                     /gene="LM20Cs1C3.13"
                     /locus_tag="LMJF_20_snoRNA0053"
                     /old_locus_tag="LMJF_20_snoRNA0243"
                     /db_xref="GeneID:12982480"
     ncRNA           335557..335645
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.13"
                     /locus_tag="LMJF_20_snoRNA0053"
                     /old_locus_tag="LMJF_20_snoRNA0243"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460336.1"
                     /db_xref="GeneID:12982480"
     ncRNA           335559..335645
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.13"
                     /locus_tag="LMJF_20_snoRNA0053"
                     /old_locus_tag="LMJF_20_snoRNA0243"
                     /transcript_id="XR_002460337.1"
                     /db_xref="GeneID:12982480"
     gene            335890..335980
                     /gene="LM20Cs1C5.13"
                     /locus_tag="LMJF_20_snoRNA0055"
                     /old_locus_tag="LMJF_20_snoRNA0205"
                     /db_xref="GeneID:12982431"
     ncRNA           335890..335979
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.13"
                     /locus_tag="LMJF_20_snoRNA0055"
                     /old_locus_tag="LMJF_20_snoRNA0205"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460340.1"
                     /db_xref="GeneID:12982431"
     ncRNA           335892..335980
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.13"
                     /locus_tag="LMJF_20_snoRNA0055"
                     /old_locus_tag="LMJF_20_snoRNA0205"
                     /transcript_id="XR_002460341.1"
                     /db_xref="GeneID:12982431"
     gene            336086..336163
                     /gene="LM20Cs1C4.14"
                     /locus_tag="LMJF_20_snoRNA0263"
                     /db_xref="GeneID:12982433"
     ncRNA           336086..336163
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.14"
                     /locus_tag="LMJF_20_snoRNA0263"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460400.1"
                     /db_xref="GeneID:12982433"
     gene            336265..336380
                     /gene="LM20Cs1C1.14"
                     /locus_tag="LMJF_20_snoRNA0054"
                     /old_locus_tag="LMJF_20_snoRNA0224"
                     /db_xref="GeneID:12980401"
     ncRNA           336265..336380
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.14"
                     /locus_tag="LMJF_20_snoRNA0054"
                     /old_locus_tag="LMJF_20_snoRNA0224"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460338.1"
                     /db_xref="GeneID:12980401"
     ncRNA           336267..336380
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.14"
                     /locus_tag="LMJF_20_snoRNA0054"
                     /old_locus_tag="LMJF_20_snoRNA0224"
                     /transcript_id="XR_002460339.1"
                     /db_xref="GeneID:12980401"
     gene            336442..336573
                     /gene="LM20Cs1C2.14"
                     /locus_tag="LMJF_20_snoRNA0056"
                     /old_locus_tag="LMJF_20_snoRNA0187"
                     /db_xref="GeneID:12982432"
     ncRNA           336442..336573
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.14"
                     /locus_tag="LMJF_20_snoRNA0056"
                     /old_locus_tag="LMJF_20_snoRNA0187"
                     /transcript_id="XR_002460342.1"
                     /db_xref="GeneID:12982432"
     ncRNA           336443..336573
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.14"
                     /locus_tag="LMJF_20_snoRNA0056"
                     /old_locus_tag="LMJF_20_snoRNA0187"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460343.1"
                     /db_xref="GeneID:12982432"
     gene            336592..336680
                     /gene="LM20Cs1C3.14"
                     /locus_tag="LMJF_20_snoRNA0057"
                     /old_locus_tag="LMJF_20_snoRNA0244"
                     /db_xref="GeneID:12982481"
     ncRNA           336592..336680
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.14"
                     /locus_tag="LMJF_20_snoRNA0057"
                     /old_locus_tag="LMJF_20_snoRNA0244"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460344.1"
                     /db_xref="GeneID:12982481"
     ncRNA           336594..336680
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.14"
                     /locus_tag="LMJF_20_snoRNA0057"
                     /old_locus_tag="LMJF_20_snoRNA0244"
                     /transcript_id="XR_002460345.1"
                     /db_xref="GeneID:12982481"
     gene            336939..337029
                     /gene="LM20Cs1C5.14"
                     /locus_tag="LMJF_20_snoRNA0058"
                     /old_locus_tag="LMJF_20_snoRNA0206"
                     /db_xref="GeneID:12982435"
     ncRNA           336939..337028
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.14"
                     /locus_tag="LMJF_20_snoRNA0058"
                     /old_locus_tag="LMJF_20_snoRNA0206"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460346.1"
                     /db_xref="GeneID:12982435"
     ncRNA           336941..337029
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.14"
                     /locus_tag="LMJF_20_snoRNA0058"
                     /old_locus_tag="LMJF_20_snoRNA0206"
                     /transcript_id="XR_002460347.1"
                     /db_xref="GeneID:12982435"
     gene            337135..337212
                     /gene="LM20Cs1C4.15"
                     /locus_tag="LMJF_20_snoRNA0264"
                     /db_xref="GeneID:12982436"
     ncRNA           337135..337212
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.15"
                     /locus_tag="LMJF_20_snoRNA0264"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460401.1"
                     /db_xref="GeneID:12982436"
     gene            337314..337429
                     /gene="LM20Cs1C1.15"
                     /locus_tag="LMJF_20_snoRNA0059"
                     /old_locus_tag="LMJF_20_snoRNA0225"
                     /db_xref="GeneID:12980402"
     ncRNA           337314..337429
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.15"
                     /locus_tag="LMJF_20_snoRNA0059"
                     /old_locus_tag="LMJF_20_snoRNA0225"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460348.1"
                     /db_xref="GeneID:12980402"
     ncRNA           337316..337429
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.15"
                     /locus_tag="LMJF_20_snoRNA0059"
                     /old_locus_tag="LMJF_20_snoRNA0225"
                     /transcript_id="XR_002460349.1"
                     /db_xref="GeneID:12980402"
     gene            337491..337622
                     /gene="LM20Cs1C2.15"
                     /locus_tag="LMJF_20_snoRNA0060"
                     /old_locus_tag="LMJF_20_snoRNA0188"
                     /db_xref="GeneID:12982437"
     ncRNA           337491..337622
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.15"
                     /locus_tag="LMJF_20_snoRNA0060"
                     /old_locus_tag="LMJF_20_snoRNA0188"
                     /transcript_id="XR_002460350.1"
                     /db_xref="GeneID:12982437"
     ncRNA           337492..337622
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.15"
                     /locus_tag="LMJF_20_snoRNA0060"
                     /old_locus_tag="LMJF_20_snoRNA0188"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460351.1"
                     /db_xref="GeneID:12982437"
     gene            337641..337729
                     /gene="LM20Cs1C3.15"
                     /locus_tag="LMJF_20_snoRNA0061"
                     /old_locus_tag="LMJF_20_snoRNA0245"
                     /db_xref="GeneID:12982482"
     ncRNA           337641..337729
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.15"
                     /locus_tag="LMJF_20_snoRNA0061"
                     /old_locus_tag="LMJF_20_snoRNA0245"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460352.1"
                     /db_xref="GeneID:12982482"
     ncRNA           337643..337729
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.15"
                     /locus_tag="LMJF_20_snoRNA0061"
                     /old_locus_tag="LMJF_20_snoRNA0245"
                     /transcript_id="XR_002460353.1"
                     /db_xref="GeneID:12982482"
     gene            337990..338080
                     /gene="LM20Cs1C5.15"
                     /locus_tag="LMJF_20_snoRNA0062"
                     /old_locus_tag="LMJF_20_snoRNA0207"
                     /db_xref="GeneID:12982439"
     ncRNA           337990..338079
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.15"
                     /locus_tag="LMJF_20_snoRNA0062"
                     /old_locus_tag="LMJF_20_snoRNA0207"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460354.1"
                     /db_xref="GeneID:12982439"
     ncRNA           337992..338080
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.15"
                     /locus_tag="LMJF_20_snoRNA0062"
                     /old_locus_tag="LMJF_20_snoRNA0207"
                     /transcript_id="XR_002460355.1"
                     /db_xref="GeneID:12982439"
     gene            338186..338263
                     /gene="LM20Cs1C4.16"
                     /locus_tag="LMJF_20_snoRNA0265"
                     /db_xref="GeneID:12982440"
     ncRNA           338186..338263
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.16"
                     /locus_tag="LMJF_20_snoRNA0265"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460402.1"
                     /db_xref="GeneID:12982440"
     gene            338365..338480
                     /gene="LM20Cs1C1.16"
                     /locus_tag="LMJF_20_snoRNA0063"
                     /old_locus_tag="LMJF_20_snoRNA0226"
                     /db_xref="GeneID:12980403"
     ncRNA           338365..338480
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.16"
                     /locus_tag="LMJF_20_snoRNA0063"
                     /old_locus_tag="LMJF_20_snoRNA0226"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460356.1"
                     /db_xref="GeneID:12980403"
     ncRNA           338367..338480
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.16"
                     /locus_tag="LMJF_20_snoRNA0063"
                     /old_locus_tag="LMJF_20_snoRNA0226"
                     /transcript_id="XR_002460357.1"
                     /db_xref="GeneID:12980403"
     gene            338550..338681
                     /gene="LM20Cs1C2.16"
                     /locus_tag="LMJF_20_snoRNA0064"
                     /old_locus_tag="LMJF_20_snoRNA0189"
                     /db_xref="GeneID:12982441"
     ncRNA           338550..338681
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.16"
                     /locus_tag="LMJF_20_snoRNA0064"
                     /old_locus_tag="LMJF_20_snoRNA0189"
                     /transcript_id="XR_002460358.1"
                     /db_xref="GeneID:12982441"
     ncRNA           338551..338681
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.16"
                     /locus_tag="LMJF_20_snoRNA0064"
                     /old_locus_tag="LMJF_20_snoRNA0189"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460359.1"
                     /db_xref="GeneID:12982441"
     gene            338700..338788
                     /gene="LM20Cs1C3.16"
                     /locus_tag="LMJF_20_snoRNA0065"
                     /old_locus_tag="LMJF_20_snoRNA0246"
                     /db_xref="GeneID:12982483"
     ncRNA           338700..338788
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.16"
                     /locus_tag="LMJF_20_snoRNA0065"
                     /old_locus_tag="LMJF_20_snoRNA0246"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460360.1"
                     /db_xref="GeneID:12982483"
     ncRNA           338702..338788
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.16"
                     /locus_tag="LMJF_20_snoRNA0065"
                     /old_locus_tag="LMJF_20_snoRNA0246"
                     /transcript_id="XR_002460361.1"
                     /db_xref="GeneID:12982483"
     gene            339033..339123
                     /gene="LM20Cs1C5.16"
                     /locus_tag="LMJF_20_snoRNA0066"
                     /old_locus_tag="LMJF_20_snoRNA0208"
                     /db_xref="GeneID:12982443"
     ncRNA           339033..339122
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.16"
                     /locus_tag="LMJF_20_snoRNA0066"
                     /old_locus_tag="LMJF_20_snoRNA0208"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460362.1"
                     /db_xref="GeneID:12982443"
     ncRNA           339035..339123
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.16"
                     /locus_tag="LMJF_20_snoRNA0066"
                     /old_locus_tag="LMJF_20_snoRNA0208"
                     /transcript_id="XR_002460363.1"
                     /db_xref="GeneID:12982443"
     gene            339229..339306
                     /gene="LM20Cs1C4.17"
                     /locus_tag="LMJF_20_snoRNA0266"
                     /db_xref="GeneID:12982444"
     ncRNA           339229..339306
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.17"
                     /locus_tag="LMJF_20_snoRNA0266"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460403.1"
                     /db_xref="GeneID:12982444"
     gene            339408..339523
                     /gene="LM20Cs1C1.17"
                     /locus_tag="LMJF_20_snoRNA0067"
                     /old_locus_tag="LMJF_20_snoRNA0227"
                     /db_xref="GeneID:12980404"
     ncRNA           339408..339523
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.17"
                     /locus_tag="LMJF_20_snoRNA0067"
                     /old_locus_tag="LMJF_20_snoRNA0227"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460364.1"
                     /db_xref="GeneID:12980404"
     ncRNA           339410..339523
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.17"
                     /locus_tag="LMJF_20_snoRNA0067"
                     /old_locus_tag="LMJF_20_snoRNA0227"
                     /transcript_id="XR_002460365.1"
                     /db_xref="GeneID:12980404"
     gene            339585..339716
                     /gene="LM20Cs1C2.17"
                     /locus_tag="LMJF_20_snoRNA0068"
                     /old_locus_tag="LMJF_20_snoRNA0190"
                     /db_xref="GeneID:12982445"
     ncRNA           339585..339716
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.17"
                     /locus_tag="LMJF_20_snoRNA0068"
                     /old_locus_tag="LMJF_20_snoRNA0190"
                     /transcript_id="XR_002460366.1"
                     /db_xref="GeneID:12982445"
     ncRNA           339586..339716
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.17"
                     /locus_tag="LMJF_20_snoRNA0068"
                     /old_locus_tag="LMJF_20_snoRNA0190"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460367.1"
                     /db_xref="GeneID:12982445"
     gene            339735..339823
                     /gene="LM20Cs1C3.17"
                     /locus_tag="LMJF_20_snoRNA0069"
                     /old_locus_tag="LMJF_20_snoRNA0247"
                     /db_xref="GeneID:12982484"
     ncRNA           339735..339823
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.17"
                     /locus_tag="LMJF_20_snoRNA0069"
                     /old_locus_tag="LMJF_20_snoRNA0247"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460368.1"
                     /db_xref="GeneID:12982484"
     ncRNA           339737..339823
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.17"
                     /locus_tag="LMJF_20_snoRNA0069"
                     /old_locus_tag="LMJF_20_snoRNA0247"
                     /transcript_id="XR_002460369.1"
                     /db_xref="GeneID:12982484"
     gene            340068..340158
                     /gene="LM20Cs1C5.17"
                     /locus_tag="LMJF_20_snoRNA0070"
                     /old_locus_tag="LMJF_20_snoRNA0209"
                     /db_xref="GeneID:12982447"
     ncRNA           340068..340157
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.17"
                     /locus_tag="LMJF_20_snoRNA0070"
                     /old_locus_tag="LMJF_20_snoRNA0209"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460370.1"
                     /db_xref="GeneID:12982447"
     ncRNA           340070..340158
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.17"
                     /locus_tag="LMJF_20_snoRNA0070"
                     /old_locus_tag="LMJF_20_snoRNA0209"
                     /transcript_id="XR_002460371.1"
                     /db_xref="GeneID:12982447"
     gene            340264..340341
                     /gene="LM20Cs1C4.18"
                     /locus_tag="LMJF_20_snoRNA0267"
                     /db_xref="GeneID:12982448"
     ncRNA           340264..340341
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.18"
                     /locus_tag="LMJF_20_snoRNA0267"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460404.1"
                     /db_xref="GeneID:12982448"
     gene            340443..340558
                     /gene="LM20Cs1C1.18"
                     /locus_tag="LMJF_20_snoRNA0071"
                     /old_locus_tag="LMJF_20_snoRNA0228"
                     /db_xref="GeneID:12980405"
     ncRNA           340443..340558
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.18"
                     /locus_tag="LMJF_20_snoRNA0071"
                     /old_locus_tag="LMJF_20_snoRNA0228"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460372.1"
                     /db_xref="GeneID:12980405"
     ncRNA           340445..340558
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.18"
                     /locus_tag="LMJF_20_snoRNA0071"
                     /old_locus_tag="LMJF_20_snoRNA0228"
                     /transcript_id="XR_002460373.1"
                     /db_xref="GeneID:12980405"
     gene            340628..340759
                     /gene="LM20Cs1C2.18"
                     /locus_tag="LMJF_20_snoRNA0072"
                     /old_locus_tag="LMJF_20_snoRNA0191"
                     /db_xref="GeneID:12982449"
     ncRNA           340628..340759
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.18"
                     /locus_tag="LMJF_20_snoRNA0072"
                     /old_locus_tag="LMJF_20_snoRNA0191"
                     /transcript_id="XR_002460374.1"
                     /db_xref="GeneID:12982449"
     ncRNA           340629..340759
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.18"
                     /locus_tag="LMJF_20_snoRNA0072"
                     /old_locus_tag="LMJF_20_snoRNA0191"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460375.1"
                     /db_xref="GeneID:12982449"
     gene            340778..340866
                     /gene="LM20Cs1C3.18"
                     /locus_tag="LMJF_20_snoRNA0073"
                     /old_locus_tag="LMJF_20_snoRNA0248"
                     /db_xref="GeneID:12982485"
     ncRNA           340778..340866
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.18"
                     /locus_tag="LMJF_20_snoRNA0073"
                     /old_locus_tag="LMJF_20_snoRNA0248"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460376.1"
                     /db_xref="GeneID:12982485"
     ncRNA           340780..340866
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.18"
                     /locus_tag="LMJF_20_snoRNA0073"
                     /old_locus_tag="LMJF_20_snoRNA0248"
                     /transcript_id="XR_002460377.1"
                     /db_xref="GeneID:12982485"
     gene            341111..341201
                     /gene="LM20Cs1C5.18"
                     /locus_tag="LMJF_20_snoRNA0074"
                     /old_locus_tag="LMJF_20_snoRNA0210"
                     /db_xref="GeneID:12982451"
     ncRNA           341111..341200
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.18"
                     /locus_tag="LMJF_20_snoRNA0074"
                     /old_locus_tag="LMJF_20_snoRNA0210"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460378.1"
                     /db_xref="GeneID:12982451"
     ncRNA           341113..341201
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C5.18"
                     /locus_tag="LMJF_20_snoRNA0074"
                     /old_locus_tag="LMJF_20_snoRNA0210"
                     /transcript_id="XR_002460379.1"
                     /db_xref="GeneID:12982451"
     gene            341307..341384
                     /gene="LM20Cs1C4.19"
                     /locus_tag="LMJF_20_snoRNA0268"
                     /db_xref="GeneID:12982452"
     ncRNA           341307..341384
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C4.19"
                     /locus_tag="LMJF_20_snoRNA0268"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460405.1"
                     /db_xref="GeneID:12982452"
     gene            341486..341601
                     /gene="LM20Cs1C1.19"
                     /locus_tag="LMJF_20_snoRNA0075"
                     /old_locus_tag="LMJF_20_snoRNA0229"
                     /db_xref="GeneID:12980406"
     ncRNA           341486..341601
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.19"
                     /locus_tag="LMJF_20_snoRNA0075"
                     /old_locus_tag="LMJF_20_snoRNA0229"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460380.1"
                     /db_xref="GeneID:12980406"
     ncRNA           341488..341601
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C1.19"
                     /locus_tag="LMJF_20_snoRNA0075"
                     /old_locus_tag="LMJF_20_snoRNA0229"
                     /transcript_id="XR_002460381.1"
                     /db_xref="GeneID:12980406"
     gene            341655..341786
                     /gene="LM20Cs1C2.19"
                     /locus_tag="LMJF_20_snoRNA0076"
                     /old_locus_tag="LMJF_20_snoRNA0192"
                     /db_xref="GeneID:12982453"
     ncRNA           341655..341786
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.19"
                     /locus_tag="LMJF_20_snoRNA0076"
                     /old_locus_tag="LMJF_20_snoRNA0192"
                     /transcript_id="XR_002460382.1"
                     /db_xref="GeneID:12982453"
     ncRNA           341656..341786
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C2.19"
                     /locus_tag="LMJF_20_snoRNA0076"
                     /old_locus_tag="LMJF_20_snoRNA0192"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460383.1"
                     /db_xref="GeneID:12982453"
     gene            341805..341893
                     /gene="LM20Cs1C3.19"
                     /locus_tag="LMJF_20_snoRNA0077"
                     /old_locus_tag="LMJF_20_snoRNA0249"
                     /db_xref="GeneID:12982486"
     ncRNA           341805..341893
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.19"
                     /locus_tag="LMJF_20_snoRNA0077"
                     /old_locus_tag="LMJF_20_snoRNA0249"
                     /product="C/D snoRNA"
                     /transcript_id="XR_002460384.1"
                     /db_xref="GeneID:12982486"
     ncRNA           341807..341893
                     /ncRNA_class="snoRNA"
                     /gene="LM20Cs1C3.19"
                     /locus_tag="LMJF_20_snoRNA0077"
                     /old_locus_tag="LMJF_20_snoRNA0249"
                     /transcript_id="XR_002460385.1"
                     /db_xref="GeneID:12982486"
     gene            342140..342196
                     /locus_tag="LMJF_20_snoRNA0078"
                     /db_xref="GeneID:12982455"
     ncRNA           342140..342196
                     /ncRNA_class="snoRNA"
                     /locus_tag="LMJF_20_snoRNA0078"
                     /transcript_id="XR_002460386.1"
                     /db_xref="GeneID:12982455"
     gene            <343647..>345863
                     /locus_tag="LMJF_20_0810"
                     /db_xref="GeneID:5651433"
     mRNA            <343647..>345863
                     /locus_tag="LMJF_20_0810"
                     /product="putative N-ethylmaleimide-sensitive factor"
                     /transcript_id="XM_001682781.1"
                     /db_xref="GeneID:5651433"
     CDS             343647..345863
                     /locus_tag="LMJF_20_0810"
                     /EC_number="3.6.4.6"
                     /codon_start=1
                     /product="putative N-ethylmaleimide-sensitive factor"
                     /protein_id="XP_001682833.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651433"
                     /db_xref="GOA:Q4QCW5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW5"
                     /translation="MSRYYSVCSVPTDNDTKTNCIFLSTVDFAEVAGPQAAATGDSFV
                     VLVQGFPFTVCRSDVVERGAVAMNSIQRRLLGLSTGARSTVVLEPFLSRVPNMRTLQI
                     QVEPISTRQAIMLDCQACIAYMEKMYSGQYFRVTQQLAVVMDTGERMRATVMTTELVE
                     SKEVSAASLDIGRFSRGVTQVIITASEASGITLMNVSEAQMDAQQPQLVRNFNLENLG
                     IGGLRAEFGQVFRRAFASRMLKPSFIKKLALKHVKGVLLYGPPGTGKTLIARKIGEIL
                     NCHEPKIVNGPEVFNKFVGGTEENIRKLFADAEKEQAEKGDQSRLHLIIFDEFDAICK
                     QRGAVRDSTGVNDNVVNQLLSKIDGVNSLNNVLLVGMTNRRDLIDEAILRPGRFEVHV
                     EIGLPDEPGRVEIFRIHTRGMLENNIMSSDVSLEELGKMTKNYSGAEIEGVVRDATSN
                     AFNRHIDLDHPDRMVDDANVHVTREDFMKAVEEVTPAFGQAKEECANLRRGGIIDYGD
                     SWEVVKSRCRRYTDQLNAAGKRIDSLAVLIDGAPGSGKSAVSAYLAEIADFPYVKVVS
                     AEDMVGYGEMQRVNILRKAFEDAYKSPASCIILDDLERLIDFSQLGGRYSNTLLQALL
                     VLIKRPPPEGKKLLVVGTTAQYDIMDSLELGACFSVKLHLPSVPVSAIPKVCEGLGLA
                     FASQQDMDSCLSLMSHDIPMKQLMLLLEMASEQKGSGRPLITYQSMSRAKESVGGY"
     gene            <347040..>348047
                     /locus_tag="LMJF_20_0820"
                     /db_xref="GeneID:5651434"
     mRNA            <347040..>348047
                     /locus_tag="LMJF_20_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682782.1"
                     /db_xref="GeneID:5651434"
     CDS             347040..348047
                     /locus_tag="LMJF_20_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682834.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651434"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW4"
                     /translation="MPLFSSGNTPVVPPTPTSLAAAKDAPQGPRDFSRAAALTYRTAP
                     HPSDSTDGVFEALLMLAADRLDPNGEAMKENSSSGASRSKKGSWLGRAWRHIMDYATN
                     NLLKMRQADFLNAFSRQLEVNSAEESSTVMVSCQCFIVSGGKLHFGSLFATNCGLYFC
                     SCAPEAAPAAAAAAESDAGATSSADHRGADDEVEYIKERILFTDVASLLPSIFLEQDG
                     TATPFIQGIPNGVVAPTALQVFTVQLSTVLQFLNLHNVAVKRPKRSAAEAEKNGAGAV
                     QEAPCIDVVQKHEFNLVCELPPSLDTLKFCALLWRLWAQRLHDLGRPLEHPAVHYAEP
                     H"
     gene            <348840..>349661
                     /locus_tag="LMJF_20_0830"
                     /db_xref="GeneID:5651435"
     mRNA            <348840..>349661
                     /locus_tag="LMJF_20_0830"
                     /product="phosphopantetheinyl transferase-like protein"
                     /transcript_id="XM_001682783.1"
                     /db_xref="GeneID:5651435"
     CDS             348840..349661
                     /locus_tag="LMJF_20_0830"
                     /EC_number="2.7.8.-"
                     /codon_start=1
                     /product="phosphopantetheinyl transferase-like protein"
                     /protein_id="XP_001682835.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651435"
                     /db_xref="GOA:Q4QCW3"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW3"
                     /translation="MTKLLVANASAWQPSPEQFNSAAEQLHREDSVRRAIESARVSAT
                     RQGSTHPNPENKARLLARHLLLCELTDCGNAQAKRRFCKRDVRLLTSAYGKPLTAPYR
                     DGNYSVTHVAEWVCCAHSMAAPLGVDVAAVHPQGSPPFSLCLSKQELAQVELVPHKQL
                     PSLFALFWTLKEAVLKALGLGLSTRLQMCDICLDSVKLENLSVLSNVEPASIYTAPKH
                     RLMVSLQGNTKQPWACSCFMLPGDPPHILSAALREEVTEGAIEIMFVSPQTALRN"
     gene            <350228..>350923
                     /locus_tag="LMJF_20_0840"
                     /db_xref="GeneID:5651436"
     mRNA            <350228..>350923
                     /locus_tag="LMJF_20_0840"
                     /product="cytochrome c oxidase assembly factor-like
                     protein"
                     /transcript_id="XM_001682784.1"
                     /db_xref="GeneID:5651436"
     CDS             350228..350923
                     /locus_tag="LMJF_20_0840"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor-like
                     protein"
                     /protein_id="XP_001682836.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651436"
                     /db_xref="GOA:Q4QCW2"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW2"
                     /translation="MNWYENRKLEKPELAPDFQSMQSVSLKPKTQLGGPFRLRESRTG
                     KYITNDELFQNKWTLLYFGFSKCSEICPSTLRFISEVMKACDAEYGSDSNLAAEEKNL
                     QAVFLSIDFIRDKPDVVEQFVRKYDPRVRGLCGTREEVEAAARAWRVYYSSVDETDEE
                     RDAREAAGVAAPQIDDTYQFDHSSAIYLVGPDGKMKDFFFKEMGLNDTVSRIGIHYSD
                     VYGFSDTRTAARP"
     gene            <351638..>356365
                     /locus_tag="LMJF_20_0850"
                     /db_xref="GeneID:5651437"
     mRNA            <351638..>356365
                     /locus_tag="LMJF_20_0850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682785.1"
                     /db_xref="GeneID:5651437"
     CDS             351638..356365
                     /locus_tag="LMJF_20_0850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682837.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651437"
                     /db_xref="GOA:Q4QCW1"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW1"
                     /translation="MNRSKWTLRRLILGLSVEDAQSKFDTPESRSILRVAHERYNQGI
                     YHELHIAQRQRNGLAPERKCHISRFTKPSVPGFQAYLKGSPDDYVIREVWDDDDNVGL
                     EEGSAVRAKDEVALSHSSAISSAQAVSPKIVQEQDAFRTTKALILRTLASALQLIMES
                     VLSELKGRRQSGALLSKEHQGSVVNRLMSEVAESSARSYKSLSSSSHLLEPVEMAVTL
                     FGRRDTAEVQAFNSGTFTVPAAEGDISYSLWVAGGIIASEELMADFPFHLAKFVTPSQ
                     ASSPSHRLPHVEVEIYFSPELFQLEKTIGPNGVRMLRSFIGKAMMKQHEPTPTSTTLL
                     LAASGEKERDLYNIYDAARDHGEVRIPWIRKVVTKVSTVTGVVFSAEDSDENPSVDRM
                     RASVSSVWRAWGHLVKDLHVHGNLDYLYVSISRQQEWESNEAYISELKKLEAARDAEE
                     SAGPLVETANVSRTLSLGNAATFAAADVARKARKVHLPISADFVVVECTLERKGLPHN
                     MVVEDIVSTLTEMRQEQMEMQRLCVLDAIAIQVEESETKPSSSSCAVQTRDKIVPVLY
                     EPKIVVSHAGTLENGTHSFQRVRIRGSCLAHVEALAAALQDESGSYLTDRSLPCSTAS
                     ATLAATSSSGDQNNQVGGTSLPKNLSFRAVRAPSSQQRLTGHSAPCASAVGDKFGDPT
                     SRSRHSRSQTLTLAADSFTLVTDDERQFWKENYYRLSEMKVIYHDRVDAADALGQSWQ
                     SLPPRVHAHLALLNRRLAPGASAANEGHAEEGGTTAPGKRKRKKGGRKTKRTTAEKKE
                     AAATTALGLAPEKLFEYLCTDMEAESARHDLRAGDCMGYDYLLNLRRIPDKHLPLVAP
                     AVASVVSKGFINYYGPQRFATYTRMNMHPGLHLLKGEYKAAAHILVQQFYLDAAMEAE
                     RQHTGQAFPRMQALHGYGGFRLPDFLRSGTRRSVAENGTPMQRVLYNALQASALLGGD
                     EGLDGDDGLCGQGLGSSNPGWGALATASGQRRGQGQPRASGRATRLNRDATAGAARAG
                     GDDDPCAEAFLRVVGPRACAMLIQEFLSFVWNDIVNQRFQRYGTFTLLPGDLVRAGGV
                     TAAALHDSSGGDAAMTSPLVHASRGEIERGAFSVWDLVLPLPGADIHLPQNHTEDLYV
                     VALQRYGLPFDPESRQWRCFKPSPLARHGEEPVRARLAAEGGPLSGAPLSPYYNLTST
                     FALMEEELGSRTLSTDALPLYGEGQGDRFGAGDAILQADVGLDAVNLRPDLRAGGGNP
                     LGLTISASYRHVLVRPTTDTMQWRLLKGVVGDPYQRWGMTTQAQVRALDAVQLASTSF
                     AADAEPAWMFPSPSGALTSVNGPGVPQLLNVESGVSSEKEEVEDGSHGDAATQTNVPQ
                     AVPAGMEASQRGSRIRDTGPLITAAARTAAGYRHQRRWTGTSQLLRAPSSAGNSLASR
                     SETKQQLALRRRAPPVPSWLPRHHGSVLQLHLRLPCGVYPGMLVRELLKMDVNTPDVV
                     DLDRAASSSSRTDRRAQSWQDLTADQRATYQKWIAKRRQQRRFLHQPRAISLALLHQQ
                     IFRSSGIRQSLLPTLRSYDSVSK"
     gene            <357659..>358699
                     /locus_tag="LMJF_20_0860"
                     /db_xref="GeneID:5651438"
     mRNA            <357659..>358699
                     /locus_tag="LMJF_20_0860"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682786.1"
                     /db_xref="GeneID:5651438"
     CDS             357659..358699
                     /locus_tag="LMJF_20_0860"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682838.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651438"
                     /db_xref="UniProtKB/TrEMBL:Q4QCW0"
                     /translation="MQRDSYASIVRYPNRRKFPVRVLQVNGAVFHENLIEDFFIGYRN
                     RRLALMTHTPGQDPRLPRLPKDIIVPNYKTFLQIHQPHFMYRLLPLLSSDVEAFAAMQ
                     AICASPGSPFTIEDRLESQTLNYRLSKLCAGRDKICAFFKDYTPREELRMPSATRALP
                     IQGIFFQGLMLRDGCVATTPQTGALTLAATAEAAAASSSTSTGESGRKPSAAAGPIDG
                     GAVVVGSTNGGLDTGMQTSYKKRVKASIAALLTTHDVLSEAVITQRALMAKFFESDLY
                     NQFGTASAIAAKVRSVDERMHFMAVKRLCAGRTNTAENVRNRAHLLELARTQNLHVYE
                     KVSEGEYAYAAT"
     gene            <359612..>361918
                     /locus_tag="LMJF_20_0870"
                     /db_xref="GeneID:5651439"
     mRNA            <359612..>361918
                     /locus_tag="LMJF_20_0870"
                     /product="putative ATP-dependent RNA helicase"
                     /transcript_id="XM_001682787.1"
                     /db_xref="GeneID:5651439"
     CDS             359612..361918
                     /locus_tag="LMJF_20_0870"
                     /codon_start=1
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="XP_001682839.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651439"
                     /db_xref="GOA:Q4QCV9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV9"
                     /translation="MASLATWDDCIGPAKWLSEPLQRVLSYPKPLPVQQAVIPTIMRA
                     LMSGVPNDVSLTAPTGSGKTLCYLIPLVRLLTESKKGVDDNALRCLILVPTQALGQQV
                     HRELQRLTRPSSIKAACICAEVVDAARGTSTDVEAAEARELVRRVVLPRFGSSEQHSA
                     DGCDSAGESEEDPDMVDGDEANDGDDGRCFATRQQHRTRNTTVRYFSNVDVIVSTPQR
                     LLHHLDHTRGLRLASLRLLVIDEADQVLAGNFASQVQKVNARYEFEVQQQQRRQLRQQ
                     ERMCALLTCAISSNFVSPSESSVSAAMASPAPFQRLGSLGGASANAFLTRCGHILHKV
                     LCSATLSSRIARISNVKLRNCSYYILDSNGEERKEEGLASSQQAKTDAGAATDSGAVL
                     RTQFALPPTLQEHIVFVEDTYRPAVLLKLVHALRSRIAATAARKRASAAARRLAAETA
                     VDSGDDRAHREADLPRIVAAQDATTASESSSYPNVEDRAGTGILIFCATAEEARVMSH
                     FLAAAGVSSVVEFTTLSSEAERRRALLERTADADDTEPGAEVSCVVASDALMRGIDIP
                     NVGHVIMYHPPEAVSQYVHRAGRTARAMRPGHVHLLLSKTGPSGKQEDGEMALYKRLS
                     RSLLRTRPVSYERGFFRFAAAPSASAATSAPSADATATAEEVGSAEWWVAQAGQFLVQ
                     SQHQLQRRWASVLESAAAAAAAKSKATAAASEGRSTTAAITTPCRDADASQMEASLGR
                     KRDRSVVSNTARAMPAAVGSGLTARWRR"
     gene            <362947..>363609
                     /locus_tag="LMJF_20_0880"
                     /db_xref="GeneID:5651440"
     mRNA            <362947..>363609
                     /locus_tag="LMJF_20_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682788.1"
                     /db_xref="GeneID:5651440"
     CDS             362947..363609
                     /locus_tag="LMJF_20_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682840.1"
                     /db_xref="GeneID:5651440"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV8"
                     /translation="MGGKRKKSNNGPVKKESKYKIPTRFDCPLCDAKASIVVRMFRAT
                     SDATVQCRVCGAGGTKRWNVLRLEKPVDVFFRFHEALVQRDHADLQQVEMGREARLSV
                     GAPNAVLGGSQSSMGKEAYSPGDAAVAGWARLGSSAAAAATASGCSHSQHVKSLGELQ
                     RKLTMPAWSGFATAPTASCAVDLRDDYEGEAEGAAAHYFAPRQEVHSAEDEDDEYDQL
                     FQ"
     gene            <364619..>365497
                     /locus_tag="LMJF_20_0890"
                     /db_xref="GeneID:5651441"
     mRNA            <364619..>365497
                     /locus_tag="LMJF_20_0890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682789.1"
                     /db_xref="GeneID:5651441"
     CDS             364619..365497
                     /locus_tag="LMJF_20_0890"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682841.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0890"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0890"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651441"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV7"
                     /translation="MSDTRDVAQPRRGSFASRKARGETGGSKSSSSSSKNKEHSYDAR
                     RYHQNANTHGIHALRTFDCPVCDSKNTIRVTLNPRLGEGTVSCTYCCSLRPAPPDLPY
                     PSVQRFVPSLENRADVFFRFNEQYAALLRQHKSERVGESVDPSSCLATVDNTRKRANK
                     DDGESGGRARGPRGESRDEDGLFGDCALHMDTGLFDNAVDQHVTGTLAMLGSDDDGGS
                     NTVADADPGNPKGVSTPSPPRPDGADMPESDFMNVAVIAGVDEAFAAHAADGVDGMGE
                     ADAEEVDVAAFFADSD"
     gene            <366707..>369379
                     /locus_tag="LMJF_20_0900"
                     /db_xref="GeneID:5651442"
     mRNA            <366707..>369379
                     /locus_tag="LMJF_20_0900"
                     /product="putative nuclease"
                     /transcript_id="XM_001682790.1"
                     /db_xref="GeneID:5651442"
     CDS             366707..369379
                     /locus_tag="LMJF_20_0900"
                     /codon_start=1
                     /product="putative nuclease"
                     /protein_id="XP_001682842.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0900"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0900"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651442"
                     /db_xref="GOA:Q4QCV6"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV6"
                     /translation="MTRRSPTPPPDFPLDSLPIYEPHDHNGPPRTKIGFHLPMRSLPA
                     SLALDFFFPGAGSNDSLQAANASSSSSRTHSSGGSANSDLGARYEEADNGAGSGHQQH
                     TSRLDRAAHGTKGLSAAGAGSVTGDTSTAFCRLCRESFDNDGTLRSHITVADRARHVS
                     HPVREVALETLTLLAVRGYPIDNIMTVWADILFNCPLFPRIRSMTDPRWSIEKRAAQI
                     GIILRALKRVGVLDVALATAEPTDVAGSLNSRYRQRRVAFERLEYIGDNCWGNNISNR
                     ILLLYPDQQWLYSERCSTFTLVRDACEMNVNLDFVFDTLELWHLLSTTAHSRLGSGKV
                     KADLVEGIFGELHLHLYGMVPKLQDDVEYVETNGAREVQLVALVEHCLTELYDLIVLK
                     HARDLVTSAIPLAKELAAKRIWARTRPFVLPQKRPNTGRARGKTAMSNGAPHASAFPS
                     AVPTVGRVATGGYTASFPAPHTGVATANASVATLEDLFDVSPSSLQQQQQHDLSACGA
                     ASGTIESRADGRTEVAVVSNSGKGSRHNTKERAEEAAAVARGRAGVMPISPLFPTPLS
                     LTLSASIGLGSTRVLPALPRLFTAPHVYPERVPNPLRLLPLSAIPSMTYCHHTCSDVF
                     ARMKMSYERLGLLHEGSSHMHYVVSPTPPRWAVLIATLVPQLVGCAPLPVKPTGDTKG
                     ASAEARRLLASMDQGGLYCRDALYNLAVLPSSPAAASRPHATPPPMSTAWALQNAGLP
                     ALSATPSKTREDDDDASSDKSGRSGCTFAPSRYVPPGIRAPPAGVVTDRNLCRGVFAF
                     LAVGVADAVAEAERLTRTDTASVSPATPAGPTTGARSSGECPAQHSAEDNSPKASATA
                     YAQRMKAAMDYWRRRSQTSLQSLSAASGEASLPR"
     gene            <370306..>371157
                     /locus_tag="LMJF_20_0910"
                     /db_xref="GeneID:5651443"
     mRNA            <370306..>371157
                     /locus_tag="LMJF_20_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682791.1"
                     /db_xref="GeneID:5651443"
     CDS             370306..371157
                     /locus_tag="LMJF_20_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682843.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651443"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV5"
                     /translation="MPPSGKTGSSAAEQVIHIDPLLVYFTFSRIRPHFSCGRTIESTL
                     KQFRDGELHPRDLPLLSVLTDGAHYYSQNNRRLYVYKQLKREGLLDMLPVRLRPLPQT
                     KRMRSKYSPQTCALNATLMRDTANRGGLRDASAAAADSNDASDTEGSHDNHNACTSLA
                     AVGEPGVGGDELRSGNRSASSSSSPSRPANCATGSGPEREVVEGGDLRNAPTRMNQKQ
                     QQQQHGFTLSQQSSNAKCREKASQRPGKHKGAAAARSPSSSSSDGGGNGGTSALKAEL
                     CKLGLHT"
     gene            <372193..>373980
                     /locus_tag="LMJF_20_0920"
                     /db_xref="GeneID:5651444"
     mRNA            <372193..>373980
                     /locus_tag="LMJF_20_0920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682792.1"
                     /db_xref="GeneID:5651444"
     CDS             372193..373980
                     /locus_tag="LMJF_20_0920"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682844.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0920"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651444"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV4"
                     /translation="MPRFNRSSGRESIVSLKQRKRSLAETVNEQLTRFAFGGGGGAGG
                     AYQDDDEYADGGFAEDYEYEDVDSNGFDGDDDAEQGSRRQTAASAAKKPTKDAAKKLP
                     SSASSSRLRHRGPLDASLSEGKYAATPVNVEAAMDDIFGTLDMGDMDAEGEEFCDGDD
                     MDAEEEEQGYGEDEDSKGRGERGVASKNDAVGRKRRRAKDLTEEEYAAWLENKSSKQK
                     KAGQLRRSISLGGGNSGVGEAVLKSEEADILRQLSELRQMQMSLVPAGDAASAAAETA
                     SAQTDAKQTRDVVQHLIMVYGQLLRLRVLLQPAVTKAISMPQYYARSLFVDGDAEVDD
                     AAATASNGNCAAEVQEMREGVSKHYSELQDDVEQVLATLYAAATGSRRDDRSSDVRVS
                     ASASKSKKAKTEGDLCVPLYREVERYHERVLRHADTCLDYWGSKLVQANSAKLKTIAQ
                     PLPQQIAAILSAKSRLRSKLQKNRSHIVIMAHPEHVRAETSADIKAQRALHIAEGDVD
                     DEIYDDADFLRELVRRGGAVASQLEKKVKEMHRALLPSREGARKGFHRMTKGKAVNYE
                     PRPKLVAFMMPEPLDNAERNDVVVKNLFQ"
     gene            <375108..>381386
                     /locus_tag="LMJF_20_0930"
                     /db_xref="GeneID:5651445"
     mRNA            <375108..>381386
                     /locus_tag="LMJF_20_0930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682793.1"
                     /db_xref="GeneID:5651445"
     CDS             375108..381386
                     /locus_tag="LMJF_20_0930"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682845.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651445"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV3"
                     /translation="MAARASPSSGVTAESLYRDVVWPALWKVLQLTSPPSNPANVGEK
                     AGGGAAEHVLCARGLQRAITQALVQLLRTACVDAATSSTSGVPSGVMQEVVSHLLLHP
                     HGTEKTTAPQVVPEAQMGVLDSATASPAAAEAAVEVERLYLLVCAAIQLSAQVDVPQL
                     AAIKIVPTAATGAASATTANAAAAPQLPWGVAQASKSVVAGIFALSSYINPSTTSLPS
                     PMAPCLTPSVLGPPPSPMATTTSQQQLQQQLQLNVQHLWFTFLYVYLQQLSSHTPKDT
                     TAYARFFAGCGDECRTRLATAPVLSDDDDSGDDGVVAVGAVMRQSTAASETAALQAWS
                     HVSVDLLRDTIARTRFRRAALLFKSFVPHMLTQAPTVTFLLVDVLSEFVRSWAAFTSR
                     IPAGCMADDIARRLARYDTHGMLHDDGPARPSQQWQQCVDLLRIYSDRLTRILATGTP
                     HGHLVATTLCAVLSALYVLPHTRGSFPLSSAGEAGAVVAGAAVGARGKRDEEAAVLEM
                     ETAHRQPRRMSAFSTAGAAAAPSVVGESLLSEVEWRLRHYAPLGQLLASTRILGLQKV
                     HLFAVATGQLRVGRSVAQQVEHTRMLALAALYCGVAGWDLTVLMYHFAECPLNPFSGP
                     ETPPPALPISALARYTAAVQQYVEHTRAELIMDMPFTELSVHNGHVDGHGGRSSGSRF
                     RGMRSGGGGYGQPLKQGSLPHSSASSIPSRGELHTRRFLRIVHPDPLLLNWRLHLTAT
                     ESLVATAAVPNGASAAAFGGGSSSITAAASSTNAAAGNASSGSAVPDLLLSPCCLMRD
                     ILVSGQYALAADGMRYFAKPPTPPVASAGDVSTGAPSVNVLLLPRRAYPQHISVAYYV
                     SILLRRWLQRWEVAEQQQQAGQAEAAAVMQLRDECFHVLSSFVPVLSVLQSYMANQSL
                     LVRLLTRLSWMCRSAGVAAAATAAATPASEATTTSSNSGVAPPAPNAVFALAERLLLA
                     FVMPCIRVLPPAPMVYDVMEDVLRLFARCSIPDAQTHGVVPYGENAAMPLHMFDWLQE
                     LLPSVKFVAVYRTKQQLLQLEGRQGWPPSPLVHPHDALLRKEREALLSHSLKRLNAEN
                     LDEYRALLRPILYAEPLLVAHRLFTQAVGYNNSFLDIHTRLLRGLPGAVLMLVVQQGL
                     VLMVRYAAEEKITGANGESRVAILATFVATLWRDNLDAVDGVLLVRRVELALRSNSGD
                     DILLGTELCKALLAVMAHRALEHEEKYNPAQLQALAYTPSTTSFFGRGSMTSFRVRYW
                     KDTASSAQLLLSPEDVFVGAWQALLAALQQPCLVPIQGDEESEDTEEEHARQSVTAAR
                     SEVRLHLGQQILLHLCRLQSCIYELQRDLDGGAEVILLSSAGRYNMINDMLVAIEELS
                     PPPAEGPVLEYLCACVRQVALPHVASLVETQQRRKFEWASASPSNGGAVPSDAVYSVP
                     APTSSRVAVAAADTPGLPPVAQLLQYFTAAHFEYKPDPYDTARYEWQQCMEQARSLTN
                     QCLRGNRSGGAVSVRRAASIVTWLDGEAKRIDTEESMHKQLYSSSAAARAGLLELIRR
                     ELAPPTAPLMSEADDRLVELAASYLLPRAVLNLREAATVAAFFTWLFREASPTAESAA
                     MAGRGEAEQTPWSLHCRAVDLALAFVTAAFTYFVGFTDGECKRLGCILQSLLQIPALS
                     AHEQQLDAAQRMWPSLLKCIQALSTRTKPGSGAPAAAGEGARVLSGEDVAAAAAAADT
                     SPTCEAGAAARGGRPAVSCGGIRTVSAAVFEGFLHSAHASLINGNGASSSECAGPASL
                     LSLAMARGIVASPAQSNELQSAASTAADAAAGAIPAAPLQLEAYLSRAMIQLLTHEQD
                     VPAYAHRNLFLVLEHLDKSTFPATLCAVDLLTRAVEPHASKTKSYYALASAVLKLLRL
                     NRRHRRELQHAIAALRHGDEGVAPAALQAARGEDGSALPQVRAAATACHGQWRLDEHY
                     MRQLLQNEAAVLLEDAQVRHRVEDDSSEDEEYEEGTDDSEAEKDVADGTSCSSGNGQV
                     DDEEGVGDDLSAAATVQEGGEEDEEIDDSGGGEDASGSGSDDGDEEEHSNGSDEDEYP
                     DSGDGDDASPAARKRRLE"
     gene            <381909..>383297
                     /gene="CYP15"
                     /locus_tag="LMJF_20_0940"
                     /db_xref="GeneID:5651446"
     mRNA            <381909..>383297
                     /gene="CYP15"
                     /locus_tag="LMJF_20_0940"
                     /product="putative cyclophilin 15"
                     /transcript_id="XM_001682794.1"
                     /db_xref="GeneID:5651446"
     CDS             381909..383297
                     /gene="CYP15"
                     /locus_tag="LMJF_20_0940"
                     /codon_start=1
                     /product="putative cyclophilin 15"
                     /protein_id="XP_001682846.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651446"
                     /db_xref="GOA:Q4QCV2"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV2"
                     /translation="MHLLQAPPSPHPHPTRTPLQTLCVILPPAMQVELSFIFPHALKE
                     LPVSFFVPLSSQRPRTVANLFFMCSGQLPLPAELLSALHLTEAEVAYATPAAAKAAGL
                     LPLSDSAVVRIDKASVMEIGSSTTKSIFGGFISDERVTLPAGTAARGQSIAATMSSLK
                     AGTLLYGNLGMPNTQASRYYILLEPVTTPEQRHEFAGFAPLGMVTGGLAELKRAASQT
                     AVQPRTLVPKKKVVVSGCRMQLDYTYLSSSTEASASVSLGGLCDGTGQDAGKQRPTEP
                     HERVAGRVRRRDDDGDEAKQADPRRALDGDGNTTDPGAAPLHSSGFFKISARFPKAAV
                     AASGAGPSLKRRRAEAFVVGDDGVPTLRTTAIAPGEQVGGDGTAEPFEFFKAQQDAFM
                     NDIEGIKDAQLQRFNRKARRIMKSRRAWASSSSSGRHANSQQHSSSSGTHVTGSGALS
                     KTGAKKTKPKRY"
     gene            <384615..>386726
                     /locus_tag="LMJF_20_0950"
                     /db_xref="GeneID:5651447"
     mRNA            <384615..>386726
                     /locus_tag="LMJF_20_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682795.1"
                     /db_xref="GeneID:5651447"
     CDS             384615..386726
                     /locus_tag="LMJF_20_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682847.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651447"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV1"
                     /translation="MTGKAGAQAAITGAARCCSTTAANAAVGGAAAPSTATRPVRQLR
                     LAVVRPDILDDWVPELNDVVAHQISCDEATTLVWWRCSCCQQRYQCTVQTRVACGRTA
                     CPHCGGGISAAGDASASNSAAISVTHKPQDVAAPRGDVGETLDKTHPDLAARWDVARN
                     GALLPSHVTASSTRQVWWLPAANTAPLPSPAAQRSFLRPVFAFVYDSASPEEQAAATA
                     AMEWRLLHEIRRVAHIEDAEKAGVIPVTVRSGKTGAPHAAAWLTGSGDAAAADSRPSV
                     ATMAAADVRVVACMWKDRISGLAKPENAEDNKFPQSSASRPAGVFPRELFAHSPTTER
                     RAAMSAESAAASTVRVALLGRYFEFVCHQRRGGGSSSKERTTLTPILASLAPSSSTAA
                     AAASAAAEGTSPSWTDFFALTRDSALPKGYIDPNAALYFPDAADVAASGAQVTAVSEA
                     TKVDSLRLTASQISDTVLTRYPRRPPSPRLREDDVMQATPPMMGASAENGCRDVSAIH
                     QVKHHQLRHHVHMPFGHTTTVAEENAAKLAAEYDVDDEDDSGRGMDSRRARTTDNAAT
                     FATELRGASRRRGEAATAASLIDSAIAALGEAFSVAEANSSSRRYHREAHRTAALSDE
                     LMASSSDSARRTGTRPRRFRLSLPHEAPQQMRRRNVAAELIAADGSGAVRPAHFEAPQ
                     TPRKVARSRRANQEASSAAAQ"
     gene            <391009..>401331
                     /locus_tag="LMJF_20_0960"
                     /db_xref="GeneID:5651448"
     mRNA            <391009..>401331
                     /locus_tag="LMJF_20_0960"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682796.1"
                     /db_xref="GeneID:5651448"
     CDS             391009..401331
                     /locus_tag="LMJF_20_0960"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682848.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651448"
                     /db_xref="GOA:Q4QCV0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCV0"
                     /translation="MKVGSSSQSPEGSAARAAADSVMPVQSCSLSLVTGTSKSAPAST
                     GVFVGDMDWPQGELVPVVSLCGAAANAPSSPPPAAAASAPLIASPENPLTPSTMVPPV
                     LPVSALPFIISVVTPASGSSAAAEINTAPTLEMLGKISVLSTENATVSTLSPPSCDPV
                     ASCHDFYRRLNSSLGVSSASSVPLLRSFPPLPATSLGDNSSCSDDSAAAAASVLSVGE
                     ADAPLAPPSSPSEPPLPLPGPAPSPQASAPPQQQQQQPPADVVARLNPSLLLVAQTLC
                     RCPFAEVMCPVFVMESSRARIAAAAIRNPDPASSSAMTVDPDTQRQTLPLTLDRPPHP
                     ASSSSSLRHLDSPQPLASNATVLDHQEDEMTEGSRGTYHQSAAAVASGDASDAGVDDE
                     DDPETNSAPASRIPESISKPLMGRASLSSHSANTKAAAMATSTAATATRNFTPNYSAL
                     PLEQLNSDSPTPPPQCAWSLVYANDAAVSMLGYSDVDEVTAAAFDNLLCCFALTLPPS
                     ASAGSIRSDMPLVTAVAATDGASLPFALASLPATESSSSPQAACVGEKEMASNDENDD
                     KGRQKHQQPSSNAVRQPGWREVQNLGELFTLPDRSYVILYSKRTSAYYAALAVPSHQP
                     KMSQRTSVDGESTPRMDSPSSRLTGSEEATAMAQCERRTSTISAATNTSSPLEPDLSG
                     EASPPPPMQQQRCSRYVEIYILQRLESSHRPAGIARMPTARAVTAGPPPTLVTPGSGT
                     ADARGPGARTTTSSGDHRPTAVFAPPPAEAPHLRTPQQLPPPPYRPPRSALSVSATAA
                     AVTETGSVDSLDVDAARPLREQYANCSQHVSLHPMVQSQRRLPSSSTERSSNWAASRT
                     SGHPGSPAPGVQVTFGSPETPSANSDATSAMRSTSQHTNQNSLCDLSYPAFHVNLAQP
                     TITSSDCLYGANEPAGAAPLAAAVAGESRGLPLTPLHKPGEDPHHNYSSPNSSSTPLQ
                     KTALNARRPQSEQRHLLSRQRHYRPLAGLDDEDEARAVTRFKRSSMNNSLPISPALQP
                     ASEATSRQRSLSSAPLSATNKTIALLSGARSRMPSPLYQQLPPPSSGRVSSSGSARLQ
                     SPAASTAALAPAVTSSAPRRATHEARDVESVVQLAQQVRTEQQPHRKNKAGQLAAFAR
                     GSPPSAWAHRDAQQLSPLPLSFSHSHASPVYRVPHSGGHHTLVSGGDAAGLSEHSLPH
                     QTFPSAVTGCLMQHPQPSGRASPMEASSAQMFGHVAGMSWQRSNDVDEITPHKLADRL
                     RSQRGVVAVLVSARLPRTIIFNSVAFMMFVQHVLRFQRRNGATQVACILTVCRKMQLV
                     IDMIPVEVLLGAGGCVKRTGTDNGSPRTNSASPASRRVSVSWKANNGNAEGADRSSST
                     ATETVGALPKLNATLLSPQEANPAGPHLVGSLPSSAPATSSQQPQRMIQELLAARLAD
                     LDVFYGYEESREAFSLAAPALDSSLGGFMPSHSSSSSGSFMNSNSSCVPPTATASSLG
                     TGIVASSPPCGSMQRYSTQASPLQSPSGGRKKSRTAMPLRSVQSLLATNAVPRHPHRD
                     PLRRPRAWSHSPHLQQQAHDRNSSTTSPANAVRKVALASNAASSGGDRRDSTRRSTSV
                     NLGTCSGTDRLSKRSSAMRSSADSVSNGALSRRSSFTTRTTAATAAAAAAAVRAGDSV
                     QRKGPLATLGGGAAHVADGSRAASVVLSRVSSSAATTTASGTAETAQEGGNSSILTNN
                     TTAASHPFNPAFSEVRALGVQQDTAEEGDDALSRQRTRMENGESSYEVMEAATESSPT
                     SLLSRRAGSVKQSLLWAYPGARSASQAPQPQRRRHPSRYVSSSSYLSRDMRESLAMCD
                     AATRIRADTYEARVLIPFTTSQRLGLLSRLGNVQLSKYRGLSVFGVNIMNLVTEEAAA
                     EAAQPSPPIIPLRYDIAARTYLEGARGKSVIFSPLLSPTTATPSFPSRAASASADVEE
                     AKAEPTEAESAMANTAAANMSRSDTLSEAANRSDFSITQHGGASGSEGTSPEGVDDTL
                     RRGSGATASGEATPMQRHADPFQLPMDPSSTGGTHHGTYRGFSALSMQSTDDGEDGHF
                     SASAVAATAARAEAVKGMEDSKKRLSDSVGRCTKQLHEGSPLRATASLSVFTVRSGSL
                     PRKGTGLQLPTVLLDDTIAAAEGKSRSTAVAKTTEKEQLTAHARTTTQRASMEITSPL
                     RRGSRDAAPVSETHNTPNTAVTVPTVVMRSPPQRHGPQKYLTPHSCHHAVEPSAQTGT
                     LQTPLHLALPFAESWNAGSQSPPVSQGSNILSASCAAGVSGASITASSCADRIMRSSR
                     SDTPSMQSRPAVPYPLSLPHPIISCTTPFAAGSSNLTELTSTQSSKTQGLVSVCKQKS
                     GGTELLGYTLSNSAAAAFGDLSTALKKDDNVHAGSSAGASSTENKEEAKKAAANATTL
                     LGSIAVGAPETERRTQQYANSASLSGQAPESVIVAGISARAALPSISSATLTGTAAAQ
                     STAAGEGNAMTSKMEVKLSGVSADDGEHKSIGNLGDLVTPVAARNGGAGASDDRHAPA
                     GDGNANMPDEANDSFADNCVDIFGLVNRPQQLADLRRCVSMHVRSVCDHGFLSTGSSS
                     MSFGATANAVAAAAAVQGNMSSSSTGNHSWGAAVAALPIRPLTASVSSPSESRVDEGV
                     RSSESSKLRRISGLSNTTATAEKGATPHTNAAMRAVAEDAVDQTTRNNLHVLLYTTRA
                     YAEVEEVLGIYGHCTTFVTSATKMLRYVRSGLQLFDVVIVEWVDSLISEEMHETLAKH
                     AIEETVVAFFISTRPGVRTPTMNVANIMTDATVVMYADNLLEGLLSRNVLAEVQQLIR
                     CRRLLRSMVDITKERSYQIVGHIGSGAFGDVFEVMMYASRGRLAMKRFFLKSMKLRQL
                     EIINREVSIMRSLEHPNIVSFSHTRLEDNSYAIFMELCDATLANHLLEPFVAIPGAAQ
                     RRQYRSAGLMAEYPGNAMSNSSNSVSGNGVDDKVDMAGMLRAAAREGGRAEFLSTHGA
                     SIMAPELKRPQDAVMIVHDIASALIYLHRRGIIHRDIKPANVLFANGMAKLGDFGSAV
                     KMTESRQLRNMKGTVSYMAPEMVLGEPYTESCDLWSFGCLIARIMGINLGHLNGLHMP
                     ALNELYRAIPKNGSLPLTFTNRLSSRFGNHYTEETTNRVLKALKYAIKIDMAERQLAA
                     SPNSHDSVDKSSTVEGKEMQSSSHQTTSIDSDASYCTDTASMTSEQESRHATESDGAG
                     AVTSEADTQNSRRSILCITTSNIVVLDEFSVLLPTSLVDLFNRLFHRDPAKRMTAAEV
                     LEHQVSWDVEWMTRMMQEIYEVSCLVEQRSAGAQGAAGGVSRCHLAGQAGGGRLPRGE
                     EGAGTGAAIPSVTAGNFAYFPIQPGSGELAWMTGGSGSQSVLGAAGTGGCANIPSAAN
                     NYVLDLSLSSSSSGGGGDDSGDRGSEGEASDD"
     gene            <403948..>404982
                     /locus_tag="LMJF_20_0970"
                     /db_xref="GeneID:5651449"
     mRNA            <403948..>404982
                     /locus_tag="LMJF_20_0970"
                     /product="putative
                     1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase"
                     /transcript_id="XM_001682797.1"
                     /db_xref="GeneID:5651449"
     CDS             403948..404982
                     /locus_tag="LMJF_20_0970"
                     /EC_number="1.13.11.54"
                     /codon_start=1
                     /product="putative
                     1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase"
                     /protein_id="XP_001682849.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651449"
                     /db_xref="GOA:Q4QCU9"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR010357"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /translation="MTDCWYIPEAVADRRDENRLSPNVPASYEVLGEAGIFYRHFDSE
                     EVNDNIEGFIQPLLKKLNYQSYDVVNLSPANLGAEKFETLAEQHFMEHIHEDDEVRLI
                     LEGQGYFDVRDINDKWIRLLLKPGDCIVVPAGMYHRFTTDQSKCIKTLRIFKEAPQWI
                     ALNRGPEAEEKPARKEYLARLHAPAETAVGAVNGRTIFSLRYPLKLDAELTVITKRLL
                     EQHSKQPLALAIYLTGSTDPTTGESWCPDCVLAKLHVARRFAELQGTYGKEHAIFLQL
                     PVERASYLGNPNFFYRTHPILQLASVPTLLVLSPAKDAKEGGDVQWYDLLDVKVRTCD
                     VDRTDVLNLE"
     gene            <406386..>408464
                     /locus_tag="LMJF_20_0980"
                     /db_xref="GeneID:5651450"
     mRNA            <406386..>408464
                     /locus_tag="LMJF_20_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682798.1"
                     /db_xref="GeneID:5651450"
     CDS             406386..408464
                     /locus_tag="LMJF_20_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682850.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651450"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU8"
                     /translation="MIAWVPVSCCRRSLASRLSGAVAKARTSALASKVRRASSTSSQE
                     TRAFSGAASGAAAEWSAALPDIPYGFPERDSTVFAAERSGGLQKRWLQDLPRQVGSST
                     SSASPNAGSIRVERYLPNKEDFWRSPPYEALREIVLHSPYHDALKIIMEHDYRFLFAD
                     VMCNAEAPMPHIIYEDFMKCLTFSSRQQPPEEQFALPEPVLRDLLCWAAYHCTLDRFY
                     FTSASALFRKLEQEQHMSSAVHSAWVYICTAAGKLEEALAYAAYMEAHSIPFDADVFA
                     RLMHPSLTPVQQHLQQAPQTSKGIVLQRRLCHDMSQHHGTMSVAVHAMFVYHILTLRH
                     TRKWEVLRGAAELFNRRQRRARSRSGLVVPASSTLAAVSAAESPYEVICSRTMQLAMS
                     LFCREKGVRWGSRVAKEMVAFMLDNEEAGCTMADVLFVLMRIRRNERTGMLATLPRTA
                     FSAEEQEALLRVTYRRARRDPAYAVAGPLLRELLAADGVSGAAAGDGGSGSDEAVDRA
                     MRHLQKLASSVADYNAYAVSSTLSISPAVAAGAPYRGAGERCAPAAGDGAGVDDERCS
                     PTSLSGAMMEQLREEEMPSPPAEIARDLLAAVMALDRESVVEAPAAVRGSGDAQTTLN
                     ESSRAASLATPAAPEEDRLRDLYVSLEAMGTPSSLSAWSLQQLQREEEEARLHRQAAN
                     AWISPAYVPR"
     gene            <409525..>411039
                     /locus_tag="LMJF_20_0990"
                     /db_xref="GeneID:5651451"
     mRNA            <409525..>411039
                     /locus_tag="LMJF_20_0990"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682799.1"
                     /db_xref="GeneID:5651451"
     CDS             409525..411039
                     /locus_tag="LMJF_20_0990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682851.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651451"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU7"
                     /translation="MRCVQLPMIRSCGLVLASIEASPRHALSGCASVASRTVVTALLC
                     SRRWHAGAAAPSNGYAARAARRLPTAAEAEAELQAWASSAAGSSTLALTGKSLVLSVA
                     ALQLHEAAAATQDSTTSSTSSTELVHRYLGALAMHIYKHFNTAGKPSAAAVLYADVES
                     AHIRPESLQVSVQYLAHKAFQRSISSASARDGAGQVTRRTAADLADTLSAERDLELTL
                     EATLVLLAGHQILQVHLAAVAAKEVGTASTAAAMVPHAESTCYYVGNVVALISKPLQA
                     PPTPSVEPAAALSLPPAKREFWAQTAKQLSSVLYVALLSAQSNVTDAQLIGQMFRDLL
                     RRVYGVEGGTFGMRRALHYTLTVTVPYVLKSFAVILDVFQQQQRAAAERAAAAAEEGF
                     GASAPTNSRNTSASSTGSLRPKKRVSTKAAGSATAVGPSSEKVHRATLLVLCVAAVLY
                     MGSSRSDLFSAATPSSSSSSQLTAAMVQAADRGHANIQEALRHGSASATAPQLT"
     gene            <413591..>415759
                     /locus_tag="LMJF_20_1000"
                     /db_xref="GeneID:5651452"
     mRNA            <413591..>415759
                     /locus_tag="LMJF_20_1000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682800.1"
                     /db_xref="GeneID:5651452"
     CDS             413591..415759
                     /locus_tag="LMJF_20_1000"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682852.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651452"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU6"
                     /translation="MELHPLETAAVRILFCGRPALTTGIVNLRVLLGGDGQYCLAEKR
                     KAKLHHSNRHGTRGDAAVSNGVEVSADSREKRESVYRVCSSEGLPDGCYYVKADRHYW
                     VMRMKGGLRAATSTTATSTQPSASLWNTQATLASSPMPLAATASAAEPSKVEDDVLAR
                     STHNQGTAASTPAEAAGATAVTAESSSALTPADDAARASVARKKVISTQRKYTRRLKA
                     VEEDMDKLPLITTTLSDPAPLAEASPTQEQQQQQQRASVQGVDVVGDVEAARGEQLLG
                     TPLSVRQAAKVATDVLVAFEETPPSLQQQQQKKQWERRKKASRVHVDAVAEDCKDSEA
                     DAAGGRVSAKTTRGSSRAGGGNDVHGEVAGGTPLAERLAADASQPPKQPQHRGKRWRS
                     DEVTAEDPPALPPVRHPSTQVTPLTSFPETSPLPTPEKSKAARRKMGLRQDEVKASTP
                     ASSANLRDATLPLPSTLIDSDTESAPRPASPARKSRKSSAATSAASAAATSDAADMAT
                     LSRIPTPPLSPPPLRPVPGQRQITSPHGKKTPSHAGTNTASLDHPPPRQAPPQQQQQQ
                     EEEKPPAKRSPASAPQETTPNILYSNRSSGVATPTARDIMQQQQHDRHAALSSPSTRS
                     PVGVNRSASTSSLLGPLLSPLLQHQSQWSGIGSGAAGSRGLHGSMMNGGSGGSGFFPS
                     DSPALGFTQVHSTLAEEFSLDVSETESSSAASEYLCDVEE"
     gene            <416729..>417052
                     /locus_tag="LMJF_20_1010"
                     /db_xref="GeneID:5651453"
     mRNA            <416729..>417052
                     /locus_tag="LMJF_20_1010"
                     /product="putative glutaredoxin"
                     /transcript_id="XM_001682801.1"
                     /db_xref="GeneID:5651453"
     CDS             416729..417052
                     /locus_tag="LMJF_20_1010"
                     /codon_start=1
                     /product="putative glutaredoxin"
                     /protein_id="XP_001682853.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651453"
                     /db_xref="GOA:Q4QCU5"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU5"
                     /translation="MNQVLDPARAPQFLDSMLRRNRIVLISATYCQFSTKLKMLLIEL
                     KHRFVSLEIDIIPNGREVFQEVVARTGVHTVPQVFLNGKYLGGYDDLIALYHKRELSE
                     TLEKR"
     gene            <419108..>422170
                     /locus_tag="LMJF_20_1020"
                     /db_xref="GeneID:5651454"
     mRNA            <419108..>422170
                     /locus_tag="LMJF_20_1020"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682802.1"
                     /db_xref="GeneID:5651454"
     CDS             419108..422170
                     /locus_tag="LMJF_20_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682854.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651454"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU4"
                     /translation="MTATTAVLTATMNEEFDDLELSTTTYGEVIRSDKLRTNLRRGGE
                     YRISCSAFRHRQGSNSGSGGGAVDHRIHAAPHPSRLSSAPQQRPKQQTASTASPTAAT
                     TLFFGEAEAAAAVAEGRASRWSVLPPDPSAENVLFIPCPPPLGGRRTSMEGGDAELTS
                     QQFARRLLDLPSFRPTQIALSFSTAAAERERVFPAPPAAAPPSDTCSLGSLALKHSSQ
                     RFANPLHPQQKPQRLPQHNSASSLEGCDAAAVAPASSAATLASGMGTRAVASELQPLS
                     PWPNPGSPGSAGQRLSSATSRGRRCLALLSLPLEPLPPLSRTRATHTHAPSTSSPMLS
                     SSPPAEAHAALAIASVHSTCVSGRRNSDLNATRVSTTRLSSAVGLAGPGAMERLSPPP
                     QPLPQGLLSPTLRALPKGWGSSPPVHDLHNPASSAAGNSSQGVNSSVTATLFGVGVAA
                     RPASVASAGRAGPTLTPIGEPATDTQRENPSVRPLEAKVCALFSGSAYADVRGAPTEL
                     RVLRALPVARTYVDHAAVKAAVVAATAAAPSPGTHERGCKETPGCLKEAAAAALPPFV
                     VPKGGVEAGAATLGASFSVCSTPLPNLPAQIAPMSFKPQQQLYSNTKSGSGSTDGERD
                     GAACRISDVAGTTKVAFGGVSSPLMVGGVPPTVAATASRSPQQQLRSSFEWRRQAGDV
                     GTWTAMSPESEVGATPRHPSDDDAVVIEEAVVPAAGISPMPSPTSLPLPTPQQGSQRA
                     VFRFHSVLQRGEDHRGGSHLLSAHSSVGSSTETGEGWTPVPKEEEAVADGDPCGHGKA
                     QGTELRVPATLPPQSAGAAATSNVSSKAGRFKAAHKRRSRQRGNREESVAGLRRESSA
                     ASMLASNSSRGELWTGLQLPRSSTLDNISFTNTAGQRPHSITSLMRRPGHEARMRHMN
                     SDTCFGTFIPSVDSFRSFLEDHQSSFYLGNTTNDRSASSGTQSASPSCSGMRMRYERG
                     KIGSSTRGHSQRKRESHGVDWAVASAASHQLSVNRDHDTPAGESLEPL"
     gene            <429605..>430258
                     /locus_tag="LMJF_20_1030"
                     /db_xref="GeneID:5651455"
     mRNA            <429605..>430258
                     /locus_tag="LMJF_20_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682803.1"
                     /db_xref="GeneID:5651455"
     CDS             429605..430258
                     /locus_tag="LMJF_20_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682855.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651455"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU3"
                     /translation="MMRPPLPPQAVFNRSASSRPAPPSMHNCGPPPPGSLNNSLRPSG
                     PVRQIAICGSSGPGNTRLPSSQVLQGQRVKSVARGPQPSSVEPTRLANGKKIKKTDKQ
                     QSQVAEARPEHYTFTGPTKSAMKIRKAQLQQQRRGANVGKEIKTTVGNDSSWMKGLTY
                     STWVDSPKGTLHKLDHEGPYKRRPKTKNNPNKNRGRKTRSNMGKTSLLLEALRNLFR"
     gene            <435319..>437997
                     /locus_tag="LMJF_20_1040"
                     /db_xref="GeneID:5651456"
     mRNA            <435319..>437997
                     /locus_tag="LMJF_20_1040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682804.1"
                     /db_xref="GeneID:5651456"
     CDS             435319..437997
                     /locus_tag="LMJF_20_1040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682856.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651456"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU2"
                     /translation="MLGMPVSKSNSGDAGRGDYEYGEYDGVMDVEAILHTTGGASPNP
                     TGSPTVADSDIGVYGNYMSIQGDNRNGGVPTPLGRGAPRKPTRMNVSPAVNGDNQSAV
                     PSSAATTPGFHGAVVGSSSDGAAAPTAARRANGPHMSAEADTHDASALSARQGTRKSL
                     HADDVVHLPAIGNQQQVRKKASEVLPTRARAAASAPDPSNAATSTTSSNSNTRAAGTG
                     GKSVTSAGNLESLQAPNDSCGAASSHQYTASYKHKPPYHAPPLSPLTVKGRHGSTDAN
                     GTSAAGSAAIGNSVGASLQDVGMRHRPATDGTVKRGESVGTDEGGYMNGHCGRAATHN
                     TAGTSSNVVTVSKTNGWVKEEARRLDHRASASCNTATSPRGDPQAFEDAISSLKSRNI
                     THHVASQFPPERMKDKPSKSSTSAKSPSADGRDSALGRNGNEDANTHAKVNTSPVPVT
                     PKAYVWGGDYEMASTPGVGTTNFSVVPMPKVSPRPFAGGLKPSTAVDSNNRSGTKSPP
                     QAAAQIVHPLSAEAVAAASASSVTPSTDSAITPLRKVFTRPPKPALNNSGAAAQAAQN
                     TCPIPHVPLTNPPAATATSSRSNNVAQSAAASVSPAPSKTALMSSHAVAAAKGDKPPS
                     APHTPTLSHRRIMNAVDTNQHSHAHYPGAAEQTSPTYGSSRVATHDQASDAGMGLPYS
                     DERRAALEAWADVLVLSITIRGQNLTPTQRAREMAKTLARPADARQMYAPVNGQGRQE
                     VAGEPCDLNYDVHNVVVQLRHRNRPLMMNYPPRLPLEADMRPRMRRQRTPRSFYGNRM
                     PHVGDTWFKDALNDARMVESPDVESMEKREEAEFIRNGGDPATRRNRYGQANNAYGHQ
                     QQHQTPPQQGGGGGAEVEADIDAMNRNDMRMEQPAS"
     gene            <447450..>450290
                     /locus_tag="LMJF_20_1050"
                     /db_xref="GeneID:5651457"
     mRNA            <447450..>450290
                     /locus_tag="LMJF_20_1050"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682805.1"
                     /db_xref="GeneID:5651457"
     CDS             447450..450290
                     /locus_tag="LMJF_20_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682857.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651457"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU1"
                     /translation="MQPANMDSGAGGHSHNRDNRISDYDVPRLGEIPVRSKYYRPDQE
                     KSHFANHPTYLPLAEQCGPPQPSSSTSLTPRQERDQEYTQSNDDEVSGHAYGDIGDET
                     GVQDDDCEQAQQMLHNSHLGRLCESSVSGTQGSGHCTQTASVGSNASGASSIGPTGLP
                     LMPQFRWIPKQGGGGLGFNPFMHFRSRTRHESMASRPSAPVTEAPMPWNEAQQQGDCV
                     TPELPRGATSPERQQRHNEDQSQAAGRQNSYSMFYGCTSQPPAQQSAPLPFPHRETGA
                     LSFYGPIGSIGIETSRKRRAVERQSGTDGEAERVYKERSSRRPVEGEETGVQLLTQLW
                     CDVSLLRGARVVDSPRLHPDDGEGDDSASTSSPSISDMDSNIGDREAGEAAMAARKKV
                     RQRRQQYSSWSPSFYFKDDDLAALGAEDNRGGSPSGAAARAAPVQMPVTVRAHHQQHN
                     GPSVVRTASPAGAAGDQREVGGVDKVAVRGVAGHELASSSSSSGSSDNDSSDDGSNSA
                     EGSAGERSACFGSDRDDDESADSDDADNPRSSDNDAAADSTHPRRWKKHSSAVPSAGT
                     GRSVLRDGQYDFMNSSLMDESFMSRMPGCGAGMSLLYACDDYDGGGEEVAAAAAADLV
                     PNHAPHRVCAQSAGIAGANMAPHPPTSPSIPTQSQEHRGSSSMPVARGSAVRPSGSGT
                     AATLALRSQRRVSNATDTRAPSTAAGRHIPHQGGEAGSSSNHNAGGGNGGCGLGEQFA
                     YGSTFGMGSRRNSYSATASDEAHNATFTSLSVYWVTKGNGNTVSPGTSVMGGDDEASA
                     IMGVYSDSRDSTVSPGLLGVTSRGPTTFLAVDGGCTAKTRNSTSQPSKSPLTDRGVAN
                     PAAHSRPPSTAQGAHEPVVLTFPKQSGRKVKAVYPGGYLAPITPPITPKANEAPLPRR
                     AQSNNGSASTPGLGDTVGGKSFTSLAYELPGI"
     gene            453168..454655
                     /locus_tag="LMJF_15_1055"
                     /pseudo
                     /db_xref="GeneID:12982220"
     misc_feature    453168..454655
                     /locus_tag="LMJF_15_1055"
                     /pseudo
                     /db_xref="GeneID:12982220"
     gene            <455966..>459814
                     /locus_tag="LMJF_20_1060"
                     /db_xref="GeneID:5651458"
     mRNA            <455966..>459814
                     /locus_tag="LMJF_20_1060"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682806.1"
                     /db_xref="GeneID:5651458"
     CDS             455966..459814
                     /locus_tag="LMJF_20_1060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682858.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651458"
                     /db_xref="UniProtKB/TrEMBL:Q4QCU0"
                     /translation="MHNGNGNGGFPWRQQQAMYSCRQNPYGGGRPDANVMAVRQQQQL
                     QYYQQQRTQGMWIAGANQMYPGVGANMRNGNLMMQQRRYFGHDGDGMHQYHQHQRQFR
                     RENNVNPTVPQQEGLAESRPGRTPCSSSWWSSVLPHMRLVDSPCGIDLDVEDENANVM
                     EELRKTGSKAGTGMSNDTEVAAPAFVGAFESAKGAGELPQLIPTLALVLSPAVAAGRE
                     ERKSAERDGMQVTNLYQSNAHPQQHPGQSQASLQSRTDGVPPPRQQKPQQHLSGDYSA
                     VAGSLDQQAIGDAEGKEGEHGAGKQSRSAQPRSADSEDSAGGMAGAQPALRKCQSEGE
                     PRTGSAQQDQGTVALRLIHTPRCTIGEHQEPPTLPQAASDSAHDFPRGGARYSYMGGH
                     NEADEEEDKDDGGCNNSDEYSGDSDSDGSGGSSSSSFDSDSEGSDTDDEAECSTMRHN
                     SQSAFGGQSTLEYSTFHGASTSNLPSDAPLIGALGQPHHTTAPNAGIRGVAMSSFSLC
                     HSVIHTPPANAVFAGNSATVHNNSTSTATGTEDSDKHGYETGILMTAETVLKHTNRTG
                     PVGAGAAEGVPSPRTGTPPSTATTLTATKAVPPAATKRKEDAPALPRQVVRRRKSVSS
                     SVKTLAARSGTSATNDASKTAAAPLPGVHPSSKPERLKSGAATAELQPMKGASKSPDS
                     SKAVSSTGKDENPLPTPSNIKCTASVKNKKTAKVATTASERATASVTTTTPIAVQAPQ
                     APPLPTTGTQHVLSKPMNSLRSVQGLSSHGKQRAAPPRLGKAKTAAMAVTNQSTAKFH
                     QPPSAATSTVAPYFATDPPLPTNAGSAAWATAGAASVAEPKPVAQPSATLLRRSPAWS
                     SPDGSAPVPDASPTPLVAARSLSTLSGKVPAGSESITATEKAASTAPFEGTLSDIGSR
                     GDRLHGAVAQSLRINLFRSPQPRPPAPLSQVAGEAAGNPPSSAAAARAAVAHHRLQPQ
                     RPSNASLRELSTAKNALGKKGKAAVARATPPNEATASVPKSSATAGAPKSLSTELLSS
                     IAPSKPTSATATAAVIPPARDATADVTTSSPSMATGTSIPTATVKSLATPSATKNSLT
                     TVSSAAAKPSANGVIKTAVVSALGNTGKQSFPTSSGSNSSAAASTSRGRPPPLSVLVW
                     MNQPKTITKAAAAPPGSLVSVSRDSNTPSHHNNQKLITNGDDDDDAWLDDPYDYYGYG
                     EADLPDSKNYSAVKPSPPKAPASNHATHRHSMVGSLAVSPLNASSTVGKTDAASGAGA
                     RLRPLGNADMLEEMGYMYHL"
     gene            <463240..>464115
                     /locus_tag="LMJF_20_1070"
                     /db_xref="GeneID:5651459"
     mRNA            <463240..>464115
                     /locus_tag="LMJF_20_1070"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682807.1"
                     /db_xref="GeneID:5651459"
     CDS             463240..464115
                     /locus_tag="LMJF_20_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682859.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651459"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT9"
                     /translation="MNHYASGEETSSSQPSFSPSYLLTDAMPVRSRFMNPVDFLSSSE
                     PLMLTPEEKAAEKAEKTRMAALQEDARALAALFARELAKRKAKAITAGVIQARRPAAA
                     AAVPASSKPGRRGGQQQPPLSLPTHSIKLAPVAPKLQRSRHKASVKSEKTQVKALKRG
                     RKLKTSHRPRALAAQRSSLMSRRRGRQSKMPAAASVSMRKPHPPLQRRPGRLPLRLAA
                     AASRKGRRRATSNKLRTLTGGMKRAVTPPRRAVQAPKFLVMRPLSKSTVKAWRLAQPK
                     KRVMRWARHDKRKKE"
     gene            <465477..>472799
                     /locus_tag="LMJF_20_1080"
                     /db_xref="GeneID:5651460"
     mRNA            <465477..>472799
                     /locus_tag="LMJF_20_1080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682808.1"
                     /db_xref="GeneID:5651460"
     CDS             465477..472799
                     /locus_tag="LMJF_20_1080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682860.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651460"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT8"
                     /translation="MAGGTGDGGAASSAGPSSTLTSGMSVSGLSNHLRLSEGLSCLDY
                     HPSFRALAIGSTRQVHVVEVIAIVGHDVAAAVRQHRQRQQQQQQANTYAVTPPDSERA
                     HASLGTAASSDLPASPPPPVGPAPFLMRNTGVFGGLNKVESVAWYPSTEEASLAFIQP
                     ARTVTIFLDAIQFKADGTYLPQQWTRSQYKGKTLTSAMAAGGGSTAMAVVANLDCVSG
                     GITPAASTTSLGGSSGLYTPASASLVSSPSYSAASASQGSAPHETSFSTPTSSGFSTT
                     GFAARNLPHAVRNLKGPLAKELIELNIDITYMRVEKIVWDPHHPYTLALSSPATHFEV
                     WQVPTDGWRVYAPQLVLRPPAHNTRSVVRDIAFSPSNPDLIVVVTECGNTGQVLLYSR
                     RQVEAKRCFDISGPGLSVAFHPIFSDLLAVCFRREKTKPDTRISFLQVMPVGGAAAAW
                     LSGVATAAATAVPATSSEPEGSSLAASSALASAATAPESADASFMTKMVPASTSSYLV
                     EQPYLPHIDNYVCISRIRWRPSSMGRLTEPKRHHYMSFTPSAQALLAACNLPNSTVPS
                     APGAFTWVDLLHSQLWFASAAMTTDTDLSIWDATNGFFPVCVVKHLAPRGDTTTNESN
                     DFAWLNELTLVTIFKSGDVVCTSLLNSLPEDSVMTSAERVQLRAVKQQQQQQLHRLRQ
                     QLDSKSRDELGEPYSKRIAEGEACLAMLPAYVRDPYADLLTTFTVLPTTSIVSDLFGH
                     SYTIRNTNAALRRHYHQMIRRECGQLIRRLAIQVSKEAVLRQQWTSRRHQLPGITPST
                     GPSMSSGLAALQEQRSRRPRSPFTQTGGLRGRATSSQDSNSTPPSPQCRMLTRRCSVA
                     NPSSSTGWRQMPVAAIWGDGTAADAIGLPQHPQWSLEDVSEAGMVSPQHSREPRRHAS
                     NAGAGGGVSSASPHPYLGVHHDGGMEGQSVRDVEASGHVSSPYPEVTHVEEEAAAATE
                     RISCSSSRTSSAVAWIKRLLDSSWREQFSRNRSSEPRDQCIFHSPGRSQVEDTALVIN
                     AGDDRPAVLARVLDVTPSLSIVPSSDDVAVASPPPLRLRQLPPCGAACGSGTYGSSSL
                     GPAQSTATSPISVIPIDNNRSSCGSPHQLAPTALAAQVHAAAAHSFPAYPGASTSANA
                     SVSSACSPQQQRVGSGRGGPSPSSLLLTSSSLGALPSVPGDLDSVGGGSGVVFTQLFP
                     LLNECVRVCSGGGSGGSCKARGKCNRSEEPRVSRFSPSAAKTSAPVASVAPLSVAPAS
                     LDNSLTLAAASAVRHDLPTVLFFSASCPASAERKPETATTSPPLLPLSIPAPVRSRLC
                     GGTVVPTRSANAASQLMPAHAYLASQRVVTVAVESFVLSDAVCGWSYPEKQAEQLAFV
                     RFALEWDMGYELALAMKALRHKRTDAEAAAQALAAADDTAPHRADPMPTAQPRGPARS
                     QTSSREAAAHDPHTSSALPRSLWRSSSSSVGGRQDVEWRPQQRQTTEPYCPQLGGIYS
                     GVAAGRERRCVGNSSARGPPRVRSGAPSAGPTHMVDWGYGVPVPSHEDVDDKVAAMME
                     ENARICERMMGQRWEAGCAGSASGGAHTNRRPSQGGDGSGVDVSGSPAWSSGDAATTL
                     NDAEGVEVGHADAALAAELSNAAACDPRAQWWRAAAHAWRSHHVSFIISITAQQLEYA
                     SLMGDVQYSLVLYILFCLWWRLHSEVAEATYAMALEARARRHHVGSGVSRDSSAGARD
                     RHRAAAPQESSPRSNAGPSHRLHAAALAPGIAVEGEGGGRGGLGASEAAADPFLSTAA
                     PPLRSPSMDDDDVGAGRTRIGLHCVSDVTDSDNGEDATDGKIPPLEEVDELRQLCLFF
                     LRCPLMPLSPNLTSHHLRKQLHPHLRPSASVDTLSSVKGGSTEPGDRAGNASSPVGGF
                     SSIATLAGGGGAPRLTGGSDMVGNLGRGGWLRASASSSLPSRSHNNSSQRLNDTPQAL
                     HRSDNNANGSRAVVRQGAAAGGITPESRNAYADLEGVSGAWMNARNAEDLCATPDYCA
                     PEEWKIRALQWLETYTADLYARQLYVPLNELLLVMPEIFREPTNPVLPRAADIAYEKQ
                     MTYVYCGTCSKAELWSRAQQDAVPAAVRLYELVARRGRHTSSSEEEGDDSNSNSGVSS
                     AKTAISAGMRRSRRKGHGEHQHASAAIRCGSEAHYYRDGGDSSSVATTPSVESPTSSS
                     PSVAADDDGPGARLADGRPASPFCSGVGLPSEHSTNERAASAVDPLHEATPLEKVVIG
                     REPRLDGSSSRASTTGRSHLNAGAAGESAAACPAALLVQCPQSAFASSSRLLPRGQHN
                     RRITRLRSRHSRRSLDDVVDGAPDAERDGGNADEGEESHFAGAGVGMARRPERRTAVG
                     CDGRDANPTANNAACRRCHNRCAMTCVICEEVVEGMFFWLRSCGHGGHVHHMEEWLRY
                     SQECPKCGVPITQTWKGN"
     gene            <474838..>480723
                     /locus_tag="LMJF_20_1090"
                     /db_xref="GeneID:5651461"
     mRNA            <474838..>480723
                     /locus_tag="LMJF_20_1090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682809.1"
                     /db_xref="GeneID:5651461"
     CDS             474838..480723
                     /locus_tag="LMJF_20_1090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682861.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651461"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT7"
                     /translation="MRHYSEHLTDATAAEENGACGEMNGSAGTLCLDHVANPTALRAS
                     VYGTGQRSTAPRHRNAFLEDISNGPKYNVNTARNRARACSCSSRSSAATYDSDVEGSG
                     SPSPRDDTGTCTGKVCLLNPQQTSLFRAPRGETAARYPPEQVVMADGSWLTTIATTSS
                     TTLQKPSLVPSGSTQEVDQQRENSAQARFREALRHAYQCEDAHRQRRRAQLDKQQEQL
                     LRGVELLQGVSFSSSTALLAELLPSRGRDGRRSAGSVKSPISLQPPQPQLGASPLALL
                     ATSVEAAVETGAETIAQQSRAGGASTSLAAEACLSSSCKATTTPQMGDISKRLLQVMS
                     PAQAQRLRRPLNPFIEALLRHYQEAQLKQRAARHAEDQAIHARRMYELPVLTEDVVRY
                     AALLLCLRRRRTGGSGTAVTRAACAGGSGMLPSEPARKEPSSSTSNAEPQPPQTLAAA
                     EPTAALPFGEEGTLLYLKYPPPLLRTTSFAVETVRLLKWLRTWKKNGPSVAGETGGVA
                     GGGSSASVGGVSEGGSSSSRSESRIGRKRVRADVVKLNSRHGNVDNGEDGDDSNDDGG
                     VVVVASPTPVPHGGASSTTNPEVPPPNRSTVERVSQQAQHAVEIQEAQLKQERRSAFL
                     KFFGAAAVTAPTPPPTNDAEWNSKAAQDHDDGNDTAKEVVAQKPVSCSAMSESAGSNT
                     GMRDTAAISVGAMYGITSSVTPISPPSNQTQLKPSTLALASHAYQLYCHAWKNVVKTG
                     ITPLAVAANAFCGPKAVTGQSRLSNGHDNNGGAAATSDKDTSWTDGAVPRVCAGLPFF
                     KEMREEARRTALGSANNGTYYEDAFGNRLRSARLAKKEQEQRELLVARQRRRAKKKGY
                     FHRHDDNDGRLGGRAASNGASAMLEAMLRSSATCGSEGHGAGRGKKRRRGSGDASSDD
                     ASEGEGVVQDTQPHDSSRCAAARRARQLRSRASSSYSSSLKPSSRCSSSSSSSTASMA
                     SGENDEDEAGAKDELTNIAVVSGPTGSGKTAAVYMAAQLLGFHVVEMNASVRRCSKTV
                     EHLLAELTRSYRLSGPRPGTTGGFNAEEELAKLKQQHAVMLERARAEAEAAERTAELK
                     KREALKVNGISVQAVANFFAKGSGRAAVVSSKTAKGIKRKDAAKQVSDVDMVSEAPAP
                     AAAATSSSPQPAATAPGTPVDAGTLLLFEDADVLLGDESAKPFYAAIRDLAHRSKVPI
                     VVAVSSDPAAAQRYDTEPFLALLDGQRQQRHTCSPSPTSALQPTYWQLCDAAGLNSIM
                     ATMEAAHRALQVEADVGNRGASTTTATTITAAAHENNRSPSAVGDNGGRTGAAPVCGA
                     PAASFLPLFSSAGGGGASGSAAPAACAWANGASAGVSTTSASGGGGGPGSTSTATSAA
                     AAAVAARYTHMLLNATLVSSFFGSQTPFTVVDPLPPSALYAQLLAVGAVELDLLRLDE
                     LATSPGGSDSAASLSSSSSQQELERMATRLTVCDTGLFRRLAEHLRHHIFGAWDIADD
                     GAGALVAPPLLPGHNLVNAVQCDAARSTTTDVRYWLNKLQVLLLSLRAGSSTVQMPEA
                     AEAATSSESVTRKRSRETMKTAPSETTSAACGGENAMCDAKVMGARRAEHLVEAEFQH
                     RVSLAASEWDAALGRHLSNVAHNEQHSTRYEHWFLDAHVCYIADIVEELATTDHPTAR
                     VDHTTPLQAPARCGRPPSSSSSGKKLAHANNSERKAAAAPEPTRHPREEASACMTRCT
                     SGSSVDSGSINSAWQSFFAASGASEVSTLSTASPVLRGASPADPRQQTLLGCGGPKAG
                     GVVVGAPPPPSLIIPTRYEWPPSALELRRQACSHAHLRPVELLLPYGAAEAYYGTAAA
                     STSTLASFSIHDMAEPTAALLGHETPLRFPMRHSVRDSSTGDNGKAEEDAGRELPAGV
                     RTTQEERFRVFRKWWCRPRQAGALRDSVAGRSAETLEDIVGFGCLLTPPAAETRNATS
                     GSP"
     gene            <482224..>488070
                     /locus_tag="LMJF_20_1100"
                     /db_xref="GeneID:5651462"
     mRNA            <482224..>488070
                     /locus_tag="LMJF_20_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682810.2"
                     /db_xref="GeneID:5651462"
     CDS             482224..488070
                     /locus_tag="LMJF_20_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682862.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651462"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT6"
                     /translation="MTSASTLLQTSFGDAEENVCLEGRGTLLTGVANRTPPPRAECVT
                     YAKLPCKCAPGPPIVVSSSLRPRSASPATLDAGNHLLTAPLPLQASAPPPSSSTEEVA
                     TSSLPKPPAPTSAASVNEKGDSPFLAAQQFLFSSGASLLHYANPSFYLSLRSGVDANG
                     GGGGTSTSFVEELSEEGQRNLLTSSTVAAALKERYDGVGATAVSGSSTGASGGSVDWK
                     KIDWVRQQCRYTGEALKSLVRTAHDGEAAARRESVSHATNAAAVASPPLPSATSSSTP
                     GSAEVGEKSVGARLMQSLLYPFTQPTVPPTPAVAAPAAAVDDAVTDTVVPHGVGVMTY
                     LLYCKPKTAGYGYPSGGSRSQTAGAGASSSPLLPIPPFLPPDLIPTAYCPPLTDIEIT
                     TAEDGFASSGALAASPVPPVPHLLLLSLIVYEGAFVRGRRHGRGRLTAYGRMVLECTW
                     SEDVPCLAVPWPISQAATSAASPAPTLWNVSAHVWTPTAAKPTLSLPHVSQRAPRACI
                     TNTDGTKAAEARRCSSGAPSGTWSVRATQAYMGSLMLATVASKKLLAKMEACMGSAGA
                     PLVAKAVTDLHGARYVALPVPHPWPSSDGVDLCDAFCGLGWANHVVLLPDGFGEAHFR
                     ADGGLVRSAAPPASCALTVSALGGLFQPPFWVPETSSAALLMCTSLPLPSSCWQYCGQ
                     WSAGLPHGFGAAAERLTDPTAASLALSASTAGAGPPQYPWRSLFLGQYVNGKRHGPGT
                     YHGAQGSEATEVVLCGTWPRHGRSSTAARENEEQTAANVVLLPASFGTGVTRAAGFGA
                     EAAASSPPPPPLSSSFFSVQCVRWSDSGADEVRKPECGSSGCGGGFFPVAKLRQSAAA
                     LSGMWEPLFRAVDDAVAGQSPTLLFGAEEPSGGTKGGCRGDEAAVSDASPSRKALLWQ
                     RACRAIDSFVASPECVAVLSTFHACFAFMYGEDVAAVTAADGATATAVSATVTTPSGS
                     DEAALRLLQRLESATTVASSSSAASRMGYPWCPLHSWCAMGRLGSPSVSLRGTQGGPG
                     FAACLHSGLSDGATHYQPPPTASRLGTRQPSSCTRTACSERSESSAPLRPPLSAAAAA
                     LEPFAAAHTFTHAMHAAAAFVSSLRLRLLSCFAAYPDLCEVVMGDKVCEDKIVQYCWH
                     IIFGYVGSVLVRRATAVAVADVRLVWELLGLKSKRGRKETLTDYFVALRRCRTLTRAN
                     IATMACTDVLEACEAGGHSPLNECARRLGKLLELHATVASSSPMHGTPVNRISSELQE
                     MTTLLSQLHALLGTAGKPSGRVKSSADHLSGSEGEDMAMTATLTLAQREALLRWVLFS
                     AAAGHTAAASFPSRSVVGRHPFAFLLVAHFLLSGRVIPAYPVLVGDSSGCPSRHGLLR
                     LLTDMGRATRELMHTYPSVRSRALLPSPGARIHVWTMSAVCPLDTLALKLEYVLSHCA
                     ALHLCASCRVHLISSGAEGESLSLLQGGGEGGSADERGDTGECSGGAPKDNTIHLSVH
                     SLSHEAHQWCRRELTDRLTAPLLEARLRHYWDRLTPSSAQHSSPNHHPARVDGTEDRR
                     RNDATPPSPLMWWLLLCLQGVLSRPLQPQPVVKPSSGTAPAGSTSMRRRTTQASSQSP
                     RQSCSTALPTRYTWKKFISAVFFSPAEREEWTSAHSPTTTAAACALSLMDSCYVAALA
                     YTLHELAGIELNLRVRFVFEDDDEDEERSTDADRQAASEAGGAGERRGATALAASSLQ
                     MESIRQSQRERKNIFLSSSSSSSSIPLSPPTASPSPGRNLSPDSGVQRAATDAHTGSS
                     SSSSGNGSSHGCSPGDETTAASTQLSTPTRQRLPASQQASRLACTEEPPCDGPPRANG
                     RLRSQSAAVAGSVASPLMGGPVGKEWELTLVLRRGSDDGGEQETAASPKHLFSTLTWE
                     VMEQVCSTVLHQLQATAQPGDAAESKKMAKAKAEKARRRPSKREAISM"
     gene            <489022..>492456
                     /locus_tag="LMJF_20_1110"
                     /db_xref="GeneID:5651463"
     mRNA            <489022..>492456
                     /locus_tag="LMJF_20_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682811.1"
                     /db_xref="GeneID:5651463"
     CDS             489022..492456
                     /locus_tag="LMJF_20_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682863.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651463"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT5"
                     /translation="MPSTAEGKSAAKAFDGNGNTTVERESLEATDEEETTNTYDEPQA
                     GKRKSSESSSSSSNSSSTTMSGGSSVSRSETGSPTDTAGAQLTGGRGASGDGTVQVVM
                     YAKRVTYSYKESQPFPNATTPSSITAAQEQCLPASANTSAAFPEGVSQLLEPVMPTPP
                     RSNFVGGPGGPGRSGLRGAAAYTQLSPPPSAPQTTGGSALYSFSDSYAVPPSTAVNAP
                     SFSTAYPNSTSAGAGYSAAYAPAQAPYHEFTGGLATRAAGPSAAVDPPRKNAEEVPAR
                     RKRRWGAVTDADENQPRRSRRIHIQDKAVEEDERSHEEYTGSSYSDEEGSYSYSGDEE
                     SYEYYEEFYEEEVEEDEEDEEEPRIDIIEGSGHGNTLHDILYGTPKAGANANENYSRD
                     LRESVRSDSPYHTVTEDKQEPPRYGHLRPRHDSDEGEKEDRLRSTSAHSWEAATKVAT
                     AHRRSATPERVSRHHHHHKKSAKGYERTDGEDGENHHHSAAGAGKKHRKGVYEHGEPY
                     TEGTFKAEGRRSKKDKAGGHYGPMADLDDIMEQSTADSGSESNEAPHEPAGKDSRAAF
                     RPLSSSDTEDVDDFTAPSRSLSRNRKSRQLAKEVNKEDRRHHRSGAESMEATRITKLD
                     AKDGGKVIREEEPINTPSQKRADAGDEALSATEHEDGGRSLDRDAKREDKKPKVGLLI
                     RCACCSKEKNTDAKASEENKTKSKCCLFGKGRCCSKEKGSDAKAKEKEDKKPKRGLII
                     TCICCSKEKSSDTEASGKENKTKSKCCLFKCRCCSKEKGSDAKAKEKEDKKPKRGLIM
                     TCSCCSKEKGSDTKASGKENKGAILVNCACCSKKDSGAKDRKDKKPKGGSGGMFSCLF
                     AMCSSTKSTKDQVADKKGKETDEEEEGAKPDATAPSKSLTTSPAESPVYHQSSSQQLN
                     QKSDKVERAFKVSKSRQPKQQEEEEEVTAETSKPASSVSSAAMTGELEDHSEDSASFP
                     PKNAKRGGTQALSDSARVAAAALSQGDSENEASAPVSKKASLQLTPRPSSRSAGQVHH
                     RHSRTGSARAQRGTAAPFTGHSRFHRKPENPGVVIPVDESDEWSVSNSAKAQQQRRYR
                     HRQTRVVEYRSKHRSEKSSRRNRAESSRADRAMLLNEKPRNRSSSSAGRKRSLSAS"
     gene            <497845..>507684
                     /locus_tag="LMJF_20_1120"
                     /db_xref="GeneID:5651464"
     mRNA            <497845..>507684
                     /locus_tag="LMJF_20_1120"
                     /product="putative phosphatidylinositol 3-kinase"
                     /transcript_id="XM_001682812.1"
                     /db_xref="GeneID:5651464"
     CDS             497845..507684
                     /locus_tag="LMJF_20_1120"
                     /EC_number="2.7.1.137"
                     /codon_start=1
                     /product="putative phosphatidylinositol 3-kinase"
                     /protein_id="XP_001682864.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651464"
                     /db_xref="GOA:Q4QCT4"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT4"
                     /translation="MHWTAARGQLSGPQHSQHPAPQASTHASQKQQQQQQQHLHQNGP
                     PGLTAAGMGGGSAGVNISSGASAGASAARANVNSNAFYNSRFSHPMGPLPPAQNQQQQ
                     VFAVSQQPLGAQLQQQQRSPRSLSGPTPNNVAGGNISGLETSATLAGREAPAIAGANS
                     AAAHTSSAAVGVFLSGTRTNFTDFGAAAAYGLGAGGVGSPSGPTANAGSTLADANDEE
                     VNQLLRELEFSVDSPHALAVLRDAVDAIEARALANFDPLSRDTFLEQRIRDVLTELSR
                     TSNERSLLLAVSLIEALIPIAYTSPHSKYTRLCRSLSVLRQSGNEKAAREAQRVYKLL
                     LEADARYPGPESPLKAFVQKELRENCEQALLQLHGRVQQAKAAFPAQFFSIMLGCAAT
                     AEVNPRYISGKTRAQAIQLGTMLTGSPDPLLRKAAYECLVAIFRNTSNMRPNELVLES
                     RRLCDECMRTLNASQHNEGHVVSALKALHALLSSRGLLAIDRQMIPQLCVLVTEQHRV
                     SKSLLVRSAVCDLVPIIAPVDIASMPRRTTYCAIVMEPVKNVRDERFKAHELHNVASF
                     VRSVGYRVLDATNRTNLESILHRYISRPETQEACWSIMAAICASSMSASGGAASVAPM
                     AGRRVDYVSTSTTLPSPTAQNTHQDLSLTPSMVEVRKASQHSSRENLATSPSALQRHF
                     SYHHGDDNDDQASVPLVSARTASQRSGGTCSLSASPTSTNAPAFNLSTFSAHHTVTID
                     DVVLRCLPYLAHAILTESLVDSLRVIQVSCPQLRADVQTALDKLVDSVLKEPFAPSAT
                     AATVTLPQYFSQLPSSTAQQQQQQQTQSLYSRDGGDGSAGGFLSAARNSVSRTAGSHP
                     LSPASGPEPVMTLSRPGTCSTPIGGGPVGRLTQYFRPSESVATHRGEGSTSSPTTTSP
                     VAMRNTSGHLPSGNNSFLGPDSAYTVGGGDSNSGAPYGAGGPLRCSPLSTSMSTPFSP
                     VTHMAAGGSGAGSGNAAAASPPVLKNDLTVALKVFTERPLTSVQHLHDLKNSVIAFQR
                     HEDPLVRQQSSETIISSLRQWIAYAKEHKTSTYSTRVTEILEAYMKNVLMEVDRQCGL
                     YEITLLANATSLRVFLSEQRILSSLLSFLNSTALVREKTVELLVAITQDSKPSPSVVA
                     VQQSLYVTVESCVVVLEYTNDVSMLLRSMADLQTFTRLCIRQLNNHLSRIFYAFRKRL
                     LEVSVPDVVLLSILKTLEIILQALAKDEKTILQHQDDVLELYDPVVEILKQSPSPTLS
                     HAAINVLVYVHEMCIPSASTDLRKQQELITALTHVYTSSTCTVNESLSMLTLFGQLGA
                     IDPSAQSVATTAKKKEEAVIQDEADLELTYDYTVIVYRTLSRMLDASLSDAVCSQALR
                     TLLQFIRFTQDKKDLVGGVHAVRAVLQITKRVTDNPALRVEALHVLAAVTAMRHERIV
                     RLMLPEIVVLLEQLWTPKDRPLFRAVLEVVSALKPGKLSGKEQSESWAWLYPRLVDVA
                     LQDRTESREFCLRVVEIVLNASYIPPHCIPVVFPMLLQFLQQSDQLVDVRSQSLCAAV
                     HIVCELKAVQFFSSLLHGICTLMRHCELNEDLGPRLSTPGVRESLKVLAALHPSGRST
                     IKMLRDRIGEGDERMTNPTGSPIFNTMGLPAASVTSFASGGQGGGLGVANPANSGLGP
                     LVNIGGFGASATGGGAAAAGGAAGGGSYLRLTNMSETFAGAEEEDVGLSLSADTAGQE
                     VDLFMKHVELGFRLKENKLREWFAEFQKYIILISPHPAFRMMVDLLDKHEPLRRGLFL
                     PSFKCLYESLSADQIKKLNEMLTLVLNCSDHELSSKCLGLADYLDHNEPNVKPEVLEV
                     VRAMRRVDCHRVSHPSENGSLLLRSTASSANNVISLRTRSSTSAGLPKAGFSTSSDAP
                     MDALPTAKVRGRKAPVFQRSSNSSAGVAGDESGTAGAEANSGASTALASPKNSANGRR
                     SASHRDVDMSELTSFDGNENDSTESGRQQSQPIGLPMSQAPAQEEEAERRSCSPVDTL
                     DGAESESKAEDVVAPVSTDHPSVEVLGAAGVHVMGSYRPLVNSVVRRCDSNAPQQSGV
                     TSQFHIISTASTHSNDLSSDTRDGDLPPAGAHIPAQPNMLFSTEDIVRAAERTRMYDK
                     ALSYLENRLLAMLNLYRYTKMPREVIHKTVWPLAWLYSQREMQDSVVGLFRAIRYEGG
                     EDQAGFGYELLCWWSKAQNTYSKSITQQAMRDMTVPPHILEGYVRTLTLCGEWSRAYD
                     VAMKVCSRPEAYVSSTVARCGATAAWLLGRWDDVQHLAERLSMSEQHTTALRLFFLNG
                     VALKSAITEHSSAAYENLRHMITQSKLVIDESLRTLLPLSYTHAYESLTMLQHFTEME
                     EMIDYCHCRSTKGRQQIYERWNNRFRSLNPDSLQPSLLSLMLHSLVLSTGEMADMILH
                     FCETRQASHPQLAEWAMSWLRHGSFSGRSSNLCSPSVASPASPGPVEGITVTTLSSAD
                     KNPKVAVGFITHLWSQGKRQAAVESMEMFLRDCGRDLEENNATCYGDAQLRLGTWKQE
                     LHADSFWERGFRDEELGHFHKAIRAVPSSYEAWHSWGLMNYRIQQRDHNLSPEDQRTF
                     VEAAHQGFVGAICRCKDSSEALPAVMRLLQLWVIHNGVELLKETVADSISRIPIDHWV
                     QTIPQLIGHLSSDSYDIREVIGMILRSLCEVHPQATVFPLLVVMMSDSSTSGSNHNAL
                     NNNGDESNIVSCASAMSDSSNPLVRKQEIVQGIIQHCPKRIFHEAEAVARLLVDVSAI
                     PIEKIRENLSQVAAAWNPNAEYEEDPEEVYRRLQNTLDIFHANRRHLLFTVGDIGQFV
                     QMVMEDDRNGQREKAAGVVSQLIEEISKHVAEKLGREPQKAMEPLLHLRNLSVAVFGE
                     YDGHCRDHYPTIASFSSKLDVIPSKKRPRRIQLNGSDGCLYTYCLKGNEDIRMDERVM
                     QLLGMVNVLLSHTRISSSAYIHRFPVIPISSNVGLLGWVENANTINNTICNYRSNISN
                     VRTHQESSVLRAYVGSFGNWDKLSLIQRTEILDFVMQSEHCEAVDVSRAMWHRANTAE
                     QWLDRRTAFTVSLATMSMVGYVLGLGDRHLGNILISMSSGKIVHIDFGDSFDVGRLRH
                     VLPETIPFRLTRMLTNAMEVFGVDGVFRASATRTQTTLHKNRDSIMALLSAFVHDPIV
                     QYKGKMKNIMEKSRSPQDIAERIRNKLRGTEMAIDHSKVNIFNTTQDSCRRPDLLYMS
                     TAFDDTAVRTQSLAMTPEEQVSFLIDEATRIDNYTTMYFGWGPLW"
     gene            <509722..>511683
                     /locus_tag="LMJF_20_1130"
                     /db_xref="GeneID:5651465"
     mRNA            <509722..>511683
                     /locus_tag="LMJF_20_1130"
                     /product="DNAj-like protein"
                     /transcript_id="XM_001682813.1"
                     /db_xref="GeneID:5651465"
     CDS             509722..511683
                     /locus_tag="LMJF_20_1130"
                     /codon_start=1
                     /product="DNAj-like protein"
                     /protein_id="XP_001682865.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651465"
                     /db_xref="GOA:Q4QCT3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT3"
                     /translation="MQVLSIELPILKAGEKALEWPQTQPGPTDDAVAADAPPQLNRWI
                     EAYRIIPLGEAFCRTVALTTQLRHEDARMQQAHADPNVAQQWAAEEVDGTAAGADGEG
                     ANDAANDGVGDGARYQSSSRKKKFVKLADSDMLVDWYEVLKLEQEDGATDDHIKAAYR
                     RRCLETHPDKQQNHSDELFKKVQRAFDILGDPDTRQTYDSSRPFNDAIPGEQVEEADF
                     FSTFGPVFERNKKWSSVPGMPSLGTDKTPYAEVLRFYDRWTGFQSWRDFSHLADLVEI
                     DDTMCREEKRYYQRENARQLSHHRREEQKRIRLLVERARKNDPRLRRRREEDEEKRLK
                     VLREREAFRLQLAAEEERRRAEEARKQKEREEAKAGAQQQAKQAMREAQMAVLGFFEQ
                     HRLLDETPTNKLLADRVRRPNVQWIFSKTTNATEAQKLRDVLLACPTDRRPRTNDPQS
                     KDVEGAEEVEAVMRFNALIQTMEQRCGVNRYGEAVKKVQDGDAAMASAKQKEVTVAAA
                     KAPVDAGQEWTDEDLSRLQKATAKYPPGSVDRWIKICDVLRHRFTEEQAMAKVSELTA
                     ALHNAGTGNPTATAAASPSHASATSTAASSVENWSLKQQKQLEQGLRDLKDYKEKDKF
                     QKIAKMVEDKTAKECFERFKFLCSVNKKK"
     gene            <512677..>513639
                     /locus_tag="LMJF_20_1140"
                     /db_xref="GeneID:5651466"
     mRNA            <512677..>513639
                     /locus_tag="LMJF_20_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682814.1"
                     /db_xref="GeneID:5651466"
     CDS             512677..513639
                     /locus_tag="LMJF_20_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682866.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651466"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT2"
                     /translation="MQTPRTPTINFGPTGGSGSPGGGTAFFGRSDPNAMMLQMGLSYG
                     QNILQKHVQQGEAGLAYYMPFIRAIRNYFAVDNTYVKRKLIMLTMPFLTKYVRKSPVG
                     GESDFGSTGGGAGEATGDQVFGGPAGSPASMYPAVLSSTLAGHDGGGSTFAGPLLPLN
                     DVFASDLYIPLMSVITYVVLAAYIFGANSPTSSVTAASLISTAWVIGIWFFLEVVVLK
                     GVAYALLVAPNPPLLELLALCGYKYVLLCLGLLASQCLPPSRLYSGLFMLYAVLAHSF
                     FTVRVSGMQYMRNDGRVPPRPRVFTYMAALAQVPGSVWLFVRLL"
     gene            <514494..>515303
                     /locus_tag="LMJF_20_1150"
                     /db_xref="GeneID:5651467"
     mRNA            <514494..>515303
                     /locus_tag="LMJF_20_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682815.1"
                     /db_xref="GeneID:5651467"
     CDS             514494..515303
                     /locus_tag="LMJF_20_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682867.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651467"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT1"
                     /translation="MSWNLKGRAAIASLDPPTRYRVLHSHTMTRCANKPLLWVLEELI
                     TLRYLGGLTGPLHTANYFICLVVRLLQICPSVAIVRVMLEQDVHKYLRAAALLIIRLI
                     GNVELQREAMRVGWSDYRKLCLYGSDPAQELAESTSTTAAGAEGVTAGTSRTLASSML
                     PLGHSKRSRAEMEMYRGNSNLASDAQSGESDPANAQVPEPPQYWLIRTDEFTDYLFGV
                     ASPSTASQGKDPHEPSKAPTSPPPTPSSVGASSRTLPGHTFMGLHFPAIIV"
     gene            <515922..>516821
                     /locus_tag="LMJF_20_1160"
                     /db_xref="GeneID:5651468"
     mRNA            <515922..>516821
                     /locus_tag="LMJF_20_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682816.1"
                     /db_xref="GeneID:5651468"
     CDS             515922..516821
                     /locus_tag="LMJF_20_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682868.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651468"
                     /db_xref="UniProtKB/TrEMBL:Q4QCT0"
                     /translation="MQPLDIEQQLRLREAMKTQRQAAEAAPSLSYMHKEYYAAAGDAI
                     TLFGGICAVTGALFLASALLTKTRLANTVRLNFRRSGVSLIPKFVSPPLLSVCMAAWM
                     GLLGVQSVCDTLREVAQQHYRAVKEKNVSALADLSLLHRIHVGTVSPRPLWGLSTEIT
                     TQYPPLMQWIMTPTALLFAAQYAGMVCIWCYMLFCGQPLDAGLMGALLTFFPTFYDAL
                     LLNGNEPDRWPVWVTLVNFMISLICVWSFGAPLVRREYREVMRELQGHTAKALFKDRP
                     EMSNVRAHGGARGGSACKKSKQK"
     gene            517696..518955
                     /locus_tag="LMJF_20_1170"
                     /pseudo
                     /db_xref="GeneID:12982221"
     misc_feature    517696..518955
                     /locus_tag="LMJF_20_1170"
                     /pseudo
                     /db_xref="GeneID:12982221"
     gene            521325..523280
                     /locus_tag="LMJF_20_ncRNA1"
                     /db_xref="GeneID:12982222"
     ncRNA           521325..523280
                     /ncRNA_class="other"
                     /locus_tag="LMJF_20_ncRNA1"
                     /note="spliced leader RNA (slRNA)"
                     /transcript_id="XR_002460232.1"
                     /db_xref="GeneID:12982222"
     gene            522121..523320
                     /locus_tag="LMJF_20_1175"
                     /pseudo
                     /db_xref="GeneID:12982301"
     misc_feature    522121..523320
                     /locus_tag="LMJF_20_1175"
                     /pseudo
                     /db_xref="GeneID:12982301"
     gene            <531127..>534057
                     /locus_tag="LMJF_20_1180"
                     /db_xref="GeneID:5651470"
     mRNA            <531127..>534057
                     /locus_tag="LMJF_20_1180"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682817.1"
                     /db_xref="GeneID:5651470"
     CDS             531127..534057
                     /locus_tag="LMJF_20_1180"
                     /EC_number="3.4.22.33"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682869.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651470"
                     /db_xref="GOA:Q4QCS9"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS9"
                     /translation="MSQDQLNDEGRWTEIEEEAPQEQETPDAPDQAEDCNEAAPTEEQ
                     AEDCNEAAPTEEQAEDCNEAAPTEEQAEDCNEAAPTEEQAEDCNEAAPIEAQAEDCNE
                     AAPTEAQAEDCNEAAPTEEQAEDCNEAAPTEAQADGAADGPVQCQDLGDEEQPQPPSE
                     KTQQAEECPEDVVPLEASETQEHETPGADEADEGERAEYLAQEPHSPQYYLAGSEAQV
                     VPQQAYEEEAPQKYPEETGNNYDAPQHAYEVVAPDNAHAPSMPAPHAAAAAAATPPSA
                     IVKPRTRNVKSVARWEAMEYDLRDGSDDEFELSTCMAPVYEGEGEEGNEDASVFKHGE
                     PDCKGEILSCFDEPNLLYRIIDPKAKTWAFYNDSLQYEMHVQFIFGKHSKLQALENTT
                     LRQNEEGQYVMEVVVYPTETEMFLQGTANGFTSKLRAVPLTEDYHNARRGITEELVNN
                     EVAAIQQVTSSDNAEDVLQACIDSGIPFVDPEFPPCQASLEAGASKPFKPFAWARPQA
                     CVPEEMASQVRLFRANVRPGCVGAGDLGDSWVICSVASVSEDPARLMGMFRHPEGKAA
                     AQREHAVGAYRVTFNKNGWWRSVLVDSYLPVSGGKLKYAKSATDPAEIWPAILEKAYA
                     KLHGSYARICSGDPLHALQDMTGFSTMRFDDSLTDDKASDQLFSDLVHGTAAGYTVIC
                     STPGRGPHDKDQELCEAYAQVGLVTGCAYTILEAKHIESKDLQMVKVRNVWGRGVEWS
                     GNWGNDDAKWDANPDIAEECNFQKAENGMFWMSWKDARKYFNGGGVCFTHQPAYDYRM
                     NCVFTEGVPSAVLEIEVRSPTCFTFVISQDDKRCQVNALEYKPVMISIAEPVEDGMYK
                     VVMNSSANGARPTSDKWMFLQARDVSLIHKLDAGKYIVVPRIMPSDDPVEPVPYVLGM
                     ICDKEVGNGDVSVKFKRLDAGNRVFENFPKFEPELMEVEQPVQYQKRAPGEAFPMTQM
                     GEEV"
     gene            <536865..>539336
                     /locus_tag="LMJF_20_1185"
                     /db_xref="GeneID:5651471"
     mRNA            <536865..>539336
                     /locus_tag="LMJF_20_1185"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682818.1"
                     /db_xref="GeneID:5651471"
     CDS             536865..539336
                     /locus_tag="LMJF_20_1185"
                     /EC_number="3.4.22.-"
                     /EC_number="3.4.22.33"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682870.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1185"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1185"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651471"
                     /db_xref="GOA:Q4QCS8"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS8"
                     /translation="MSHNGTAGEWRELGEEQPTLSSKPQDAAMNTYVTKEADEGERAE
                     YLAQEPHSPQYYLAGSEAQVVPQQAYEEEAPQKYPEETGNNYDAPQHAYEVVAPDNAH
                     APSMPAPHAAAAAAATPPSAIVKPRTRNVKSVARWEAVEYDLRDGSDDEFELSTCMAP
                     VYEGEGKEGNEDASVFKHGEPDCKGEILSCFDEPNLLYRIIDPKAKTWAFYNDSLQYE
                     MHVQFIFGKHSKLQALENTTLRQNEEGQYVMEVVVYPTETEMFLQGTANGFTSKLRAV
                     PLTEDYHNARRGITEELVNNEVAAIQQVTSSDNAEDVLQACIDSGIPFVDPEFPPCQA
                     SLEAGASKPFKPFAWARPQACVPEEMASQVRLFRANVRPGCVGAGDLGDSWVICSVAS
                     VSEDPARLMGMFRHPEGKAAAQREHAVGAYRVTFNKNGWWRSVLVDSYLPVSGGKLKY
                     AKSATDPAEIWPAILEKAYAKLHGSYARICSGDPLHALQDMTGFSTMRFDDSLTDDKA
                     SDQLFSDLVHGTAAGYTVICSTPGRGPHDKDQELCEAYAQVGLVTGCAYTILEAKHIE
                     SKDLQMVKVRNVWGRGVEWSGNWGNDDAKWDANPDIAEECNFQKAENGMFWMSWKDAR
                     KYFNGGGVCFTHQPAYDYRMNCVFTEGVPSAVLEIEVRSPTCFTFVISQDDKRCQVNA
                     LEYKPVMISIAEPVEDGMYKVVMNSSANGARPTSDKWMFLQARDVSLIHKLDAGKYIV
                     VPRIMPSDDPVEPVPYVLGMICDKEVGNGDVSVKFKRLDAGNRVFENFPKFEPELMEV
                     EQPVQYQKRAPGEAFPMTQMGEEVM"
     gene            <541963..>544026
                     /locus_tag="LMJF_20_1190"
                     /db_xref="GeneID:5651472"
     mRNA            <541963..>544026
                     /locus_tag="LMJF_20_1190"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682819.1"
                     /db_xref="GeneID:5651472"
     CDS             541963..544026
                     /locus_tag="LMJF_20_1190"
                     /EC_number="3.4.22.33"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682871.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651472"
                     /db_xref="GOA:Q4QCS7"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS7"
                     /translation="MTAMNGKVDEFDEGSVVRKKYGPNDYRYGEPVYKGDATPCFEDG
                     LLFRIVEKSNNRWSFYNDTTHTQMNVQIVFGRNSSLRALENTEMVKLENGSYRATVTV
                     YPMETELFVEGQVNGFTSSIRALPLTEDYLKDMARQDYEFIKQETATLYNAVDKNATT
                     DNMVCKCVQSKIKFVDFAFPPEQKSLQIGSLMKLKVLAWERPGMFLSDENARQARLFR
                     NGVHPSNIDEGDLGDSWLTGAMAALSEFPDKIRDIFRHPESVEQGQKERECGIYRVTL
                     NKNGWWTSLIVDDYLPVAGGRPKFARSKGDPAELWPSILQKAYAKVFGGYGFIVAGDP
                     LHALQDMSGFPCSSFDNAFVESTINETYELFAHLKNYSDLGYQLVFTTPTREAIMTAR
                     GAISCGSPVQAERVYERSSLLLGHTYSVIRVGYFEEHDLRLLQLRNPWSQSSSDWNGP
                     WNKRDENWNKYTEVADYFHFDSSDDGTFFMEWTDVQDYFVSCGVCFIQSPTYDYRIRG
                     TFFQNVPTTCLEISVTRPMLINIILSQEDKRGTDKSENAPIMISVAHGMGAMTPMRVD
                     LNSGFDNDHPSPEYAFLQSRDVSMFYEFKPENSPYLVVPRAMSQFAKLPFTLGLLCPY
                     EIGKETSEVRVAFRALAPENRIFDNFQKFNCETVATETEFQAKGPKQFFPDIYVGTII
                     QTSDD"
     gene            <548104..>550335
                     /locus_tag="LMJF_20_1200"
                     /db_xref="GeneID:5651473"
     mRNA            <548104..>550335
                     /locus_tag="LMJF_20_1200"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682820.1"
                     /db_xref="GeneID:5651473"
     CDS             548104..550335
                     /locus_tag="LMJF_20_1200"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682872.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651473"
                     /db_xref="GOA:Q4QCS6"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS6"
                     /translation="MFDEFREDSVEPLPMDASKSSPTPWVNWGPSIDGEATPCFKGGF
                     LYRIIDSKKKVWALYNDTFVYEMHATFIFGPVSNMEPITASLSASESGGEVDERNRVV
                     ASVEDNELTISMVVYPMETIEFARGDKSKYRCHFDGKPLSKEYLQREIALANTELERN
                     KMTLARFTHTSTDPEDVLALCKKHRLVFIDPSFPPGQHSLDGDRGLIAPSGWRRPEAY
                     LPLALKGQIRLFRHRVTPSATQRGELGNSWVVSAMAALAERPDYVKDMFRHPISSEET
                     QRDEAVGAYRVWLNQDGLWRSVLVDSYLPVVGKQQRYARSANGPCEMWVSYLEKVYAK
                     RYHSYSNIAGGDPLFAIRDFTGFPTSRLDARFRECATDPVKSDMFFLRMVRDYENGHL
                     VLLSTPGSGDPRSAHSTYKEKGIFVGYAYAVLEARAIESPTLRRKKVPPLRLLRLRNA
                     WEAATKWSGKWSDDSSMWQAHPEACVAFPQHSGKDGTFIMEWSEVLGIFVGCGVVFNH
                     FGYTDYRIPFEFRGSVPDLCLEIHVTEPTTLTLILSQPDSKGTVRESEDYNPVMISIA
                     CASSAKTSPVSQSGSKRSSGTSSHSMMTASTQLVARDYSLLVNSSADAEAPSKSFTFL
                     QGRDVSAICTLVPEQSPYLVVPRLLVQQSSGSNGTRASSAAVASASNSAVTWPCVLGV
                     LSQLAFTPNGQAHVHLRKLPANSLVFDNYLSFANDSVEVAKTFYVKRSGTSVVERSAS
                     ELQ"
     gene            <555012..>556256
                     /locus_tag="LMJF_20_1210"
                     /db_xref="GeneID:5651474"
     mRNA            <555012..>556256
                     /locus_tag="LMJF_20_1210"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682821.1"
                     /db_xref="GeneID:5651474"
     CDS             555012..556256
                     /locus_tag="LMJF_20_1210"
                     /EC_number="3.4.22.-"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682873.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651474"
                     /db_xref="GOA:Q4QCS5"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS5"
                     /translation="MAAVAEHTHHLLRMFRHPRSQQLGAAEQLLGAYRVTLNVRGWWR
                     SVVVDDYFPMTEGSSYMNCAHSHRDVRELRVPLLEKVYARMRGGYSNIITGNPLMALR
                     DFTGWPCTRYDIAHFNDISVVSSSFASRLMRYDRYGFQVILHTAPRFDPDGMMLQTDV
                     ATSRAEMSLPSAAEASGRGACTEAGAVHGLLADMVYPVMRILRFNADSFYAELTLLQV
                     RNPWGAIAAWKGKWRCGSRLWEQWPQIAAACDMQECLHRDGSGGMISSRHDLRDRCAA
                     PPAPQTATTAAGATTTACACRRNQYIWVEWSGVYQHFSGCGVIFRLPLHHDYRVKGVF
                     DTTCPSVWVRVSVAACTFIGAMLSMSDTVGDRSLAATDTEDASTYPLIMLTLAREEVG
                     VLHVVRNSQADPDNPTTRFSFM"
     gene            <557906..>558346
                     /locus_tag="LMJF_20_1220"
                     /db_xref="GeneID:5651475"
     mRNA            <557906..>558346
                     /locus_tag="LMJF_20_1220"
                     /product="calpain-like cysteine peptidase, Clan CA, family
                     C2"
                     /transcript_id="XM_001682822.1"
                     /db_xref="GeneID:5651475"
     CDS             557906..558346
                     /locus_tag="LMJF_20_1220"
                     /codon_start=1
                     /product="calpain-like cysteine peptidase, Clan CA, family
                     C2"
                     /protein_id="XP_001682874.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651475"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS4"
                     /translation="MGCFNSTDAVADQDPASGYMYTKPNAKGTKEALFGGLLYRITDE
                     EEGGLAFYNNSKDYEFHIKYLFGADSELNAVGDTKLEMQDDGILAEVVVYPLETKPFV
                     QGTIDGYETKLEALPLSEEYFALHPEIDEAAYYRRLEAPKSSRF"
     gene            <561022..>561423
                     /locus_tag="LMJF_20_1230"
                     /db_xref="GeneID:5651476"
     mRNA            <561022..>561423
                     /locus_tag="LMJF_20_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682823.1"
                     /db_xref="GeneID:5651476"
     CDS             561022..561423
                     /locus_tag="LMJF_20_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682875.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651476"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="PDB:1R75"
                     /db_xref="UniProtKB/TrEMBL:P84150"
                     /translation="MGSRISKEAAPVTFKNGKPTVKGTKTYPMFSNILYRIADTEARR
                     WAFYNDSKELIIHVAVLFDYDSQIVPLGDTTAFRIDDPDEGNEDDFGKYLCEVDVRPL
                     ETQMFVEGSVTGWRVDTLEARTAEDERGYRL"
     gene            <564823..>573093
                     /locus_tag="LMJF_20_1240"
                     /db_xref="GeneID:5651477"
     mRNA            <564823..>573093
                     /locus_tag="LMJF_20_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682824.1"
                     /db_xref="GeneID:5651477"
     CDS             564823..573093
                     /locus_tag="LMJF_20_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682876.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651477"
                     /db_xref="GOA:Q4QCS2"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS2"
                     /translation="MPAASPPTWPVRHHADSPLRMVLSVPDMESLDEITDEDVQELLL
                     AMASPTGSHGRVLRLTDVEALAEDDPVAPYSAEVAYTREGQPAQQQRPQQPPLVAPGV
                     YAAGRSRRVSLPQDPMPSPMTTEFHSTFPCSRRRTSVASPLQQNTPLSKSNMFAEPNN
                     TTLASRSSTLTSPLSTTLGSPTNTQDSRVECRSEASPLPPSPSASQALPRLVPISDTE
                     VLEAELHRWDSQLVQECWLHQELHGVRWDEELLLQHGAAYRPRAIASRTTVSMTHSKR
                     LCIALNVETSVVENAEGALSDEKGEGGGGEAAGMPSMSSPEAEAWSPLFMWRSPAFIL
                     GDSSAVLAQLSERLSEQYKGLAPRPLPTTCCANARPSDLIQALSDARKDAGNAKVIFH
                     YVARGVPPPRGGNLYLMNVGPSATGYAGPPYSKLSLDTFRSRVGFPLVFVADCAEAGE
                     ILNYYIRMCEEQHQQRYFTSSREYQLMSSRQVSEVEMDAPADSQASRINSNYDRVGSN
                     LDTVPADSLHCGGHFGAGGMDSAAPPQSTILQDFYFIGATGCTDSGNGGASGSGSSAM
                     RSRMGVGRGDAGMMGVGAAAGGAAGGGRAVCDGDAGALRHHPRLPSDILTSCLTTTLR
                     MAILWFVAERPELQALHPLILHLFPGTLTDKKTPLGQLQWYLQCITECIAWSTLSLPQ
                     YSRLFREDVYVAPLFRGYLLAERIIVGGLGGCLSVYPPVPATHSHRLWSTWDNIVERS
                     CVSLLRAVRPAPPHCASVLEFRSWLDVQVTSWKYSRPDLLAAEVSNAVPAAAASPGAE
                     AQTSCLPSLPDDAAVVIPPFLAEELLGLQAMLDGITQQSFELPRAYSAGVWGLQPRSS
                     TSAAWGGTSTTAPGADGRDEAGEVGREKRRPYVCPTSGRVQGRNGRGAAARVPLSSVA
                     DQYVNSLQSSYPRVPQQPQQGTAISPPSDGLARLTVASRSSVALPNSSESAAAAAGLV
                     WDRHTQSTTAAFPPRASNRCQDSRKQRPTAPEGAVAVTSGVPKRAESRATVTFGGYQR
                     VSNAHLSRLSNAAAMAAVPAASAASDEVSVLHTTALSRAVTQGPPVHVGVRKTEYITN
                     LFTSTTTSGQAASFHYTADLYRPADALESTAALGNLYSCSSTAATATAASEAHPPQQT
                     FPFMERMPSLLQALLVAAHRERATELVCRLVDCGPAAVLQCAEANIYRLVLDRYWTRP
                     DLRFLMPATLFIYCKSCYADPELIGSAKQREVAVKACAEILQCPVEVPPSTSSAGGDE
                     VPGAWQSNVLGPYATPYGQRMMAASLLTLIALHSDDGREACHQRGVFQLCCQLLQQAQ
                     EEAPLWLAATEASTAPATTPGATAALPVPRVLSFSQKLHVSSPPPALRLQRPATPLCE
                     AGDEPPHMAPPPVFIATTYHLTLLTFFVSLLCSWKLPVTTPAAEEEDHNTEREEEGVS
                     FGSSPADVGTSFPGAAPTDPPSLSPPLDGTVQDVPQTSAEVLEAGLHAAAPALLHFMY
                     SDTSILRGAAQRCFMMVLISPAPSQASRARYAELQLHRLHGLPVRLSEMNTDLRLEAT
                     RMAYTAYRWLFAQLREDIPVEEIGQYVAQWMYRWFRLAAKGKPPPPPSIFGDKNFCRG
                     SGQQTSLRAHGSSAPSPQHQQQVAHSVWAPPTVSVSYHGPHVVTPGSISSHCRSNVLV
                     PAARSARVGMVSDSATGGGIGSVVLGGGLRHHVMPQDHRRLQAYLPPLSNLVRLFFEH
                     TQDTCPYVRTYVRRVVLEEFSFLRQSWYDDYTVMDPQRRTSPSPVAEEDDYSGAGRHH
                     YPGHQRRQRHASGSRQSYRHIDRHHGVSGESGPGCGGEELEASSAVSGGGLATYLPLK
                     QLFHVREETAHGGGPAATSLFGMRTMGASPMPMSSDFEVGHWSVAAAAASAGDVEDVA
                     EPHPAVLRRFIVRLLRIASSNSAEGATASPMSPLRPHSHYRIEAAGAVGGKEGDEVDG
                     GGGDTRQKRRCGVRGLRCSGEMEVGQGGFAVRTGARGGTSSTATTRRRGAGDRGVGPQ
                     DGDDYFASELQVGSEGVVGGSGMASMLLDAEAFALHPLWTLDSTAMMNFAYGALSFLE
                     RFMLEETDDSDPRHPMNLEKENALYEYSQRVECNIRASAQEAAAGVVDGGRCSGAPLL
                     AVRDREQLSRTAGSTAPLPTALRAYAPFQCIGVGDIGRAGVPGCGRRGASASSSSPDS
                     SATRCGGGVGAAALSLSRVAGNVDVILFHPSEPMLVTSTTGGLLSVWSYEPAGKAAAD
                     EVEATQDAANNDRGEDGYERSVTARGPRRGPISSLRALEARAQYFLRDVVGRANSAMA
                     RVAQPRYMYDRYNPHGQVPARRAGGAIAAAKVELEARRLSRTVYGTGKDVSAAAYRRD
                     EASGLGGGGSRPGMWMERAEAANAAAALPSSYRHGHLHYYHGVGDLHLVDAAYRPLLC
                     AVRRTGAVEMFSDFADRREVRRVTTFETMPLDQREEQHHCVSSYQPPTGLLYVSTQDG
                     GVSAWDLGSEQRLAVSGRFSSAAEDSAAVSALMAHPCTPYEYVVGSYGMPVCVFDLRD
                     GVTGAARRGMSLPSLRCGIRGGLVSPFCLRVSYSRRYPNAVVAGYADGTVAVWDRRYA
                     KQPCILFGAARDSPYATDLTSSEGHAASAVAPRMIRQLDTHPSSKLFLTLMTTPSSLQ
                     LVQPWRGDGRAGLAHTDGAGGSLLPHEGPLKRPTTSLLHQFSLDNGSSEDTNDGSGGG
                     SSGPGAACFHDFSPVLGVGVGSTVQLYGTLHLTSAAAYLERGLA"
     gene            <574520..>575230
                     /locus_tag="LMJF_20_1250"
                     /db_xref="GeneID:5651478"
     mRNA            <574520..>575230
                     /locus_tag="LMJF_20_1250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682825.1"
                     /db_xref="GeneID:5651478"
     CDS             574520..575230
                     /locus_tag="LMJF_20_1250"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682877.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651478"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS1"
                     /translation="MPIESYLVSVPTSPASSPTVSTPASSYSASVDDYEVENTISLQS
                     GKASAVGPAERSTGSEAESSAATLTTENVSVVNTPQRDDEQHAEELITLNGQQHQLTS
                     IAREESQARFMVDESSPYVGPGPAVEFPINHVYRCFDVENGLLFRLVNNKRHIWAFYN
                     DTSEYMMRISVTFGPESSIKALGSARQVSFDKETGQCQLMLDVAPGETQNFMRGEYNG
                     FYTCYDASPINVATDVDA"
     gene            <578399..>580933
                     /locus_tag="LMJF_20_1260"
                     /db_xref="GeneID:5651479"
     mRNA            <578399..>580933
                     /locus_tag="LMJF_20_1260"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682826.1"
                     /db_xref="GeneID:5651479"
     CDS             578399..580933
                     /locus_tag="LMJF_20_1260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682878.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651479"
                     /db_xref="UniProtKB/TrEMBL:Q4QCS0"
                     /translation="MGSGFSRASAGDTSAPLPPCPLFYNFMPDNRLIPASTLPMRGPG
                     ESLRRPQGGCAARVIPLRSLPVVSEKSRKDAKKIVADAKRNKKRGGDSTADEVEARVV
                     AAANALLRNPSLLPSLSSCFLLNIAVDEQGRLVPLLTNDGHAVDTMVGFNDTGAGGPG
                     SSRWNPLKSPRSSFVKKGFNFFATNSPVRTPMFPGAASNRGDSLTSGAERPSQAGENG
                     AAANQLVSTLLPPATAAVNAVGRPAGAAPPPDPPSPQCSEGQPKQRSRIKKGGDDGAQ
                     PALPKAPEKLISTFAIAPTPSSSVGPARVVCDTTKDDEQDVSLATPSVCSVLVKDSHF
                     RKSEDGQGGASASVAPALSNGGASGVDGVSPKRMRRKLSRITLLRASERTQWLLFNDS
                     GTHEAQVSALLCYRAQKERSASPMKPIAGEKAPMKPSGKTETASTPAPGDLRVLCRPT
                     PLSHTSLPTKKGKLHLQGMTSSSRRYVEVRPVLVEVFTAAIPAPTTPVEEHQLEEFKK
                     SVASAAAVEVFVVLAPGETVYLAEGDVLGYRLDTLLVPFDTSRSMAVLGRMLTPKMVC
                     SLKKKSEAASKKGYRHTLIFLAKAVAPAVGAAPAHAPRSGPAVARLTGSAMATLPKAA
                     TSRAPKHTHTIPPLSSDTLNAAPPNPGHSTVFEAPTEALTDALRSVDDAEATTSATPP
                     QHPPPSSLPAPETAAKGKAAAAAAAAAAAAAAAAAAGGTGAQRRLSLRSHCRKGEASR
                     NGENHCVEAAGNPYSLGAPAIVPSTAAAASPSLGGGAATLPAWSAADAKAALAGRVRS
                     AAGVPALDIKSLAASSDKDGSPPRGDASLEGSEWKSTGANSLDIAF"
     gene            <583251..>583820
                     /locus_tag="LMJF_20_1270"
                     /db_xref="GeneID:5651480"
     mRNA            <583251..>583820
                     /locus_tag="LMJF_20_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682827.1"
                     /db_xref="GeneID:5651480"
     CDS             583251..583820
                     /locus_tag="LMJF_20_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682879.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651480"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR9"
                     /translation="MGCGSSAPKADTSATNEEVRALSVDMKTHFATIDPEVLGPHKEA
                     AKAKLAFMYGKTANIFLLTTEPFHKPHHQPKPDGEEHAAEDDEKQASAVEEIRWTLFN
                     DSKSDATVEATFFRAAALRPARAHGATEDSESPVMLELSDGGCVKAKVSVPAGATVAF
                     VEGPIKGYMWKCMVLDPKTNRFEPAVAAE"
     gene            <586537..>586995
                     /gene="SMP-4"
                     /locus_tag="LMJF_20_1280"
                     /db_xref="GeneID:5651481"
     mRNA            <586537..>586995
                     /gene="SMP-4"
                     /locus_tag="LMJF_20_1280"
                     /product="putative small myristoylated protein 4"
                     /transcript_id="XM_001682828.1"
                     /db_xref="GeneID:5651481"
     CDS             586537..586995
                     /gene="SMP-4"
                     /locus_tag="LMJF_20_1280"
                     /codon_start=1
                     /product="putative small myristoylated protein 4"
                     /protein_id="XP_001682880.1"
                     /db_xref="GeneID:5651481"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q5SDH3"
                     /translation="MGNKQSHAVGEFRYSGPTDDFPYDEKVPLFEEKNGLLFRLVNNQ
                     NGSWAFYNDCKRFEFHVKVTFGPNSRNLQALGNTYLAEDPDGGWVAKTIVYPGTTEPF
                     IQGEVVGFNSVVNAVLLTTEYKERRKEEKRAAKKAAKEAENGDELGSSTR"
     gene            <590424..>591266
                     /locus_tag="LMJF_20_1290"
                     /db_xref="GeneID:5651482"
     mRNA            <590424..>591266
                     /locus_tag="LMJF_20_1290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682829.1"
                     /db_xref="GeneID:5651482"
     CDS             590424..591266
                     /locus_tag="LMJF_20_1290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682881.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651482"
                     /db_xref="GOA:Q4QCR7"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR7"
                     /translation="MEKAKEIQSKLDSLQQEMHAKVEACDVKYSKEKNAIFAARRAVI
                     AELIAKKEMPANFWALALIALLQMKDRESTTTPHFLGPYDEELLKTYLEDIEVLYTEK
                     GHRITLRFKPNPFFEETELWAQASEIMNHEAGEEDEMPPAEESWGFSGVTWKDGHGPQ
                     LDEDEEEEEDGAPGKKRPHPSSGGLDASASSLTQGPSVLEVFSEMPPHPEEDEEMDEE
                     DDDAVADAIEEWEEEMADRKMLLRMVELFVHYNPVSALRDAGAATTGVSNGEEATAKK
                     AKVE"
     gene            <594049..>594459
                     /gene="SMP-2"
                     /locus_tag="LMJF_20_1300"
                     /db_xref="GeneID:5651483"
     mRNA            <594049..>594459
                     /gene="SMP-2"
                     /locus_tag="LMJF_20_1300"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682830.1"
                     /db_xref="GeneID:5651483"
     CDS             594049..594459
                     /gene="SMP-2"
                     /locus_tag="LMJF_20_1300"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682882.1"
                     /db_xref="GeneID:5651483"
                     /db_xref="GOA:Q5SDH4"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:Q5SDH4"
                     /translation="MGGSNSTNRKIIYKNGRPTFKGDEVVKGFERDNGLLFRIVKRKK
                     GHQTWAFYNDTTQYNMRINVTFAAGCELTALGHTKVVKGERGEWVATVVVMPGKTEMF
                     VEGKIEGFKSNMDAYPVMSDGNGNRLAAGGAVAN"
     gene            <596447..>596842
                     /gene="SMP-1"
                     /locus_tag="LMJF_20_1310"
                     /db_xref="GeneID:5651484"
     mRNA            <596447..>596842
                     /gene="SMP-1"
                     /locus_tag="LMJF_20_1310"
                     /product="putative calpain-like cysteine peptidase"
                     /transcript_id="XM_001682831.1"
                     /db_xref="GeneID:5651484"
     CDS             596447..596842
                     /gene="SMP-1"
                     /locus_tag="LMJF_20_1310"
                     /codon_start=1
                     /product="putative calpain-like cysteine peptidase"
                     /protein_id="XP_001682883.1"
                     /db_xref="GeneID:5651484"
                     /db_xref="GOA:Q5SDH5"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="PDB:2FE0"
                     /db_xref="UniProtKB/TrEMBL:Q5SDH5"
                     /translation="MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKK
                     KKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFI
                     EGRVNGFKSKMDALPLSEEYRQHQAEKDK"
     gene            <601836..>602888
                     /locus_tag="LMJF_20_1320"
                     /db_xref="GeneID:5651485"
     mRNA            <601836..>602888
                     /locus_tag="LMJF_20_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682832.1"
                     /db_xref="GeneID:5651485"
     CDS             601836..602888
                     /locus_tag="LMJF_20_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682884.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651485"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR4"
                     /translation="MGASSVFYDGADNATQHAPYGPGALSGGWGDGAPDPSLYSWKAD
                     PSRNRPPPYMQPSLSGLRGNGESSLPQNAKRVETASRPIEESGGGNSTSGDPKGGTTN
                     TNWLGGPAGGAIPDTLERATLQHAFGTSDFSMVDRQQLTLTRLIQLMLDATLKPRDPD
                     SRGLGGDGATKLAEQREELKLMDQRVVPFQHDDVMNDYLKNIDRLHSPSGALCQRDVL
                     KGRLVGLLFFTESERSLTFMRYLQRFHKRHSPDFVVVAVSLAAKEMMDITRSFGFFHC
                     THRDGASWVSRDAGLILRPFVALPRLIVVNGTSGIEVTRGGVTAVMANPDTCFQAWRR
                     GEGGYRYRDWLKSMYM"
     gene            <605434..>606588
                     /locus_tag="LMJF_20_1330"
                     /db_xref="GeneID:5651486"
     mRNA            <605434..>606588
                     /locus_tag="LMJF_20_1330"
                     /product="kinase-like protein"
                     /transcript_id="XM_001682833.1"
                     /db_xref="GeneID:5651486"
     CDS             605434..606588
                     /locus_tag="LMJF_20_1330"
                     /codon_start=1
                     /product="kinase-like protein"
                     /protein_id="XP_001682885.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651486"
                     /db_xref="GOA:Q4QCR3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR3"
                     /translation="MSVASQHRQSDSAERDEANVKNAPKVASEAEIHRRNVVFAEALR
                     CACIVMRVGDDPGYIWTPQRLGAGSFGTVTLAYRHEGDAVWRKTAVKRISLRKETRLS
                     AVLEKVRCTGREVALCRRAGVSPHVVPMYKPWFDCREGVIALPMDAGDFSLEQYAVHC
                     GFRFPPLALLSMCAQCARAVAHLHRRGVVHRDVKPDNFVVNVFDTVGGAGAGGDGDCG
                     EARPPFVRILDFGLACGVEEVEQELKRCVGTPHYMAPETFSHLCDCDVPAACDVWSLG
                     VTLFRLATGVFPVFEVDKTWQQPPFTELHSGKLWLPSRNLFHEPLSAESLAVLSVAAS
                     MLVLDPRCRPTADAALLQLQGFQEAFSHQIQSWPPGSAPQPCRVLKRTHK"
     gene            <608417..>609361
                     /locus_tag="LMJF_20_1340"
                     /db_xref="GeneID:5651487"
     mRNA            <608417..>609361
                     /locus_tag="LMJF_20_1340"
                     /product="kinase-like protein"
                     /transcript_id="XM_001682834.2"
                     /db_xref="GeneID:5651487"
     CDS             608417..609361
                     /locus_tag="LMJF_20_1340"
                     /codon_start=1
                     /product="kinase-like protein"
                     /protein_id="XP_001682886.2"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651487"
                     /db_xref="GOA:Q4QCR2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR2"
                     /translation="MCSPIADNADMIVPSADTCCPNTVFERVLRCACIVMRVGDDPGY
                     IWTPQRLGAGSFGTVTLAYRHEGDAVWRKTAVKRISLRKETRLSAVLEKVRCTGREVA
                     LCRRAGVSPHVVPMYKPWFDCREGVIALPMDAGDFSLEQYAVHCGFRFPPLALLSMCA
                     QCARAVAHLHRRGVVHRDVKPDNFVVNVFDTVGGAGAGGDGDCGEARPPFVRILDFGL
                     ACGVEEVEQELKRCVGTPHYMAPETFSHLCDCDVPAACDVWSLGVTLFRLATGVFPVF
                     DQDVTASWPPASASSARLGVPRLRSPWPRVVERCPAPW"
     gene            <612247..>615246
                     /locus_tag="LMJF_20_1350"
                     /db_xref="GeneID:5651488"
     mRNA            <612247..>615246
                     /locus_tag="LMJF_20_1350"
                     /product="putative coatomer beta subunit"
                     /transcript_id="XM_001682835.1"
                     /db_xref="GeneID:5651488"
     CDS             612247..615246
                     /locus_tag="LMJF_20_1350"
                     /codon_start=1
                     /product="putative coatomer beta subunit"
                     /protein_id="XP_001682887.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651488"
                     /db_xref="GOA:Q4QCR1"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011710"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016460"
                     /db_xref="InterPro:IPR029446"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR1"
                     /translation="MAETAVSSQEESSTLLVGVGKAASAMSSKEIKNALEKGDTTARA
                     NALMAIIRLHVNGEPQNYLIMTVIRYITPIDDHLIKKLVLYFWEVVDKRDADGKLLSV
                     IILICSFLRSDLLHPNEYVRGLTLRFLCKVNEVELIEPLVSAVVQNLSHKVAYVRRNA
                     VLAVHYISKKFPKLLPDAPELVESAIRTETDVSTCRNGLDFLAAFAPERAASYLSDFR
                     DSHTLSAVDGPFLMSVVEFCRQMIRANPYEKARYVPVLFSVLQSKSAAVRYQCATTLL
                     SLSSSPTAIRQATLTYVDIIKVHSDNSVRLIVVEQLNQMRGSYLYVLQDSLLDILSVL
                     QDGSMTIRERVIELAVELVTRRNAETFMQAMRKELLRTNSVDIEVEDANAAMAYRLLI
                     IKAINTALLRHPPSAPSMLPVLLDYLCDTTSTSREVITLIKEVLLSQPELRRDTMKKL
                     SEIFPMMTSGPVMRTALWMFGAYASSADEVLQTLRMLKDAVEPLPFETPKPVLGDAVS
                     LSTTAATNNASSQSNMRAVTTVLEDGTYVTTYTTATPAPAATATNGHGEGDSNDVSSS
                     GLRLALLKGDYFLAAALASTLTKLVVQLFTGEAKGSVDAATCNTAQSDALGILREVLR
                     YGTEADSLHPISADTNEHLLLNIELLSNPQAPFMVDVSHASLEALGRAERRSARESGK
                     TDGGGAATASAAAAVQLNAIDTPVVFSQLREGKDAVFEFEAAAEGPGAAAKEESSERK
                     AQLFLKKLEDTMPLSGFNDPVYCEASITVHQFDVSVDWLLVNCTSKQLTNLTIELVSL
                     GGMKLCERPQTYTLDPHETIAVRTSLKVSATESGVIYGTVLYDAPNNQHCSFILNDIH
                     VDIMNYIHPGPCFSAEFREKWGIFDWENKIAVSTTKRDLTSLVRFIVQELNMQLLEPY
                     EVEQQEEQDPELELLPTSEENEKCAYVSCNLYAQTAFGEDALANVSVESDGKGLVSGV
                     IRIRSNTQTIAYGIGEKLNMLQKSGKL"
     gene            <616414..>617634
                     /locus_tag="LMJF_20_1360"
                     /db_xref="GeneID:5651489"
     mRNA            <616414..>617634
                     /locus_tag="LMJF_20_1360"
                     /product="RNasePH-like protein"
                     /transcript_id="XM_001682836.1"
                     /db_xref="GeneID:5651489"
     CDS             616414..617634
                     /locus_tag="LMJF_20_1360"
                     /codon_start=1
                     /product="RNasePH-like protein"
                     /protein_id="XP_001682888.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651489"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q4QCR0"
                     /translation="MSVGTAAISLAEVRAVQDGVANDVREDGRTLLQRRPVHITARTS
                     PSSLATAAAGDAQESYDGSYVEVNASGTVVLAAATPSVVDGCATAGPNSSAGTEHERT
                     SDTGRGKLHITIDAVPHVLDTYASAVGGRNVGRYRRDYLAFLASTMRQVFGAAQVEVQ
                     EQQGVAEADVVQEEAGEATVGACTASSSSSPSAGASWAAPAAGCSGDHMLNGFPAADL
                     YVGEDFGFMIHVDVHVLQSSGGNLFTAIAYAIHAVLRSLRLPAVTLHKAPGDGAGVSV
                     EVDRSKPYRQAVSWTHMPLLCVLLVSPTGHCVVDPTLREEWAMPQQVHVAAGANGQVM
                     YFRYQQLPSRRGNAYQLRPAELSSATDGCASYVAPPSALSVNDCWSILCDAVHICQAM
                     LHDCEEALTHGEGA"
     gene            <619698..>621119
                     /gene="PUF9A"
                     /locus_tag="LMJF_20_1365"
                     /db_xref="GeneID:5651490"
     mRNA            <619698..>621119
                     /gene="PUF9A"
                     /locus_tag="LMJF_20_1365"
                     /product="putative RNA-binding regulatory protein"
                     /transcript_id="XM_001682837.1"
                     /db_xref="GeneID:5651490"
     CDS             619698..621119
                     /gene="PUF9A"
                     /locus_tag="LMJF_20_1365"
                     /codon_start=1
                     /product="putative RNA-binding regulatory protein"
                     /protein_id="XP_001682889.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1365"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1365"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651490"
                     /db_xref="GOA:Q4QCQ9"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ9"
                     /translation="MAPAVHVAAPVCGPRRLSAMPAAALVEAFRATCEGHVADVACTP
                     QGKALLQAALRTQRSEVLDSVVTELCPRLRDVAVDVHGCHVLRTLVEACTAEQTDALI
                     GAMHASVVLNMCTASQYTRRTLQSLFERREVDLSALVHVLADNAGYLAATQQGCISLM
                     RVFELCDAAQKAELVRELLPKLAALSMDAFANYMVQCAIEHSDRATAAQYVVAHFTGN
                     ILQMSCNKHSSNVLEVVLRCCGEVPAVRRLFLDELVFNPAALKEVVGDLYGNFVVQAL
                     IGVVTNPMEFKRVEDRLRPALVGCQFAAKIEGKIKAKRPVPPHAGGAVHHHSYPQSRQ
                     QRPLSVPCTMPDHVGPCAPSVRATIALPQAPVMSLGEARVPTQGYCHRPYDCNPLCCA
                     PLAAEQQQPQNVVQAPSGHVYPVDHFQFPILKERTAARAAGAVPVTDGEDSGPVYGPS
                     PAARRHLQQQQQQAFRPPFNIMC"
     gene            <626571..>627860
                     /gene="PUF9B"
                     /locus_tag="LMJF_20_1370"
                     /db_xref="GeneID:5651491"
     mRNA            <626571..>627860
                     /gene="PUF9B"
                     /locus_tag="LMJF_20_1370"
                     /product="putative RNA-binding regulatory protein"
                     /transcript_id="XM_001682838.1"
                     /db_xref="GeneID:5651491"
     CDS             626571..627860
                     /gene="PUF9B"
                     /locus_tag="LMJF_20_1370"
                     /codon_start=1
                     /product="putative RNA-binding regulatory protein"
                     /protein_id="XP_001682890.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651491"
                     /db_xref="GOA:Q4QCQ8"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ8"
                     /translation="MAPAVHVAAPVCGPRRLSAMPAAALVEAFRATCEGHVADVACTP
                     QGKALLQAALRTQRSEVLDSVVTELCPRLRDVAVDVHGCHVLRTLVEACTAEQTDALI
                     GAMHASVVLNMCTASQYTRRTLQSLFERREVDLSALVHVLADNAGYLAATQQGCISLM
                     RVFELCDAAQKAELVRELLPKLAALSMDAFANYMVQCAIEHSDRATAAQYVVAHFTGN
                     ILQMSCNKHSSNVLEVVLRCCGEVPAVRRLFLDELVFNPAALKEVVGDLYGNFVVQAL
                     IGVVTNPMEFKRVEDRLRPALVGCQFAAKIEGKIKAKRPVPPHAGGAVHHHSYPQSRQ
                     QGEPRTVPCRVYQDAEPREAYDKACASARASTASTGETSTSTAAKHFRHFPYEPPRFV
                     TVPFDSVGKSAGGVLYGHPSAARRYMQQQLQRQPLSK"
     gene            <629765..>630016
                     /locus_tag="LMJF_20_1375"
                     /db_xref="GeneID:5651492"
     mRNA            <629765..>630016
                     /locus_tag="LMJF_20_1375"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682839.1"
                     /db_xref="GeneID:5651492"
     CDS             629765..630016
                     /locus_tag="LMJF_20_1375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682891.1"
                     /db_xref="GeneID:5651492"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ7"
                     /translation="MCHAAWRPRFSAPLYFRCTASERVLVHSLPCNCRKNRCRCLCVS
                     VCSIDVASLTTLLRSPPEIHRGALPPRLKRGHRHVRISI"
     gene            <630348..>634112
                     /locus_tag="LMJF_20_1380"
                     /db_xref="GeneID:5651493"
     mRNA            <630348..>634112
                     /locus_tag="LMJF_20_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682840.1"
                     /db_xref="GeneID:5651493"
     CDS             630348..634112
                     /locus_tag="LMJF_20_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682892.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651493"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ6"
                     /translation="MPSSFLVHRTAHVSARASTGRPRGPVPSQQPPLLRRVSPSYARS
                     PYASPVVAHTDAAASSSAPLDDASRMPLDLLEPAAARWASTAGHGGRRAPRVRSALGP
                     QSEVVDTGVFVCPNPVVAALYSAAPGRGHVVVTAESGGWLRVREQQTGAIRHQQQLRD
                     GGEVSCLAWASAADDAAVEPLGAVVVAGQLSGLISFYVLVGESLVELPFTTCVFHEAP
                     LLSCLPLRAPASAVEPASTAPGTFVNALLSLDADGVVALWCLQMAEAGEGAGRGGEAG
                     TRLSVLLLDSRYASLSPPERFLANTRVQDAGEARPPSSFPPVVMTAAALSHPSASPCC
                     VLSTHCFVQPHLSAPGAPSPEDGETDAQGSAVVFLYRFTTSAACDSAPAANLNATALA
                     ANKGTSMSLEEGAPVPDSAQPRLCRGWEVLRAYRVPVALLRQRGGEAGAASADAAHVD
                     VAVTALCVTGSTAPAGQLWAGTADGRLLVWRAHTGQFLRCLRSASAAPVHSLTSMPSP
                     GSPGQALVWASQADGSVVAWSAETFNVAEVLPVSYPPPGLLESGRGHEEDSMSGGDPA
                     NVVVMVRDAIDLLRATRHRCALSTSSAPWRRGCGFTLFVKPMNQVCMQRAWSVATDGT
                     VRTWLLPTGSTSADGTVADTAPVTVASTPTSNADGAARAASLDAYTVQRYLQDRADAL
                     VRERQAQRLASEAQQEQLKILQERNSVLAAALQQAISRLERVSVDALVRSASQPGSSS
                     STASSQNEDGENAMLAESTVPSPDSPTTTSTTTLAAASDSDEQLAMAARPATAVAMPE
                     AAPPPLLPLATLPPMARMHLQVLQQLLEELHTKLEESWSRNDALREELLVYQLRTLDR
                     EEQTLQCVRTIAAAEAAVAVSTGGAEGQASATGEVTATAMSTPAPPPLLPSSHTATSP
                     LSVGSDSSYAPEENRAHSDRPQTPPPPKTEHTPNATRAVAMDNSTPSRTLCSPSVEEL
                     VHWRVTQARPLTPPPPLWMLPTESASYTPSVKPHATSPSPVEASLSTSTAAERFFKAA
                     SAMLHSSTITCGSAARREGSVAGQGRVPAPPLLLATAEEDVQAEEDDYAAGDGEDEPA
                     LLEAWCTSEGDLSPIPSPGLAAGGDGGATSTDASAVRGGRHEPLSSSLFSFPFTSVSF
                     SAEDTAGGGGGAVDRPGAPRGAWPPARGAATWTTPAPAAGRDNATTDGAWARAPAASS
                     CRPGSPATGSAPPTLGAGVVRRAPMRCSSTTSAAASPPRAFRSPIIYRQV"
     gene            <635308..>636621
                     /locus_tag="LMJF_20_1390"
                     /db_xref="GeneID:5651494"
     mRNA            <635308..>636621
                     /locus_tag="LMJF_20_1390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682841.1"
                     /db_xref="GeneID:5651494"
     CDS             635308..636621
                     /locus_tag="LMJF_20_1390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682893.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651494"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ5"
                     /translation="MRASGNGGAVEPAAGGDASYTAKAQHALSLFANLQANMRTSASL
                     QSSEPAAHATSETRASSATAHHTTASSSHKHARDTHGRLTSSTPAATPNAGAARFSSL
                     HSLQRVDNSDRADDAAALPTYTDAELESLSPLQLRQQLRVAAAVTQRLHQRSRRLESE
                     VETWTHKYAELEAKAAGMRDAGGKEGSTNERQAPSASRLNGAHSCRPTAVSSASKAAA
                     PATASAEGAAPHARQLETEVRRLEAHKRELTRRLYAAEQTIQKLREELRIAAAASPAT
                     TRPASSPPAAVNATTCESARDKSRPEAWKGGAAAAPPAQVPPSRRDAEPKGERVDRRS
                     NGTGEGDAAGENSVAHLRDTVRQLQRRLDLSEARAREAMQVHLDAVLLHRESTPSAVA
                     LVNAEVHKLFQLMQQQLLSNAVQHQAERARMNELLYQLQCQQHAP"
     gene            <637468..>639000
                     /locus_tag="LMJF_20_1400"
                     /db_xref="GeneID:5651495"
     mRNA            <637468..>639000
                     /locus_tag="LMJF_20_1400"
                     /product="putative axoneme central apparatus protein"
                     /transcript_id="XM_001682842.1"
                     /db_xref="GeneID:5651495"
     CDS             637468..639000
                     /locus_tag="LMJF_20_1400"
                     /codon_start=1
                     /product="putative axoneme central apparatus protein"
                     /protein_id="XP_001682894.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651495"
                     /db_xref="GOA:Q4QCQ4"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ4"
                     /translation="MSNRVILQTFDEYQKARVRFVQTIAELASKPANIEALQHAGVMQ
                     LLRPLLLDSVPSVQQSAALAIGRLANSSEEMAENVVSGDVLTQLVYSLGDQNRFYKKS
                     AAFVLRSVARHSPQLAQAVADSQAVEALVGCLEEFDPTVKESVAWALGYVARHNADLA
                     QEVVDKGAVPPLVLCVQEPELSLKRVAASTLGDIAKHSPELAQSIVDQDAITHLAPLI
                     ASSDAKLKRQVCQCLAQIAKHSVELAELVVEGEIFPKIFLLLADSDEVVQKNAATCIR
                     EIAKHTPELAQLVVNAGGVGALVEYTTATKGSTRLPGIMTLGYLSAFSETLALAVIVA
                     HGIMPLADALEKEAEDHIRAAAAWSLGQLGRHSADHAKAVADCNVLPRLLDVYLSPSS
                     SDDLQTKSKRALKAIIQHCVYLPALEPLLHPDAPQDVLKYVCGQYAKVLPTDVAAKRE
                     FVANRGLATVQRIKAEPGSSLAESIQIINSCFPPEIVEYYSPEYAQTFIEKIENYHVQ
                     QH"
     gene            <641102..>643897
                     /locus_tag="LMJF_20_1410"
                     /db_xref="GeneID:5651496"
     mRNA            <641102..>643897
                     /locus_tag="LMJF_20_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682843.1"
                     /db_xref="GeneID:5651496"
     CDS             641102..643897
                     /locus_tag="LMJF_20_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682895.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651496"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ3"
                     /translation="MDLAMVPESVAGHAGTRALQPPPLTQLDGTASGASAAPASLSPV
                     TLHVNWNRWGASLPPIGYTVSQRNLGGAPAGDGGKRSRGQASHEHIRGDAVAGQGRPS
                     FTAPLPESAHRGKRRRTEHTSFTSLLKEVFMYLDSVSSTQQQPDHGCISGNAEEDEEG
                     SLRQTTTAPSYTTASCYTSASPAVPPGARARNDDSSGPVAAAPAPLMSVDSAVQDTVR
                     VLQQCWEYRGSPHDAFEPVRLLSPITVHLLLTYGHHIVTHDGQYMVLRGGAEHLPWAG
                     CLYSILLTYVYRRRVAPATTAAADNGERGGSVTPALDCVSRLLLLNCHSFGWLNHTGS
                     GEYECSHRRLYQAREALLALLEDPRYTALGRPAGCPLCASSMLGSNASTLILLGDTIV
                     MEGGVPSLGLAHPRDTFTAHYQYGCGIACCVPEKGGGLQLDATGAPVVAGRGAYTPTS
                     GRGLCAAHREPPRPAAMQASCERHRHLREPHSAPSVGDCLVEEDSPTLVRPGDHGHDG
                     PWSGARSSSLWLSGTGAAPCRLPPVCCGVCRAAGVLGQAVLLGPTGPLVIHLQFDERE
                     WFDMSARAVHAATTQGWLSAATAETTAVCPPPSSHLASQYASHPASALAAVLYAVLQG
                     ESTVGLTVQHYHASLGDHRNSSPHVGDSVPLAEFVEWLVWLLNAPPPALVVEWHPSTS
                     TSAITTTCNALRCGGVTTPSSSCDSGVASGSQVSLSSPCSPIAHPHSPLAPFLSSATA
                     FPNLVDLCAATGGSNSSFKATRVYGSDEGHATASLSTDHQQHGGYLNSPSASHGATTT
                     FAPLGMLAQPRRSTVMQLLETYIDVVQSRAAMSAPPAATSSAPSVGRARTLPFTAADG
                     TSGHIAEAMKPHLLLDWLLAVQESLRPCEATSLFDGVERPLVLAKELEVATEAERLLN
                     ASSVATSLQFRPRTARL"
     gene            <644883..>648560
                     /locus_tag="LMJF_20_1420"
                     /db_xref="GeneID:5651497"
     mRNA            <644883..>648560
                     /locus_tag="LMJF_20_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682844.1"
                     /db_xref="GeneID:5651497"
     CDS             644883..648560
                     /locus_tag="LMJF_20_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682896.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651497"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ2"
                     /translation="MASLLRRLRSSSPSLVRAGGKDDVAAADMFLVQIIAFGEVFAIP
                     VCKTTPVTVVLRHVMEAAVTEEQAVELGSMKATLYYKDTPLPLDAAMKSVPRNAVLHL
                     HSSVSTTSLIVRDCRHGAVSMLPNCRRRDANTTATVRPCLRSKSVAGGGSEGTGTPAS
                     HRLSSGFAGLSSAVSPYTERQGTPATAGLGGNSESVSSACHDTGLMSMATLPLMSTAP
                     VAAASGTGDVGEARYYYFVPCAGAATRTPIQLLSTPSRTASALSLMASRRRDSAVDFA
                     NSCRFPPAGVNPLDTAAIAAAEPLLFSPLPSPPNAAAVAATDRLTGSSDKYLLAYLRL
                     PRDKAAAYMSAAALNADRNILAEAVEVDEVPVEALLDATMSTVATTKSRATRACAYRR
                     LRVPQDFPVGTLRELFAVAPEHRLYVAHVEVEDEQKTFREMRVAPNTVFYFKRRVEAG
                     SNAGTEQKDPQRSLTCERIREHLAATATVPRPLEMAKDDSSAERCPIPCHIEPVRLSA
                     DQPFPSASAPVLSGTVPSSRAHNCTQSSASISTTSNALSIRGCVGAFNEGAALNPTYG
                     AGQSVCVADGNAEAASVAASTNRHVVEGHELTLSSAMTAELAALRTEAETTAPQQSSK
                     QQHRSTERDDPLTAISPGDIEAAEAEESCIDVDCCLADKEGEEAAAATPTATHRAATP
                     QAASVSQVTSTTAAAAPAVEAAASQQTARRAYRLHRRSPTAAAAEKTRSNALHCEEEV
                     LAKAARTTASTRSPKARRGSMLVAKMHDALRRHRTNSTPVPAALTPSHHAREGPQSLF
                     ATDALQPAVDAGEPFDPLAARADGVPLRLPHVADEVADAKPKRRPAKESNKEPATGKR
                     ATPSFDGAPAVSRTASTGPSTAKMNVSNSASPFHPVRRMSSRQRKAHGEIRSSSSGKD
                     ASIAPSLVATSSLTLSTSEEVLKALRRDSAHLSNTKKSKEAAETAPAETTAWTPLSAA
                     RAAATAESAERGRAEVGDTPGQQKVIPENGSPSCGSGASYGRRNRRASVSMPCQPVAF
                     LGSDPGQAASITLPAETAPAAVDISTTLEPAVLSSTRVPTPPESQTPAPILVSATQGQ
                     RSGRQSNSGTPGSCSLEHVNPTPSVWRRREESGPLEYSVESPSSAHRLRITLKDPQDP
                     TRFHYGVPVEPDCPVGALREWVAAVQRLSSAVGEGEPDLRDTNRYGIFLGDKYLSEAD
                     SVTFAEVTCGRNDSVFSIRPL"
     gene            <651116..>652138
                     /locus_tag="LMJF_20_1430"
                     /db_xref="GeneID:5651498"
     mRNA            <651116..>652138
                     /locus_tag="LMJF_20_1430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682845.1"
                     /db_xref="GeneID:5651498"
     CDS             651116..652138
                     /locus_tag="LMJF_20_1430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682897.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651498"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ1"
                     /translation="MLHCSLWRLTAAAVASSAASGETLAPFTARVGALCKQMHAAGAE
                     FGCVAVDPSEEQCRGLVAKCAIREGTTVMSVPLQSCSISSEQLIKDNALVQEMKPPSL
                     NVVRQLMNTRSIRDPVMHEQFYLALLIAADHMNPASPRSDYYNLLPHPAIDDTLAIQR
                     HKDVLDPLLLVEWDDYQKEMLSVLHHLLRRWGSPSAPPIQVAYWALRTVLSRMHMLPK
                     AGLAPQQVGSTLSYTALSTVDQADLQTRWRRRFKSMLSSLTGNPADAEEYHLVPTLVP
                     LLDMTPHIPSSNVQVEVNTRGAAVGGCAELRAVRDIDAGETIGLRFNASQAPAFLLFR
                     FGFIPQ"
     gene            <653056..>653493
                     /locus_tag="LMJF_20_1440"
                     /db_xref="GeneID:5651499"
     mRNA            <653056..>653493
                     /locus_tag="LMJF_20_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682846.1"
                     /db_xref="GeneID:5651499"
     CDS             653056..653493
                     /locus_tag="LMJF_20_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682898.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651499"
                     /db_xref="UniProtKB/TrEMBL:Q4QCQ0"
                     /translation="MSAEAESMPAPQVTAPATHTTPTAVELKPKNTHRLNRILRKPKA
                     SLPPRKWHPDEEGEPRVVGVPPSVVNTLLASLSEEEKKRAATGLDPLSATQEALIRRA
                     ARFGLNINSSNPAAPVAPAPTFMVDEETLRRREERFKQAAPSQ"
     gene            <654522..>655703
                     /locus_tag="LMJF_20_1450"
                     /db_xref="GeneID:5651500"
     mRNA            <654522..>655703
                     /locus_tag="LMJF_20_1450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682847.1"
                     /db_xref="GeneID:5651500"
     CDS             654522..655703
                     /locus_tag="LMJF_20_1450"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682899.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651500"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP9"
                     /translation="MSSGVTTRPEAATAPVSVQLTPIVPIRVFDAHGEYFDTEMDIDA
                     PLRSLQLAIEDYFKVKPEVQLLLHNRQQIHADRSLRDNGCLLLKGDPYVKLVCLLKRG
                     PVLNLQCEVGPITYVVACHEMATVWEVKKMLCEEMERQQRRATPAGAALRRLTCGPER
                     LRLLWRYMELNDKATLHYYRISTNAVLHVMHRRRASVPAAAAASSPLSRETGLNRTVT
                     AQQPSATAWWQRPHAASASPSSAACAPAASPASAPEAWVTHSPAEGYTDAFGAAARPC
                     VGLPAVSAYTQPPPSLLVAAEPMAAYAGSAPGAPQHHHDPLTSTEVVTLSLAVRSLEA
                     QLRSLQQEQRQVEQHQQSLTAYQRGSLADAQQRILELEETVKRFHALLQRAVALIPAA
                     A"
     gene            complement(<657201..>658244)
                     /locus_tag="LMJF_20_1460"
                     /db_xref="GeneID:5651501"
     mRNA            complement(<657201..>658244)
                     /locus_tag="LMJF_20_1460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682848.1"
                     /db_xref="GeneID:5651501"
     CDS             complement(657201..658244)
                     /locus_tag="LMJF_20_1460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682900.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651501"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP8"
                     /translation="MWVGGCALLHIGEHMQAQALHFRSYTPLLLLLLRLRLGNQHAHT
                     RRCRKLLCVCVYVCVCVCLSVRLPLSLSLSLSSSPSAVLFGVSAVVRQSPFPLIYAPL
                     FVTMPVVDVSVLCATEITGVSLRYSFCVYVRLQGQAIRTKSSSADHVGEVRFGERFRF
                     QYDYDTRRPSRNRLFVELWTKRLFSQSCVSVAWIEMGEQRFVRGEQTRMNVRGAFEGK
                     RATLSIAITPLDFGESRCVVQQQMPVLYGVPVEGIPLASPNPYTSAAYVPNACATAQD
                     STACENREVPTQPPQPQACVGASLPPPLYPSLSQGMQHQPSGGGQCCGTVSTPSQIAE
                     RDHSVDCGKPKQL"
     gene            complement(<658594..>660339)
                     /locus_tag="LMJF_20_1470"
                     /db_xref="GeneID:5651502"
     mRNA            complement(<658594..>660339)
                     /locus_tag="LMJF_20_1470"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682849.1"
                     /db_xref="GeneID:5651502"
     CDS             complement(658594..660339)
                     /locus_tag="LMJF_20_1470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682901.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651502"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP7"
                     /translation="MLGSSSKATQHLLRAAEQEVVNAQRENFERLHPAASIFASQRDR
                     RASSALSDSSLGILGARYTPPPLSVPANHTGAKVQGSRARVDRLTGPPFCGAAVHGER
                     SVLAEARQVQEAVTWLRECPSRTLQQLQQRVLCTAEVLFTQLVGMPVAARQVLEHIAA
                     ACQPAAAKKKTSTGGGDGDEDDDEDALGPQYVLPPQPLTFSDFVSNFLLDSPAGASST
                     SRALPFNLVLLSGRPQPVAPLTSLHLVYGLHVIEEVLRRPGLSTSAPESALSPTVAAG
                     LEDHQALLSEVVHWSAFFESVFDKARESLCRDPLNLYAAVLLACAERGAWELRNTADA
                     LAEEAVRMLKLSDAASGRRPNVCVACRTEAAHLAVSCRSYVKHTLRTVATPQHAASYS
                     HSLSGSSAKGSKSSASSRGTAPVTRFFLATPAVVWWAAAFLRLYRLHTPVSAPRRAPA
                     VKGVSSTSTNLFGDDAQKEAAAAPAAVDVVSSAEAYFIRDWIAQAARMDREGFIEQED
                     AGCLCIPLSCATHAPVAVLGFTQESVQAALDRMTAWVDAGVLANTPLRVDELLAALQD
                     EYAVLPYYLSYFAGV"
     gene            complement(<662734..>665700)
                     /locus_tag="LMJF_20_1480"
                     /db_xref="GeneID:5651503"
     mRNA            complement(<662734..>665700)
                     /locus_tag="LMJF_20_1480"
                     /product="putative zinc-binding phosphatase"
                     /transcript_id="XM_001682850.1"
                     /db_xref="GeneID:5651503"
     CDS             complement(662734..665700)
                     /locus_tag="LMJF_20_1480"
                     /codon_start=1
                     /product="putative zinc-binding phosphatase"
                     /protein_id="XP_001682902.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651503"
                     /db_xref="GOA:Q4QCP6"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP6"
                     /translation="MPCFPPFRTLKGEVLDLHVSSSIDAKDAVALLYFCGGDEKACVV
                     QPCSLALSQYQLHIGPLGREACVEVPYMLIATWGIARASSSITKAFVQVQQQAEETAR
                     TSSGTASMGSTIGSGVASAASPSVTAAVAMMTPLLSAPPAQVPQPVPLPSRPRYADPL
                     PALYVVTLQTKHVWQHRLIVQSERILKNIRAHLTLMHCLARVSDLPAFHYAEERQRQQ
                     RVGSSSNSVNSTGEATGTAGIWSTEFGWNLYSPQREFTRQLCIDASRPAPEVATEAAL
                     QAGRIGLHQDLRPWFRLVDLRDEERDVGRGERPADFQYTCSPTYPWLFLQPRLVDREL
                     LLRAIAARSRARVPAVSYVCLRTGAVLARSSQPLMRSPQLSADSDVCYTLINMGYAPH
                     HARPQRTTASAAVSSSLVPSLLATAHGSSPAATNSLKASPVVGAPAAVARPVRPPSLF
                     DDDSDGDGQPPCAGSTSNASSTQQLESTPVNGSGCTSVRTPPSTVSKAARKFTVTAAG
                     DAANVATTPLMETSHGAVMGASTNANAAKVLLVADCRPQITAAGNAQLGGGYESGSYY
                     TFCQTNFFEIDNIFGVAKSFEKLRSMLARYQGNTVEKTFLRRLYDSDWLAIVQRVLVC
                     SVTAAQSLQNGVSCLVHCTDGWDRTSQCTALAMLLLDPYYRTIVGFCTLIEKEFCSFG
                     HKFAERSGHQLPGRTTVFTHSGVASSDTEQQHGGSGGSAPRLDTSPIFLNFLDAVFQV
                     CHQYPTCFEFTPELLAHLSEVVYSCLYGTFLCNGEQERHLEGVRLRTASVWTDVLRRT
                     QREKAGKIPLCFVNIHYDAVTAWRFISQRRRGRVEGGAGGATALADFVLLPNCSSKRL
                     VFWEALYTREDADHYLSYNPHVYAVKTTQEVSWGLEFDSFLDAEMEEACADRENEMAS
                     LLALEEFMAAEANTPAAPSLAANSARSAWCVFDAVNCFNCYKSFGMWSTKAQCAACKQ
                     YFCTDCHVHDCILQQY"
     gene            complement(<666656..>669556)
                     /locus_tag="LMJF_20_1490"
                     /db_xref="GeneID:5651504"
     mRNA            complement(<666656..>669556)
                     /locus_tag="LMJF_20_1490"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682851.1"
                     /db_xref="GeneID:5651504"
     CDS             complement(666656..669556)
                     /locus_tag="LMJF_20_1490"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682903.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651504"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP5"
                     /translation="MGAANSCTCSETKYRFKDFIVSVYPDNIHGGPDEDALAKLNNYI
                     ASNPERIPRVCRKIGKLLLIHLASKKETRVMVSVLMLRSLIEHAARVVDFVPHSVDIC
                     ALLLSTSIPRYHIGAADVLSTLCYRLSTQPNTDSARRLIADNKDRLVPQLLQMTSDHI
                     ASRKCANTVQTRYAAILALGNIANCIHTALAGNAAVIMQAMIVNLILVLRERAHKPLS
                     DASVHLLAKQHNGGADATSVASPILKLPAEAEEQDVTYALACSHGIGATAACTTTAGV
                     AGLLNRVTALLETQNGWGIPHVPSLVFRDIVSAMQRRPQQLGFLVYQCLCDMGQCTSD
                     PSVRIGVLRSLQACVDVLPMTGGRPAVVLDHIVSVMQPPMAGSTTDGAAAGDEDGVDS
                     ACLEKDTHDAVVTLTSRLLRSTYLRHNGSQLQSILVSLWHLLEAAQSRGTPHPTLVLR
                     LLVVAAPYLRSVPLVDRRDIRVTDGLECYLNGSGGDVQRHLASRVLAGILAGIPAPTH
                     SAVEGGGGGDKVSVAEVTAAFAAAPSPPTGTGVLFTAEEDVAFAQEWVKRVSKETEGV
                     TPLTVVSVANVLCALMAGYGVSGLPFTLMFLWALQQLCVRVEPASAAARQDDTASAST
                     ATVTTMSASRAATSPLTRAWLHMIAALLVCCGRVYAIPKLQAYGQEILEKRVAAGQLA
                     SCFEPALRISGHAADVYTVSGLRCHASEKSRPLATDFTEAPVSKLPSFSYVSNIIADA
                     DWADVAVVFGASDEEKLHMVIEEVCFQPDSEVSVSLSSLIAARSSSIPAADAMSQRSL
                     HFSLSVQDEAKVSTLRSLRISVVDNSILRAQDSRGAVPLSAAAITTAKKVQEIAEHYN
                     VSAATQVLPPETTAALPPLPMLPLHRDDEDTSGGMSESSEFASEVRGKAMSPPLYVAG
                     CTADSRSRSGAGTESAAFVNPLNVDVGIQAARKAQRALSIRALPAARYVSMV"
     gene            complement(<670191..>673052)
                     /locus_tag="LMJF_20_1500"
                     /db_xref="GeneID:5651505"
     mRNA            complement(<670191..>673052)
                     /locus_tag="LMJF_20_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682852.1"
                     /db_xref="GeneID:5651505"
     CDS             complement(670191..673052)
                     /locus_tag="LMJF_20_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682904.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651505"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP4"
                     /translation="MYTFLPSSASRTQPLDWVTLITNALAVAREAPSEQVLNTLVMMQ
                     SYATASADVFTNVSRGARDVKEYVALLCAMDEAIGAWPLRVRQLLDVPPVILVPAGGP
                     GGSFVTVPVHTPRGEALVFLFNVSLYHMNAGLHYLARVRADASVMISSNASRRLGGAG
                     SVAAPNQNAKLAAQHCRLAVDVLRWSEALHASPSSPSALALRNLRSHIPLDVTRDMGV
                     LCSAVAKYMYALSSASTKDKPDVLAKLAFDAAQLQLPGCVSASSSLQLLPSLLLATYH
                     YHKATWYYSASKVPDMAEALGHMQYADTLLRSCDAQWGVEEARTQMEHESRQWWGRRL
                     ASFFKGVSQAGASAANRPRGEAPRRASEVSRAAGVASSDEADDNTVVAALQPATEYPS
                     LHALLLHGEGRSASRAAGAASSDDRSDGAPTAATVADVVHVYPYLRLLLQDVCDCLQR
                     YKRENELVFFVKAAAADVVSRDVPDVTAAIGGGAADAAEESALFEPRASLFASLPSTS
                     TLQLALAQEEECGQAQQALASLLQRVERDQRTLSLFIKPPNTLHQALDALEALLPQAA
                     PWGSLDAVVNAAAEAVEAAVQNFVDVAAAWQEGHDAYVGARCAAHPLLKDTRAELAVW
                     SERAAVALQRWKKLELPAEVDSRSAFLDALVPISSELHAYLKQSGDVCRDARDVLMCS
                     PGSVAVAQVQACTAAVDAARQSGIELLTRVTATASRRSIPRPPLYRASGGTRTRNSDD
                     NGNAAGAEEDEPAPAPQYAEAEAAIEAMVQVLEEAPTVVAHVESAAAELRDMQKKAVV
                     TPLGQLRDVHFLSDSTKQPIKEADKERGGRGGGAVRASAKCGGSVMKAADPTSGVDNV
                     ASRSTATASSRKRAGTSSPVGKPLLPDPAADDASDSVSSSQLADAKEVAVVEGDGATK
                     AAVSGSLLRRLKANKEERQQGSRSAPVTASPPPSKRAKR"
     gene            complement(<673816..>680148)
                     /locus_tag="LMJF_20_1510"
                     /db_xref="GeneID:5651506"
     mRNA            complement(<673816..>680148)
                     /locus_tag="LMJF_20_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682853.1"
                     /db_xref="GeneID:5651506"
     CDS             complement(673816..680148)
                     /locus_tag="LMJF_20_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682905.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651506"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP3"
                     /translation="MAEETQHDLPTLVSSLQDATVEWSLPAQRLTSPSITGSSSGGSG
                     GIAGVRMGGRYLCYAQVLQDIDQLFADVRVRSSAALVAWCASLQQSNVASRFGALIVD
                     HILQGMLPYVVLQRCLRLLDTFLGWVTRPNAGSVELGIGAASPSCPVLVPSHVVVEWI
                     ERTWATVTTLSRDNAGTSSPTSTASLCGALQLLPILLRRNLAGSPLPPFRRAQLPHPA
                     NMLSLEARLLALQVLPPLLQHQPDAPGIQACTSEMIEYIKRACTRAAEPSVRIAVGTS
                     LRGLLEAGLRVTSPTVAYALIDMLLTLCDEASLHSVADGELHDVGVVMGYLLAFYQCD
                     FTMDVLADILQASTPSTSKPAGEERSGYRGVGGGGSGRVRWQFFGGSDAVEGSRVVQR
                     SFNERMSRAAQRALATALATLCSCGATPATTADAVQCCFVLLVPLADDARAYMPRLLA
                     DAMLEWATQLPSNGYRVVLADALRGYIQRSGEDKAVARTAMVALQGVMLTLTSSLEIG
                     FKVAEDVLAAVQATPSLLHAGVEVLAAVARTNVLYARHLQHQCARIDSADVANTLAFQ
                     LHVRAFLDAASVLRGGSASHEDTLGEEDRVSLVHICIRLLLRLSRGDPPRTVQNVHYR
                     QAELIFRLTQLLYDLLRGSAEAVLGAVRDEVLPCAVGFMNLLVGNPAPTIAYYKAVAA
                     ACAMLRRAPVISDMERMLAVGFMEAHLASQSNVAEQDASAATSSAATAYFAISRGSLF
                     ELISSKPWPTCKDDGSLRWLAAQALKDVATACAQGVPVLSFADACDATVASAAQSMRL
                     LRADLLPNSTSEAPFGASSAAAETPTHTVEECGGHAVRLLRWTLRHFLQRAGADGVCV
                     ALLTSLRTDLFEVYCTPVGVGAAESAEDEARRVMQRDVALWNCLCIVEQFLQEASPRT
                     AAPLWQNADWDAEVRQWQSLAAQLVPAVARASVEVRLLAAKVLGRCLVSTDQVDLYTS
                     QTMSAAAQGFVGKSVQYDALSALMVLSEAHSCYKECRAATAVATSTDNDSSPTLPLAT
                     SLLVEAWKQITSSAPTATTAAAISVPILLLLSLRLTRAYPAEVEAALFDSVMAALLAP
                     MTAANRLWWSPESALGVLTAVQQLWAAFPGNMAGASAVRHGTALALLQQSHAAALRGQ
                     RASSSTVVAAALDAVHIYTLKQQREGEQAALADMREQRDLWHALLHQCLDHVTFIPPD
                     EANAAFRANVRVRGQSTALRRRVMLDDGVSRSLAVLWRMAMEGVTKVSPSAARGNVRL
                     LSPVDVAVQVDVAIAAATRREWVSVAQSMYTPPLSPRSTWTPLEAAGADLSLKTYLDG
                     IRAVLQARSPHVQVDIAKRDTDMFAAVEEAGAADTVRGGGSDSEGAKEYAEECGEEGM
                     GGILSEAGGAGGGGGADEARGPMTFDLGAGGGHSVAASLTFDVAAKEAAMWLLYSVLR
                     SISASSSSSATTGRESDDEARRALLPVVVAAAQLVEVHPEVQMSTIAVLHEVLVAWGN
                     ATQQQGCSRETPVLLQWKTQLVVGLTTVLQHGLLSLEGCTSLAVQYSRCNMADPSSCR
                     RVLRSLLLLLHACHKLHDRGRGFLLIGGSGAGHVIVALAKVAQASAMHLESGDGGSSA
                     SDGAADAAAAKQSQRNILRSLTSAPCQAALTLLCELFVTAASLANGYVQSADTIGLGW
                     SGGGGGNDDGTSAASSVYASRTSVSAGDVLQAVAFLTQEPLKAVLGPALRYASGCLAV
                     LVLSTLALSATPPPPPPDGSPSASKTALTSMVALSGQLAANHQSLLAQLAQERLCARI
                     GKRLSNLQPLQSAWDTVDTELLRIVTVAPVSRDTAAALLERITPVLSQPAAGVWKAEV
                     AVSILLAGMTASLDLNRLLPLLTELSVESLLGDVPQEVLARLHQAVRSYLRKGGSTWV
                     RALALASPAGLLLAEHCAASDDSSVVCHSPLAHRATWPVVLRLLWEARDPLHIFTVMW
                     SSTPFLAHTTLSCSTLLREQVLQHRLQAEVLLAILASLGASSASNAGVNEDVVLLLLR
                     CGRLMSELLMGIMTSAAEHAAAPDADALYTVLAYVVAVLCTPLSAAFAVALRPVGLHL
                     VRTVAPSAGPALREAIQRLGPTKAMQLRSFMEGSCA"
     gene            complement(<681380..>686134)
                     /locus_tag="LMJF_20_1520"
                     /db_xref="GeneID:5651507"
     mRNA            complement(<681380..>686134)
                     /locus_tag="LMJF_20_1520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682854.1"
                     /db_xref="GeneID:5651507"
     CDS             complement(681380..686134)
                     /locus_tag="LMJF_20_1520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682906.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651507"
                     /db_xref="InterPro:IPR027914"
                     /db_xref="InterPro:IPR028089"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP2"
                     /translation="MLAESHAATLSMITQEQQRLSEQQEEAEAHNEALLDADPDAVLP
                     VCTDMYHCSTADDQGRAQAMTLMKQDRLRLVQLLVEVRDHHRSRVAAIDTCFADIASA
                     EEARCKHIQAAVQELMASLTRIAVTSTTESQVLAQRILHHTNEQLGGNYLGMQTMATQ
                     LRQRELYKHQHYQRTLVAVYRDTQVYMAQQHVTWCITVLRSALFHRPEGRLQSVKAAG
                     QLIGAIRSEAEGLTRGLTEVVDSLEVAQPSASTAELQVCGGSGANGWLRSFEPNVHQP
                     VFVDEDPQAVLEEWHMRVSVLLRHCRARCNELMVRVRADEAARTSVAAALAEQTLSDV
                     EAIARPISEEPSLLQRASLAHSGTDKDRQDVSPDEAADLLDDALHSLTDAHSGVLAMK
                     QSIVRSAAWALCVPAIKKEGQWFAHLVSRGFQRGYAQFCADAVKSTGSMLVSLEGATD
                     ILLASTRGLLGFLRGLYAQWQEKEMDYRDEVARLELQLRVLEDELRQQETPAAAEARY
                     TAGLMCLQSIADAHTRYYEAVRSRVANATADVLQVGQACVGELSRQAGLSWVRLSSSD
                     ECEIPGTPQQQFQRKNSAGAVPASTHESVPAAAAAPRWSTSHGEEFTIDSVAFRFACV
                     TARSGGGDVTANADANLEDFDDDKTAAAGAAPGADFQQFYLNLLPELQPAQQHVSLFL
                     PQSRVSEWKEYLRCALMKWGLSLQRHAWESWRLYTAAFQADVQHRAAEALRYHHRRPA
                     TLQATVYEARVRELIDAKNRGDKMLLRIAERVSRVQALKHTFLAQTSHSDSDQALIRE
                     RATLLVKVREAMSTNAVRTLVSRHDALCAEYCTALADRCAEAVHNLERARAVIEEDCA
                     QLLHDRAVELRGGDTAAQLPVDDPVQVRVDHLRAEVQETLTQSLKAVEDQQQTRAAEV
                     DNWKATWTSTVEHSSAELSVFQTVQEGLARLKAQVQALLTTAATEEAELAAGVAMVVR
                     EVDEASAAPVMDLAAAIHALFKESPSAASPAGDGGGDTPLTTEDLKNMVEHNLKVTKA
                     MQQDRIRAASACTVLASLDKLRGLLYARGCRLGLLAHTVEMLRVSPLHYVLPMALGEE
                     EPEAVRGRTGSRSVSSKAGRRAKDVQGTPTAGHTAMPLSTPATYAEQVAQWTAQVLRD
                     AEAAAQRHVKAFPGDMYRRLPGMTGGKVEQLNAAVAALCLAQQERVKSYMAKAGQPFR
                     QRVQELWNTLQSTPSLLVRTLSAAATTAILERVEAVLRPWWRFQAQSSEQWRAHRGAV
                     KLSLARQPNATALTLLTDAEATRSDTTELALQQAWAWSLREVEDEVGLHVARCWTALH
                     SYSHLLKGLVTPQHLVPTTEVVEGGHHRGLRHLLELRAQHERAASELEGTAGAKKDPR
                     LQEVMPLHRADTPGTNPSAASKRHANASVAAAAAAAAMESAPLAQLSQWSDVELPGLP
                     LNTCVPLSQYNAQHPQTAVAPPLAAAAYVPAAVRFTSDSKGPQGHGHQRISAATSSAS
                     SNPSGRKGRASIAMDAKAAAAAAEVSVPLLVPRAPLVLECAQLLRAAVQSVSSQGNEA
                     AGVLSNAFDFYERQEAQWRQTWVLTVKDMAAM"
     gene            complement(<686922..>689567)
                     /locus_tag="LMJF_20_1530"
                     /db_xref="GeneID:5651508"
     mRNA            complement(<686922..>689567)
                     /locus_tag="LMJF_20_1530"
                     /product="cell division cycle protein-like protein"
                     /transcript_id="XM_001682855.1"
                     /db_xref="GeneID:5651508"
     CDS             complement(686922..689567)
                     /locus_tag="LMJF_20_1530"
                     /codon_start=1
                     /product="cell division cycle protein-like protein"
                     /protein_id="XP_001682907.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651508"
                     /db_xref="GOA:Q4QCP1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCP1"
                     /translation="MHGVGRTHTQANNGGVSAAPAPLLTHIGSSLVCLFLCGTLYLSL
                     KHAPTTTTICIGRQQGHAHASTCMAGFTDALVLEAPVLWWPAVGDLPRYPIDEQRSFV
                     AAIVEAAMPWPQGSSTAEGTMISTLGLSCLGRSVMMTAEWSCLDGIDSMQLPSVKVWN
                     PLQGCAVYMTVSTEAGLGSLASANHGGKNGRSTASLTELDLRQLARDERVRVTHRSLR
                     EMLSRCCCSRTALLTHMQRCAEQREEYALLHRAVTRAHAAALKHLERAAQAMDGVLDS
                     SHRLSGKAAISAPFLSSLLFAGDTPSQRHLLRLLQATTPSVVQVSSTRVFVLEARRLN
                     LAEVLALLELEALEVVEAVLRPPPLCASAASSSSTVVYPCLLIVMESLHLLEGNANSL
                     VASVTHQLCVCLDALQASTVPAIVWSFTEDVLNTPPALLTRVGAQQERLAMSTAEDRI
                     AYLTRRLARWPPVSSLQPAAWHTAAVKLAESTAHWTVGRLVLVRDADLASMLPSAPAV
                     TREVSDGASRQAECLHEERKRGVEVQEVQAGVPASSAISVAAQRPEPPLFDVYSRLYG
                     IEEAICKVEELIVWPLTHLLLLRELAIPCTKGVLLCGPSGSGKTALLSCLGRRLQLPD
                     ARRIHVMSVDGLSLITKEVGRSEKNIAQLFDTARSLAPTALFIDNLDSLAPPRGRTTA
                     ETNTTGDRTLSTLLTQMDGVGGGQADCVVVVVASAPSIDTLDPAVCRPGRLDVHVQLT
                     NPPTSASAAVMKNRLREFVARMQKRRQSDDVLATGDGAGTATLEVLEEVDQLVDEYLA
                     SVTAKANSKADGDATLPPQPSLSPAEVTAAIREVMLDVVARLERGDSPTPPCATLSSD
                     AHVADRSGDVVRAVRDAVRHLYAAA"
     gene            complement(<690027..>690524)
                     /locus_tag="LMJF_20_1540"
                     /db_xref="GeneID:5651509"
     mRNA            complement(<690027..>690524)
                     /locus_tag="LMJF_20_1540"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682856.1"
                     /db_xref="GeneID:5651509"
     CDS             complement(690027..690524)
                     /locus_tag="LMJF_20_1540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682908.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1540"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651509"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM7"
                     /translation="MPLKPFAMGELEAALRQVPCESVKALPMHGRRTLLNICSRSVAT
                     LALSLLHGKEGVAVPLLKPHKPGDDPAPYHPVTPASNLCNLPEQIVSRPVRGHLEDKL
                     QPQQPGLRPHRSTADPLDLLLRKVVQPQPATMAGAAFVDCARAFDWVDNDAVITALRK
                     FSVAP"
     gene            complement(<692420..>694246)
                     /locus_tag="LMJF_20_1630"
                     /db_xref="GeneID:5651510"
     mRNA            complement(<692420..>694246)
                     /locus_tag="LMJF_20_1630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682857.1"
                     /db_xref="GeneID:5651510"
     CDS             complement(692420..694246)
                     /locus_tag="LMJF_20_1630"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682909.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651510"
                     /db_xref="GOA:Q4QCN9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN9"
                     /translation="MTLHAATMSTSSTSSSAAILSSSPLEDEELLIDCHERRRLEQTE
                     AEYMNYCVTLCRSGRMQQHKRLRAMVWRDIVIGRKRVTAVPQLSDGIIRQLQEETRLQ
                     TRQGSCNHSREGTRMSGSLDSLASPVAEVEDHHNNDKGGPSRAPEVKQRKDGSGVSSD
                     SSLRGSSLCTGAGLALSTAAAPLRRHRHPSLEPPRPVPPTEQIEEAADGCGGAGDEMP
                     PAFAPVRRRALSQLSRRVKSDAGHFLKLAKDVASRNETPAQDFSGSVLWPMSWYHLPD
                     NCQPRVVEADTERSLWTLYPHSAERTEQRRRLKNMILRVLLHNPERFYYQGLHELMGY
                     MMYMLSPYTEWEEVVSVCDKLLVTRWKRFSARQLKSSEAMLYAMHAIIVQEDPPLAAA
                     LEWCGVGPESHYAVSWMITWYVHSIDSLEVLARLFDYFLVDVEGSAVIYFTAALVVSQ
                     RETIFEWIHNAKEEIGVSMGATEASDDGIMLMARVYAQLSRLPGNVLNGIDQDALNAL
                     LEQAEQYCTLHRHTVRQEEQNFLNGDIKQLGLLSNQHTRDAALQLLWHFLPREWRSPA
                     KSEHVRRVLFWTGLMVAATAVIVGTARADFKPGEWVQGLLHR"
     gene            complement(<695026..>695667)
                     /locus_tag="LMJF_20_1640"
                     /db_xref="GeneID:5651511"
     mRNA            complement(<695026..>695667)
                     /locus_tag="LMJF_20_1640"
                     /product="phosphatase-like protein"
                     /transcript_id="XM_001682858.1"
                     /db_xref="GeneID:5651511"
     CDS             complement(695026..695667)
                     /locus_tag="LMJF_20_1640"
                     /codon_start=1
                     /product="phosphatase-like protein"
                     /protein_id="XP_001682910.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651511"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR007699"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN8"
                     /translation="MPTVPFTGQVRMEWYQSVEQIHFTFYVKDRTVDDVVVTKTATSL
                     EVVIRLDENGREYSCCYDPLFAELTGDAASISVRPMKIEVSVVKAQPYQWPALERKAS
                     AADAVVAPTGGAPEIALPATAKDLKYPNSKGKDWSALKLEVEEDAKPEGEAALNKLFQ
                     QIYGDGSDEQRRAMIKSFTESGGTVLSTNWDDVKKKKVEAQPPKGMEAKTISE"
     gene            complement(<697089..>697514)
                     /locus_tag="LMJF_20_1650"
                     /db_xref="GeneID:5651512"
     mRNA            complement(<697089..>697514)
                     /locus_tag="LMJF_20_1650"
                     /product="ribosomal protein S11 homolog"
                     /transcript_id="XM_001682859.1"
                     /db_xref="GeneID:5651512"
     CDS             complement(697089..697514)
                     /locus_tag="LMJF_20_1650"
                     /codon_start=1
                     /product="ribosomal protein S11 homolog"
                     /protein_id="XP_001682911.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651512"
                     /db_xref="GOA:Q4QCN7"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN7"
                     /translation="MHRPSRKHVNKSGHIRYSKKIGLGFKTPAKALNGKYIDRKCPFT
                     SNVVIRGRILRGVVHSTKMHRTIIIRRNYLHFIKKYQRYQKRHKSLAVHCSPAFDPKQ
                     GDEVVIGQCRPLSKTIRYNVLEVVSKSSADKMGKKFAKN"
     gene            complement(<698405..>699616)
                     /locus_tag="LMJF_20_1660"
                     /db_xref="GeneID:5651513"
     mRNA            complement(<698405..>699616)
                     /locus_tag="LMJF_20_1660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682860.1"
                     /db_xref="GeneID:5651513"
     CDS             complement(698405..699616)
                     /locus_tag="LMJF_20_1660"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682912.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651513"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN6"
                     /translation="MQLVSDLQQRPKKGRLSIEKNIVPFYDLCTTVQLVTFLIHTVTT
                     MIGANRTFTRSIIVQNNFELTPSLVYKTRDCSFNTVRDIYAFSAVDMKFTQSSVNDVF
                     VDQAIQMRLAIFVCAATLLVGGLNRMLVESNVFVIKFRNFYLWKDIISATELLLLAYV
                     MQIVATVQYPARLLQDYLRHCGVTANSYLPFISTINLWVFAGVGYLTYVVGLILYLNN
                     ALPKYGVMTPQEIEEYKAWVRSRRTEQEQARMLIDEAKKAHARLHMLNSTDYKHGDNN
                     TLALPPSMLGPNGPMYPYPYPYGPAYPGSAPIAPSMTNAMTDPRLPAPQLFGAGMMPT
                     PGQPGMMPPSGYDGQQPPPMDPSPYEAMGPSGATAAVSSSPGGAVSLPVNMPRRRILP
                     SPSQVNPPMYE"
     gene            complement(<700554..>701507)
                     /locus_tag="LMJF_20_1670"
                     /db_xref="GeneID:5651514"
     mRNA            complement(<700554..>701507)
                     /locus_tag="LMJF_20_1670"
                     /product="putative ribosome biogenesis protein"
                     /transcript_id="XM_001682861.1"
                     /db_xref="GeneID:5651514"
     CDS             complement(700554..701507)
                     /locus_tag="LMJF_20_1670"
                     /codon_start=1
                     /product="putative ribosome biogenesis protein"
                     /protein_id="XP_001682913.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651514"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="InterPro:IPR026532"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN5"
                     /translation="MAGAGKKRSRSAQSETAPAAEAAQPQVEHPADVADAATKAMVNR
                     EEEMVGQLHVQHAQTTKKMTNRQKMLVLGARSMTSKDRHLLLDLRGLMPHSREHPKIG
                     RTNTLGDDLIELCGLHQCNSVMFVEPHRNDVSYLWIGQAPSGPSIKMQINNVHTADEI
                     RMAGNCLKYSRPLLHFDRDFELHPHLRVAKSLLHMAFNTPRYHPKSKPFVDRIMSFLW
                     LDNHIWVRNYQIVPTSPPSLMEIGPRFTVEPVAIFNGCCKGSVLWKSATARPPTEQRR
                     DRKLRRLEKQQANEVIKEKSERHKALHPAPSADPLDLVFRD"
     gene            complement(<702393..>706232)
                     /locus_tag="LMJF_20_1680"
                     /db_xref="GeneID:5651515"
     mRNA            complement(<702393..>706232)
                     /locus_tag="LMJF_20_1680"
                     /product="putative separin"
                     /transcript_id="XM_001682862.1"
                     /db_xref="GeneID:5651515"
     CDS             complement(702393..706232)
                     /locus_tag="LMJF_20_1680"
                     /EC_number="3.4.22.49"
                     /codon_start=1
                     /product="putative separin"
                     /protein_id="XP_001682914.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651515"
                     /db_xref="GOA:Q4QCN4"
                     /db_xref="InterPro:IPR005314"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN4"
                     /translation="MTSSQGALLRTLHDAITHTLRNADEVAAVVDAAVQLSSLRYRSL
                     ASSWDLPKLLSSALRTQLNTRMRSPAAVASSVSPASLCCVLAAAWRLCPLVTLPLPCA
                     AADGCTSPASIALLLSLSEEDVERVGREIASLENAPCSSDTAEPPARGTATAVVTSLL
                     LYWHILCAEAQEATAESEETFRRVSATVWRCLQHWTASDGCDEVRRTLLKAWVSTVLR
                     RALLCTSDLCVMSAVTLLDAVVPPSMSMTTAMTFGSCGPSNSGLSELWARLHLRVCQH
                     VMEDMRVRQAAFSAEWSRSVVPVLTRAFAQEPPLLSPSFTNVMQFAEPLDTSLGELVR
                     VVHRMRRCALGSSATSQADDFASCVSADTLAPLLCLSRLSPRLAEAGVPIAPFATANM
                     YRTYVTPLIAVSLRWGLIAEACALLDWFTNALDDRGTQWQRRLHRILDGLAPGASSAA
                     PGDSLTSPRGQEGGLPYFEWLEEVRCTSSTALDVLATCDDVRQLRPVCDALLRHRPAE
                     WATEVLQDSFAPLFVLSGVTRLIEALLQARDAPLARFYVTLLGRLLPRCPCPTQLEVL
                     LRLVHRLATVLTTTHLSAADYAAPDSLYGAALARWQRLKTALEHADAELSDADNADGS
                     RHVGWPRQSTAGLAWDARKHLQSFCAHSRVENSCTAASAQITPHSPAVSLGTVVVLCY
                     VPASSQSEGEGLLWLRRTRTSATCPSEEQRVQDQRLRGLTARCSVGGALRSCAAEVTD
                     VMNRNRAQLMRGTASAVGETGRFLDSQGQRELTASTSSACQRAGDGAAAPTETDAQRQ
                     RRRKEAWWCERFELDDRIGRVAASMQDALGAAHMLLLGYPSTSLGGQLQTLAARFACE
                     CVRLRGASHCPPMDALQHVTLQVLAAAPYLWKDETPPRGQTTCWYGPRNARSCACCMQ
                     TVKRAHRMLLEAVTALGQLVAAATAAATESSLSCALASEPANVEECWLALLADRSVQG
                     VVEEMVPAVLNAYYHELTPDAAANAPGDEEERRHHHADLLLVPREHVYLVLDGELHAL
                     PWEALGVCQERSVSRVPSLEYLKHCSTDASAVSLQRLFVHRDDAALQHGPSSLTDLIA
                     QHPRWEVVYGETLQAAAAAARDGSSAVTSPLMRRLLSRCEAASDRIDTYVYAGHKGGE
                     HLVPRGALYDWIPAAAGTPPTLVLLMGCSSARMQASALYDCFGLPFAYLSAGVSCVLG
                     CLWDVTDADIDRLTGRFLQVASQATANGEGITVGECLAVARRACKLHYLTGMATVFYG
                     VNCYVTAAREDDSKGAA"
     gene            complement(<707457..>708305)
                     /locus_tag="LMJF_20_1690"
                     /db_xref="GeneID:5651516"
     mRNA            complement(<707457..>708305)
                     /locus_tag="LMJF_20_1690"
                     /product="putative SNAP protein"
                     /transcript_id="XM_001682863.1"
                     /db_xref="GeneID:5651516"
     CDS             complement(707457..708305)
                     /locus_tag="LMJF_20_1690"
                     /codon_start=1
                     /product="putative SNAP protein"
                     /protein_id="XP_001682915.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651516"
                     /db_xref="GOA:Q4QCN3"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN3"
                     /translation="MSSADSMFADADKKTKKMFFKDFEGAFDLFNKAGVRYKLDKDYM
                     RAGEAYSRAGDCAVKLGDKAGACMAFADAANAYKKIDAGKAKTMVDMAVRLQLENNRL
                     SGAARLLLEFATSLEEQGSGMDAIPYYEQAMQYFNAEDQKAQAQKCMIAIGKICGEND
                     QYGKALMYYERIANEMLGGPLKFQAQDYFLRAMLCRYAMVNNDNRFEGSEECRDALQQ
                     YMSADIYLKNTREAEFLQLILEAVTDNDMEKFELGVSLLQDIRKLDDWKTHVLLVVKH
                     NMESLT"
     gene            complement(<709244..>710083)
                     /locus_tag="LMJF_20_1700"
                     /db_xref="GeneID:5651517"
     mRNA            complement(<709244..>710083)
                     /locus_tag="LMJF_20_1700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682864.1"
                     /db_xref="GeneID:5651517"
     CDS             complement(709244..710083)
                     /locus_tag="LMJF_20_1700"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682916.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651517"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN2"
                     /translation="MSAWSNRNLAAMLKEQRASPATMVAPLDKATDGDVPKRPVVSVE
                     PKKPEPPAPAAAGVVAAVSTPTEPVPTSGPASGTEVVYTSIGPVSMPQALAKLVMPSE
                     FRFAGSVEAPKPVATLQPAVTQQPAEAAPKPVAIAPPIPVAVAPAPTVTSSSDLQQSL
                     SQQQHQWNPPQPAYNPPVNDYVHRYQGALPYGGELGSVPRFYSTERQYNAQPYHPTYH
                     TPYYRSSYSSSAIQYDGYGDMYHSHYSGQGAPYMGGRLQAHPPYYPPRDPSLQQRPAA
                     QYN"
     gene            complement(<710641..>712449)
                     /locus_tag="LMJF_20_1710"
                     /db_xref="GeneID:5651518"
     mRNA            complement(<710641..>712449)
                     /locus_tag="LMJF_20_1710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682865.1"
                     /db_xref="GeneID:5651518"
     CDS             complement(710641..712449)
                     /locus_tag="LMJF_20_1710"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682917.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651518"
                     /db_xref="GOA:Q4QCN1"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN1"
                     /translation="MSVSLPPPSTEGHGAVQLHEHSNANLLKIDTHDTYSTVGAIKKL
                     IVKAVPAEEREAPPQPLLKGLIRINKNPKNAYLFMAFETPEDRAAASAVLQTISHRGR
                     PWTETAVSPRDLELTHKGGVKRRRDGDNGNGSSKLTQYEHLHMEEQLDCKKRHCLNVM
                     RRILPAGVYGYAAFQDRFAGILTSPMTEGYRNHVNLSFGFCADGSTPALGFQQGSLVE
                     GTAAVLPATLPDKDIVTMNSAAKVVAAALMGVCMEFRDVARGALDVFDKVKASGFWRK
                     LQVRHNVKGEVMMDVEVDVASTTADVWTAVRQRLVEVFTSEEMRVKLVAATGLSTAAV
                     VSLQCHTHTGISSLPLDVPREVLYGAPTLTEYLAELCFELSPTAFFQVNTPGMEKMLT
                     KVAEVAELSTGTTLLDLCSGTGTIGLTLSKHVKRVIGIELVESAVANARRNAQQNGIT
                     NAEFHCGRVEHLLPSVISSLPAEDRGDIVVILDPPRAGVNSTVLKWIRGMETIRRVVY
                     ISCEQKALERDCPGLTKPSTKSYRGTPFEVTAAFAVDLFPHTHHVEMVAVLTRRPASA
                     AAPASELAPASAPAPLSAERVAEEETVADANGGCVE"
     gene            complement(<713192..>713929)
                     /locus_tag="LMJF_20_1720"
                     /db_xref="GeneID:5651519"
     mRNA            complement(<713192..>713929)
                     /locus_tag="LMJF_20_1720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682866.1"
                     /db_xref="GeneID:5651519"
     CDS             complement(713192..713929)
                     /locus_tag="LMJF_20_1720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682918.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651519"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN0"
                     /translation="MSFASGLLRDISPSTRSASTNATIDSTVGDVLWDLCERMDYYVQ
                     YNIPSSWQVTELLRDNSIAIQCSPPPPTEAAEGSGAAVHGISLNCFAYKQRVKQADSV
                     RLLHVFLKRFNASVNNSLELLSEGYPPLPPAEVRAPANGSSGGAGDARTVTSAYSHDT
                     GDDEGTCQTLAKQLNSAVAEVTFTPGPGQPLAHGLCRAFYNSNGRFHYVIVVAVPEEE
                     YANSLDLMIHALASVVESRVEAAAKRT"
     gene            complement(<715134..>716390)
                     /gene="REL2"
                     /locus_tag="LMJF_20_1730"
                     /db_xref="GeneID:5651520"
     mRNA            complement(<715134..>716390)
                     /gene="REL2"
                     /locus_tag="LMJF_20_1730"
                     /product="mitochondrial RNA ligase 2"
                     /transcript_id="XM_001682867.1"
                     /db_xref="GeneID:5651520"
     CDS             complement(715134..716390)
                     /gene="REL2"
                     /locus_tag="LMJF_20_1730"
                     /EC_number="6.5.1.3"
                     /codon_start=1
                     /product="mitochondrial RNA ligase 2"
                     /protein_id="XP_001682919.1"
                     /db_xref="GeneID:5651520"
                     /db_xref="GOA:Q6T452"
                     /db_xref="InterPro:IPR012647"
                     /db_xref="InterPro:IPR021122"
                     /db_xref="UniProtKB/TrEMBL:Q6T452"
                     /translation="MLRRCLLTRLVRRSLVLFSDEKEALFERYSEIENAHSRRIEALK
                     DAGLFNDEWIATEKVHGANFGIYSTEHGKTIQYAKRSGIMPPYEHFFGYHILIPDLAR
                     YAKQGRELLTEQLGMSPSTVIINGELFGGKYDHPSVPKRRQNVMVAGRPRTITAVQNN
                     AFPQYCPDLHFYAFDIKYRKTEEEEYCTMTYDQALAIFEKISGLLYAKAIIRGPLSKV
                     AAFDVENFVTTIPPLVGMGDYPLKGNWAEGLVVRHCRRGEPDFDAKGLTIMKFKCTAF
                     QEISTDRRQGPRVDALEEVRRQSIKVSGVQLPDMESVIGDPEVLQAAHRLLDHVCENR
                     LQSVLSKIGTGPFETQSMTPTELSTLLAKDALKDFLKEADAKIVNTPLLVRREMVRYV
                     VFEARKYVASRWKDVVGQQKEADGAS"
     gene            complement(<717112..>718014)
                     /locus_tag="LMJF_20_1740"
                     /db_xref="GeneID:5651521"
     mRNA            complement(<717112..>718014)
                     /locus_tag="LMJF_20_1740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682868.1"
                     /db_xref="GeneID:5651521"
     CDS             complement(717112..718014)
                     /locus_tag="LMJF_20_1740"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682920.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651521"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM8"
                     /translation="MRLTASRALLQQAGEMCTALHWMCRIAARVPESGLSGSQLQALL
                     DDEFPSFSPSEVGAVTLKEAVLRFPELLSVEDGSQLQAKWRVRPTHAHKTQEQRASPS
                     SKPTETYTLPMMKLQQFCTKRARMHRNTYMPLEYVLSKADITDVNIVGEVLHNPDAAL
                     DVQAGVRIKPKRTPRAVVAFVDGDALPAVAVDEMCNELNVLKESSIVTIVRQPGSHEL
                     SAVDIVCPDVIPTYLSIEKHAHELRLRRPNVRHDVVYMCAASQFNIYADRVALLNDFP
                     DADVYVCCPSMIALVKPKKVIPFE"
     gene            complement(<720270..>720767)
                     /locus_tag="LMJF_20_1750"
                     /db_xref="GeneID:5651522"
     mRNA            complement(<720270..>720767)
                     /locus_tag="LMJF_20_1750"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682869.1"
                     /db_xref="GeneID:5651522"
     CDS             complement(720270..720767)
                     /locus_tag="LMJF_20_1750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682921.1"
                     /db_xref="GeneID:5651522"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM7"
                     /translation="MPLKPFAMGELEAALRQVPCESVKALPMHGRRTLLNICSRSVAT
                     LALSLLHGKEGVAVPLLKPHKPGDDPAPYHPVTPASNLCNLPEQIVSRPVRGHLEDKL
                     QPQQPGLRPHRSTADPLDLLLRKVVQPQPATMAGAAFVDCARAFDWVDNDAVITALRK
                     FSVAP"
     gene            complement(<722272..>723477)
                     /locus_tag="LMJF_20_1550"
                     /db_xref="GeneID:5651523"
     mRNA            complement(<722272..>723477)
                     /locus_tag="LMJF_20_1550"
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /transcript_id="XM_001682870.1"
                     /db_xref="GeneID:5651523"
     CDS             complement(722272..723477)
                     /locus_tag="LMJF_20_1550"
                     /EC_number="3.5.1.14"
                     /codon_start=1
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /protein_id="XP_001682922.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1550"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1550"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651523"
                     /db_xref="GOA:Q4QCM6"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM6"
                     /translation="MSFVQTLITAVQPEVVQWRRHIHEYPYVAYEEQPTADYVADVLS
                     SMPAPLDIRRLTPNSVVADLRGGAGEGPMYALRADMDALPLQEESGEPFSSKRPGVMH
                     ACGHDAHTAMLLGAVKVLCQMRDRIRGTVRFVFQHAEEVIPSGAKQLVGLGVLDGVSM
                     IFGLHVDVMRPSGSIWCRVGTIMGACNDFDIVIRGAGGHASQPELCVDPILIASEVVA
                     NLQSVVSRRVSALKAPVLSITTFEGGRGSYNVIPDTVRMRGTLRCLDRDTQAQVPSLM
                     EEIIAGITKAHGAQYELSWLEPNIVTYNDAKAYEVAKAAAIRLVGEGNYHDLSTPLLG
                     VADFSEYQAVVPGCLCWLGVGNSALGDANNHNYSSRFRMNEAGMELGVKHHVLIIASL
                     MMQTEGSKE"
     gene            complement(<724572..>725762)
                     /locus_tag="LMJF_20_1560"
                     /db_xref="GeneID:5651524"
     mRNA            complement(<724572..>725762)
                     /locus_tag="LMJF_20_1560"
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /transcript_id="XM_001682871.1"
                     /db_xref="GeneID:5651524"
     CDS             complement(724572..725762)
                     /locus_tag="LMJF_20_1560"
                     /EC_number="3.5.1.14"
                     /codon_start=1
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /protein_id="XP_001682923.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651524"
                     /db_xref="GOA:Q4QCM5"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM5"
                     /translation="MTSPISALVQEVHPEALQWRRHIHEYPYVAYEEQPTADYVADVL
                     SSMPAPLDIRRLTPNSVVADLRGGAGEGPMYALRADMDALPLQEESGEPFSSKRPGVM
                     HACGHDAHTAMLLGAVKVLCQMRDRIRGTVRFVFQHAEEVVPSGAKQLVGLGVLDGVS
                     MIFGLHVAAEYPVGTISTRPGTLCGACDDFDIVIRGAGGHASQPELCVDPILIASEVV
                     ANLQSVVSRRVSALKAPVLSVTQIVGGTGAYNVIPDTVRMRGTLRCLDRDTQARVPSL
                     MEEIIAGITKAHGAQYELSWLEPNIVTYNDAKAYEVVKSAAEEMLGKDAFVVKEEPMF
                     GVEDFSEYQAVIPGCYALLGAKPYGDGKTPLAHNCMFRVNEDAFAHGIGLHVNVIRRL
                     LIDS"
     gene            complement(<727619..>728866)
                     /locus_tag="LMJF_20_1570"
                     /db_xref="GeneID:5651525"
     mRNA            complement(<727619..>728866)
                     /locus_tag="LMJF_20_1570"
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /transcript_id="XM_001682872.1"
                     /db_xref="GeneID:5651525"
     CDS             complement(727619..728866)
                     /locus_tag="LMJF_20_1570"
                     /EC_number="3.5.1.14"
                     /codon_start=1
                     /product="putative N-acyl-L-amino acid amidohydrolase"
                     /protein_id="XP_001682924.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651525"
                     /db_xref="GOA:Q4QCM4"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017439"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM4"
                     /translation="MVGEQIVTHIPHSIVHKKTFSMQPSISFIDAVKDEVVQWRRHIH
                     EYPYVAYEEQPTADYVADVLSSMPAPLDIRRLTPNSVVADLRGGAGEGPMYALRADMD
                     ALPLQEESGEPFSSKRPGVMHACGHDAHTAMLLGAVKVLCQMRDRIRGTVRFVFQHAE
                     EVVPSGAKQLVGLGVLDGVSMIFGLHVAAEYPVGTISTRPGTLCGACDDFDIVIRGAG
                     GHASQPELCVDPILIASEVVANLQSVVSRRVSALKAPVLSVTQIVGGTGAYNVIPDTV
                     RMRGTLRCLDRDTQARVPSLMEEIIAGITKAHGAQYELSWLEPNIVTYNDAKAYEVVK
                     SVAEEMLGKDAFVVKEEPMFGVEDFSEYQAVIPGCFSLVGIRDEAFGSVYTEHSSKFR
                     IEESALQAGVMMHVGTIVKLMME"
     gene            complement(<729519..>732575)
                     /locus_tag="LMJF_20_1580"
                     /db_xref="GeneID:5651526"
     mRNA            complement(<729519..>732575)
                     /locus_tag="LMJF_20_1580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682873.1"
                     /db_xref="GeneID:5651526"
     CDS             complement(729519..732575)
                     /locus_tag="LMJF_20_1580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682925.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651526"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM3"
                     /translation="MWRTSCAARSKALSPYAQALKQVALKGVVAMGPSAKEMEIDMYK
                     RGTLPADYRPPVQGKWDDTIERWAYAWQFPAEEEVEDVVTSVERNGKAMQDLLEFGER
                     LASSPPSTVPKSGRHSTRYKVLLAAAEQRPLLVPSQKYDLLEGDLNNLSSTPDEEVRP
                     VMAVEQFSQETNIPIAYLDDESERTNASKELSVIMGGAGLDFTEEGLVVVLTALARQH
                     YYDAARAIFLFAADVGLGPNAEMYKALMKHSSSLGKVNDSMALIEEMKMRGITPRIGN
                     WHELMRSFHNAGDYSAVAQIVDNMKMYANIEPNEVTFALQLRALSKDTSQMNSLAESV
                     QLFDQMENVYGFIAARPHYDALMFSLSQSPVPEMRLRCEELAQKMELMGIPWNATTYL
                     NLIRSAQVVGDVDAVERHLAKMRDDRIPVSILHLSWAVQAHVQRLIRADYEQMKEQKS
                     DIYAMWLEHMNTCFGIYELVARRGWEMQAPFVNALLRLCCQTAILSIEHLPDNARAIG
                     MFEEQANKIWADTFNEWHLKKDVYSYECYIALLAHQQRIDEAEKLFQQMVLQEDVVPS
                     RRTYECLIFMHLSSGEEGGAARALHYLEAMENARIPVRASLLKKIVRVNNAAGYKRDM
                     KRRARRIMQAREEYLARKQEGIEFPLQPSPAAGVVAAEANAAVVVQPLPVPADTTLAW
                     WERWKKTTVSKHELFAEENADGTPKGETFDEKNAALAQLNIDSAFKTPADVPALSKQQ
                     LLPKIRQQEGEMAGSLWALDGGELAYPKSGGGPEGWGVRLWRERAIVKQEYQGILDGK
                     AAVPEFSEMGKAVRVAGDQLDIEESGATSPGELADWRQYPQHRYDDGSKKPASEMAHA
                     VPASAEFVWQGEQRDPLAPYKSDEEIALESDNTFYERINEETASNTKALVEVLQNKEE
                     DVVKLTSQGPTRKSKYDYLEKWREMYRHGTLEAPEDPPLRFGRSPDDHHDSLASSVRD
                     WYRRNRKTPATEAQLQRWEAEETRSTEERSSRKALQRSKRRRLRTR"
     gene            complement(<733125..>733490)
                     /locus_tag="LMJF_20_1590"
                     /db_xref="GeneID:5651527"
     mRNA            complement(<733125..>733490)
                     /locus_tag="LMJF_20_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682874.1"
                     /db_xref="GeneID:5651527"
     CDS             complement(733125..733490)
                     /locus_tag="LMJF_20_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682926.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651527"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM2"
                     /translation="MSRATGNNNAVVKGGEPVPNKEENLPVLARVINHLLTPGSSLSP
                     IVWISFNLIMLALFGVWLMFVFAMHDNIHIWAFGFLGLGLTASTNWLMKIIFSSGLDF
                     ASQQQREAVERKSSDKKND"
     gene            complement(<733980..>737000)
                     /locus_tag="LMJF_20_1600"
                     /db_xref="GeneID:5651528"
     mRNA            complement(<733980..>737000)
                     /locus_tag="LMJF_20_1600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682875.1"
                     /db_xref="GeneID:5651528"
     CDS             complement(733980..737000)
                     /locus_tag="LMJF_20_1600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682927.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651528"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM1"
                     /translation="MLFVSPDRRRVLGKSTRVQDRHGVIWCIRYDSRECICVSSDTMT
                     VIPVIPESEGAIIRTKEFEGGSVASVAASQTEPDCFFVAHGESRNLTVVHGDSGRTLH
                     KETLSLLSEEPDPALDVARVIPTIYAHGCSGVSLLAVVYPDAVSFTAWEGHLLVSTAA
                     VKNELTTSFGLAFWKGTADGARLCVVRSDSRCLMYDVVMSKSLPGVEEIVVAQQVTLP
                     SHVACLMGGVETGVFLCWRSGTSLARYTALLQSRAEENKFEPIKVCSAVRPSLASTSV
                     LLLEVVPIYGSYGVVCLFSTGECHLSLYSKPGTVLLAVEEHPYDATSCLAFEGDAGRY
                     SCVLGFNAGDIKVFVGGQIQANVRVAHCGAVDRLLKLPKMNETDDTLFVSMSTEMGTV
                     CCHAGANAAVSRTMCSPSRPLTACLLNRKLEYMFLFSEDTGNLWHLPTCRLERAFRSP
                     PGTLDRQLDNLLEHHWASALSIIRYRFVGGEHYAIRIDVDCLLSGLGVGEQSLKRSSL
                     EYSSALRLMLGCLGESCPPSLPREDALCEVLDDLGLVVTGVQTHECVWCAILLLCGLL
                     SRTSDGACASAICCIIESLGDKLTSSLAPDPYRQADAVQHLLSRFYTLRRSTPAAFRH
                     ALRLMATKMSVCSLADVVNLLRSRALAAQSPEAAGDEAAGALPLIESESAFTALLVLL
                     SLASQRADYSLQAETPLFSLLRQSTVEAQRAVRAALDDDHTLSHRSATLLGLVESHAT
                     LCALGETNPFQSFVKALVREAFRGSGEETKQASLEALERLVGQDPQGFLSTYVVTDFH
                     LNAECRPYIIVFLAHFVKNFPYEAYTVFSTIADIFVSGLSDLSSVSKDAASIYHTAVS
                     QLLRVTTASLPSVSLQQSLRHLAVGRSDGKVVVYNVKAASIVTAFQAHSAPVLAVAYS
                     GNTSTLDIATIAETLDEIKVWRSPNQSSSLTSFFSGSGSTSFKLVAAAPVPSMGLRGE
                     SLSLLIKYFQLNWLSPQCVEFSSPYHGKVQVALP"
     gene            complement(<737803..>738567)
                     /locus_tag="LMJF_20_1610"
                     /db_xref="GeneID:5651529"
     mRNA            complement(<737803..>738567)
                     /locus_tag="LMJF_20_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682876.1"
                     /db_xref="GeneID:5651529"
     CDS             complement(737803..738567)
                     /locus_tag="LMJF_20_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682928.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651529"
                     /db_xref="UniProtKB/TrEMBL:Q4QCM0"
                     /translation="MQEDTVLFASCFLLFFASHAGTYIFFPLTMAPLSVAYISGTTLS
                     QFLGAAFSCMSGRKYICKLYGFIQNVHEITDDRITHESRGVVILGATSIGCSDTSAGM
                     QNMGYLTICHSPSHKLSYADTQKLQRKPGPGDATQQVLMHITSEMKSDGTARVLYSLY
                     EVGVKPLMPLQLKVDNLVGVLGGFAKLSNAYARNVSLTAALPANVGAGNEMEMVEFED
                     PHAKELEALAREKADLTKRLLELNRKLSNCRRSEMS"
     gene            complement(<738892..>739782)
                     /locus_tag="LMJF_20_1620"
                     /db_xref="GeneID:5651530"
     mRNA            complement(<738892..>739782)
                     /locus_tag="LMJF_20_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682877.1"
                     /db_xref="GeneID:5651530"
     CDS             complement(738892..739782)
                     /locus_tag="LMJF_20_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682929.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.20.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.20.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651530"
                     /db_xref="InterPro:IPR007051"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL9"
                     /translation="MKVYCIYDGKNVKGEVVNRMAESFKLKIDIPASWREGPCERLLT
                     FFLRTLKAKRDVDVAADEVVMQCSGLVIRLRDSIGSCVSDYNDIVILHKIPEKVEGTH
                     EGELKCTNFGCNEYYKEEENTDNSCHYHSKGPVFHDLEKHWGCCEGKKAFDWESFEQI
                     PKCCVGRHSTSNKPFVFPKEEVLNIPLSASQVAQASAASSGMHDGKRTTGPREFEGAA
                     FAQTQPQEIVDGKARCRNFGCAKEFVVAENTKSSCRYHKEGPVFWDTYKYWKCCPDKK
                     CLEFDDFVKVPGCCEGAHRL"
CONTIG      join(FR796416.1:1..742537)
//
DBGET integrated database retrieval system