GenomeNet

Database: RefSeq
Entry: NC_007262
LinkDB: NC_007262
Original site: NC_007262 
LOCUS       NC_007262             772972 bp    DNA     linear   CON 18-JUN-2017
DEFINITION  Leishmania major strain Friedlin complete genome, chromosome 21.
ACCESSION   NC_007262 CT005260
VERSION     NC_007262.2
DBLINK      BioProject: PRJNA15564
            BioSample: SAMEA3138173
            Assembly: GCF_000002725.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Leishmania major strain Friedlin
  ORGANISM  Leishmania major strain Friedlin
            Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae;
            Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Rogers,M.B., Hilley,J.D., Dickens,N.J., Wilkes,J., Bates,P.A.,
            Depledge,D.P., Harris,D., Her,Y., Herzyk,P., Imamura,H., Otto,T.D.,
            Sanders,M., Seeger,K., Dujardin,J.C., Berriman,M., Smith,D.F.,
            Hertz-Fowler,C. and Mottram,J.C.
  TITLE     Chromosome and gene copy number variation allow major structural
            change between species and strains of Leishmania
  JOURNAL   Genome Res. 21 (12), 2129-2142 (2011)
   PUBMED   22038252
REFERENCE   2
  AUTHORS   Ivens,A.C., Peacock,C.S., Worthey,E.A., Murphy,L., Aggarwal,G.,
            Berriman,M., Sisk,E., Rajandream,M.A., Adlem,E., Aert,R.,
            Anupama,A., Apostolou,Z., Attipoe,P., Bason,N., Bauser,C., Beck,A.,
            Beverley,S.M., Bianchettin,G., Borzym,K., Bothe,G., Bruschi,C.V.,
            Collins,M., Cadag,E., Ciarloni,L., Clayton,C., Coulson,R.M.,
            Cronin,A., Cruz,A.K., Davies,R.M., De Gaudenzi,J., Dobson,D.E.,
            Duesterhoeft,A., Fazelina,G., Fosker,N., Frasch,A.C., Fraser,A.,
            Fuchs,M., Gabel,C., Goble,A., Goffeau,A., Harris,D.,
            Hertz-Fowler,C., Hilbert,H., Horn,D., Huang,Y., Klages,S.,
            Knights,A., Kube,M., Larke,N., Litvin,L., Lord,A., Louie,T.,
            Marra,M., Masuy,D., Matthews,K., Michaeli,S., Mottram,J.C.,
            Muller-Auer,S., Munden,H., Nelson,S., Norbertczak,H., Oliver,K.,
            O'neil,S., Pentony,M., Pohl,T.M., Price,C., Purnelle,B.,
            Quail,M.A., Rabbinowitsch,E., Reinhardt,R., Rieger,M., Rinta,J.,
            Robben,J., Robertson,L., Ruiz,J.C., Rutter,S., Saunders,D.,
            Schafer,M., Schein,J., Schwartz,D.C., Seeger,K., Seyler,A.,
            Sharp,S., Shin,H., Sivam,D., Squares,R., Squares,S., Tosato,V.,
            Vogt,C., Volckaert,G., Wambutt,R., Warren,T., Wedler,H.,
            Woodward,J., Zhou,S., Zimmermann,W., Smith,D.F., Blackwell,J.M.,
            Stuart,K.D., Barrell,B. and Myler,P.J.
  TITLE     The genome of the kinetoplastid parasite, Leishmania major
  JOURNAL   Science 309 (5733), 436-442 (2005)
   PUBMED   16020728
REFERENCE   3  (bases 1 to 772972)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 772972)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR796417.
            On Jun 1, 2012 this sequence version replaced NC_007262.1.
            Data release policy www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..772972
                     /organism="Leishmania major strain Friedlin"
                     /mol_type="genomic DNA"
                     /strain="Friedlin"
                     /db_xref="taxon:347515"
                     /chromosome="21"
     gene            complement(<4973..>7417)
                     /gene="SCG2"
                     /locus_tag="LMJF_21_0010"
                     /db_xref="GeneID:5651762"
     mRNA            complement(<4973..>7417)
                     /gene="SCG2"
                     /locus_tag="LMJF_21_0010"
                     /product="phosphoglycan beta 1,3 galactosyltransferase 2"
                     /transcript_id="XM_001682878.1"
                     /db_xref="GeneID:5651762"
     CDS             complement(4973..7417)
                     /gene="SCG2"
                     /locus_tag="LMJF_21_0010"
                     /codon_start=1
                     /product="phosphoglycan beta 1,3 galactosyltransferase 2"
                     /protein_id="XP_001682930.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651762"
                     /db_xref="GOA:Q4QCL8"
                     /db_xref="InterPro:IPR002659"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL8"
                     /translation="MREENNVPAEWAPRDTHRLDPLQLLPPSQRHCGQSSAAESGEGC
                     HSRSRGKPEVHSTRASSGGKRSTGTLPRSDDCLNAVAQTPLFNSCGHPRRSAAQCLRL
                     CTRQRRLAALAVLLALIVMVHWVISQFTTNVGLQQKSSIELLNEANREYESSSPFSVL
                     VQHESAVERLTTTQRGLAASGAGSLARLDRDQLPSWTLRVIDEDCTMCFDNVTYASAV
                     AADAGRSTNKTGHHKQKGLSVFATTSAPLGLMGPMLFAMASVTDDVDVAAELPRWQWV
                     TWSYAQQRRFVHTSQSRSTGERPRHLIVLGIPSTDQPMRYPLRDAQRATWLTYREVAR
                     TENNFTGALLQLYVFAAAHRDSDYTAQYLGDTAQVAPTVSEYAAATEQHLAVEGGDVN
                     NAPPYLQCRVVLRDGWRDIPRSDDAVWRSPCAGVRTTVVTAASLVAGTSSLTALSAQL
                     SLPVTPAFTAAAQYVCHASAALWQEALHHRNSLWLDFLTDRKPTTKKKMGMGISWGIP
                     TEVGMSQKTVLWLNYAYTAFPDVPYIMKGDDDMYLKVPQYLSDLRHVRGGWQKPRNLT
                     VTIPHRGVIPPTLAINDAEECLYRVWWLYRSKLAYGNGVGYILDRRLIQAALNPFDDF
                     NALLMKLLTNPYDYRLEKEYLSLNMQHEDKHIGKQIRDHHDAVERFCPKKRVCYMADR
                     RFRAHQILRPKPVKLTWISVMAHFGMSAIPYYVHYFHKNEFKVAEEAKRLIAQGIDVN
                     TIEENATQRMHEWVASQVPSTLVGLGASFDLDWVRGDPRTAYTVAEEDEVAVYDVRYK
                     LRRRNDIACVLESDKR"
     gene            complement(9293..>9610)
                     /locus_tag="LMJF_21_0015"
                     /pseudo
                     /db_xref="GeneID:12980674"
     misc_feature    complement(9293..>9610)
                     /locus_tag="LMJF_21_0015"
                     /pseudo
                     /db_xref="GeneID:12980674"
                     /db_xref="PSEUDO:CBZ05826.1"
     gene            <10530..>11570
                     /locus_tag="LMJF_21_0020"
                     /db_xref="GeneID:5651537"
     mRNA            <10530..>11570
                     /locus_tag="LMJF_21_0020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682879.1"
                     /db_xref="GeneID:5651537"
     CDS             10530..11570
                     /locus_tag="LMJF_21_0020"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682931.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651537"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL7"
                     /translation="MKRDLCVHVPRTRNGGAFKHSEDVELHANDFEWDEKVAELTITE
                     RKHVDEYMSRCMAELSRAGLSRSLEEVPEKPWEMHFAASKHHFPLKNYIIHAFPLLRT
                     VVGRRGSPAWILECGCGTGSTLLPIMRECTSPDVHFVGFDISPSALSHFRSHEIAQSY
                     LQRNQLTLLPLAIGSSTCATIADPTAPVAKRQRIDKNATLVVDALTAADKSLQHQKFD
                     AILLVFVLSALPTVEKMLSAIKQLKGVLKQDGILLFRDYALPDHNFFRFLSKMNNKVG
                     GVAFAKGDCTTQVFFHKEFATKLFSSAGLVEVDDAPSKLTYHCNRIVNRKNGKKMDKI
                     FINGTFKLAPSS"
     gene            <12119..>12439
                     /locus_tag="LMJF_21_0023"
                     /db_xref="GeneID:5651538"
     mRNA            <12119..>12439
                     /locus_tag="LMJF_21_0023"
                     /product="putative ring-box protein 1"
                     /transcript_id="XM_001682880.1"
                     /db_xref="GeneID:5651538"
     CDS             12119..12439
                     /locus_tag="LMJF_21_0023"
                     /codon_start=1
                     /product="putative ring-box protein 1"
                     /protein_id="XP_001682932.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0023"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0023"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651538"
                     /db_xref="GOA:Q4QCL6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL6"
                     /translation="MQAKDEPGTSSAEEGSKGNRFQLKKWNAVALWSWDIQVDTCAIC
                     RNHIMDLCIECQSNPSCSPKDCTVAWGACNHAFHMHCISRWLKTRNVCPLDNKEWVYL
                     RYGA"
     gene            <12991..>13761
                     /locus_tag="LMJF_21_0027"
                     /db_xref="GeneID:5651539"
     mRNA            <12991..>13761
                     /locus_tag="LMJF_21_0027"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682881.1"
                     /db_xref="GeneID:5651539"
     CDS             12991..13761
                     /locus_tag="LMJF_21_0027"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682933.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0027"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0027"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651539"
                     /db_xref="GOA:Q4QCL5"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL5"
                     /translation="MSLLRCTAHRLCASTGSCLIDPLASSSRVAPHNLQLIHTLGTRQ
                     FSLFGEGINHSKLLVQCTVASERSPKYEGGKNAALRGKKASARGPVEFECQLSNMCRS
                     FPLTLSLCCSTRAGLLLINGARFLPAGSTVLEGPECTHGQFVYHGPHMNQSHLAELVV
                     GHRSPNSPLDDIAHIEAVFFSAVRCFGSTSSTWFGHTPVHTIKPELADCIAELVRGFG
                     VDDALAEYVECKAHAVEKLERDAWARVSNSVLPNLEKL"
     gene            <14221..>14913
                     /locus_tag="LMJF_21_0030"
                     /db_xref="GeneID:5651540"
     mRNA            <14221..>14913
                     /locus_tag="LMJF_21_0030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682882.1"
                     /db_xref="GeneID:5651540"
     CDS             14221..14913
                     /locus_tag="LMJF_21_0030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682934.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651540"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL4"
                     /translation="MRKFMLETKAALGVAPKTVDYDFEEKAGNLKTINHTLSDYKSAV
                     EETRSSSQHLLTAMESMLKVLETMTRGNDIPENVRGVVGDFAQMVQKARCEFLVDFKK
                     MLDDDDSVTEIKSLAGKCKSLEARRSKVMNEYDAYREAVTKKEAEYRKKGKDLCDSKL
                     YEEASRRDSLKAGFQKIDKEFKDTYAELEKKKLHSYMAALSTYLASTSQLMGSIHKEM
                     ESTRRKADMVNI"
     gene            <16381..>17118
                     /locus_tag="LMJF_21_0040"
                     /db_xref="GeneID:5651532"
     mRNA            <16381..>17118
                     /locus_tag="LMJF_21_0040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682883.1"
                     /db_xref="GeneID:5651532"
     CDS             16381..17118
                     /locus_tag="LMJF_21_0040"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682935.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651532"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL3"
                     /translation="METMMKIKTALKLAPSTCDEDYNRRKREMKELSSAIRSYSTAME
                     KAKVSVRRLVEALTEASKAFESLCNYPSIPDSTKDCALALAASMNRIEDTAFPEFNVA
                     MDSTVLTATNGLKALYDECERLEGKRNKIMHEYDAYREEVAKKEIEYLRKSKSLLKSK
                     YYSTEVARRNELEAAFESADQKFKDIHNQLTQSRLVTCTDALNAFLSCMSRIMEDISG
                     EFEGLKGSSEYVEPVVHNIMCEGYESD"
     gene            <18392..>19093
                     /locus_tag="LMJF_21_0050"
                     /db_xref="GeneID:5651533"
     mRNA            <18392..>19093
                     /locus_tag="LMJF_21_0050"
                     /product="putative Qb-SNARE protein"
                     /transcript_id="XM_001682884.1"
                     /db_xref="GeneID:5651533"
     CDS             18392..19093
                     /locus_tag="LMJF_21_0050"
                     /codon_start=1
                     /product="putative Qb-SNARE protein"
                     /protein_id="XP_001682936.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651533"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL2"
                     /translation="MLASDPFNDSVKELREVVVRAKLIEQQLTQKGVISPSSVAELRD
                     AKETAEELLHFLKEMLRVVDERGGKVQGKVFSANEIMERQNIVRSLEGDVGEARSFYE
                     KIAASAAQRQRVAEAAVGSPSESCGVAADGFISAQAFAQREEEKVQDEVLDRLTFGLR
                     ELRETGLHIHEELDTQEVMLDNVDRDISGVQVRLRAANAKVDKLLASLSNKGKVCTIA
                     VLIFVLVFLAFFGFG"
     gene            <19684..>21165
                     /locus_tag="LMJF_21_0055"
                     /db_xref="GeneID:5651534"
     mRNA            <19684..>21165
                     /locus_tag="LMJF_21_0055"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682885.1"
                     /db_xref="GeneID:5651534"
     CDS             19684..21165
                     /locus_tag="LMJF_21_0055"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682937.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0055"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0055"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651534"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL1"
                     /translation="MRVTTELAGLVRRLPPQAYERVLLLLHCLVASSEGSQGSSNPQK
                     LFLQVICDVVLCACPGPVPRFLFALSCNDKLFRSADCGLTWRLCFSRSSEPLKASTAG
                     VQGLLDDVTSLLKSTESTDDVAGGEEASSVVCCADGYGDVVALCGRNGFLAVSGDKGV
                     TFTTATNYLMGDFGEKAHLRHICVLDTDRVLVSDGLRVVCVTVECTGCGPLALGKAHV
                     ALVCSTQICMLRACSFGGGARGAVVAENRKLHLSFDGSASFMEVRHSLGRIRGFNTAA
                     ALRHCELPDFPHATLASSMGLQSTEASPSPPRSASVYDYVSGCKYDAAVGKGDSAAAV
                     TQFEAGALRHGADVFYRFFFVAGCGTEVLPYDYTALLCVCTRREGNHVAVMSTASYVS
                     YIPFSQSRSHDRLLCTVTRNSGDGGSYLASRGSVVGTSVSRDLDRWSTPHGAAPVGLL
                     AVGGGDILACGRNKVVWRVEGDAEAHTISHDTRVPVLSAAFSM"
     gene            <21795..>23069
                     /locus_tag="LMJF_21_0060"
                     /db_xref="GeneID:5651535"
     mRNA            <21795..>23069
                     /locus_tag="LMJF_21_0060"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682886.1"
                     /db_xref="GeneID:5651535"
     CDS             21795..23069
                     /locus_tag="LMJF_21_0060"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682938.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0060"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651535"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q4QCL0"
                     /translation="MGNTCTKTGEVVDNRSNGTSGNKRFNRYRTKQYAKPEDVPSPPA
                     NNERVADLKKMTVVKKIEALQHMLKPVVSVVLSELLHEDFRQFTSVFARGKAALAVAS
                     CAQVQRPRHILAAGEDRSVALLNYETGHVMQRWVHAHQNDINCVTTPTSSGVFATASR
                     DKTVKVWNLTSDSSLAELRGHALTVTSIDTNPGCNLLVSGSKDNTVRLWDVNRAEELF
                     CGDVKLNIVHFVRFMSSMNCVAQGGEDLAVRLWDVRTKGTYSDLHLSKTIEGMNYYPV
                     CCETIPENPYMLLTGHNGVNDCGSYVAQWDVRTGKRVALYKGHGATVSSVRMVAASVY
                     GNGSFFTSSDDGTFGVWNLEDGEASGEVQLSVEHRFCLPEGRVTTFEAEDNGDIVIAL
                     ENGCLVVLRPAVKGDSVVPSLRLRYVGVLTVQ"
     gene            <24119..>24976
                     /locus_tag="LMJF_21_0070"
                     /db_xref="GeneID:5651536"
     mRNA            <24119..>24976
                     /locus_tag="LMJF_21_0070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682887.1"
                     /db_xref="GeneID:5651536"
     CDS             24119..24976
                     /locus_tag="LMJF_21_0070"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682939.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651536"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK9"
                     /translation="MESAAKCVDATSRCLRLFNPTRTITQSKGMTMLAKLYGTGAAPH
                     ERVITFLTHIRDTFDGVLPVEIALSGGHCLQRLDPSAADEYLLAFVTDWLALAAAADE
                     QADPFRRRFRDRLSTGNAQKTFHLHFRAVVLLQIECAAQSGHKHVLAAYNTQAMDAIL
                     TPFTREELQKYEATCWQEAARHREMESVVAVPFVSAAPASSMSSALAPDKQQGTQRGT
                     STEVRRGGAVAPLSSGIPNWRHDAIRILAFLLLALLLRFAWRPLARALKSVLQVTRAA
                     PARQRTLTL"
     gene            <25588..>27240
                     /locus_tag="LMJF_21_0080"
                     /db_xref="GeneID:5651541"
     mRNA            <25588..>27240
                     /locus_tag="LMJF_21_0080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682888.1"
                     /db_xref="GeneID:5651541"
     CDS             25588..27240
                     /locus_tag="LMJF_21_0080"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682940.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651541"
                     /db_xref="GOA:Q4QCK8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK8"
                     /translation="MCACVGGVTIEHTAYIQLQHVTSITRSLHCCSSWRAPFLPRISH
                     SLKRFSTHTQTHTHTRGLLPSPSHTDHRVTGSTAYQRSNKKPCWTHPHKMTIADFFAC
                     FEKKHQVLFIFIVFTMNNGFAWLMFEPVANWLKTNVHGMTSRSLQLLSSWQPLVFLCT
                     FIPIMKLVTRYDGLRLAVRIGTAAEIVGAAFKLVGAFAHKSTFGLVMLNIGQIFSGVG
                     SPVATGAVSALSATWFEPEERTRATAAAVLFNSVGNSLCYIFIPTLTKKLSFSAVTVY
                     ELLMAAIGLSLAWVIMPQEPVSAGICTETKEQTVLQHSAVSESKSDGDVVAHSKEDIS
                     LVSQLRSLWSIPSCVCLLVVYAWLSGGFSAWISLFADTYSKFYSEEFIGIMSFFGMIA
                     YVAGGIASSYVVDLYFSRQMKYVIFFCITMNMLCNLVFIACTPNDKSYSLWNLGQSFI
                     FFSTALCGFWNGAAAPLFYELVAEISFPVEEGVSGICISVMENVGALVFYQVVSRFFT
                     GQSMSVAYSFGMTVAVALTAAVKQRYNRSYHAYLLQNAEEDC"
     gene            <29097..>29648
                     /locus_tag="LMJF_21_0090"
                     /db_xref="GeneID:5651542"
     mRNA            <29097..>29648
                     /locus_tag="LMJF_21_0090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682889.1"
                     /db_xref="GeneID:5651542"
     CDS             29097..29648
                     /locus_tag="LMJF_21_0090"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682941.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651542"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK7"
                     /translation="MDVKYGNWKNARPRAHLMIIFLFIITDLMNIMCYILYLLPSREY
                     YGVYGSNAYITFSCIGVLIFAGVSAPLIYWPYAHGNEMSPVSRRNALCLGIIISFLAH
                     GFPMAWLELWLVTTFGWTELLQAISLFLTLLCFIIGFLVTWVAYSWKLSKMLQIRYGN
                     AAPSQSAVSAAQLARSSSRTYRI"
     gene            <30537..>30992
                     /locus_tag="LMJF_21_0100"
                     /db_xref="GeneID:5651543"
     mRNA            <30537..>30992
                     /locus_tag="LMJF_21_0100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682890.1"
                     /db_xref="GeneID:5651543"
     CDS             30537..30992
                     /locus_tag="LMJF_21_0100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682942.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651543"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK6"
                     /translation="MFRISLICFPKAGCEEITRQGRRVVLKPQEYFAQHRMQVWQMRF
                     KEMGPPFSRVWVALGGKMRRRRIGRQIDVKDMRYYWRPIEPQYQRLYMSRLRIKDHSN
                     KRVQPMRLRATNNDIGQASSLKEWERSSDRKYGAALAPPKKRDFEFRVF"
     gene            <31892..>32473
                     /locus_tag="LMJF_21_0110"
                     /db_xref="GeneID:5651544"
     mRNA            <31892..>32473
                     /locus_tag="LMJF_21_0110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682891.1"
                     /db_xref="GeneID:5651544"
     CDS             31892..32473
                     /locus_tag="LMJF_21_0110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682943.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651544"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK5"
                     /translation="MMESPRSLSGREEVRVFQSTLDKRTVTTTVFAQPSFYMGLGSAL
                     VMVLTQRFPEELMLRKYLSMSYNGIRAPSLLAIPFCAISGMYFSVASVITAAPTPLVG
                     HLFGYGVSVGVGLTMLWLRRVSWYYPLLGLMYLSFGGLHHYRKMMVYGDNAPIFYWSD
                     FGEIYRDRKTRRLEKKRCTEDKKAMVQQERAIE"
     gene            <33215..>38101
                     /locus_tag="LMJF_21_0120"
                     /db_xref="GeneID:5651545"
     mRNA            <33215..>38101
                     /locus_tag="LMJF_21_0120"
                     /product="putative calpain"
                     /transcript_id="XM_001682892.1"
                     /db_xref="GeneID:5651545"
     CDS             33215..38101
                     /locus_tag="LMJF_21_0120"
                     /codon_start=1
                     /product="putative calpain"
                     /protein_id="XP_001682944.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651545"
                     /db_xref="GOA:Q4QCK4"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR022684"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK4"
                     /translation="MGTTQSPHAYPGTCTHTHTHTESEPFPAMPSNAELYIYYCRRSA
                     CHPNSAVKRYLDDTASSPLEVVDVSANYLGLRGLIPVLDLVKNTKTVHTLDLSNNTME
                     LEHVEHLAYCLALHPCMRTVRLCNDGLHDGHVDALLQLLGENASIEHVSIEGNNLTVA
                     SVQAIARALEKSKAVRAQRRREEEEHDSYLKSHTPRARLSFQARLSDHISAGESGGYI
                     HYATWWRNPQYSVKLSRSSRVSFVLECAHAEAANQVGMLLMRHDGVHRVVEILADTLV
                     VESSIEDQRCTMEAHLRMDEAYVVMPFSFNVGRAVDFTLAATLRNDHAAQEEGWITVE
                     RLNARYDWCMRTVEAAWTSDNAGGGPDCPSWRRNDMYHLTCANTAAAPGQQQPPSFMA
                     TVHVLLMKEADPYENDSRAIGLDVVTYDVHNATAPPLLCTPEVVRASHSHQRKTFISL
                     QFSMPVAELDVFVVPSTAEAGQTGTYSITVFSSVSVDFTRSAFPHGWRYRTVTGHWDA
                     DCCGGCRQLYQSWKNNPATEVCVEDAAKSLVACVEVHAAEATTAAQNAEKQMATAAAQ
                     ETPVAMERKTELEELRQRHRSSKREVCVAVVSCSPPSYAELAVSALSEKSAMAVANDI
                     QQPVFVVPMLRHAAETGAYTLELFSSSSFVVCGATQSLAVRQREAQLAAYSAENGRRA
                     AQQNAEQQSCRGGADMPALREERRAILDRLYATDLPFVDRDFPRGTSSLFLDPADAPP
                     LNFPAVTEWRRASQLKVSLHARGGDATFMSPPSPYGPRHWFASVLNSVAAKPGWLSRV
                     FVDYFREAGFAQFAFYKQNDWVGVTVDDYLLVDNQGALVYGHGAAADDALFPLAEKAY
                     AKLHRCYEAMELKVCPQQSLLELLRQGLMDVSGGYCSTMRVRPTDGSELPENEREALW
                     RQLKAGVSRSVLCALMLDSRSTGARERSRAGLLPDRLYGVMDARFVEQQRVVKVRNFD
                     SRNDADTTWRGKWADKSSLWTETLLEVLQYRPDEDAMWMHFDEVLYYYTHLLVTEVCA
                     HTATVSGSFAESTANDPDDADLSLRNPQYALTVTRTSATAADTTPIEVHVGVHRRDPR
                     LDITRDKHTTATFKTAIGFAVLGTEDNCRRVCRITDKQLLQLVTPNRQRDAYCTLQLT
                     AEALCSQRITVMPFCEHTCDPDALYCISARCSGPATVSIAHVTPNATTTVAGQWDSNA
                     GAPDSPLWRNNPQFFLSPVEAMEVTITLRTAHPTSGVRGFTVHNTQRCSSFLTFEPAT
                     VVASAAADAVGVVPTCVVRLAGMRERRGMPYVVVPYSSGGAEDFSVEVTANRSVQLRP
                     IDPRLDWHRVRQNVSISAEKGNAGGSLAFPSWRFNTQMALTFPVEREGRLFISARRFR
                     SADPRVKVGMVLMRSGRTVNGGYRRLLAYAEADIVARSSERAGGEATLATEVSLPAGR
                     GALVLLVHADQPYKEAEVELSVYSAATVEMQPVVEWTKVLWEEGSWELGTTAGGSRTH
                     FANWINNPFYGLSVIRSTEVVVLLVQYPRDREHPKVRRYGQKKAFLPPPIEFKGRCTA
                     IELSIVKYDKDLSEVASVNAGTAAEAYLVTELLPDQPYLLVPCTSEPQHDGDFKLFVF
                     ADHPIDLFEAEKPRLPYV"
     gene            <39462..>41900
                     /locus_tag="LMJF_21_0125"
                     /db_xref="GeneID:5651546"
     mRNA            <39462..>41900
                     /locus_tag="LMJF_21_0125"
                     /product="DNA topoisomerase 1A"
                     /transcript_id="XM_001682893.1"
                     /db_xref="GeneID:5651546"
     CDS             39462..41900
                     /locus_tag="LMJF_21_0125"
                     /EC_number="5.99.1.2"
                     /codon_start=1
                     /product="DNA topoisomerase 1A"
                     /protein_id="XP_001682945.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0125"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0125"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651546"
                     /db_xref="GOA:Q4QCK3"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK3"
                     /translation="MLRRSVRALEKLVIVESPNKVIKVEGLLSDPKVIPDWSFNNSKL
                     RAISTGAEKAIAMATTGHFMSLKELTWSPQSSSPASGVTAADFPANGLLVSFSLEWEL
                     IPGRRIQDTVSHYIEEKADNLTEIIVATDPDREGELIAVHAQNLIRRMFPQLNAPFTR
                     AYMHSITADGIRRAMEERHEAFDYNLANAAEARHAMDRIFGFLGSSVVRYANPQMRSI
                     GRVQTPALILINDREDKIKSYLESHASTFEIQVVCYFTSKHHQRFSQVVKVTPARKGG
                     AAPVDWSDKATVKQRCEQWALSSATHFSVSPGAKPQETVTPPPKPFTMATLIARANRQ
                     LHYSSDMVSSCLQDLFQMGYITYPRTDSTRIDESILPSIYAAVRREHGKRLLQEQDGP
                     SKAGVRRSTAQKEAADANVEDAHEAIRPTNIDTTVEELGAVSAPMKHIYDLVRRNTMA
                     VHMIPMKTERIVVLVACKAANGEEVEFELQGKHVVEPGWSAAFHGSKGTATPVTETDQ
                     DVEAVEDGGVVVPSISDDEFKAIMDIAAQRGGGTGVQKGSMQLESAQVAENRPSPPLP
                     FSEGGLIEQLKNNGVGRPSTYPMIVKTLLARNYITVNKGRCETTPVGRMLVDTSRATF
                     PSIVDIGFTSAFEKKLDRIAKPRSTKELALPPNVSDADYVLSSFISNFLNYVTEATKA
                     QRVAITTRSLALQQEKRAASNTPMSPTDFQANLEKETKRVLTQVPDLVDNMKSYRTFT
                     ALQNSLNDYLRRNFPPSAAAMAPASSSGTARSYGSSSSSSSSTKKKESYGATYRVDKK
                     TPRHFRAKLKKAKK"
     gene            <44069..>49237
                     /locus_tag="LMJF_21_0130"
                     /db_xref="GeneID:5651547"
     mRNA            <44069..>49237
                     /locus_tag="LMJF_21_0130"
                     /product="putative serine/threonine protein kinase"
                     /transcript_id="XM_001682894.1"
                     /db_xref="GeneID:5651547"
     CDS             44069..49237
                     /locus_tag="LMJF_21_0130"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase"
                     /protein_id="XP_001682946.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651547"
                     /db_xref="GOA:Q4QCK2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK2"
                     /translation="MRLRAPLGTHTAAFRAGGTPAEEHTSTGMQGGMEKTTSRDVDDE
                     SAFTALSPSAGEKEMVHGGSAASSLYCFKDTLRIELPVISSEHCATPSSPVDGTGTGS
                     PETAIYHPSETAFSRETAECTPLSIEEDNARRSAVALLQAGILSKSAGGSSGRGASKR
                     LPSFIPTFSNLEPVEAMHKKSPVNLFTNIRRKNICSLSMSAGILQREMSMEADRTSGG
                     EPDGVIPCSGALNRSSGSFELHPALTTVIAQGGSSAPPSPGQQQRCGSTFTSPAPSQP
                     ASAISLTDKESEESGDTSDQGIEMDLVLRDASKIRGLRLTWLLYMLIVMVIVLFVLVL
                     VQITYETRRMLTRSATEAVQAQAASLLNSVDMQQYALEKLFEVIHETKITGFSHDPVT
                     QAIVREIICSSLHRAPIAFAMYDETEELQWKASCRRSNAADMLVELPHAIAPDIAFVR
                     IFDYGNVALACRTFYTSSGRVETYVVMTEKETLGRTLMNNQMADYSSATLQSVMTAFF
                     LPRWNTTKLTMLFHTLTKETRSYTETLTSPSAAALMNTFESFCYTDSPYVWHTVLTSV
                     YALDIENSPTNASDWPATTTNPIPTPRFEYKRPWGQLSKANLCGVKCVSAEGDKCTFD
                     NPTNVWFLVDHSMAHLESIHTTVAIVGALSVMAVVIFSFIMFLVYLSITVPVNYLRYQ
                     LMRAVGSNEMATPWQRKIVRWTYCLWLGDLTSIARSVYILSLCFRLNKKYVPDHVLRN
                     HAKQLYMRRRKFNFLEEADLTEDAMLEHDTDSDNEAESPLVGVNTVLPPSDKRFLWHF
                     SVTRSKDQADHAAHESGVGARISDGATFAEVSPVYAPRPQLPTTSCEVVVPCGRAAPA
                     PRGVGLPRDAPLNVKAYGELEDTVAMQEVSAMAAAAMTIQCSNDIMSIRREYETTVLC
                     IRIPSVALAYLISYSGAAHQHRRLMRVLLHRIRRHKGALFHCSGDCLGAVWNAFEGCP
                     NHAECAAVCAQEIANAFAPYRSDGLHVGMVLHQGTLVCGTVEYSKTAFVTAFGDGPRE
                     ALAVAELAAAVKNLNVLVTEPVKQALSGLYDCNIVDVIQLPNSAHPLLLFELSGSRTP
                     ERSLSDAHLQTPTRTEFSIDYARAFAQFRNHEFSKALQSIQKLRTHISSRNVHLLRRL
                     ERLCLFYSAQPAALPRPYHRAFPVWVNYEAIAQAGLRNDPHLTTSQSESLAAHSMNRG
                     LVYQGVPVLRNDMDCIRDFKQELQANMRRLVSPQRTTRQGGSPTLDNAATPTHDNLHA
                     SLPMRSTPLPMPMSAGVLLEISGDLSESLSAATPAKPCYVDPQENVAEMSLPPLRPAP
                     VVTVAPPCSIAEPPLVAASTAAPMACEEAKSCDGPERTGPEVSSPHGMPFPSRHLAVT
                     HSVANLPPVALAGTPDLVTASVALLQSAATHTDSINSSAQADGASCSIIQSAGLSFQE
                     TGGMRGFCVSNETLPATIKAKNGTTYLRSTRILGKGSFGCVYLGMDAHSGRLVAIKFL
                     PLPSDESGMEVIEAEVLILQRVNDTHVVQLLSYAFEGDTIVIFMECMLAGSLQNMIAA
                     FRTIPSSTARVFMRDVLRGLSKLHSMGVIHRDMKPQNVLLSFTGNCKISDFGASAWLQ
                     ELARKESKGEVCGTPVYLAPEAARGSPEKESDIWSCGIMFLQMITGRLPYSPEQLSLG
                     AAALVYQIGSGIVQPNIPDDLDMLDAEFVRACLDDDPSKRTSAAGLLQLALFTV"
     gene            <52274..>54199
                     /locus_tag="LMJF_21_0140"
                     /db_xref="GeneID:5651548"
     mRNA            <52274..>54199
                     /locus_tag="LMJF_21_0140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682895.1"
                     /db_xref="GeneID:5651548"
     CDS             52274..54199
                     /locus_tag="LMJF_21_0140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682947.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651548"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK1"
                     /translation="MQRYVGCAWGHRGGRWATTTLAMASAAATPSLLVSSSMLTTSRY
                     CTTTSASAEVPAQGDGGDALVPHLKQDMEALETLRSIAPVSSTEEIQAMIKSAKNARE
                     VRMVLERIVYTHHLCFDLLNGHGYRVAVLQTLTAVAPHASCMHEWFDCVARFRRLGFV
                     LTRTYAAEGFTTIRQWLSHEFFHRGRSPSLVTEGTAHIKELMQWCLEDRLVFDHVLYT
                     RIVFLLTMIVSYLDRQNLYRASFPEDFAKRDGIVVEWIVTNERCVDFDECVLQCDAVM
                     EELLEQMRQDIPSRPPFSFMYRLADYYFATDNVEKMIAVMEDAESYGVSVAESTTAKL
                     MQMACAFNSPQVPELLLRWRVLPPQCVLATPDMSRLLFFYSRSGGGLPCPHCGEAYNH
                     RNVSVYCWLQTPPHQRQCPALRKARVQKGELEESRELPQNADWSAQAFGLFELSRARA
                     IEWTAVEWRGFLLCCIFSPRAMEAKALMDQYLDVTEMDDFLRAACIRLLRHHAPAEAW
                     PTLKKWKQQQCNMSPIALQEALMAASMVADAATRLEHMKAVWQLLLEKDSYVMPLTRR
                     FYQRRMEELATSYAAAAASGDGKESQGGLATEREEAQLMQRVVEMQPRHVSLLDMKDS
                     AADFVVGTRRKNVYRPR"
     gene            <54986..>56056
                     /locus_tag="LMJF_21_0150"
                     /db_xref="GeneID:5651549"
     mRNA            <54986..>56056
                     /locus_tag="LMJF_21_0150"
                     /product="serine/threonine-protein kinase-like protein"
                     /transcript_id="XM_001682896.1"
                     /db_xref="GeneID:5651549"
     CDS             54986..56056
                     /locus_tag="LMJF_21_0150"
                     /codon_start=1
                     /product="serine/threonine-protein kinase-like protein"
                     /protein_id="XP_001682948.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651549"
                     /db_xref="GOA:Q4QCK0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QCK0"
                     /translation="MAASLSSSPVRHPIVDNAAVPAASHRIPPPLNGFAFLEHRRSAL
                     SHDTFIARDVRQQQHPEQQDNDPAKVIIRVYALEYLRRDEECRFALERECLTARLVVH
                     PHLLPLGAPFASKTDLFVVEKYCAGGDLYELMVSLAKEDPIASEMGAAKGEAPPRSST
                     GLPTNTVKRFMRELLSAVQYLHRTCGLVHRNIKLETLFIDEEQHLRLGGFGLCAVLPP
                     PSVVTGDREGALDAPDAPEDTASSSHEPLRLCCGSKHYAAPELVQGHPYQGEGVDAWA
                     CGVVLFALLTSCFPFDSDDGDEALFRLLCGDVEAHLAQHPAMAAIEDPQACDLVRNLL
                     RPNPNARYTVSEALEHPYLWVA"
     gene            <56635..>58878
                     /locus_tag="LMJF_21_0160"
                     /db_xref="GeneID:5651550"
     mRNA            <56635..>58878
                     /locus_tag="LMJF_21_0160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682897.1"
                     /db_xref="GeneID:5651550"
     CDS             56635..58878
                     /locus_tag="LMJF_21_0160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682949.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651550"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ9"
                     /translation="MRCWRRCWVAWPSAPSSCRRLWSLDAVMSAPQASVEGLLGQVRQ
                     QAAASPVWSVDFSALLERCFTVGCHSPPSQAQLMDRVAATLATVLSASEAPSVTTLSV
                     TLPTPEAAITVLQLCQNTSLLASLESLELVVDVAAVRTRQEGMEGTGGHEVAALLREL
                     AAHQRRRAGQSHWTSLSVRSRDTSAPGVFTLNLHAQPQHHVVPRLWDDVMVSALAELV
                     AAAPWTRVALFHADLTPSSYRARQRLWASFDSVHASLAVLDLTGVRHAHELVASRQLR
                     HLTRLSSLDVSHTQLEEDAVQCLLRDVQDGVGGWWLLQHLGLAECKVSEAVVTLLHDQ
                     HEQHARNEAPLLESLSVSGACLSSRTAFVMAMCLMQCTRLRLLQTRHCHLQPASLESM
                     AAALRHAPGLQTWVLCLNKFGDEGVAALTKHARCWPSLTDMDLSRCRLTCASVHALSR
                     ALPHWSKLQSLRLVGNDLRWQPPQTLSLASSSRVEGGENGRDTGGLFAYDPAYMKGHG
                     SSMKVPTSYELERRDRKEGRQRYKGTEEFTEAAAPIAPPLEVFGEALSMCAQLRVLDL
                     SDSAMADAQLVQLVTHFAGAALEELRLAANPLFATVPALDALVKLLWRTPSLSVLDLS
                     FTGLGDLGVSMICDGTAGRDGGVLKSMPGLHTLLLSGCAVESLGWESLAAAVSQLTSL
                     RNIALHHNRVSNVALLEELLCQLATVSSLQSVNLAGCVDSTESVRRLRDGAVCRALRE
                     RGVQVLL"
     gene            <60166..>62487
                     /locus_tag="LMJF_21_0170"
                     /db_xref="GeneID:5651551"
     mRNA            <60166..>62487
                     /locus_tag="LMJF_21_0170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682898.1"
                     /db_xref="GeneID:5651551"
     CDS             60166..62487
                     /locus_tag="LMJF_21_0170"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682950.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651551"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ8"
                     /translation="MPPSAHWGKRPREGDSDETFLRFSELSPAQKLERRRQERAEKKE
                     RDRTLAYFKSVQRALEEQGSGGGDAGALASIVDGFFSELLKLLKADSSFYILRNGTAC
                     RVVELALANALLLHVKSLLYVFLGHICELLISPVASYTLETLLASLSQGLSALADTNP
                     EGLEAELTEGGVGMHTGSGVPSSATLLSSMAEEMCENAEDLIIHDIGGRALRSVVLML
                     GGHSIRQAPLLVHPVAFPRVLGTLAEAVIKALEEGYGREYRTANPAEAWMAAVQAPAT
                     SLVVQSLLRVSNEGSVVDRCVRQRIEQLSYKGKPLLHHLLVDTLGCHVFQSYLQVPPP
                     TAVVVEGDAAAVRASALSEESDGSSEVTSVPGGDTSCCWSRAAGTVTVEVNNLLKPGS
                     DLVAQTSYVLQDLVLYAPTATHLHWLWRRVLEPRLALLFDVPALTPVLVQLVKRCAFE
                     SFTLKPFASSGLAAVGDAADSATGEVSHHGTVLPADVLKTLRKDAVHHVRYSPVPITF
                     QKAVCTSVCTLARQRAVKGAAQYLLADGALGDKGYELARFLLHLHPTASTVLQYSLDK
                     LQRDDLLAVMCHQKGSLFMQQYIKVSALAVPKSTVTHADGNKAAHVSGATAAAAAAAA
                     AAAVAESKRPLMRLFRRLQSSLGTLIYDRYAAFMLEVLYEAASLPLKEALVKSLVPLY
                     QEMRTQSSGSTPTLSTSAEAAPSVASATAEDEAGENGTHADLTPTQRRFIAYKVLSRC
                     CVEQYVHRKDDWFKLAERQCHAQRLLRRMLLSE"
     gene            <63061..>67488
                     /locus_tag="LMJF_21_0180"
                     /db_xref="GeneID:5651552"
     mRNA            <63061..>67488
                     /locus_tag="LMJF_21_0180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682899.1"
                     /db_xref="GeneID:5651552"
     CDS             63061..67488
                     /locus_tag="LMJF_21_0180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682951.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651552"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR024983"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ7"
                     /translation="MADTGHSTALPVLGEGKRGGNGSPATIAAPVSADGSMDHVALYR
                     QFCAEEGCKANSAFLRYMQDRGGHFSLERLNLGSNYLGSKGLRPVIRMIDLCQTIVSI
                     NLENNGINNDAVMGLCEVLQRHVSITSLNLSHNPISVAGGKRLLQLVEDNPRITELLL
                     NGTDIFEGSQSRIRMALQRNSATQLGSGPHMEVNKEVASPAALARAARCQPPSPPARR
                     RGGPAAANTLPALTPPKATLQAIHHHPRSADNAAADGTSPGAASTLSGAVSRRSPMNG
                     ASSSCNGFSYSATSAAASEASPRYTWHEATLGKPQPRPPPPAVASQEHKSFSLSKVKD
                     LKTLFAERARLLTEISRGEASRRAYAARQELMALERHGRPTKATASGAQPRTYPGAAT
                     TSIPLPGLLTNVDEEGSPTANTIGGGGGAENASVDTSAALYVAVSSGGEATAAVERSD
                     NAHAATPPSSLAGATAHITDAPAPATVVGAQSAEAVLADGAALSVPEERPQAHTIDDV
                     LTLTRMKLLTTEEQFTVLFDQGCREYMNRNLDAAYMAWNEAMRMAVREGQREWMAVVA
                     SNLQRLSYELLVEEGASHLEHGELDKALETFKLAYDVAMKAKNAAWERDMRTALQNVQ
                     KALFHRCHEAALLLFRRAQDDMQGGVAATTVTEDDYFVIPGTEEMVRHTAAFVREWSC
                     LLLLKEAVGMWAEATRVTARLSEAAAAPLKECVKDAVSLVAAFIAEHHFNATSPTGLT
                     WFGTDAYLYHECILLSELWCDLVAYSEQNLHHGLLSAICAAQLGELYVATFQLPQALA
                     QLNKLVTYGRTQRSAVLEAAGLTLCGRVHLQRADYAPAEAALDEALRLWTELQSDPAP
                     KVVTDSGDAGVWNRYDVALMDASSVTADEPAVACADATAVQETAASAPAKAAVAVPDR
                     LEEMRGTTGHGNSSTRFRIETHLPTDAVSVLANMCRHYKVCLLLHTYRYSAALEALEN
                     SLNEAYSDTLREKLRRNFHLSPSLDEIAAIAGVLKTPLVFYTLTTRYDWAVKECVYTA
                     EDSLCIWVVSASREMRFVAVNLAQDFKCTLSDLIASLRQRLCIEPEMAVQPDIITELP
                     SRSWQEPLRVLYQACIHPIIGYVRALDSHLLLADGIITVVPSGQMWMVPFHGLLNVKA
                     GDRYFVEEAAVQMAFSATQAAFAALSAVRVQQQDLHREVVAVQRDANHGAADALFYTP
                     FPSDTDRSVQEGAAVVEMLSAGPVQLVEQLRRHSTPEKVIFTRKVELVEDVESLRTVL
                     PRARAVHIATATTAAVPLSQVSAIDKTSSRPEDEGGLLMCTAAPMGDVGVIRAAEIAH
                     MELAAEHVILTNTNMSPQHTDGIRDDVLGLLRGFFGSGVPCVIAGQWCTPDMKPMELF
                     RYFYAQRCRPLPTSPADLSARTDTASGGSVSASNEQPSRAAQPQLVAGEAEPKEEGEM
                     VRHRALLLARSIRHLLAEEPAMRYRPRVWAGYYCIGSGW"
     gene            <68684..>70858
                     /locus_tag="LMJF_21_0190"
                     /db_xref="GeneID:5651553"
     mRNA            <68684..>70858
                     /locus_tag="LMJF_21_0190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682900.1"
                     /db_xref="GeneID:5651553"
     CDS             68684..70858
                     /locus_tag="LMJF_21_0190"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682952.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651553"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ6"
                     /translation="MSSGRRDIIFFGSIAVSILGHEVHDEAVAPQLERQNARIKLHTT
                     ARAPYAKTEEVFGLDATSPLYEIHSADFKASPTSSLTPQRGAPHPRHHRQKAAFLPVM
                     LKLAQDAAVEEVPSIEDQDGALLQLDSPTNNVDPAPSYASASVRIEVDMSRSGGDATP
                     VGTKEVFLPSLNYLAIRDMCTVVRIPVWSNTIQRSETGDVDVAELDRRSPQPQRAGDD
                     NSSSSSGVLGGVRDRNSRGDAVSGVALSVYAMVRVISLAEKVRLALEADDAVRCLLGL
                     PDPVPGVSLALTQRGDAPYGAMPLTELYKHHRQFFGYYSNTIIKHSNVVTQRLAEAPR
                     QREADASFPHRWNTLTVVDLRPALLGEDAFAPLLVTLAYCANLRALYADGNHLGDLTC
                     ARLSALFRRHRYLARVSLSKNTIHEAGGEHLLRLVRNNLRITSMPCQGNYFSDALRSR
                     IEEVARRNASVIAQDPLNIFSASYDYLTDLSSLPNSLQQQGLRTWAMLSAAPVGDVDV
                     MVRNFTTSTQRTLGDSPVVAMQRAKTALRARESFSLIPPAALAPFLNEIMRTVSVGVS
                     RVLPDPLVRSLFSDMETVVAREQEQVEAQRRDELAGGSRDASLLPPEVCDAVGGAYTP
                     PVDSETMYARSFVRIVVAALRGVALGTPWAEIAKVLEGIGRVHRDLGVMPEDYWLAVH
                     IFMTSLRISCGAECYDADSASSFLGLLALAVRTAVGTDTVLQ"
     gene            <71752..>74634
                     /locus_tag="LMJF_21_0200"
                     /db_xref="GeneID:5651554"
     mRNA            <71752..>74634
                     /locus_tag="LMJF_21_0200"
                     /product="major vault protein-like protein"
                     /transcript_id="XM_001682901.1"
                     /db_xref="GeneID:5651554"
     CDS             71752..74634
                     /locus_tag="LMJF_21_0200"
                     /codon_start=1
                     /product="major vault protein-like protein"
                     /protein_id="XP_001682953.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651554"
                     /db_xref="InterPro:IPR002499"
                     /db_xref="InterPro:IPR021870"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ5"
                     /translation="MSTTSVVKLMPHEYLHVEDTNTCEVLTLVGPITYTLYDHHRQLH
                     ETPQPCVVVPPSRCVTVKNPMHAVPASLKDKADAPLVYTLLRSSPGSITGLAALPYSR
                     WKVPYGSSELRFCDESPFPLLPGETVDEPSPMPLLTASEALTLEALAPHDVVDPVKGA
                     TVHRVAQECFLFKGPGLYTPRLDERIVSKVTGVYVSPPQVCYLSAKYDFVDDDGVPRV
                     AGEQWVVQAHGIFFAHPAVTLQMRDAYVLASFEALTFVSYKAFYDEELQVAREAQKPY
                     LISYADTKDGTYLPRPHETFRGRRRQVHLSATQYCVVINPIGAEGTARLHQAEVRVGK
                     QSFMLQPGEYCTKPLTALVLSEDEALLHVALQTYTEADGTVREGGSRWLVHGPRQYIP
                     PVYARVVERRRIIKVDENCGVYVRNIHTGKVRSAFGKPFMLGADEQLWERPISAYVRR
                     LLAEPRQSLRVTDMSAKERAESSLEEGWAATRAEWDMQASSTAAAEVAGGGCYSASSS
                     GESLDSDDDFMDRDECADELQLLDAATRNAHPPRLSRHISRYHVITANVEHNTLVRLY
                     DTSTGLSRVVAGPATVFLEPHEHFTPLSLSGGRPKEPQQIHSLSLYLGPDYMADIIEV
                     ETRDHARLRLHLAYNWEFGSVASNGKAGRVDPELAFTIPDFIGEACKALASRVRSAIA
                     GQAFEFFHCNSSTLIRQAIFTPAEDGSIVSHGDSLCFTANGLYITTVDVQSVEPVNIK
                     TRTALAKSVQLAVEIITKAQESDASHQAALLEQEAKGALDLQVMHDRAKAEQQRTELL
                     RVMGENTALEQAGASRAQALAESAARLAEAQGEVDATPIRCAAHSVGMDTELEVLRKR
                     AVLDLAHRQSLNNLAIDKIRKLSDIEATKYEQIMASLGSETLIAIANAGPELKAKLLG
                     ELGLQGFVVTDGKTPINILNMADKMAVGPSATTTPSPAAPGAARVP"
     gene            <75355..>76959
                     /locus_tag="LMJF_21_0210"
                     /db_xref="GeneID:5651555"
     mRNA            <75355..>76959
                     /locus_tag="LMJF_21_0210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682902.1"
                     /db_xref="GeneID:5651555"
     CDS             75355..76959
                     /locus_tag="LMJF_21_0210"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682954.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651555"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ4"
                     /translation="MLHEVNVGTSDIVRGGHGGDEAATPQQPPALSVVEEHIQRIRLE
                     LCGQRHPPSGYASAIAIPSTAAGLDRVAVLVDLLDQVRYWAIEEAFTFKDEPSRLAET
                     EAPEAVVACLCSQRPQLVAQALRVVQPMLRHRQTAYETRRVMVDVWAYREQVNSMVPL
                     PEGLDPLLAMLAEFLEQHKGVLPVLVEALSTATAALVQDGTACVGSDNGNDDNLDGGV
                     SLRRRVAPLVVALHETTLVYQMESAMRRHPDAVPLQVEGVSFCAALVDLPWPFEAEVD
                     SEEGTPTSLADILAHSDGVLDVLHGALRRHRQNLCIARGVLHVWRVCAQHPANRVPLL
                     QHGAYAGALQQLRGVLPYAVGVWREIAETVGYFIPLLDALQRRSLALTLRELLLRRPQ
                     LEMLELILALLLSLLMVVDSGHRGGGGKSSGAFNMYAMYPQPPEAAPSPSATDIAGEP
                     HHRGTKAVLRPSLLQWHPTRGHHPHSGASAAEEDTWHFLLERCAMPQLVSGLLEYFGH
                     CEAVDEEDASDVDRVCRLAEVVLGFF"
     gene            <77597..>78061
                     /locus_tag="LMJF_21_0220"
                     /db_xref="GeneID:5651556"
     mRNA            <77597..>78061
                     /locus_tag="LMJF_21_0220"
                     /product="calmodulin-like protein"
                     /transcript_id="XM_001682903.1"
                     /db_xref="GeneID:5651556"
     CDS             77597..78061
                     /locus_tag="LMJF_21_0220"
                     /codon_start=1
                     /product="calmodulin-like protein"
                     /protein_id="XP_001682955.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651556"
                     /db_xref="GOA:Q4QCJ3"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ3"
                     /translation="MSVLSEAQRTCAALQFLLLDQDSDGFIGSHELGTYLRAIGLYPA
                     QSDIAGYIALVDPEEQGRVSQESALALYEKLYPQRTTPEELYAALKVLDDDADGYLTT
                     TQLRHILVNLGARISQEEAEEILCDVEKDGEGMIMVDDIIQLLMPAEGEERL"
     gene            <78705..>80462
                     /locus_tag="LMJF_21_0230"
                     /db_xref="GeneID:5651557"
     mRNA            <78705..>80462
                     /locus_tag="LMJF_21_0230"
                     /product="putative actin-like protein"
                     /transcript_id="XM_001682904.1"
                     /db_xref="GeneID:5651557"
     CDS             78705..80462
                     /locus_tag="LMJF_21_0230"
                     /codon_start=1
                     /product="putative actin-like protein"
                     /protein_id="XP_001682956.1"
                     /db_xref="GeneID:5651557"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ2"
                     /translation="MPRVQLFIDNGGYSVKALYLPASADTSNRSAATHASALTSSSTH
                     GEAAATAATVAPAPKVLVVPNCVGAAVYAGTGIMGDQLDHLPHYHGLMVRRPVDRGFV
                     VDGGLQARVWEHVLQHFSIESEEEVDVWLVVPFAAPKAVAQLLWLLCTRSFRFGSVTV
                     VSSSFMSLIAYKFARGASAPSSAARKRPRSTVDTDAQESPGCSGSSATGGGMAIMVDV
                     GFSATTVVPYVNYIPVYSSVVRLDVGGKVLTNRLKEYISFSQMNVIEDTWLINHVKEQ
                     CCVVARHPRRSLQRYAALWKGRTRDEVEAAAGALSTLRREDGGSGDGQASRSQRPGAP
                     VAGVLTSPDVPIRYYLPTIPALLPLGVLEAELPSRLPKTSGVDAAALQHLLLCQERFL
                     IPELLFTPADVGINQQGVAQAITEGIFQRGLLQHLTKLLRPLLLHNVCVYGGTASQPN
                     FRDRLEAEVAAVAPQSPDCDADLDLKDSKRSSSSSRHGATEACADRTTCLSATPALPE
                     FLLKAGGASTDLSLQPLLGAWCLLSATVDSGSNGGASQRELLRLRALVHERSGIELQH
                     PPAGRVTVETFQHALERML"
     gene            <81248..>82663
                     /locus_tag="LMJF_21_0240"
                     /db_xref="GeneID:5651558"
     mRNA            <81248..>82663
                     /locus_tag="LMJF_21_0240"
                     /product="putative hexokinase"
                     /transcript_id="XM_001682905.1"
                     /db_xref="GeneID:5651558"
     CDS             81248..82663
                     /locus_tag="LMJF_21_0240"
                     /EC_number="2.7.1.1"
                     /codon_start=1
                     /product="putative hexokinase"
                     /protein_id="XP_001682957.1"
                     /db_xref="GeneID:5651558"
                     /db_xref="GOA:Q4VT70"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:Q4VT70"
                     /translation="MAARVNNLLSHIAIRDSDSEEMRYIKQRLALASLATQFTMSSEK
                     MKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPAKATGVYYALDLGGTNFRVLRVS
                     LRGGKVDDRTDSKFVIPKSALVGDATDLFDFIAQSVKKMMSENAPDDLEKRVPLGFTF
                     SFPVDQKAVNKGLLIKWTKGFSTKNVEGNDVVELLQASLRRVRVNVNVVALCNDTVGT
                     LVARYFVDTDVQVGVIIGTGSNACYFERASAVTKDPAVSARGNAVTPINMECGNFDSK
                     YKYALPITVYDDEMDAITPNRENQRQEKLVSGMYLGEISRRLIVHLAQLGCLPRGLVD
                     GLCRPWAFESKHMGMIAADQMPGLQFTRELIKRIAGVDMADISDLHTIRETCCLVRNR
                     AAQQGAVFTAAPMLKTRTQGLATVAVDGSVYEKTPSFQRLYQECITSILGSTSNVKVV
                     LQRDGSGVGAAMICALAANTK"
     gene            <85247..>86662
                     /locus_tag="LMJF_21_0250"
                     /db_xref="GeneID:5651559"
     mRNA            <85247..>86662
                     /locus_tag="LMJF_21_0250"
                     /product="putative hexokinase"
                     /transcript_id="XM_001682906.1"
                     /db_xref="GeneID:5651559"
     CDS             85247..86662
                     /locus_tag="LMJF_21_0250"
                     /EC_number="2.7.1.1"
                     /codon_start=1
                     /product="putative hexokinase"
                     /protein_id="XP_001682958.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651559"
                     /db_xref="GOA:Q4QCJ0"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:Q4QCJ0"
                     /translation="MAARVNNLLSHIAIRDSDSEEMRYIKQRLALASLATQFTMSSEK
                     MKQLTMYMIHEMVEGLEGRPSTVRMLPSFVYTSDPAKATGVYYALDLGGTNFRVLRVS
                     LRGGKVDDRTDSKFVIPKSALVGDATDLFDFIAQSVKKMMSENAPDDLEKRVPLGFTF
                     SFPVDQKAVNKGLLIKWTKGFSTKNVEGNDVVELLQASLRRVRVNVNVVALCNDTVGT
                     LVARYFVDTDVQVGVIIGTGSNACYFERASAVTKDPAVSARGNAVTPINMECGNFDSK
                     YKYALPITVYDDEMDAITPNRENQRQEKLVSGMYLGEISRRLIVHLAQLGCLPRGLVD
                     GLCRPWAFESKHMGMIAADQMPGLQFTRELIKRIAGVDMADISDLHTIRETCCLVRNR
                     AAQQGAVFTAAPMLKTRTQGLATVAVDGSVYEKTPSFQRLYQECITSILGSTSNVKVV
                     LQRDGSGVGAAMICALAVNTK"
     gene            <89468..>91258
                     /locus_tag="LMJF_21_0260"
                     /db_xref="GeneID:5651560"
     mRNA            <89468..>91258
                     /locus_tag="LMJF_21_0260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682907.1"
                     /db_xref="GeneID:5651560"
     CDS             89468..91258
                     /locus_tag="LMJF_21_0260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682959.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651560"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI9"
                     /translation="MRVYTNLGRIDKVREVLAVGLRDLAAPKELTLASPVQYAWLGSN
                     ARRRDGGNTTAATGTPLKLQDDLLAPAAAARGGKPCETSPVMWWRRPTMLNAEVFNAY
                     FEALTRRNKYAVEEVVFVLDQMKACGVEKDALTYHYLVELHVRAGYDPTGLWEEMKQR
                     EPEVTPLPATVQTFMLRVVPYSADPSLVVEITRAALRYGTAIVDKRMLAELMVQWLSP
                     VRTPNHGESSGGSGSQHTVAQASRLGLSTASPSSAAQYPPEYVFWLMLELELRCVLEK
                     ASFSQYVQRHYFTELLLRCAKCTDAGTAEQVLALMDRHAIAKTAEVLALVVWCWSQAL
                     EIEKALDLIEWMALKGYLDQVDCFRKAQIESLRYTMDRHYLMIFADAINTTTLVERAL
                     SHLQARRQKGALVTVHTLDLLVLALARIGEERKALQLVSAYEPRWGVAPRTNTYNALL
                     TGCSRHRSTMLHRVVYKTMKNSGVVPNVLTFRVLIRQAVMAGNIDEAIYYLEEVTAHP
                     GLRVEVEMILPILERAARVGDVETATRVSQYSLKCDIGIDSSVLRSVMQQLTEAGQSV
                     EVLKGQLPLHEALRSRSKAGRQRARNEVLV"
     gene            <92298..>95720
                     /locus_tag="LMJF_21_0270"
                     /db_xref="GeneID:5651561"
     mRNA            <92298..>95720
                     /locus_tag="LMJF_21_0270"
                     /product="putative protein kinase"
                     /transcript_id="XM_001682908.1"
                     /db_xref="GeneID:5651561"
     CDS             92298..95720
                     /locus_tag="LMJF_21_0270"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001682960.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651561"
                     /db_xref="GOA:Q4QCI8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI8"
                     /translation="MATVDTVRGRYSSYKLLKEVGRGGSALVYRAQDVATRKDVAVKQ
                     LFGNRPQDMEDWLREVDALHTLNSHHCPHVVKYLDHMQQHDRLFLVEEFTEHGSLLRC
                     LKENKKLPEDTACRYIYQVLTALYHMAPWGVVHGDLKASNILLFDNDVVKLTDFALRS
                     HGEDDHEDAERRTTAASTASAEALPPMRGSRAGRDAGEECSGSALSEFRGSAYWAAPE
                     ILAGASKATAASDIWSVGCLAVELLTGAPPYFERPVYNAIYHILKSYYEVLCESEASR
                     VGAGGTSCASTNPATPSAATGSGDDDGPRGPRKKKNGAKDAGGAPSQKTDVASARRAT
                     TTTSTRNPPKEPVDAAKTAASSGAVSASEQNEVATPLCEAALLPPLPEDLHVSDECLS
                     FLRMCFRPRAVDRPSAGELLHDLWFLDCTVPQLLRAAREGRPMSGTTGDESVSAGTSS
                     GSRFGVIVQWVKRNLTCDNESRCKAWLNSDALPLLVPVLTPRIMTPKYIGDVMRCFSH
                     FAESRSALATLFVNRLGSTELWGVEELTSACDADHLATLFRRCCATQDAQVPVYTPTD
                     RRALRFVLGLEKEKALACVRALHSRLVLEPTAAAMAAAASSPTTATDDTAVDLNDCSA
                     SSRDPAEPAHARAPDCVPASLQEQHEQQRRARERLLSDGGAAVLCQCVEAQCKAAFLS
                     NTAPMMEWSTMNLLFDVLCTIEPLAGGQALLWGLRADLSGGHTSPSSTVGPGGGGAAM
                     VKSLTVVVNPCGGRGGGELNSTWDKSLSGTGPPLSVSPISVSPQELIPATAAAAGGGG
                     GLLSSLGSTMRLGCHTVSGLPPDSVQWATSMSWLLAVQEAARHLCEAAGRLLTRYIPV
                     ARRCRAEYLEKAGVSLTATLLLVASSEVVSTEVRCAAVEGLPQLQASSLRAARYLRDP
                     VRCIALLALTLKRSFGAPALTSCLLTAITTMTSEKQMLAACTGCPWVWEALVSLLREV
                     EEADKAAAAGGKRSSSALHSAASTDGGAAEGADAPPALAAAAASPTSVKSPSASSSSG
                     SGSNSAAAVFADIVVLLSRWFAEVTPTALLSSAVTAAAAASEAILALGQPAASPPLPV
                     LLQTLRCQLIALSQNDRVCHGDLMPDVAKALRHLAPLEAAAVAASTSTATVA"
     gene            <96455..>98083
                     /locus_tag="LMJF_21_0280"
                     /db_xref="GeneID:5651562"
     mRNA            <96455..>98083
                     /locus_tag="LMJF_21_0280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682909.1"
                     /db_xref="GeneID:5651562"
     CDS             96455..98083
                     /locus_tag="LMJF_21_0280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682961.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651562"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI7"
                     /translation="MYKVFPVLILRAAKVRAQCLELGSLSDYGTSPSTLVAAAPSATN
                     VYTLAFGEREGLAPGERLEVYGNKVRLVRTLAYGCPRGVTPESAFTGRLKDAELAAIT
                     EQLDLLRRETRRPDTLLHTAQDSDASAQAHRSVTTAFGEEPRRPSEWMLRLPNMTNSR
                     VLRNAVPDDPQACSGRSLAAQLSKLRVSEEEVVVAEWVGKPKGASEAAAGASAWSPRS
                     SSAGVSTRADHSTSAAAAAETNPNSSSAGTISALPATPCKGGAAPPPGAGDTLLMENG
                     VCFRNPDSCGLRALRTARLAFISSIERTANGLAWRQRRQTCEEARGLTVLDASAIDFT
                     FAQAALQSTLELGLHAGAGCQISHVPLTDAAAAHVESQAATYIRVVAAGPGRALPRPF
                     DYLPTHSIDVGAYTAHLPLPVEPAAKEDGGSGGEGSAASRRGCKSSGRDARANRQQLA
                     VQLSQALATLRRGAFMLVTFVPTCSSVATLYHQMETQRRAEVLIEHKVVTEAKACIAE
                     AIARTGRWGFITDEVLPAADSAQGSSFSLIVMLE"
     gene            <98643..>101927
                     /locus_tag="LMJF_21_0290"
                     /db_xref="GeneID:5651563"
     mRNA            <98643..>101927
                     /locus_tag="LMJF_21_0290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682910.1"
                     /db_xref="GeneID:5651563"
     CDS             98643..101927
                     /locus_tag="LMJF_21_0290"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682962.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651563"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI6"
                     /translation="MLSNTRGYQRFSHTLGFHSDDLSKLSKVCHQWRETGKCKAYNRE
                     QEVRREIAAAKEAELLKKATALYTMHMELMADMAGADGGDAEALELVQGAMSRGSFPT
                     DPAKREEAIGKLVEELKQEPVYLNWSLDAAVAERLVELKVKRCPYNHRGDLNLALKRG
                     RNEEDEEEMQHRSEEEVLRGSSTNGAAAASSSSAVAATTAAGPTKAAGDNSDGGWAAA
                     RHRIFRTLTPLQRCVVCLLWQRTFQVAQGLVMDVRLALEKRVTAQHKATGRVEPPSIP
                     SSGVAAQSLSHRPHGGSQNDVKNADSEDALEAYLSSPDFEELVERETKRVVPRVAFRP
                     EFGLVDLSALPQLVAHLSAHPTCGIFLARTLTYFTGKALKRDGSSPSAAPAAASSLSK
                     HQSDDAPAPESFHHLLFPSRKRITEKELDLSTSTCADEVMEAIEWALHVYHRDAQSHA
                     ETERAEGKGELGMTGDERRLCKASDTASAHVTALFRHQRIRLHGLTLSHCQITSADGI
                     VESLHKRHLEQYLYALDLSENRLWSLRFLLVLRAHYARRLLRLSLRNNPITRKPEYQE
                     QVRASLPQLTSLDSEPIRRPPLRLPKPWPTSCTRWISDEGMPEHQEQESVLDCVARLL
                     YIWETRRIPHTARELAAFRNADRPAPVEEALNEDNFPHRYLHPAAAFSVTVSPNLSFY
                     DAATMRDARSVELDKGYTGMRLSAVDVRDARVFNVAMKNSSRNLLAGRQALQRFGRGA
                     ENCYMAYQLTLYPERMDVSHHLTDAVVSVARVPEVVTAAVSGGKAAASVATTTAASGK
                     REKSAADPGVARAAGSRKTSSHGNPTSARFGALAHRSPPLQQHVVTLHGIMTWRLPSM
                     KRNECLQASYTRVLTLTKKVLPDQNREWERLRSPPYVLMNDQVFLYPAPTAGAAVATA
                     ALLPSVFVANTATRLSRLVVEFGLEACRDGVALVRDVMERCTSPASEYAALQALVLGV
                     LGPREETDEAEEAAQLACAQAAEAQLTPLFADYLRRSPPPATAQSREYTIFSMLDCAA
                     ATTPVEPAARTTGSTQHQSNVTSAVRRLKAPAIAAAPSAVHVVSLPLLHQVTAITNVC
                     YTLSFH"
     gene            <102553..>103284
                     /locus_tag="LMJF_21_0300"
                     /db_xref="GeneID:5651564"
     mRNA            <102553..>103284
                     /locus_tag="LMJF_21_0300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682911.1"
                     /db_xref="GeneID:5651564"
     CDS             102553..103284
                     /locus_tag="LMJF_21_0300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682963.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651564"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI5"
                     /translation="MGCSASPWARWAAKVQHRCKISSSSTSATRSRPHNNLRSGTVKS
                     TPFHVKPNMSMPVWQPSAKYMKYTAVRWLSNNLFAIATYQLTLEVGFTVIFGSLLYAD
                     KITAQGVRDALAAYHYPFVNWIDAEGGVYTEPVRVGPFTLNAQKMTALHTGHNIASGI
                     LPVQVLLLVTTFVPVQHAYRLLRHAAPATASAPHPASGVGGVNAAAAAAATTTPPASV
                     STGTRRASYACATNAKKASPAWPHY"
     gene            <104159..>105127
                     /locus_tag="LMJF_21_0310"
                     /db_xref="GeneID:5651565"
     mRNA            <104159..>105127
                     /locus_tag="LMJF_21_0310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682912.1"
                     /db_xref="GeneID:5651565"
     CDS             104159..105127
                     /locus_tag="LMJF_21_0310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682964.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651565"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI4"
                     /translation="MACLLLALCILPDPAAAAVGSPSGASARSPSVAPHIGDLVPLTM
                     YIRAKRQIRHAFISVADQQLAVDEEAVVDNAEGNVEAATSVEVLRPKDLDLPSLGATR
                     GKHENQVVRLLPPAFSPRFGINKAVTIAANSTLRAAGQSLHEDKTLQQSDLAFRFSVG
                     RGLHKESTWLPLAARKKYTSQLSETLAGRLHELQAAQAADAAAERQRDEEAAEAMDNT
                     AAAVAAQKVQYLSRVTFFFGYRRGDLQKMTSFSITAQYSPEVKPGVELQFLWSEHRPY
                     NPNRAVTLCSAVAVLVSMITVLAVFHPSSRSMLLFSQRIVAVRAHD"
     gene            <106109..>106801
                     /locus_tag="LMJF_21_0320"
                     /db_xref="GeneID:5651566"
     mRNA            <106109..>106801
                     /locus_tag="LMJF_21_0320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682913.1"
                     /db_xref="GeneID:5651566"
     CDS             106109..106801
                     /locus_tag="LMJF_21_0320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682965.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651566"
                     /db_xref="GOA:Q4QCI3"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI3"
                     /translation="MDPSAVAALGTAAGAGQHHPHNGSGNGVLSAGQPSEAEMKRIRQ
                     RRRLACKTPEQRRKLQQYQRRHNEKDERLYYCDYCDLFISSRHRTWMTHLRSARHTDA
                     FQSYYDLVAHVESVWVAEINREVELARSREVHRLQQRSAGKGAATPLTAQQVAPGIVV
                     GGAPAPGRLPPPPPFPHPPHGSAQVVPTPTIRVGTKTILPPAASVASPASPLTAAERS
                     RTSEDEPRLSMP"
     gene            <107939..>111139
                     /locus_tag="LMJF_21_0330"
                     /db_xref="GeneID:5651567"
     mRNA            <107939..>111139
                     /locus_tag="LMJF_21_0330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682914.1"
                     /db_xref="GeneID:5651567"
     CDS             107939..111139
                     /locus_tag="LMJF_21_0330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682966.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651567"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI2"
                     /translation="MHPGSAGGGNAEERRQRLREQMKAFYGDPSASTKRTASHASAQS
                     NPNVPPELDLDSEYFNVNRYTTDLLKRESLKGLVETDTELLRRVRRLDGELQELVYRN
                     YARFISATETIREMKNNVVEMDAKLQTLSQNVNTIDSISSQISQQLQVHRGHIEDTIT
                     ANRMLKKVQFLTSLPTTMRRLIDKEEYSVGVKYWVAGDGFLSKHKSISSITQIQESCC
                     ELARELYRAIEKRMCSYPLDDPDAMDRLRGYVEGLRLLRATSLFESEHVADEAPFEVA
                     VLQTLMKSVTASFQANVATTQRSLKAALVIPDDLQASEMAKREASLAQVNLREPLAQL
                     KNACAMLAVNSERVHALLDVEVCSSSGSSPAAPLVAKSIEPVLLEVLQPISQSLADFA
                     MVHLDAMAMDGASALCDPTASAEALQAATAHLARLLKQLVTAMKTLGEIYLPTMEHGT
                     AGASGSAAPAAHNVVQLYANKVHEVACGVVRQCWEKVQTKLLQGPEPELLRACVPLPI
                     LNASVLSTLPAVDEERAREMAFVLTRFLYASLAQCLSTSLGANLVGEEGVPAEMLTPI
                     TAGLERTAQQLQHRGIVLLGQLEVQQVYDKAFSGSSGHVSAAATTTGPTVQEALLLLL
                     PQWSTMYEALKALPPVKAAGATEATKAGDGASSLLNRRRDNSGYGGGNAYRVGGGNNI
                     GAYSDGTGGGGSTGTRSDHRAGGGSAMVGGFSTHPRGGSGGKPAVSYTRQVMSTLQMS
                     VNHIFANTDTWLRTEPVAGPPSALMACVVRYVLQGILDRVRDEVAYTEAQFQQLQASC
                     TFLLYALVLPAKGSAPRQWRKEWSEDDMRDVQRLLDEICTCAYDKYEAKVPLSTAVLD
                     RVVEAAVRGGRVAQESVSTNSTGTAMETGVPIPPATTVALQQEETKAPSPEPPQRAPT
                     APVHVTLQPEPQQQPQKMCRPLHNGSLQSSAATSSKEAPPSAVAPLPNPSDTTPPPTP
                     HTATSAPTASAAEPPLAPATPTSASPPISSTAPVQASAVRPPAPRTAPVASLEPVAAA
                     PVTAMSPPQARRSSYYSNDSHTERLARLEEEEELPL"
     gene            <112309..>113712
                     /locus_tag="LMJF_21_0340"
                     /db_xref="GeneID:5651568"
     mRNA            <112309..>113712
                     /locus_tag="LMJF_21_0340"
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /transcript_id="XM_001682915.1"
                     /db_xref="GeneID:5651568"
     CDS             112309..113712
                     /locus_tag="LMJF_21_0340"
                     /codon_start=1
                     /product="metallo-peptidase, Clan ME, Family M16"
                     /protein_id="XP_001682967.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651568"
                     /db_xref="GOA:Q4QCI1"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI1"
                     /translation="MLRATSRLGIYEYQFGQPSLKNAFSTRITPAAKARSPGAVQSTK
                     LTNGVRVVSHDLDGPVTSIGVYADAGPKYDPIATPGLSYVMRFALQTSNMDSSLFQID
                     RTMRSTGNAYGHGEVCKRYLSWKAEGRRDMWEKPFEMLATGVVAPRFHESDIERFRDT
                     MDNQLEEMRWQNPREYAIDQLETVAFYKEPLGAPRMVPRIANDRCSHKALLDHWAANF
                     QPSRIVLAGVNVPHDALIAAYEKLPYKHSAEAPHHARAAAPKLSHSNEVAQFYAGRQN
                     VEYESRAAVMGTMPDMQAEVIGAVGVPTHGRDEGATQYATALVTREIYEEAMRSAHGS
                     RAGSEHYGAQVFYRPYSSAGLIGYTVRGAPAEVAKMLQVASSAFPAAVDEAAVKRAAH
                     CAHVRLLHDQVEMTRDYCDFLATSPNSVEELVQAISGVTKANVEEAMKKMVAQKPATY
                     ATGDSFTFPMVASLKHA"
     gene            <115205..>115570
                     /locus_tag="LMJF_21_0350"
                     /db_xref="GeneID:5651569"
     mRNA            <115205..>115570
                     /locus_tag="LMJF_21_0350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682916.1"
                     /db_xref="GeneID:5651569"
     CDS             115205..115570
                     /locus_tag="LMJF_21_0350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682968.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651569"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:Q4QCI0"
                     /translation="MERTKAECDEIAFHYPGVLMKQLFAALVLQAAVLFDWTYVHFDW
                     NFVEPITYLVGYSATWIAIAWYGAMQQEFGYESLHRFLQNAKRVRLYKAHQFDQQAYE
                     ALRVEVAKLDRVVRGLEGL"
     gene            <116155..>116967
                     /locus_tag="LMJF_21_0360"
                     /db_xref="GeneID:5651570"
     mRNA            <116155..>116967
                     /locus_tag="LMJF_21_0360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682917.1"
                     /db_xref="GeneID:5651570"
     CDS             116155..116967
                     /locus_tag="LMJF_21_0360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682969.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651570"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH9"
                     /translation="MATNSEQYWRRQLVQTEAEYEQIIQGLRDEVERQQRRCGDLVHE
                     QAMHRATVAADIRDFCQQYVANANQQQQQQARWGTAATRMLQGVKKDADSIPLPALLT
                     FLHEYSHGLLQLPENRRKRLRQDTQLSPLHHRLRQRMLAHHRRTGREDELMEEWCSGE
                     YGDGSGVILPNMPSLSASSPAWPTTVLPRYADPEGKQPMVPANGGGSPDGDGPPSPRR
                     SGVNSGAIAAGGAAVPTRKASATAGGGVINSGGESGPVMAASAFGLPSLSPR"
     gene            <117336..>119501
                     /locus_tag="LMJF_21_0370"
                     /db_xref="GeneID:5651571"
     mRNA            <117336..>119501
                     /locus_tag="LMJF_21_0370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682918.1"
                     /db_xref="GeneID:5651571"
     CDS             117336..119501
                     /locus_tag="LMJF_21_0370"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682970.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651571"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH8"
                     /translation="MCCAQLFGAVQARMLRIRRMSSPAQPPLPPHASPPPPYVHRDVR
                     MSHSPADSTFKSGSDARGGAWEAIIDKAVSFVTEYLASTTREFDPAAPLSQHMLHLLD
                     HGSLRDILVERNYNELCGCFGCSNKPRGLLAAGSGTLSFEWDSSLSLSASDAEGDDIT
                     DEEADGRSHGSHRRGRGETADGAAAAAQPTNDQPGTDAEEIVYEEDLYTAESFRLAQR
                     QRAMLNRMQRKKLMREQRAMRAAATSDGAAVRPAPVGPGGTAPVSSRVLRNGLMGASF
                     PQRFCSPECEETYESSIMRRVSPYFAYDYPSVFGAITNLFPNLRVAALQQLAGAETFS
                     AGLVKRVLETQQQEGGDAPANASASVSAGPAGGALKPVQVGVSLESNELIRRSPGKRA
                     ARVAHKARGVGTATQMNDASSAPLLRAVLEQMQVLQHVWNNEVGPRLSETRLSRMADD
                     AATAPSPTSAATAARCFGSAQVPASFPPRSVLRGSLLLLDFIMNTSSAQTRRLFHAHY
                     ARHRPALQRCLTAAASPREARASSLFYSVSADIVAELEKRSVEGLAAAGAAEEPVGGT
                     AFDVENEGLRVDPVLQQQRRELFVSHIFSEDVTAMLSRLLFVDYTVLSSMSWSGVWFS
                     GVSLRLPAGQQSSKCSLLRSLQFPFAIPAVLLQTAESTPEVLGLAMIFLIAAGCCSEG
                     VWRGCMREEVAFDEVAEAIGLTRDDITAAVGSLMLGEEV"
     gene            <120228..>120875
                     /locus_tag="LMJF_21_0380"
                     /db_xref="GeneID:5651572"
     mRNA            <120228..>120875
                     /locus_tag="LMJF_21_0380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682919.1"
                     /db_xref="GeneID:5651572"
     CDS             120228..120875
                     /locus_tag="LMJF_21_0380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682971.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651572"
                     /db_xref="InterPro:IPR007714"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH7"
                     /translation="MFHNSYQAGFLSILYSIGSKPLQIWDSQVRNGHVKRITDEDIQS
                     SVLEIMGSNVSTCYIVCPANPKQTLGIKLPFLVMIIKNMKKYFSFEVTILDDKNMRRR
                     FRASNYQSTTKVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQVHANC
                     RIRRLYFSDRLYAEEELPPEFKLFLPIAQQPPAAAAAEQRDIEAADVPQAASAAQ"
     gene            <122020..>123093
                     /locus_tag="LMJF_21_0390"
                     /db_xref="GeneID:5651573"
     mRNA            <122020..>123093
                     /locus_tag="LMJF_21_0390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682920.1"
                     /db_xref="GeneID:5651573"
     CDS             122020..123093
                     /locus_tag="LMJF_21_0390"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682972.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651573"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH6"
                     /translation="MQPLKRIRHPSGSEILFDAKWHQYKLGGTALRSVSKLLDRFFPF
                     DEKRVLELVSKKTGQPVDKIKQGWSRQALLGKNVHEFIECKLLKKPPPTFTLLMKRKQ
                     AREAARPADATGPAAITTTPLEDEVLHGEEALYLPVAEMAVEKVLSTYDVLGAEQVIA
                     APGWGIAGTIDFMGRNRRTNRVLIGDWKTTGSVTSNFRFGSFETACPGALRHLPNSKM
                     YRYAMQVTIYGEILAREQYFEKQFFDAQLRASLTASLAVPSTDVTPPAPPAKTRGRPS
                     SRAAAPAKSDIGSDVESLLKTFYRNNTEQRFEYGIVQLAKGEDGGVVAEFKEVTPETV
                     MPPDCPEMTFDSLLQRVMEGVGV"
     gene            <125934..>127931
                     /locus_tag="LMJF_21_0400"
                     /db_xref="GeneID:5651574"
     mRNA            <125934..>127931
                     /locus_tag="LMJF_21_0400"
                     /product="putative ubiquitin hydrolase"
                     /transcript_id="XM_001682921.1"
                     /db_xref="GeneID:5651574"
     CDS             125934..127931
                     /locus_tag="LMJF_21_0400"
                     /codon_start=1
                     /product="putative ubiquitin hydrolase"
                     /protein_id="XP_001682973.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651574"
                     /db_xref="GOA:Q4QCH5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH5"
                     /translation="MALSAETPPLRSASGATDTVGSSVPRYVDAKSMVYTLPCFTPDR
                     SLSSPTSGGAGARSQPIAIQMAASQQLPRMSSSSDFRVGAPSSPLSPSRRHFSTANLS
                     NTMEIPTYNTSTPIAVEDLSCSSPVLKSYRQHSFSHSKRDACLADSPTSPGMSVHGGA
                     FLSTGASEAPVAMSLSTSFSSGAGGGSTSTAIHTKFLEITGHPLGLENYGNTCYCNSV
                     IQLIYHCAPLRLRLLELYHVYLTKKGKPGFEEDTVLFQLCSLIAVMHKSNNRTKDKYP
                     REKIAPKDLLNCVRAKNEDFNNDMQQDAHEFTMFLLNDIWDTEQRIMADPANVNLFLK
                     YEASLKKKGSLSFSWKHSKDKHISSHSHKENRLDKTTLAAATNSDVGTNGGKAVDAQQ
                     PFSGELTPLQVILQGQFGSLTACLECENVTAREEVFMDLSLETAQGTSLLRCLDHFGD
                     PEYFWGKNKLRCEECKMPVRAAKTIHVQQLPQYALLIHLKRFQYDVEKQIFTKKADHV
                     ALPMQMDVEEYLTDPEVIEQSLRNKQARTQKNSGVDAGSSTSGHNSSGSGQKDEANAT
                     SSPDTFKPASEEVRRKLRGVARHKARFELTGFVAHIGEGPNSGHYFTCVRYGPQLWRR
                     FDDETVSTMAERDVKQYFGVPSDAVGVVTTTAYILLYERVA"
     gene            <130629..>134357
                     /locus_tag="LMJF_21_0410"
                     /db_xref="GeneID:5651575"
     mRNA            <130629..>134357
                     /locus_tag="LMJF_21_0410"
                     /product="putative argonaut-like protein"
                     /transcript_id="XM_001682922.1"
                     /db_xref="GeneID:5651575"
     CDS             130629..134357
                     /locus_tag="LMJF_21_0410"
                     /codon_start=1
                     /product="putative argonaut-like protein"
                     /protein_id="XP_001682974.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651575"
                     /db_xref="GOA:Q4QCH4"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH4"
                     /translation="MWSLLRPSPVIASSILTAAAARGECRYPVGDIARGTIVIHVCLR
                     HYHGYSDGQRTPHGQRSASSALATDGRGRRDHGPARSPSAPPQLQQYRSQQRRGTSLA
                     AAEAASTDLVTTRSTFWSQPVKHVSAATLKQQHTLERAQDKKSRFLVRRSIREDGVIS
                     NLFPLNFRVADASHPDSHRGAPPTGTHVYIYEVYVTRLMATQRGGSAARGSPSVTGAG
                     ARGKARAGAAAIAAAIGGVQAGGLASVERRVSPGRAWRAVERFLRHRYAGAAAALLPP
                     LVQLNSKVYAAAPLPADALVLPRAYFDIGWQTAVLRLQRRCRFTELPPSELQMLLNKI
                     VPEVARTSHREQRQRVDATPAFLEVVREKAGKLVCTTQGVSAGGLRLYQGVLVQAIFV
                     DSSAALDPNAADAREGQVAGEAHTCSLASAKTSAGSGTKPSTDADACPIATRHLGDTP
                     VGLTDAAAAVHFQVVAFLRPFAYRGTHAESYRIRDASGVYLASLWAPAQPRSLTVGAV
                     YAAAPVRIREFAERGSARLIEFLDDTTLTLLSASTATAPASLSSGSATAQPFSPRSDS
                     GDGGNGGAASEASRLPGQLSLKIDTRGTIASEVSLWEEVLQHFGHGPYDEAAQQRLRK
                     SVQGIPVVISYSLRQSIVRDVRFDSDALLAAASHTHNLAAAEEGRGQSVGAPHSSSPN
                     GDAVAHDRARERLSAPVLCVREPRLVPLMPRLDSQQPCAILDDHTIVPLQVLHCCFDP
                     RMRSWQSIGVSALSLMPRQRRALLESIRALLANGLQRWGIDLSANPYRTKALSLLPAP
                     TKCVVPQRRPATGFANPAAVGFPTTIVVIGVTGPRCTAEQSRRISLTAQHLAHYFRTK
                     FVATLADEGAAVQYVHEQLMYTPAAVAAPTGQPTASLKDPNASVILITNEMDTRATRW
                     LKVECMCRGAHFIAIPASSNPKKLNLVGAQLRMRIATQFELNPLRGVDLRGELPVLGH
                     RHVLVIGVDSCHTNTHSVGTIVGILSTPTESKLLSYFWRHDARGREAQHVAKHFRGIL
                     ASAVALSGRVDEVVVFQDGDVFSELVGVKEELTMQVPNCGLTFMCLHKRCNVRFMHAS
                     PGRDGSSATRSQASAAATASNDVEKDDRDTNDFREDNNLHNLVKGVVIPALAPVPLHH
                     QLAANSFYLQAHESSMSTARIVQYTVHHVSPSLDVTDVQQIANIMANVLAPQATKLPM
                     STRCAHRLAAQAERLLDAVPQLTADMIPRPLCNRLWFL"
     gene            <135567..>137666
                     /locus_tag="LMJF_21_0420"
                     /db_xref="GeneID:5651576"
     mRNA            <135567..>137666
                     /locus_tag="LMJF_21_0420"
                     /product="ferredoxin NADP+ reductase-like protein"
                     /transcript_id="XM_001682923.1"
                     /db_xref="GeneID:5651576"
     CDS             135567..137666
                     /locus_tag="LMJF_21_0420"
                     /EC_number="1.18.1.2"
                     /codon_start=1
                     /product="ferredoxin NADP+ reductase-like protein"
                     /protein_id="XP_001682975.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651576"
                     /db_xref="GOA:Q4QCH3"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH3"
                     /translation="MLCGSRTLHRCACAPALVTRGALNTAVSWTLSHTLALSASLRRC
                     SCTARSTSNPERCAGSADAENASSASASAPNSSTAGTTAPKRRVQIAVVGSGPSGCFV
                     ASHLVKKHLELHVDIFERLPVPFGLCRYGVSPDHPDVKNVEKQFMDLFQSGRVTWVGN
                     VSIGKEIPLQALLAHYAAVVFATGADGSKKLRIPGEDLGGVISARSFVEYYNTLPFPY
                     GSPHFCPFDLDRTKRVVVIGNGNVAMDVVRVLGGSYKYFSPTDMNCVCIKELMKNRIE
                     HISVVARRGVEHSAFATAEFREITKYQEHHVKVEVDHFDLGAAVAAMPAGKVMRAHKR
                     MMELVHRYALTSEETAAEAAQLATDAQGVPLPSAAASPAEPSATTTASEYGMGRPQRG
                     NRGSCCIRFRYNLTPIAILPSRHRKNYVGGVLFKRTRAEAPGKAAEDEGEYCIVPCDL
                     VMTSIGYHSDSIAGVPFDDRTGVIDNEKGRVKGMPRVYCAGWAKNGAKGIILHSVVDA
                     QETAGTILADMEVGVIPTEPTAQSEEAEGTAAAVGSSSASAAEAELVEVLSFENGHST
                     PHRQAAGAATTTMYGKYGLVDYFVTKKLQPVSIAGLQRVLHVEHQRGVDLGKKAEKIS
                     TVRDMLDVALGGDVGKKADERIRGITPARSDAMLYLKELLDDDTDLRALARQVARDVP
                     HKLAQQHPLGSIAPGQL"
     gene            <138525..>139718
                     /locus_tag="LMJF_21_0430"
                     /db_xref="GeneID:5651577"
     mRNA            <138525..>139718
                     /locus_tag="LMJF_21_0430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682924.1"
                     /db_xref="GeneID:5651577"
     CDS             138525..139718
                     /locus_tag="LMJF_21_0430"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682976.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651577"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH2"
                     /translation="MSELQSLTPETAFTVASTFLAYYYSEFVKLNELARMSDLYDERS
                     YMTLVDFRDEVPVVAHGRNAVANLLAKLDSTLGQRKVEIITVDTVALPHNCVQVICQG
                     VMYLREYRRVFLHVFMLEPTAYRTKTYHIASDYLRFVDSEKEVIPEGAVVIAADQVAA
                     YLEESRRRVEEEQRRQLLEFQQRIRLQQQQLQMQQQQQQQKAAAMNMPAPASRQSRPA
                     ASASRDGGRPARGERKPREPRENRGERKPREPREPRGEHKPREGEEKVAAASPSRLAG
                     EGKKGGERGNRKPAAAANAAKGTADTAAATPAPAAVRKPRRESGPTAAIIMLRVPKKI
                     KLSDIKAELVSQGFSELKDLFWCGRDSAHAVVKFSTVEKATEAFETKPFKIQGESLNL
                     DYYHE"
     gene            <141192..>142004
                     /locus_tag="LMJF_21_0440"
                     /db_xref="GeneID:5651578"
     mRNA            <141192..>142004
                     /locus_tag="LMJF_21_0440"
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /transcript_id="XM_001682925.1"
                     /db_xref="GeneID:5651578"
     CDS             141192..142004
                     /locus_tag="LMJF_21_0440"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme-like protein"
                     /protein_id="XP_001682977.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651578"
                     /db_xref="InterPro:IPR019547"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH1"
                     /translation="MAASGGEVIGREGDPSVRKANAKQLAAGYTRKKRLLECCYLSAS
                     TFLWCSNVISCGRYFVFASDANLMQLVWMPLFILAAMMLADLVSGLVHWGMDTWGTPD
                     TPIFGTFIRSFREHHVDQTAMCKHDFIETNADTTLPLLPLLLIQYACVRSTNHSGNGY
                     VANLHVRNIGVHVFLCTFFIFVAITNEIHKWSHQAKQSRIVRKAMDMDILLSPIAHRK
                     HHKDPFDRTYCITTGWLNPLLDSTNFWRHLESLVSSITGEIPRANDQTLLGK"
     gene            <143468..>144244
                     /locus_tag="LMJF_21_0450"
                     /db_xref="GeneID:5651579"
     mRNA            <143468..>144244
                     /locus_tag="LMJF_21_0450"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682926.1"
                     /db_xref="GeneID:5651579"
     CDS             143468..144244
                     /locus_tag="LMJF_21_0450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682978.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651579"
                     /db_xref="UniProtKB/TrEMBL:Q4QCH0"
                     /translation="MKAILQVGPAQFFIEGATFHLLCVDIRQTLAAIVKLQECSISLK
                     LHVNKLETRLAEDARRLRAAGVALPGDDDDDDDPILGSSLLSRVGAASRSSWQRRAYI
                     KSTAPMPRYVCPTTGQRQPVLHRRPLFIFSAASFDAAEAVVQRLQARLLEQHLLLDEI
                     ELQALCSGGDGCSVSDAPTRVLPLPIMELDTYLSTSANVMPAYDVEGNRRRCFMTVVG
                     ASANGRHRSCVLGRGELVACGDARECTCEEHPLCTCVGHT"
     gene            <145086..>147857
                     /locus_tag="LMJF_21_0460"
                     /db_xref="GeneID:5651580"
     mRNA            <145086..>147857
                     /locus_tag="LMJF_21_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682927.1"
                     /db_xref="GeneID:5651580"
     CDS             145086..147857
                     /locus_tag="LMJF_21_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682979.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651580"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG9"
                     /translation="MAERSQVQVVCAPYTAIVEEYALFPKARQLVVQALPRGNAIVGS
                     RRPSPRKSTKGVYSASRRSPTERHSAYEHSIDTNEDGGGVDASTRLAALQLPASCLHA
                     WLRHTETLAEGDDPDADDVATWLNSSGEAWLSVQPALEYASLSYGPVHAVNWLQWEEV
                     KALHNAEQPRRKWHAEFAATAVGKSPVRTPPCIVVQVVLLWLHEGQMHRLMPEEFVSM
                     ETKARAALAARSMRPPRAASTGRSVAPSFRSLFTCYLRLEYPPGTLCPHRVPVPIAEP
                     LLTRQELVELVRATAHIRRHHPLRVAYRIWPQATPPTAAAPASALPWSGGRAGVSSAE
                     ARIAVGTPTVRAPPLRALESNAAMVEFIRDVLAYGCMALQVVAVRSGRVPVQGTNGRR
                     PEAVGSGVPRAPQRPYYAGYNRRQVEERSTVLVTNNVRMNDVLRSITRKDSATQRGSV
                     SSVWRMASATSPSPMADAAVGPPPIDREDEEVEREGSRAPADTIHPLEASDELACAAP
                     AEAGGTAALAEEVSGMDCLESYGDAAPSSIHGSDAMASGEDDPPQLLRQDAVLPSLSE
                     ESTGNITPAGEAALQIVHHGYFRDADEFGATWRNADQYTEYVSGEGAGDGVGSQQQPE
                     LQREALRRPRVDSSVQCKLFVEDAREGKPMALAQKEPSARYAEKLMAVDSWSDNRAPH
                     TPHARGPTSSPSKTPADPGDVSAGAAEGGITDNARVAVPAPCAKSPCSVSLTQQRRST
                     SSSCGSATMPDPATIVLVRYEVDPTVVCVSGPVLQTVLQHLQEAIFQRCCAHLCHDLD
                     APRPRFHAAHPHRHAGSAQFKAATSFINSSSTAAAPSRDVVMAVGFGNGDRNTRDSNL
                     PIASSTDVPCTEFILPLYQYIFTRVEEDALECCIAEVMAAYQGLEQLPAKEAEEWLRM
                     KPNLVSLGC"
     gene            <149331..>152366
                     /locus_tag="LMJF_21_0470"
                     /db_xref="GeneID:5651581"
     mRNA            <149331..>152366
                     /locus_tag="LMJF_21_0470"
                     /product="vacuolar sorting-associated-like protein"
                     /transcript_id="XM_001682928.1"
                     /db_xref="GeneID:5651581"
     CDS             149331..152366
                     /locus_tag="LMJF_21_0470"
                     /codon_start=1
                     /product="vacuolar sorting-associated-like protein"
                     /protein_id="XP_001682980.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651581"
                     /db_xref="GOA:Q4QCG8"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG8"
                     /translation="MAFRIPEDDGTDECVVTLRGPVLTAAEEQKKWLQEALIAVDRKA
                     AIMRNSMESQDSMAVVIRAAAQMLDELRTNLLEPQNYYELYMKVFSMMEVFVAYLEDE
                     QRAKRHTLEEMYERVQFCGYIIPRLYLLIAAGAVYIDAGDQPALEIARDLVEMCKGVQ
                     HPTRGLFLRHFLLTMMKGKLPGDQNRRVSDVGNGPAGEGQEEYPHKEDGGTVADTANL
                     LVQNFKEMNWLWIRMEAGSYVNRNGGSTNSVTACSPTTAALPATSLPPAASTAASSRS
                     SDAATRPGSPSRSLRAARRTQQERRAMCVLVGMNVVRVAQLDGISRDVYASTILPQLL
                     SIMVRYCEPLAQQYLFEVLIQVFPDEFHLFTIDKLFGAINRTVPGVEVSELLRSLMER
                     LCKYAVAVQEGVTEVSSPEEEAKLRDVFPMLLNQMSCMSVSYSAQRSAATVIKRTSTV
                     PPPTPMMLGTYVTTMRHLVNVVMTLYGKSAKRRFMSLSNIVDVVASKFPSAPADSSES
                     KESSGVVETAVASAETLTHVSISPAAALAAGQFLVHIITESCATVQEVMAMEGIAALT
                     SCLPFLQRREVAMAVCEVALRGSTAAPVLPSVSKAASSGAGGGGWKPTVVVTVPPPSP
                     RPITALEDVARLFELLDPILVEQPDAPSDPRLIYKYNPAVEFVDEQNLVCRMLHLLAN
                     DDPAVYAKMLTGVRKVLLQGGARRIPLTYPTLMTLHRRAALRLYAQYQRLSSSSAKSD
                     EGERDGDEADTAAAAASQAMKAIRKCFSHVHSGDSKGILEVFAVEAPTEALKEYLFCS
                     NTADVCEQSETSYTLYVEALTLYEGHVEGHEQIDVLVACVNALCQMRSMPEENYEVLA
                     AKVCQYASKMLKKHDQSYLVAVCAALFAKKQLSRENQQRVQECLRRSLKLAGQVLALA
                     QLQLYVQLLNIFLHFFTSKSGYLVSVELVNELIEKISEASEVQRSEVGGDGNNSTADD
                     DDSDNAANMFAKIRLVYRNITKYIRSRQSAEERWSEIDV"
     gene            <153481..>154971
                     /locus_tag="LMJF_21_0480"
                     /db_xref="GeneID:5651582"
     mRNA            <153481..>154971
                     /locus_tag="LMJF_21_0480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682929.1"
                     /db_xref="GeneID:5651582"
     CDS             153481..154971
                     /locus_tag="LMJF_21_0480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682981.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651582"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG7"
                     /translation="MDQVAVDLSALRELVLQHQHQQRLANDTHVGADAVAVPSAVSTS
                     TSAATAATTADKLRQLQQELGALTEQLHAEKGASAQLLLQQRCDAASMQELLDQAVRA
                     DEKVADLTSQLVEWKRRCQAVEEAHAGCAGQYESVREQVECVQRHVAETQAQHSVLTA
                     RATEAQQLVSKLADEKAQLQGTLRSRDAALLRLSGVELDRDEARARVQAFEAQHAEWV
                     AEVCAYQRYFDSARDEYVRGLHHVAAVRQEHEALREALTQSEARCVHWEKLFTDLRVG
                     ACSGLAATPADASTEEAAADISGASSAVIAVGVAEDGSPSSGSCCDASACFDHPTSPL
                     NAAFVPLLEAKVADLALRLCDAQTRADAAERTAEDLSRLSLADSALLMHLKSLVCALR
                     PQVDGVADHNAQLQARLLAAESFTDALMQHVVRLGEAFADEASQRCWLTTASSASATG
                     GGGGVDVVSGGSGGRGSETTLPPATPPSALTQSRRHRLRTRVLGRR"
     gene            <156550..>157896
                     /locus_tag="LMJF_21_0490"
                     /db_xref="GeneID:5651583"
     mRNA            <156550..>157896
                     /locus_tag="LMJF_21_0490"
                     /product="putative DnaJ protein"
                     /transcript_id="XM_001682930.1"
                     /db_xref="GeneID:5651583"
     CDS             156550..157896
                     /locus_tag="LMJF_21_0490"
                     /codon_start=1
                     /product="putative DnaJ protein"
                     /protein_id="XP_001682982.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651583"
                     /db_xref="GOA:Q4QCG6"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG6"
                     /translation="MVRETELYEVLNVSVEANEHEIKRSYRRLALKYHPDKNTGDEAA
                     ADMFKKVSNAYEVLSDPEKRKVYDKYGKEGLERGTGEGGGFHDATDIFSMFFGGGARE
                     RGEPKPKDIVHELEVKLDDLYNGATKKVMISRNRFCGACEGSGLKSGGKRTTCAQCRG
                     RGALLRTQQVFPGFHHQVQVRCPACGGEGEIVAASDLCTGCRGKRAVREKSVLEVHIG
                     RGASKSDHFTFIGEGNQEPGIRLSGDVLIFLRVRPHPVFHRINDHLMMRCSITLQEAL
                     CGFEVPIEHLDGRQLVIKASPGQVVHSDSAWSVYNEGMPVKGTGGLQKGKLFIYFDVE
                     WPETLPREQIDKIVTAFNVPEKPGKLGGHVVELREYKAAGKFKSGKNEKRGGTAGSRS
                     AGAGRGREAARGRQAHAEEDEFEDVTDDDDDEQQQYFRAGPQGFNGNTQTVECAQQ"
     gene            <159415..>160059
                     /locus_tag="LMJF_21_0500"
                     /db_xref="GeneID:5651584"
     mRNA            <159415..>160059
                     /locus_tag="LMJF_21_0500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682931.1"
                     /db_xref="GeneID:5651584"
     CDS             159415..160059
                     /locus_tag="LMJF_21_0500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682983.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651584"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG5"
                     /translation="MASMLTRQALWVPVVQHNPAFVESVHRLLRSSPITSLTAAAIGL
                     KLEEVQVALEPDARHPDKMMASMMAFPIQISAAACDYMLEQQQRQQPKPRELAFGFAI
                     SICDSCNTLHVMERLLPAFNRHVSVNMQTHCMRNLREEEKVVVVSTVDKMGKRLVYCK
                     TDLFVEATEPVPEEVVQREKSIETLAELRAALMHYEKAVSGAHVKSIMSASKPG"
     gene            <161619..>163316
                     /locus_tag="LMJF_21_0510"
                     /db_xref="GeneID:5651585"
     mRNA            <161619..>163316
                     /locus_tag="LMJF_21_0510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682932.1"
                     /db_xref="GeneID:5651585"
     CDS             161619..163316
                     /locus_tag="LMJF_21_0510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682984.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651585"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG4"
                     /translation="MAKKRNARNASVSADATDSGAAPANGGLRPVFAASTRTATAEEV
                     LHAALEQLDSIAQEAHVYTQQLKAAELNGAAAEATSPPFKRARDDPASGETRLAASTA
                     AKGSRLDVFAAMSALQYQALCAAVAACGLQLLPSLEEILKRVALAVLTPWLSTPEAWE
                     TLAMLCTTYRAGAAHALTELLESLLREPGVLLLDAPQLVPAWYAEAVVHVLPSAMASN
                     AATAALGGLLTLAEDQQLREESAESVQQAVHIHTERTARKLRALVDMLYAAGGYVPTA
                     TLQQMALRHAMEVVEGGVLPCYLSEQEYSEAFNTASTFPGTAAAAASSSSFVGAAATA
                     GDSTSAAVLRWSVPAAWHAVSLQLLEAFLFTCRPGLPAQLLVTATRAINVLAARLHRG
                     VPLLSTSQDPNSTADPNQDRSKKATSVALPLLPATVAVGAAVVRLGHVLQLLRHPVVL
                     PPLQPAQLVVEKAKRRTFVSVEPAAAPVTSAPAAPAAPPAETVAAPSARVTTTPPPQQ
                     QPQPVVPTVAAPAVAPAPTAALPRTPQQQPVKPAPPPQPPAVVDSPDDDIPDIVMDD"
     gene            <163991..>165334
                     /locus_tag="LMJF_21_0520"
                     /db_xref="GeneID:5651586"
     mRNA            <163991..>165334
                     /locus_tag="LMJF_21_0520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682933.1"
                     /db_xref="GeneID:5651586"
     CDS             163991..165334
                     /locus_tag="LMJF_21_0520"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682985.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651586"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG3"
                     /translation="MLRRVAYTLLPRDPQEVRLLHHTSGGVVIAAVRYRKTSSPLFFT
                     VVEMAAPNEQALPLRVVHVRVPRPAAVVSAVALVRSADGADIYVIVQAAEKTDAEAAP
                     ASVTSYVYRRQIVAIDEDDDGDKTHNYAVEGDVVSSSAASAAAAATRVRYQRLPRAFA
                     SASAATWTAVAAFNSSENMLTDVSSSVGAVVTPTAAFITASGGGADIQLQLWQLCGTR
                     VALEATWRVPALAGFAVEEILTLPGTQDVALLRHHNSILEVNLSALRSACAYRSTVTG
                     NAFLSRAWRWLAHEQLTACAVKDALLYAGTEGGAVLVWDLRRPTSTAATAGSCGGPPL
                     LCSAALKTPITGLYAPYATGFITCDASGGVRDWRERGEMGMGDNQNEEAEEGALRDVA
                     GMAASAAAAATQFPYRSRAPVEMPTGDEGCVALDGHDNFVAVVSECGRLCLYFCD"
     gene            complement(166168..166290)
                     /locus_tag="LMJF_21_5SrRNA_01"
                     /db_xref="GeneID:12980511"
     rRNA            complement(166168..166290)
                     /locus_tag="LMJF_21_5SrRNA_01"
                     /product="term=5S ribosomal RNA (M5)"
                     /transcript_id="XR_002460406.1"
                     /db_xref="GeneID:12980511"
     gene            complement(166347..166427)
                     /locus_tag="LMJF_21_TRNASER_01"
                     /db_xref="GeneID:12980670"
     tRNA            complement(166347..166427)
                     /locus_tag="LMJF_21_TRNASER_01"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12980670"
     gene            complement(<167158..>170604)
                     /locus_tag="LMJF_21_0530"
                     /db_xref="GeneID:5651589"
     mRNA            complement(<167158..>170604)
                     /locus_tag="LMJF_21_0530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682934.1"
                     /db_xref="GeneID:5651589"
     CDS             complement(167158..170604)
                     /locus_tag="LMJF_21_0530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682986.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651589"
                     /db_xref="GOA:Q4QCG2"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR028796"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG2"
                     /translation="MSAITSFAAAAVGASSAEYVNYVDIKLDGVHHLPADWVSAGFPA
                     LTPGTAGGAAGAGANHAHVHDKEGPTEETEVAYAYHPFRYEVSLALPAATTNATAAAD
                     SDEADAATAEAFREEPPPNTDEGAKLDMSVVASFTRGRLLALLPQYTAYIAAAEPAPA
                     PGVDDASPLRDVPVSISAESEMATACVSGDEREASEAGKASDKAAAAGATPAILWVVT
                     ERTDSPGGSGGANGADAVGMVATKRRARSATPIAPAAAAAAAASANNTAAAAVPGAPA
                     PPVPESSEPAPCVVRVPLTAVQEAYLEGLLEAGAPLKLSFRRVLRPGCPAEWEDFNAG
                     YFEAEIPISLHALTEPGSTHLAADVALQPANVPEKRAVAGSVPSENDLADRGKKRTVT
                     RKQRQMVPSILIDVPDRDAPHPYVTAGTMATVSLTLQRTLTPLVSDRVRPAVTPAQLI
                     PPRPMPTVSAAAADDTQTRLQQTLLGVVRQLVCGMRGATQMKSCGLPGSDDAAWRTDF
                     VAALQSTGELAAFKSQLTPLVTGLVQERLRSGLTGGGSPQEVARASNELYVQLMDMLH
                     SALHECAGEGDAASSVPQLRTTSSGGAPNSGEEQEVRWRAIEAEVSGDFELAAKLYQS
                     RLTSHVAGDNWVALWVDCGLFYQRTEELAKAEQCYREAIACDPHCTSALLDYGAWLLA
                     HDRLDEAAVFLHGLVDIAPQHKLGWGCIALLADLHELAVRVGSPDAVVEQQKWRREQR
                     LALRKAAECGAVSPSHATGGADSGGLSGSSGPANDSVPTPPPASSQQDAEEEQMYLEV
                     ATYLVNLHHRDLANVCLARCRPGMLQVELLYARLFTQGGQYEEALRTLDEINTPSGAH
                     TSISAAEQRLVDECALLRAECAAALGRPSDAVRVYKQVLCRGEPPTAPPYLGTLTSHW
                     QAQLQEVRSFGMASKSGAASPAQALLDQRITEAESMHYLSAYLHLCNLLLREGRYRDA
                     LGVVTLALQVWPSSSVLWLGAGVAYYRAGDLLPAEECLQESNTLNPANPRTWAYLALL
                     AVRLHNVGVEEVVQQLLTLNLEDAPLWAELGRTLLGTARFPRLSVLCLRRAAALASGK
                     GGAADAILPSTQYHLAHALMELQQWEEAEQLLGKVASNSGSNEVLRGKAEEELAVLRA
                     GQ"
     gene            complement(<172095..>173114)
                     /locus_tag="LMJF_21_0540"
                     /db_xref="GeneID:5651590"
     mRNA            complement(<172095..>173114)
                     /locus_tag="LMJF_21_0540"
                     /product="putative la RNA binding protein"
                     /transcript_id="XM_001682935.1"
                     /db_xref="GeneID:5651590"
     CDS             complement(172095..173114)
                     /locus_tag="LMJF_21_0540"
                     /codon_start=1
                     /product="putative la RNA binding protein"
                     /protein_id="XP_001682987.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651590"
                     /db_xref="GOA:Q4QCG1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG1"
                     /translation="MSNLADKIRRQVEFYFSDVNVAKDVFLKSKMAEDPEGFIPLEVL
                     LTFNRLNSLTKDPKVLAEALASSDKLVMNKDGLSVRRKDALPESIQTDEQTVYVKPVP
                     ATASLEQLQEFFSAHGTVLAVWRRYFQGGSKDAPVESRTKPSVFVVFASKEDAERFVA
                     APPQYDGVQLSAQMKTTYLEGKAVQMASQKNRKRVREDGEDGGAPSSAAPRTPAMPTN
                     SSYRISGCGAIEKFSEVKGLWPAEEQRGVRYVYMPTKEEALIIFQDAETAEKMVESVK
                     TRAATLQGKQPEVTKLSEEDEKTLIANVEKEISERAAQHGSRGGRGGRGGRGGRGGRR
                     GGGHH"
     gene            complement(<175063..>176247)
                     /locus_tag="LMJF_21_0550"
                     /db_xref="GeneID:5651591"
     mRNA            complement(<175063..>176247)
                     /locus_tag="LMJF_21_0550"
                     /product="dihydrolipoamide acetyltransferase precursorlike
                     protein"
                     /transcript_id="XM_001682936.1"
                     /db_xref="GeneID:5651591"
     CDS             complement(175063..176247)
                     /locus_tag="LMJF_21_0550"
                     /EC_number="2.3.1.12"
                     /codon_start=1
                     /product="dihydrolipoamide acetyltransferase precursorlike
                     protein"
                     /protein_id="XP_001682988.1"
                     /db_xref="GeneID:5651591"
                     /db_xref="GOA:Q4QCG0"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:Q4QCG0"
                     /translation="MMRRTLLWLVNFEPVFMPALSPSMETGTVVEWKKKIGELVKESD
                     VFCTIQTDKAVVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVSKADEYTP
                     EGEVPAAEAEAPTAAAVAAAPAAGGASSKAPEGVTCEPVFMPALSPSMETGTVVEWKK
                     KIGELVKESDVFCTIQTDKAVVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSDAA
                     DVEKVANYYPEDAVGGPPASAADPSAAAAAAASARPAPSAASAKHYGGSLDAAVAASG
                     PSVARIAAGLETSTLAGIAPSGKGGRFLKSDFSGQPGFDYNDTTPARAMQQKAAPAAA
                     ADEASKTAAKSAAPAAVSGDIYNVVLKPGPVYKSVSDTALLKKLMHTMHVPKPKLKKA
                     AE"
     gene            complement(<177346..>177636)
                     /locus_tag="LMJF_21_0560"
                     /db_xref="GeneID:5651592"
     mRNA            complement(<177346..>177636)
                     /locus_tag="LMJF_21_0560"
                     /product="putative Qc-SNARE protein"
                     /transcript_id="XM_001682937.1"
                     /db_xref="GeneID:5651592"
     CDS             complement(177346..177636)
                     /locus_tag="LMJF_21_0560"
                     /codon_start=1
                     /product="putative Qc-SNARE protein"
                     /protein_id="XP_001682989.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651592"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF9"
                     /translation="MERTFAQQNDLCTQDQLLDQLHASVMNTRHYAIQIGNDLGEQDD
                     MLDRLHGNVTRTADESRRQNQNVIQLLRESENRGFYSVVLLLVVIIILLLAV"
     gene            complement(<179213..>180538)
                     /locus_tag="LMJF_21_0570"
                     /db_xref="GeneID:5651593"
     mRNA            complement(<179213..>180538)
                     /locus_tag="LMJF_21_0570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682938.1"
                     /db_xref="GeneID:5651593"
     CDS             complement(179213..180538)
                     /locus_tag="LMJF_21_0570"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682990.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651593"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF8"
                     /translation="MRSSAYQLTKAAYHAAAKPNSAALVTATSSAAGKQAVEELEVYL
                     RVMKTAQRRWAREIVAHETHVRRLMIVEEHCRERLKQQVLKGTREHLKYLTNTDLMAA
                     SQLVSPPSVDVFLAYGILPEQVSGFTVYVMGCLAADPNRLNVPLPILIADLSSTWAIV
                     PPRKKEAYNELAAIFRPHLPPRATDVEGNDARETEATTAVPKRKVGGALKATRRNAAS
                     GDAGLQVRAPAPLPRHGRGFLPKPSAAVTGKSPVPRVLRSAGKQLQVRRWTATTSARA
                     PVSPLTSLSSPTAAATQTSTLPRSAKREQSLLKTAACANNGTGSSVISRSQSQPTAPP
                     PQLRRQPALRAADKAAVAALAEELQLPDAERDAFCEFAEASLHEMEMALNSPFVSPNS
                     DRSSGSSKAKRSAKTPRGGVQLLVKEWLPIAAEEWARKTRRQKRFYMRV"
     gene            complement(<181146..>182546)
                     /locus_tag="LMJF_21_0580"
                     /db_xref="GeneID:5651594"
     mRNA            complement(<181146..>182546)
                     /locus_tag="LMJF_21_0580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682939.1"
                     /db_xref="GeneID:5651594"
     CDS             complement(181146..182546)
                     /locus_tag="LMJF_21_0580"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682991.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651594"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF7"
                     /translation="MDTFQATLDELQRESKEKIAHAQDTASAAVLQARVVPHRIAVAM
                     AQRFTSDRVESCFPVLCLLDATLARTASASPSTSSEADQALAAILAEFWTLAPAAFMS
                     VHGAGQPAWREKCLRLVRRWKQRRLVPEPLITELLTAMEKGTVKAEAGEATSVTEVSS
                     NATAAAGISSSSSLAIAAAATTSGQPSPSTTVTATAATNAAMASPSASYLVSTPSFTA
                     AQARAFRSTLQACLSALESLQPARAALYLELVRSQHFRAPSRTSLAFFEDLLKELRRE
                     VTMASSSSSPNQAASAGGGTGAKDGADPASNGHARETLGKLLDQLHVAAGEGAAGLSA
                     GGRVAAAGVAGAGAHHSAATTVVRYVSPIFSDIYARQALGQRGTGFGTLQRKAGHGGP
                     SGGSAVYTSYYPKAEANAQRPFRIPPARQMQGGAVRLHFPRQQEWVSAQDMADVSQYA
                     SRGITDRGRKRTREGV"
     gene            complement(<183824..>184990)
                     /locus_tag="LMJF_21_0590"
                     /db_xref="GeneID:5651595"
     mRNA            complement(<183824..>184990)
                     /locus_tag="LMJF_21_0590"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682940.1"
                     /db_xref="GeneID:5651595"
     CDS             complement(183824..184990)
                     /locus_tag="LMJF_21_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001682992.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651595"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF6"
                     /translation="MESRVPFSAASLAAYAMPEADDNTYMQTVVVPPQSHTCTAAAAA
                     VGAASSTDVANDDYASGEGSSCYPLPVSRLDSGVASDAPSALAPASLISDSRDCHPQS
                     PFSIDLPQSAPPLSWRESEETDVAAPAEIDHCIVADAGAEEDEAAKQDEAQTERCGAN
                     RDVQRLYMHPLAAAAAEGSFGVTSPVDPITAALARQQQQQKRGEPRSPLSSRTLQALY
                     AACAEGRYSSFITQLTADDVLAPPPLALTWYPSVPAGTTRFADRKRTADSLTVTAMRQ
                     HEKSMLAEEEVHGVAEMTTTGAAPPLRRPRTEELAVPGAGPQPPSASSSVPACMGACI
                     PPLCIYTGACATKRSDSADAACASAAADRYANPHRKRDRDERVYEYLSHGRRLR"
     gene            complement(<186128..>187474)
                     /locus_tag="LMJF_21_0600"
                     /db_xref="GeneID:5651596"
     mRNA            complement(<186128..>187474)
                     /locus_tag="LMJF_21_0600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682941.1"
                     /db_xref="GeneID:5651596"
     CDS             complement(186128..187474)
                     /locus_tag="LMJF_21_0600"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682993.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651596"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF5"
                     /translation="MLQRVAGRKEEMLRLLRLAAGHAAAPAEKMEGVFERHCGVADTK
                     AASTGNERAPSTAAAAWRAAVWRTLQLHCYFTLTVIENGRGGNAKDRVMSVVPFNWAS
                     TLCQVATQIPYEGWTEQEFLARLRSNWPILETYTPVWSTRYSGVNSLAQLVYRHFSSI
                     LTVTRSAVTGEVLYHRTGHNSVSVTWRASPDTSAMTQPPSGALGASEASAAVQYALHT
                     LGRGHQLPVWTDVDQVAPLLSAQSGLTDGRPSTWQEAFAKDAELRGTFQLEGYVRVRA
                     IQDQQRFMAIVDCTSVSSAELRALLRQHPMRGGGVSVKLLLRDGMAPESHEAYVKTCK
                     EASGPSTLIEDVPVDTLLEPEHLLAALLEAVATDMARDVASAAHPAESTAVSEDDESE
                     ASENGGMLLPSSPLTPVPVMVLCGAASREAFAAVVAEVPSSKVAITVLTPEALAHT"
     gene            complement(<188662..>190755)
                     /locus_tag="LMJF_21_0610"
                     /db_xref="GeneID:5651597"
     mRNA            complement(<188662..>190755)
                     /locus_tag="LMJF_21_0610"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001682942.1"
                     /db_xref="GeneID:5651597"
     CDS             complement(188662..190755)
                     /locus_tag="LMJF_21_0610"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001682994.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651597"
                     /db_xref="GOA:Q4QCF4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF4"
                     /translation="MSVYGWETADGAHRYRRKAKKTGTVVFHTDERVDTTFDRLQKEV
                     IVEKLHFSRKEAEEALADPHHRANSVKTALMTASTAKVLQKTMNFKALLPCQAQCYRG
                     IFNGRDVILHSRTGSGKTLAYALPLIERHLLLEQHQQPASVGAAAGPFLLVFVFSNDL
                     AMQTMSVLEKIYGKQTTLRIAVAGFDDLHPTSDGRAVDILVGTLRSIDEAIRGHRVAA
                     AATAAEEAEAQRDAHLPGKKRPRSARKPQQAVAAAAEEEDDDDGDAAASMSDSNEDEA
                     IAGHGDTREAGIISPARVRAIVVDEVDITLGPHFSAMGRRMKSLLKFIRKANGSLADG
                     LLNDFRAHHYVLCGATIPNWVLKAGFLGVKKYHYQLVAVGSAKLPPHLECFHQICSVA
                     DRVRTATRLLTENTAFNGRVVVFGTLKQLTALEAGLHTATATTNAGATEAKTTTPSPS
                     AKKGGKKGNGTSAAAAAAAASSSSLSSSSSLIARALTSQKDELDRMAAIEDFNCGVAQ
                     VLLCTDIAARGLDFTEVDTVLMLNLPRDALASDTFVHRAGRTARVGRPGRCILLHDAS
                     EAAVVDAIAKSTHVVFKALGPALAAAAGASADALRGGKVKTSAAVNAGASDVALTSMK
                     LVVRNPFRYTKPNVKVPSAMHVFNANLDEPLKALLEDIREEGGSNGEVVLFRVPVSHV
                     HEVKQRLWKYTLQEA"
     gene            complement(<191442..>193802)
                     /locus_tag="LMJF_21_0620"
                     /db_xref="GeneID:5651598"
     mRNA            complement(<191442..>193802)
                     /locus_tag="LMJF_21_0620"
                     /product="putative DNA polymerase eta"
                     /transcript_id="XM_001682943.1"
                     /db_xref="GeneID:5651598"
     CDS             complement(191442..193802)
                     /locus_tag="LMJF_21_0620"
                     /codon_start=1
                     /product="putative DNA polymerase eta"
                     /protein_id="XP_001682995.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651598"
                     /db_xref="GOA:Q4QCF3"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF3"
                     /translation="MLSRCGAGPSDTGEDARCRSSPRVSCLCSADAMRCIAHMDMDCF
                     YAQVEAVRLGVDCRVTPFALVQWGSFIAVNYPARARGVRRFCLSPDEVRRELPDVRMS
                     HIATYAMGESEYCYPEAPHINTHKVSLEPYRHASRQIFAILRAEPGVVVGKAGIDEAY
                     VDVTEAARRELAEVRAAAAGASLDPLEDVMEPSTRLIEDRRAEMEAWLSARGTSLAAV
                     FDEPMRALVRGECGAELEGSRAFCVGADDAAYAERCLLLCAASRVVHRLRQRIYAELH
                     YDCSAGIAHNRVLAKCISATHKPNQQTLLLPDRSASALFELPLSGLRGFGGKLGAAVS
                     AVCGGVTECREAWLVPLAQLRKLDGTCDAGDGEDAEGDREGHVDEASAACRGDTKVDN
                     GGGGEDGMVAQSRTGVYAFYRLRGLGSDTVADPALPRGMKASKIFHPACSSWSAAQLW
                     MAPLAGELWHRLSEYESCYHKEGRSLVLVLRAYVTPEQARRGQHTRSYRAQVPLPTNV
                     RDASEIAGMGLREFVKLMREVTTRGKEGERRPGSPAPLPSQHIPTNPPSEAPDAPTGI
                     AVPSSGVLTMPPLHVIELSIIGLRLRPLQATEGGNDGITGHADGGTLASSQRSLTDMF
                     SALSASAAGSVRTAVPGGGSPRKRHRNGTRDGEVAHGRGRGVVVEIDDSDEDENVSDD
                     CVDFDVHLGEATEGKRSDTPSHRGQSAGPAGASSPPLMRTLDDLFCRATAAPSASAAE
                     TASVPTRAVRQVTTVCVEEDNAVVWVPQQSCVSFTEVSSEEDEAIS"
     gene            complement(<194515..>196797)
                     /locus_tag="LMJF_21_0630"
                     /db_xref="GeneID:5651599"
     mRNA            complement(<194515..>196797)
                     /locus_tag="LMJF_21_0630"
                     /product="putative DNA polymerase eta"
                     /transcript_id="XM_001682944.1"
                     /db_xref="GeneID:5651599"
     CDS             complement(194515..196797)
                     /locus_tag="LMJF_21_0630"
                     /codon_start=1
                     /product="putative DNA polymerase eta"
                     /protein_id="XP_001682996.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651599"
                     /db_xref="GOA:Q4QCF2"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF2"
                     /translation="MALLPTSLPGADPMRCIAHMDMDCFYAQVEAVRLGVDCRVTPLV
                     LSQWGSLIAVNYPARARGVRRFSNVSEAQALCPGLIVALSPSYRMGEAVSQYHPHPVQ
                     DSYKLSLEPYRHASRQIFSILAATPGVQVEKGSVDEAYVDVTEAARRELAEVRAAAAG
                     ASLDPLEDVMEPSTRLIEDRRAEMEAWLSARGTSLAAVFDEPMRALVRGECGAELEGS
                     RAFCVGADDAAYAERCLLLCAASRVVHRLRQRIYAELHYDCSAGIAHNRVLAKCISAT
                     HKPNQQTLLLPDRSASALFELPLSGLRGFGGKLGAAVSAVCGGVTECREAWLVPLAQL
                     RKLDGTCDVGDGEDAEGDREGRKRRPIARKRGRAASASLERDLQGLVAHTTSLYVFYR
                     LRGLAEDTILNRPLSKTIIASKNFGRITTSVEMVRRWIIVLTSELCSRYEEFTALYQI
                     RGRSFNIKLGNDGFRSTGGLSSHTVALPEAMQPDILAAVAMREVQAVFRNKPGAAADS
                     VTLTIGGFVSDGTGATGSVAPLAATPGNRTSAGQRLAARGHLRQQTLLASFLAASAAD
                     GGAAGAMHQRSGGNVAEVLSSDGSGLDDSDSNGSVHIEDDAVILSLSSHSMSSNSGDM
                     STVVLIDRTPPLPERDVVPETRCVAKVRALDVCKSSPCEAAGAASPPQTPHLCSPLPA
                     GKAATEESQGESRDATEYHEEHQRHLGGHHHIVPQPPRSALALPFLTAPPSSPAPANT
                     VEVVEDNGGVEGDDGVTIID"
     gene            complement(<198760..>200529)
                     /locus_tag="LMJF_21_0640"
                     /db_xref="GeneID:5651600"
     mRNA            complement(<198760..>200529)
                     /locus_tag="LMJF_21_0640"
                     /product="putative phosphoglucomutase"
                     /transcript_id="XM_001682945.1"
                     /db_xref="GeneID:5651600"
     CDS             complement(198760..200529)
                     /locus_tag="LMJF_21_0640"
                     /EC_number="5.4.2.2"
                     /codon_start=1
                     /product="putative phosphoglucomutase"
                     /protein_id="XP_001682997.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651600"
                     /db_xref="GOA:Q4QCF1"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF1"
                     /translation="MEVTTTAYKDQKPGTSGLRKKVTVFQQPNYTANFVQSTFNALHR
                     QGAVPDVLVVGGDGRYYTSEAVQVILKVSAANGVRCVWVGQHGLLSTPAVSTMVRRRR
                     DADGRKATGAFILTASHNPGGPDADFGIKYNSENGGPAPEKLTSQIYEETVKITHIKM
                     APTLPEVDIHTLGTYTFDDYNFQVEVVDSLADYAAYMQEVFDFEAIRALVQRLDFKVH
                     VDSLHGVSGPYVDRIFHEGLGVPKTSLFRTNVLPDFGGCHPDPNLTYAADLVHVMGLL
                     PDGNANPAMKHISTVPSFGVAFDGDADRNMILGCRFFVNPSDSLAVLAANADCVPFFT
                     QSSSSGLKAVARSMPTSGAVDRVAAAHDFALFEVPTGWKFFGNLMDSKDLYGGKDFNP
                     LLCGEESFGTGSNHIREKDGIWASLFWLSVIAKRNAPGTPLVGVQQIVEEHWATYGRN
                     YYSRYDYEDVSAEAAKAVMDTVENTVVDDVPNLNGVACKTIDNFSYTDPIDGSVSTKQ
                     GVRVLFEDGSRFVLRLSGTGSSGATIRLYLEQYMDSATVKSHLAEKTLPTASTALKAL
                     IGVALQVSKMESLTGRKTPTVIT"
     gene            complement(<201540..>203459)
                     /locus_tag="LMJF_21_0650"
                     /db_xref="GeneID:5651601"
     mRNA            complement(<201540..>203459)
                     /locus_tag="LMJF_21_0650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682946.1"
                     /db_xref="GeneID:5651601"
     CDS             complement(201540..203459)
                     /locus_tag="LMJF_21_0650"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001682998.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651601"
                     /db_xref="UniProtKB/TrEMBL:Q4QCF0"
                     /translation="MSAISSFVLECAHAGRWVRGLMALQEQHLPAEPSMRVACVALAQ
                     AAAPHSWAAALCLLRPSDALRHPQEVCKTVDTIARHAQLPIDVFESSMEALLLSLQQL
                     SQSKSHPASGSSRQLASIGPCEALGLATPSTPIQQQVFLSATQWCGWETAARLLACLP
                     SPLPQACVERVQELRTLRHRILHDVGPFCHWGSRAALSSVIGSAGGPLPASAQGTSLA
                     EQLERMEPSPARRYSARDRRELSWLRDHKRQRLLQRTREEEDMLTRQAAEDVAPSALS
                     VCAALRAVTRLPSAASVTAPHVLCRHVLTLSQSRRLTPDIALLYGRAAGLCTPHSWEA
                     TVDTLNRAEVRDARLHRQLTTWVISRGSWRAALERLSQLHRDTSSAVPQRSGNNTGDL
                     HRGGDAAASFDCVQRTAVPASYLHRVVPQVSRPWCRLVSSRHSTASLLRQIAGALAGG
                     VRLDEVQLSEAGKEWAANGRWEAALALYYRFPLPEFQKYATRSLVTARPALPPVPSVS
                     HPPSSCLQIGSDPLPGSPSKDSAMFYARTVLELLVPRDGVRYDSASPPRPAPPLGTYP
                     ACLVIDAAADWSEAVAVFRACVRRGTRCNPQLLSTLMRRQDLPPQELRQILKSYPAAV
                     NDGVRRRAKEGFGVE"
     gene            complement(<204905..>205888)
                     /locus_tag="LMJF_21_0660"
                     /db_xref="GeneID:5651602"
     mRNA            complement(<204905..>205888)
                     /locus_tag="LMJF_21_0660"
                     /product="putative nucleotide-binding protein"
                     /transcript_id="XM_001682947.1"
                     /db_xref="GeneID:5651602"
     CDS             complement(204905..205888)
                     /locus_tag="LMJF_21_0660"
                     /codon_start=1
                     /product="putative nucleotide-binding protein"
                     /protein_id="XP_001682999.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651602"
                     /db_xref="GOA:Q4QCE9"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025669"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE9"
                     /translation="MATAQNANPECVGPESPQAGIAPSCQGCPNAAICASAPKGPDPD
                     IPLIRERLAGVKHKVMVVSGKGGVGKSTMTKELAFALGARGLSVGLMDMDICGPSLPR
                     LTGVRGEDAHQSAGGIEPVLVDENVTMMSMHYLLSDKNEAVLFRGPRKNGVIKMFLKD
                     VIWGNLDVLLIDTPPGTSDEHITVNSLLQQTTNGVDGAVLITTPQRVAEADVRREVNF
                     CQKAKLPILGLVENMSGFVCPGCHKESQIFPKEEGGEGRKEGAGVRLSREFDVPLWGE
                     VPLDPQLMKACEEGISFSEYVEKSGMTSSTTLDALFTVADQLIASLGIQVE"
     gene            complement(<207214..>208224)
                     /locus_tag="LMJF_21_0670"
                     /db_xref="GeneID:5651603"
     mRNA            complement(<207214..>208224)
                     /locus_tag="LMJF_21_0670"
                     /product="metallo-beta-lactamase family-like protein"
                     /transcript_id="XM_001682948.1"
                     /db_xref="GeneID:5651603"
     CDS             complement(207214..208224)
                     /locus_tag="LMJF_21_0670"
                     /codon_start=1
                     /product="metallo-beta-lactamase family-like protein"
                     /protein_id="XP_001683000.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651603"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE8"
                     /translation="MHAEAAAEAAMPVIATLSSRVVRIMGLNPGYMTLQGSNTYLVGT
                     GQERLLIDSGEGVEGYGHLLQKAVAEESTRLGGPVHISKLLLTHWHGDHIGGVETVRR
                     LFPQVQLLKQPSQYAHTEVDALCQVPPEVVKVEGATLQLVHTPGHTDDHLCAFLQEER
                     ALFTSDTVLGTGTSVFSSFRDYMASLHVLERMKPERLYPAHGPVVEDGTARIEEIIRH
                     RHTREKQILQVLCERTHGVSALDSEKGLTVRELVDTIYTTIPAALKTAAGTNVFHHVK
                     KLLNEGRVVVRYAPADLVHFLKDATDYTVFGEGADADVKVIERILTEFRVAAAGVSSG
                     AP"
     gene            complement(<209387..>210673)
                     /locus_tag="LMJF_21_0680"
                     /db_xref="GeneID:5651604"
     mRNA            complement(<209387..>210673)
                     /locus_tag="LMJF_21_0680"
                     /product="putative histone deacetylase"
                     /transcript_id="XM_001682949.1"
                     /db_xref="GeneID:5651604"
     CDS             complement(209387..210673)
                     /locus_tag="LMJF_21_0680"
                     /codon_start=1
                     /product="putative histone deacetylase"
                     /protein_id="XP_001683001.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651604"
                     /db_xref="GOA:Q4QCE7"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE7"
                     /translation="MHAVPKDDAEAPLSNTESRGRVALIDTSGYASDMNISAFVPQHA
                     MKPYRVLAAMEIVRSLKIDAHCRTVVPPLVKVEELMAYHTDTYLANLGLHSCRSWLWN
                     AETSKVFFSGDCPPVEGLMEHSIATASGTLMGAVLLNSGQVDVAVHWGGGMHHSKCGE
                     CSGFCYVNDIVLGILELLKCHDRVLYVDIDMHHGDGVDEAFCTSDRVFTLSLHKFGES
                     FFPGTGHPRDVGYGRGRYYSMNLAVWDGITDFYYLGIFEHALHSIVRRYSPDAIVLQC
                     GADSLAGDRLGLLNLSSFGHGQCVQAVRDLGIPMLALGGGGYTIRNVAKLWAYETSIL
                     TGHPLPPNTVLPVAEMPLSGWLFQDSPLLIVAQDRSNHVLPGLHCQRAYQMMTEQIDR
                     HVPHIQPHPRLQKAFTAAEAADKQVEDGTTAVEDFK"
     gene            complement(<211549..>211995)
                     /locus_tag="LMJF_21_0690"
                     /db_xref="GeneID:5651605"
     mRNA            complement(<211549..>211995)
                     /locus_tag="LMJF_21_0690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682950.1"
                     /db_xref="GeneID:5651605"
     CDS             complement(211549..211995)
                     /locus_tag="LMJF_21_0690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683002.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651605"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE6"
                     /translation="MSYSGRKLKYFVEDSDGWLRRNQQVAEQFVMAEDDRETKEMLSL
                     LAPRAHFASFWGVVRGLPAAVALQAQEREHLRITWTSGLQPLTSRTFARNGYVHVLDR
                     ERMSFIPVLGPWLSSFFQRPVQELLVVREGRVVFRGMGYVWDIGKH"
     gene            complement(<215758..>217623)
                     /locus_tag="LMJF_21_0700"
                     /db_xref="GeneID:5651606"
     mRNA            complement(<215758..>217623)
                     /locus_tag="LMJF_21_0700"
                     /product="putative dual specificity protein phosphatase"
                     /transcript_id="XM_001682951.1"
                     /db_xref="GeneID:5651606"
     CDS             complement(215758..217623)
                     /locus_tag="LMJF_21_0700"
                     /codon_start=1
                     /product="putative dual specificity protein phosphatase"
                     /protein_id="XP_001683003.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651606"
                     /db_xref="GOA:Q4QCE5"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE5"
                     /translation="MDDLVAVRIKDGIFAGNAGAAADKTLLIMNKITHIINCAGAEVA
                     DFFLGEPGFSYLSFPWKDAAGSVCTTILFDAGDDNIHRVVQFIDEALAAGECVLVHSV
                     YGNSRSPALIAAYMIMKYGWKLESALLYLKMAHPDSDIKPHFQRQLRQFAKRHEVDHD
                     IFAQDVDDSQFGLDNDQWMLRNTLLNGLLYKDQMANDLYRQCAEKVDVGNPVNGKAKK
                     AHITFVDTKKGTDADSQTTCPVVNRAASLPADQASVEPVSFLGLRGHSCLRSGRRLPS
                     ILSRSTSPCSRRLESDPRTCPKGRQSLPVVHSVTTETSTGVLIKAVERASALRASAPA
                     SSTHISFFQLEDKSAKGRDREGGPASPQLQRSSAESARSIDYARLAPPTQLRSPFATL
                     GSSHKYRNGSPLPTPKDKKGTTKEIHTRIQSLPASRPGSTTSVSSVSVPTSAWVGSSF
                     GLNNPTSVRSTPRTSSPLASNRLTRDVMGRPSAASYRGIAPYRSTVVPRTATEPSYRT
                     PQSSNPSPSRRGVNHATGSRSGSRRRTMSPVYLTAKRSPSGGRTQSGTEDKPHSRTRS
                     PRGQKHQDPSSGSLNNSFASNDSNGTSGGASGANSKHTATVRRQPPPVISSRRQA"
     gene            complement(<219213..>221192)
                     /gene="ABCE1"
                     /locus_tag="LMJF_21_0710"
                     /db_xref="GeneID:5651607"
     mRNA            complement(<219213..>221192)
                     /gene="ABCE1"
                     /locus_tag="LMJF_21_0710"
                     /product="putative ATP-binding cassette protein subfamily
                     E,member 1"
                     /transcript_id="XM_001682952.1"
                     /db_xref="GeneID:5651607"
     CDS             complement(219213..221192)
                     /gene="ABCE1"
                     /locus_tag="LMJF_21_0710"
                     /codon_start=1
                     /product="putative ATP-binding cassette protein subfamily
                     E,member 1"
                     /protein_id="XP_001683004.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651607"
                     /db_xref="GOA:Q4QCE4"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE4"
                     /translation="MPPKKQAEEQSRLTRIAVVNADRCKPRKCNLECYKCCPVVLQGK
                     LCIEVSHQSTISKISEELCIGCALCVKKCPYDAIRIINLPSNLERDTVHRYGPNSFKL
                     HRLPLPRPGQVLGLVGANGTGKSTALSVLKGRIRPNLGRYMNEPGWDEILKYFRGSEH
                     QAYFQHLLDDKMRVLLKPQYVDKVPKTNNGVVEVLLTKADERSMKDYFMEVLDLKNVA
                     DRTLDKLSGGELQRFTIAALCVQNAQVYMYDEPSSYLDVRQRLTAAQVIRSMLTETNY
                     VIVVEHDLSVVDYMSDFVCVLYGVPGIYGVVTMPYGVREGINIFLDGFVPTENLRFRE
                     EGLTFHIADDIEEGVSKRRAMNEYPAMSKNLGSFSLSVDAGTFSDSEIVVLLGENGCG
                     KTTFIRMLAGHVKPDNDVEVPKLSISYKPQKIAPKFQGTVRDLLQTKIYEMYCHPQFQ
                     TDVLKPLTIEELLDQEVQNLSGGQLQRVGLCIALGTPANIYLIDEPSAYLDSDQRIIA
                     SRVIKRFILNSKRTAFIVEHDFIMATYLADKVIVYDGTPAVNCTARTPCGLLEGMNRF
                     LKSLNITFRRDPTNFRPRINKLDSVKDRDQKASGNYFYMTDMEDPKGKKPAQKNGDDS
                     DNGDGADVKAAPKKQQNQRHDGGGNDGKGKKAHKN"
     gene            complement(<222637..>223701)
                     /locus_tag="LMJF_21_0720"
                     /db_xref="GeneID:5651608"
     mRNA            complement(<222637..>223701)
                     /locus_tag="LMJF_21_0720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682953.1"
                     /db_xref="GeneID:5651608"
     CDS             complement(222637..223701)
                     /locus_tag="LMJF_21_0720"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683005.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651608"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE3"
                     /translation="MSGSIARCETWPFPLHFSLLLLLLDFPACGNKGGLVIFIAHKFS
                     MLRLSMHRASLPLWVGARLLSSTAVLRLEQSAEERTREEELRQRVQQKYRGMQIPEMT
                     HHEYGHFSTTGISASAAHQAARSAGVEGYPGFGGGAFQNRGRVDWLLLLTGCTLVYLS
                     FKILFRQFTRGVNGLELPLWTASIELQAKHILFAVQFQQSEQDQIKKDFEAVRQTNPF
                     VDFFEWVRSRRPEFCCGRKYGADYVMHTLVSCLRSGDGTQLATLARTLQQSMTRKNGD
                     SLQRVDDFVEQLQSAGYLFQGIRGVGSSGVHTPEHSPQPIYTPLREVSQCGVQESDLI
                     NALDVKNGEAHSSTPFREAK"
     gene            <231166..>232299
                     /locus_tag="LMJF_21_0725"
                     /db_xref="GeneID:5651609"
     mRNA            <231166..>232299
                     /locus_tag="LMJF_21_0725"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682954.1"
                     /db_xref="GeneID:5651609"
     CDS             231166..232299
                     /locus_tag="LMJF_21_0725"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683006.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0725"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0725"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651609"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE2"
                     /translation="MHATYLQRVTRHFCEDKGKEFDIAAEVRHASQATDVRHLVPLTK
                     AGIQHFSTFLPAVKNKDDLDTLPERLKGSGELGFSPLFDPSLIDACCQRGIFPLTILI
                     DDNIFLFAPKLHTERAVCALADGAAQDNTMGGFPFCEGAEGIFDKDCLGVSRKLTKGP
                     NESTHRPSFDIFINRKEDLVDVFTLIRRQHGENWLCAPLRVCLLHMFFKPTKYATKII
                     VTAVRHRKYSNVPTSENSPVIQEGELVACEVGYLVGDIYASATGAYCISGGGSLQLSL
                     TGVCMKSAGCRLWDLGMMMSYKKSLQCVSLPREKWQNMVSARRAIPNEHILSYLRDLE
                     KGRPVSDFLKRDVPPAIADPNSKSQHKKRLKKEAAIQRKAEIR"
     gene            <232743..>233060
                     /locus_tag="LMJF_21_0730"
                     /db_xref="GeneID:5651610"
     mRNA            <232743..>233060
                     /locus_tag="LMJF_21_0730"
                     /product="putative 60S Ribosomal protein L36"
                     /transcript_id="XM_001682955.1"
                     /db_xref="GeneID:5651610"
     CDS             232743..233060
                     /locus_tag="LMJF_21_0730"
                     /codon_start=1
                     /product="putative 60S Ribosomal protein L36"
                     /protein_id="XP_001683007.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651610"
                     /db_xref="GOA:Q4QCE1"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE1"
                     /translation="MSAPTPRTGIIAGFNKGHVTTRRPRQPSPNDRFAVPHKHLRAVK
                     AIIADLVGLSPLEKRVQEFLRVGKEKRALKYCKKRLGDFTAAKKKRSKMEEALRHATK
                     KHH"
     gene            <233240..>233668
                     /locus_tag="LMJF_21_0735"
                     /db_xref="GeneID:5651611"
     mRNA            <233240..>233668
                     /locus_tag="LMJF_21_0735"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682956.1"
                     /db_xref="GeneID:5651611"
     CDS             233240..233668
                     /locus_tag="LMJF_21_0735"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683008.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0735"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0735"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651611"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:Q4QCE0"
                     /translation="MPVISIDALLFLLHYHLCFLLNRCTTHLGDMKPDCSLSSHQLKK
                     LDKNMGDSTIIDRDALTESQKWSYITDNTLKMMSLGFLCGGAVSMVVFRSVASRAAVT
                     AFGTGCGIGKSYVDTKYVLGHDVAAETVWSAQVAPPKSSM"
     gene            <234023..>234343
                     /locus_tag="LMJF_21_0740"
                     /db_xref="GeneID:5651612"
     mRNA            <234023..>234343
                     /locus_tag="LMJF_21_0740"
                     /product="putative ATPase subunit 9"
                     /transcript_id="XM_001682957.1"
                     /db_xref="GeneID:5651612"
     CDS             234023..234343
                     /locus_tag="LMJF_21_0740"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATPase subunit 9"
                     /protein_id="XP_001683009.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0740"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0740"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651612"
                     /db_xref="GOA:Q4QCD9"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD9"
                     /translation="MMRRAIAQPVARRAAAASSALVVAPRQASTVTLSVQGLHYVGTG
                     LAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFL
                     MLFS"
     gene            <234897..>237062
                     /locus_tag="LMJF_21_0750"
                     /db_xref="GeneID:5651613"
     mRNA            <234897..>237062
                     /locus_tag="LMJF_21_0750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682958.1"
                     /db_xref="GeneID:5651613"
     CDS             234897..237062
                     /locus_tag="LMJF_21_0750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683010.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651613"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD8"
                     /translation="MQRFAVSNDGKLAWGSCFASCHGGQVPAVIKLVRKAGDGERVEP
                     DCVAFSSFNVARSARLDIKSSYSAGDHVVLAFNDSDSLFAATIVRCDTWAVQWAIEKT
                     ACLTDASVTQLAALCANTVCGVATASSSASSSSPLQRLFVASRFDVPTSSRKANKEWR
                     QFLAPPRSIEAGLEEEGIASISAFDKNTLLVLTGKGSLALVRLDARALKEQPASASAF
                     YTVQRIQCTLTLASIRSRMVVYNDGKEHAYAAVYSASEKAMELVYFHQTTAEVSSRAG
                     ERAATVLKVATSIPIDDVRFAGSFHLAVSCSRIKENMQFVGLVPGADAPEAMVFDPLT
                     VPYVPIATLYSESTEEFVVISSSQEVAAFSALTNEQKVASLIGTTLKFSTGPFSQASL
                     NKAAWGLISNPFRHYGPKTRRHTEEESGADEEDLQLLQGAGARSAGRWTPVTLCYALA
                     TLRPSSPTAPVAVFAVETAPFLHTRLIKQWHNATTGLKTILGAASTKLTGALALPWNP
                     RHVRRALRLFSQDELSSLLHRIATTIAASERVASPVSYPDATTTAVDIALHVITLARQ
                     MGATLKPEDVRIVAIILRAARESSHELLRYSSCMELLIESHLQQRAMDRVLARRASAR
                     DEADEVSQTLEGNFYGIAAELQTERTLHTRYTSNAWAQHLGKCKVQYKAEAESALRLL
                     AAAHNKSEKTMECALSDWRQLGSTPHQDLLLNQFEHALL"
     gene            <238209..>239633
                     /locus_tag="LMJF_21_0760"
                     /db_xref="GeneID:5651614"
     mRNA            <238209..>239633
                     /locus_tag="LMJF_21_0760"
                     /product="19S proteasome regulatory subunit"
                     /transcript_id="XM_001682959.1"
                     /db_xref="GeneID:5651614"
     CDS             238209..239633
                     /locus_tag="LMJF_21_0760"
                     /codon_start=1
                     /product="19S proteasome regulatory subunit"
                     /protein_id="XP_001683011.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651614"
                     /db_xref="GOA:Q4QCD7"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD7"
                     /translation="MADNEWKGASFKQDEDHSAETAKLLERVNATTIPVLLRSSNAKL
                     GDIVAELLALEKVSRLGGDAASTKLLAVEVLRIYRTQNELDLMLETLDMLMKKRGQTK
                     QAQSAMIAECAIVLTDDSLAKEKQEEVLERLAYVTENKIHVELEHARFTIELATLHEA
                     AGRKRSACDMLRTLHIETITNMPRLEKLEALNQQIRLCLELEDYDHIPLVSRKINHRG
                     LGRDEAQQQKLKYFELMRAYYAHKESFFNVGRCWYETYNTVKSTDDKLSALSNMVVHY
                     LIAENATAKEIEDLAECTAFAPATKLHDRVAALSTISEKLRSDLEDIPQLYALLQRFN
                     SIELIQERVSSEVELLCQTHPELAPYPTRQELLSNRCSEHDIMVIARFYTRIPLKRLA
                     ELVHLSPEHTEMFIMTMVTNKTLYAKMDRVDELVVFEARKNTTEVVASWNDSVERSVA
                     LLDKASHLITKERMLHNLASRKVH"
     gene            <242335..>243828
                     /locus_tag="LMJF_21_0770"
                     /db_xref="GeneID:5651615"
     mRNA            <242335..>243828
                     /locus_tag="LMJF_21_0770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682960.1"
                     /db_xref="GeneID:5651615"
     CDS             242335..243828
                     /locus_tag="LMJF_21_0770"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683012.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651615"
                     /db_xref="GOA:Q4QCD6"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD6"
                     /translation="MSYSTHLREPAPFAGPSLGSKGKGDDFQHPLGGETCNGYTATEE
                     GSAAPTAEVSEEKHSSSASSDYKKEDEKWIWVLDPMTRKLRVPLHLLVPTHATSTPGT
                     VPSLCIAFLEGRCRHAWCRQAHVVPSAIPQLRYEALSSPTCCHFHQDPQDISMLKNHF
                     KYVLITGNGGSNELIPADRVACTVGLRRYLVHNVPKKSACASINAAEKRSVPDENDIL
                     ELPAKFICRLHLAHRCRYLDDCNNIHICREFEVRLQPPPQILSSLNSVTTSTRTVSIS
                     DTCYTVTPLAVGDVSDDDFNAIAEAKRINHRNASTPASATFKSAIPPYDAALGGSSEN
                     GSPMPYSGAGGAFPPFPDYRGALRTPNTSAVTPPSGKSPAFLHVESPSQIPPGGFGFG
                     GHLRVYDVRPKNQSDTVTPSCTNSPAMNPNTQEKNGAGGKIAPPKYTDGASPPAMASR
                     SNGMSGSGCASSRTEGGMSLATSEANTPLATGGYSIISGRTAVTTRK"
     gene            <248720..>251068
                     /locus_tag="LMJF_21_0780"
                     /db_xref="GeneID:5651616"
     mRNA            <248720..>251068
                     /locus_tag="LMJF_21_0780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682961.1"
                     /db_xref="GeneID:5651616"
     CDS             248720..251068
                     /locus_tag="LMJF_21_0780"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683013.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651616"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD5"
                     /translation="MHIAARVWAALGFLEMRWEGRAEEMSPYATGPSSPEDAESFLWG
                     LEEYLSFYRAGSKGPSAAVLVEVTALLRNGLWRVLFNAVFYCLTVLDKHRRRRGPLSC
                     REAEVQTGGAEDTYEVVYSSSSDADGEDAKEASLSREAPVRLVWKYPGESDEERLARC
                     VRDPLPPNSPLWSGLPSAAWEREADGASMLHSDLHDIQRPSSRCPLDEVYGGRLRTAL
                     PITDWYLVLRCLAQVGYRRDAFYLQTPFDASPQELVLALLWLTQRYKMLAVAEYVELN
                     RRYAFLLQYHVNDAFLYGSSATGGSPRPACATARERLLYHLSHASAWPPVSFDENATI
                     AARLAQLERCLGKATSSGGRSASAQLCVPTGSSAATLHVRRLMAVRRLLGLSFNRLHQ
                     ALQRQAEQVTLLGLHSPLDAQLCREHHHALYEEVTAGLAHVQATQQRLQTAADNLAKA
                     GSLVAFLLRYEESTVSAEEVLLGLEEDDATWLSHGDPAEGDASDTEATLARGKRNETE
                     ADRWRRAVRRGKLPVSQSAPEHASAALATSAASLAQAISRFRAAHVRATLTETWRRLL
                     RRSHVAPQKVPPESLRFLLDTEAQQVQEARVRENMRCRYSLQAALAAELAVLGYQTQQ
                     RRHHCHSHSSPRGGDGGAVSSTNLAEETRTVDDSKDVEARPVQVALPPLDLVTNAGIA
                     FAQLRSEETVYGSVTLGSAELQLTEVGDPAAGSTTSARLELERLQAWEEQLDAQLRVP
                     AETTARMEYCKGLLNALYHKYGLRIATPVAQKPPSQLLPSAK"
     gene            <252916..>253782
                     /locus_tag="LMJF_21_0790"
                     /db_xref="GeneID:5651617"
     mRNA            <252916..>253782
                     /locus_tag="LMJF_21_0790"
                     /product="putative small GTPase"
                     /transcript_id="XM_001682962.1"
                     /db_xref="GeneID:5651617"
     CDS             252916..253782
                     /locus_tag="LMJF_21_0790"
                     /codon_start=1
                     /product="putative small GTPase"
                     /protein_id="XP_001683014.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0790"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651617"
                     /db_xref="GOA:Q4QCD4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD4"
                     /translation="MDTRMKDLSFKVVLLGEGRVGKTSLISRYVHNAFDEKEASTVQA
                     SMHSSKAVPINDASSAPGAIREVDLALWDTAGQERFHALAPMYYRNADGAIIVYDVTD
                     ADTLRKVRTWAKELYAVVGEGKIQLVLCGNKADTPLAEREVSEGEGAAMAAELGASHF
                     FASAKTGQNVAEVFSAMATQVARSREVTGMGGGVAAGGSSGSSGGGAYTGISGRTPSR
                     SRARRGLMVVTEDGEAVTPGRSSPCEGRVYGGITPPRAHRYGSSGTNQPITLSADGSP
                     DAAAAANKSGCC"
     gene            254730..255420
                     /locus_tag="LMJF_21_0791"
                     /pseudo
                     /db_xref="GeneID:12980512"
     misc_feature    254730..255420
                     /locus_tag="LMJF_21_0791"
                     /pseudo
                     /db_xref="GeneID:12980512"
     gene            <257809..>264570
                     /locus_tag="LMJF_21_0800"
                     /db_xref="GeneID:5651618"
     mRNA            <257809..>264570
                     /locus_tag="LMJF_21_0800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682963.1"
                     /db_xref="GeneID:5651618"
     CDS             257809..264570
                     /locus_tag="LMJF_21_0800"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683015.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651618"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="InterPro:IPR024557"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD3"
                     /translation="MLYDRVNDIGSSQGEAIRYILGAVSKSTVQTTLTTLEQFCSRSV
                     ELHRYTIKATCTALLAARSDERSLLASRLVSEALGRPNGLTLVACALDGCSSTLTKES
                     LTALMANDLKLSPMKQMQMAMALVLGGNAMVKAAATDILEDFNVPQAALKEDDGGVRA
                     AALLSRQVGLAPENLDGQLANVCHTVALPKPKTEVKPRVSVAGVLRELGTGCVTTLAD
                     SRELLSIFPHSFTERDGAEVLAFFASAGSAVNDSSTYASLMTASGKSSPKSMSGTTTL
                     VNAMPLLDALCEGSPKGFNWDLVIRMLDQPDGGPFRVKHISVIFDAYHRFQPDNEFPS
                     VALFLGRWTNTMRQRSVLEYILRHPDKVNRKPLAIDAPSELLPATKPPGVTTAEMDLW
                     RSTAFMEAAVHVASREKDFDNDVFRPAAEKLPLLFLYSLFTGNFQGTVKHFTSMKHLL
                     KAHCPSLDLVSQHIVPEMERRGRLSTVIGVLSDLTEAAPERLVDVLQVVFKCKSAAKR
                     VLAESGSPRLVTAVAMCMEEAGESSDKWLQRALEGKLHFRASSTENRFAVAMSIVEVA
                     EMLLEKQLYTVSATAALNALLASPLKEVLKSVTDCAKALLASTDSLFPDDVENEALEF
                     FKKMYAAGSTAAAIATVENLLKSTVPRDKQLYACIVGIMFDETSAISCYPRKELQLFA
                     ELYGQMIAKDLLPPNQQQRAWGVLLPAVAKPGNYAMEEYGIIALEQVKPRLPDWPQYG
                     RALRYVRDLDFRVPGIVAAINRGIKQEDAAARGGAATSAEPGEGSPTSPTSPKQPGSP
                     NKALAAIDPAIVSAASSQSKKFTDMAAAKLHTLDIGTLVTNANVTAPPRVIQEQINFL
                     IGNTDVRNLESNATELSQLLRPEYYEYFADYLVVKRAALEPNYHSMYIELIAKLHSKD
                     MERALRKATIGAVHRLLSSQKIGTDSSERILLRNLGSWLGSITLEKNIPILQQDLHFK
                     SLLCQGIREGKLVPVVSFITRVLTSCAKSRFFCPPNPWTMAQLVLLMEMYTLPHLRVT
                     LRFELELLLKSLDQSMQDLAQYMRLHASHASTETRLRDVYDEININESPDFRVGEDES
                     NVSAAVVAAQPAPATASPPMQQSLRSSARPLQASAEPFQPKDKAQAPPSEVSRVMQML
                     NKPIRPPIGISLNWVFSTLSDPAFGNNAQRLTDHRLEIVAQLQAVVDEAVSYCMQRSV
                     AIAARTTERLVLKDYARDPFPDDMLVAGDAMARSLASSLSYVMVRDELPLLLHRSMTN
                     LLERILAPYTPLEHKATIRDTLVARNVELCMRAVEYSVGEEAATATSRFLFDVAREKA
                     SAFAEQEPLPLPPDQVEAAELLRVMGETLVPSGRMPAPQRDVYDDFYSCVPPVAVFNM
                     VLRSVEEAVSRYHSNENSPPLDFAQLDAASQKPGGLTDDAQAPIRQHLGRLMSLITEE
                     SSPYFLSPMLNKLMSLAVSTERLAKLVNSSAKNTQAAAATAAAAAAVTNPDGTPSAAE
                     DPAWQQEALRISAALHQLYLRIVLRCRECGEETNRDELTRLFLRHSHCYSFSKLTTDL
                     IRIKVLKCSEFDDALAKALTNGTSNYVTFAGDIITDVIIKEKLVASKDMRRTLMALDT
                     IARTRAPRAAPAAPAQTLPSYVTEPPLSKIVPSQVTKLLVPCDCVRPGEDEAFQKEVG
                     QLMNDWITVWSQKSHRYAEKRIPSVEFVKTLQQRRMLDTAHLQTFLSLGVRYCVEYYV
                     DTMLAMERADGNISSETLVGTRPGGPPGYRTPYTAKPFVMCDGFVELVMVLLQCCSLR
                     NEASHDLRAETTLLRRVLDAVTRVLTEHHNFVAKARPAPAWTLAADEQFVPLFQQQPY
                     VRLLSNLVYSLHRLEISTTRAMSTEFTSAFHTFLRRVHPMEYPGFVFGWLEILSHRHI
                     IPRFMNVQSMWPHYVDLLAGAMMFVKFLIKGNRISPNGLVFYKSLLKLVLVLLHDYPR
                     FLIAQHYPLCEAISLSCVQLLNTVLCSFPPDKRLPEPFPHVDSNDPAMLQVLDTSVQE
                     ACIKDAFTSFNVQPQLLASLEMMITNDDAPVRDSVLTDVLNDLTQASTKRSLINAVVQ
                     HMAIVYLRTHDNRIPANFAKSNVLACYRFLCSRLNTKRRYYMLGACANQLRFPNIQTN
                     FFANVVLNLFLPSPTVDAQTQTCVQEQITRVLAEKTVIVQPHPWGVLNTFVELMREPK
                     YKFWETSFIHYAPLDSMFTKLHHTVHTRLSKTGGGGAAALDGGRGDSVNVAATTSSIG
                     AAPSA"
     gene            <266007..>268250
                     /locus_tag="LMJF_21_0810"
                     /db_xref="GeneID:5651619"
     mRNA            <266007..>268250
                     /locus_tag="LMJF_21_0810"
                     /product="putative methionyl-tRNA synthetase"
                     /transcript_id="XM_001682964.1"
                     /db_xref="GeneID:5651619"
     CDS             266007..268250
                     /locus_tag="LMJF_21_0810"
                     /EC_number="6.1.1.10"
                     /codon_start=1
                     /product="putative methionyl-tRNA synthetase"
                     /protein_id="XP_001683016.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651619"
                     /db_xref="GOA:Q4QCD2"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR023457"
                     /db_xref="PDB:3KFL"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD2"
                     /translation="MLKFFTEKANHQALKAVLCAVFVQKPLEVTLGSTYSTPYLQLPK
                     SRALLYSCNEAARLIWSTHAAPLPADNSLEGEAEWLEWESTVLTPALTPLYTHRRITG
                     EAEAALKKLDSTIEEHQGTVAVKGAPSSTSFLVDSVLFASLLPALCEGGLLPAAQAAR
                     VPHLVKWFQAFQAEHAELIASAFDVLSVQECGDFLRVPQTYEVSPKKQKVFFATTPIY
                     YVNASPHIGHVYSTLIVDVLGRYHRVKGEEVFVMTGTDEHGQKVAEAAAKQGVSPMDF
                     TTSVSSEFKQCFQEMNYDMNYFIRTTNPTHEKLVQDIWKKLAAKGDIYLGKYEGWYSV
                     SDESFLTAQNVADGVDRDGKPCKVSLESGHVVTWVEEENYMFRLSAFRERLLKYFHDH
                     PNCIVPEFRRREVIKTVEKGLFDLSISRKRESVMNWSIPVPGDERHCIYVWLDALFNY
                     YTGALTRVATDGTETLDEDHHALNRWPADVHVVGKDILKFHAIYWPAFLMSAELPLPE
                     RLVSHGWWTKDHKKISKSLGNAFDPVEKAKEFGIDALKYFLMRESNFQDDGDYSDKNM
                     VARLNGELADTLGNLVSRCVAPKINVNGMWPEPAEYSESDKTLIASLNNLAGTVDHYY
                     CLPDIQHALIAIFDVLRSLNAYVTENAPWKLVKMDTARLGTVLYVTMEGLRICTMFLQ
                     PVMPQKAKEIMDALGVPEAARVGMENYLFGIVKPGTKIAGLAEGQVVFQKVTLPTEEG
                     ERSSKGQ"
     gene            <272182..>276303
                     /locus_tag="LMJF_21_0820"
                     /db_xref="GeneID:5651620"
     mRNA            <272182..>276303
                     /locus_tag="LMJF_21_0820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682965.1"
                     /db_xref="GeneID:5651620"
     CDS             272182..276303
                     /locus_tag="LMJF_21_0820"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683017.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651620"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD1"
                     /translation="MPPRMHRGGGGQGPAPQQQQAPPPQQQQQQAPPQQQQQGYGNGT
                     GGPQSHLHVFHHHAAYNDVGRGGMPPPQHGGNSGSNNMSSMMYGGGSGGGNAPTSPVY
                     GGGGTAYGNNKSSIPPHMMSPSPHPQIVGMGNEYAPRMQSSPYPQQQQQGGGASTPNS
                     IGRRVRTPGPSNMGPQPQQQQLPPPPPQQPYYGGNQGGGMSYNPNMRGSAPPPPPPHM
                     EPSPSFVNGTPQQPQPGMMRGDGGYGPDVNNSPPPQNNGYRAGQPPPPPQQHQQQMHM
                     QSSPLHPQHYQGNGGYGGGGGRGMGGGMQNPNMQMQPPPQQQQHMMGGGGGSASNSAN
                     RGMMGPMGGSKQMQQGPPPPLQQQQQQAMPPPPQQQQPGMNSNWGSPQPPPTHMQANV
                     SPPPQGQPQMGGMQYGGGGPVPMVGRGRVPGARMGGGGMGPMGGNNMGAPPPPPQQQQ
                     RQPPQPPSMMSGMGGPQQMPGGGNMNPQMMMPPPPQGGQGPMMQQSGGVPGMYGGSMD
                     ANMMGGMGGPLMPGYMDADPRGDLAPQQTLYEFLMEKRLLRKTTLGTFFPEGYDPKCN
                     SRITIAVDGNYMITNLRAQLQRTDPLWFLHSCLPDCLLSLVHKHVEQMRAHHLEPLWV
                     LSGISINGDVEAFLPSPDELHSRDAVWAKLNEGIDLPTQDEITEAFETSSAVGEDVLR
                     AIQRFLRTEENVVCVTAPFLNWCQMCTLHKEGIAQLLMGPPEMLMVPYDDMKVIAEVN
                     LQTSEVAYYDRDEVLRELFPRYVTETSTAAAGDRFLDFGLLIASHPAITTAHASVQLS
                     TQSIYEELSTPHPNFNTLREFIDQYEYPQNQNERPNLEKLKHSKGRTYIQYSPVFSNQ
                     VTSESSLVYFKRILDPSLTNANMPNNLSGVFGYLVPLSLFYFQFTGLLSVGLMTAVTQ
                     LYIRDEFPVADTEEYHHLLHPLMALRGQIISQMVSRIKADAHGQRLGKISWVRWFDSI
                     LMSVLPPDRLIVLDEWNLKNSPELASVPDDQLENIDMSMVLSLKSSVMCIPAPQLPAN
                     ASPRDAPILYHGKKETFFAILLKTFDFVGYFSHSADPMDGAELASEPVQVMVQGQSAP
                     DDQSNGPDGGKGDLADSSSDPNMSEQRVFFTAYLSISLEHCPQEFQCALVRFTELVRV
                     STINSIAFTFADTIELQHDEDGALADPPEVLLATRIACLVSVPYQQKTDEESEFEWAP
                     VYSRQLCAFTVMSRVMNRSLRVLTEAIAAALFLSGFSDCSLEDYDSMTPLLPFGDVPS
                     SLGGLLLHYVLVFPPDYEANCQTPEERCRLLETKFKAIPNIQTQLRRVMEFTFHALYL
                     LNVYILRDPSIVSSPELVETDVVANALNLLHEKWVLHLDGPAPEDVHGYFQFE"
     gene            <282167..>285103
                     /locus_tag="LMJF_21_0823"
                     /db_xref="GeneID:5651621"
     mRNA            <282167..>285103
                     /locus_tag="LMJF_21_0823"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682966.1"
                     /db_xref="GeneID:5651621"
     CDS             282167..285103
                     /locus_tag="LMJF_21_0823"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683018.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0823"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0823"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651621"
                     /db_xref="GOA:Q4QCD0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCD0"
                     /translation="MEPKKASSARGNYVRLGKNADVIYKEADVIGRGQFGIVYRGLIP
                     ASGTVVAVKLLQNVPMVFTPTSEHASQHLRHADRHEGKGSHPAALSSAGPSSSSFAPP
                     SKPRSQGCPSELAILYDVRADNCPNIVRVISTWNKVLRPPRSEASSAAAAAAPPPLSS
                     SPGESRPSRIFVMVTEYCEGGDLQQFMKARGGALPAHVARSFTYQLCNALLTLKRRRI
                     VHRDVKPANLLLTSADCEVATLKLADFGMAKAAPAPESRKAGPGSASGGKDTGSEARN
                     EEDEPADAFSPLFHSEMGTPMYMSPERLALQPYGYKADVYSAGMVLLEMMRGSCVQVK
                     WESQLCSEVPRTIWRELRQYPPAEVPAWLDLVRRMTAADPAQRYSVEDVLRHSWFHAK
                     VGPPLPPLTFPLPETSESGGERQPQETRLETAATPAVGCTGSGSQSTAHADADSLTAA
                     AVGVPVTGSNETAPGTPHRHNDPTVCAGGKSTSVPEPSASSSSDDGEAGEGTRQAIKV
                     AAPSNKHRNSRPAEPSRWMVLGVCAEVDAVHNVASGAYTGPPKPALGAQGASPVTTTV
                     PSVVTAEAFSLPPGCGPHIITNAVRSFVDVVYLYVLQDELDAARGLTLVSYLMELMQN
                     GYAAYLKCLEYLGCSWRHTAAMNSCTLGGHRLVVREVNVLYGVWRQLMARLHGAQAAY
                     TVRLPSRILDSAAAWRQRLLRASAPTGDEAAGADEDEGAPTALFVEEPRDVDVSDAST
                     LSEGDMMMSTLPSVTSISNVVADTEAAEGAGVPLLAAPPAPRIAEKLRVSSVCARAEQ
                     LIFEKAAEYVQSEALSMLMDSTPPPVADDLGAMDCLEEEEAAERVYRNRTTPSPPPGL
                     EHLSTAADRSMPPHRGVALLRVLLRRAVLTISEVGLEEEGSRSARTPVVASATESLSY
                     LVPPPGLNPMSVAAGSVSVDAVSKIVFVVKVPVFGTLDRTDLRTVENLLHAATRVFSS
                     ALSSTR"
     gene            <288250..>297849
                     /locus_tag="LMJF_21_0825"
                     /db_xref="GeneID:5651622"
     mRNA            <288250..>297849
                     /locus_tag="LMJF_21_0825"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682967.1"
                     /db_xref="GeneID:5651622"
     CDS             288250..297849
                     /locus_tag="LMJF_21_0825"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683019.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0825"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0825"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651622"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC9"
                     /translation="MSSAHASLLGSGAPSLQHIAASAGMASPPYSHNHISGSSVHGEH
                     TSLLYPPLTPEREEALRSKGRQLLDEHRRQVAANGLPYTAEEVAALQERGRELLRSAR
                     EAAAANGGHHVPAPMLSAAVRIAAETPHHSSMHSDTPDVSTDVDKSGAAQSSSAPAQL
                     PHTSAAMPYSPTAKPGATVEGETPPAFNSSASIGATAIPSSSSSSQLQDLLAEVQRLQ
                     CVVEEQQAQLHALRSSSRVTGEESFTKSEVDALRQTLIQQFNEHMAQCEQANQVYWTQ
                     VTSQHRSEVSALEQECAAYKHSAAKAETAAQAQQLQRDVEEKASVSAATALQLDVNRL
                     EAELRLARQQSAEAEAARDAAEAEAAFLRETVQEQRGRLTELEQQVSFATVQLQGARE
                     DAQRAVHTAEAELNASRLQIAHLQTELEAANAELQATRESAAAARHTHGDGNPFADAE
                     DPFGGPSRAAAPCADDGALDAARQRIAELEAELDAANAELQATRESAAAARHTHGDGN
                     PFADAEDPFGGPSRAAAPCADDGALDAARQRIAELEAELDAANAELQATRESAAAARH
                     THGDGNPFADAEDPFGGPSRAAAPCADDGALDAARQRIAELEAELDAANAELQATRES
                     AAAARHTHGDGNPFADAEDPFGGPSRAAAPCADDGALDAARQRIAELEAELDAANAEL
                     QATRESAAAARHTHGDGNPFADAEDPFGGPSRAAAPCADDGALDAARQRIAELEAELD
                     AANAELQATRESAATAQQASDMELEAARQSVADLEDALGEAAGDLERLQEDVEEKSRL
                     IQALRAGEAALGSLRVDATCIGSGGGWAIMEPSEGVHGGAKDAVGGNSAKTVHLLRGR
                     VADLTHELERMRRQQERALVSAMVPRMEARGGQYAEGEQRLALSEEVRSAVEDEVAQR
                     RGQARGVPGEWKSEKDRRGAESGEQTTRPRDGTTCMTAIATASASLVNPFYSSDGDEA
                     AERMIFSAVPRPPAGTPIKALRLPGNRKDSDVFAAAESERRVALRGMQPPAVAAEMSA
                     AAEIGMWEEDDGEDCRNTPDTLASFHMNRDGPAARGDDAFRGGDSCKDGGAEAENMGC
                     RRAASSRTLLPAIAEGPETLRAFSAVSEENADFNDLCRCSRDVNADSDEDDNTEEYDV
                     SVSTRVAASYGRQATHSAAMEGKVDDSGAAMQKLGRQYADAQHRLYLSEEARQSLEVE
                     VSELRRMVEELQAVLARQPRQTSAAARTDGEVGDEADARTITTSFASSVPTAARERFT
                     KEEGCEANASSPTPPRSGDDDAESGSFGSAHFSEHGVSVTTTAAPAHDDGPTSCQYPL
                     ATAASENTAALYERIAELEERLKDIEAQHEEELESLAEAAADRIAAMEQRYADDLAAT
                     QKAAAAAEVERQGEDDTTVSLMARVTQLTEALADAQAAHAAELQRLQDEHEDLLRQRL
                     SEQEDSFGAVVRQLDQRYQGHLCALAASGETGGVEAAGSSQSPQESAQYWKGQHTTLL
                     KRFEQLQSEYDAFAQDIAALQRRLSEQEATRQEQEQSRMMRDATSQQFTTLHQRLEEM
                     SKVVDAAQADAQASSEKLQYLTARHTENEAALQAEVDGLRSQLQSARDEVARANNLNE
                     ELSELLQRGATSVDTALRERDAQNAALEQQVQQLKLQLAAAGDRLTDLQAALQEKQVS
                     ADALQQRLVELEEEKRAAEAQLRESRRHAEEHERTTMNAADRAARDAEQARVAAQQAM
                     AQQHATHRQEIAALHRELDELRNELEVAQTVAATVPLEAQRHQRDLGTVRDRLAEALR
                     SQQELQQQLKTSRAELERQRLLLMHGGSGNGSDADDAAAFEGGGVPADARLNALLHRS
                     EELEEKLREASAERNGLQQERDRLSMQVKSAARVAEVKEQATRRQEAELRRVRSQLAA
                     VRDDLAQRVQSNHALQLEIDHLQERLADVTSAYEELQGRHAATVLQTGMQEHAEALLM
                     AKAVTIPRALEEYVEGVFSAYHAMLQAASKDRRHIYDRCDLIEKAASEAMAEVEAQNH
                     AYEAAIADAQEEQQQMKEIIESLQQTTHKALEAKNAAVADAAAAHDELEATQRRARED
                     VFNAQRDLQMAELQHADTLHSLSLLQDEVTNTAALIKSQKSKYERREAELMEEVALLQ
                     AELETRKSAARQLQQANDEKRTELQDIADAAVQVRDQAVHESQALQAQLARVLPRLAQ
                     LEDEQAQRTADLMDTAQQLSALHKKTTSTENVSRKHIEELDQTLQELLQAHAMLQRTH
                     TTTEATADRLRLQLASVTQELERATAKTSQQEEELTTVKARLHEVETHTSRVMAEDQA
                     RLRDGERRLQGLEQRNAALQQECKTLQESMQSLRIEHDGTVDALQHKSEAFAAQEQQL
                     NHQLRLSRERIETLELERQELMSSEQAITASRDACQREMLALEHQVEHLQHHLGASNG
                     HNERLNQEIVQLKTDHAVEVDRLREAITDAQKELAKCRQLLAQAEAHQVEQESTHYSL
                     STEVSAVREELKAARAQAERAAQQYRKLKAEQEEMVTLLQSKVAQLHEELRGKHEQLR
                     ILENTSAHQQDTLNRLRQDVAEAEESLKHTRQQLLNQQEAAAAAKEHHRRDRYELQTK
                     LNDAEDAMAEMTRSQEQYRQRMTSKVELYEVAEDALRNEVTDLRADVARLEEALAATT
                     HSKAAAETHQSRQAQSIKAAESELQLLRAQTAHDMTEISTLKLQLQQRAAELERCRRE
                     AAAQLAGERLRWEAEHTAACDALEEALRQEQQAIKDAREARERALASLECKQRDAVAL
                     EDECRAMRAQVRHLRRCLDAAQYQLTSLEGMAKDTAEYLGMTPEDLPGDEEGAFVDAA
                     SHPHDASVDSTESGVAAAAAAAAASGAAVQSVMDELQRRLSIFTFAANTFESEDDQLA
                     ELRKALEQQEDVMQLLAEACAGESMNAANSATPLRTGRAGASDATPGLNSTPTPRGLR
                     VAVSCGADVRGASASGVPPPAVLTHARRVFVQQISQASSTYVHRVGDHLRTAQQMLRS
                     VMMAIGSHEIASPPASRPTTAALSSRYKLQVAATAAELHRRTATLTRAAERMLDFVVQ
                     GGDGPAAAERSSTQSSSGSLIQEQLQELRRLFSEAERYVLLPFNELLCVPDSVGVVTA
                     AAATAGDENDVDGQPPHKCYSYTEQPHLAKLSGLGAASAASAAPQRPSSSTTNTSGAT
                     CVQEITAAILSPIARDEGARQWF"
     gene            <300131..>300775
                     /locus_tag="LMJF_21_0827"
                     /db_xref="GeneID:5651623"
     mRNA            <300131..>300775
                     /locus_tag="LMJF_21_0827"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682968.1"
                     /db_xref="GeneID:5651623"
     CDS             300131..300775
                     /locus_tag="LMJF_21_0827"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683020.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0827"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0827"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651623"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC8"
                     /translation="MKSSDIFHACKYTPILLKSRTNDSGVNQYGLRPVNSYDYLNPTN
                     LVNFGRGTAFDNLGVRRSERGQIDSAPSLGGSPVFTQAKLLGLSGDDQLRLCEAETTQ
                     LRMCMAKGGSACERESLLLDACLSKVGHLRRAISQAGSEFNDWFIQNVSDNHTKPFQH
                     RPHDWRHYYAQEKLVREKQQNGHAYGRRPKEFSFGARYVKTEGYGKRPRLPYNK"
     gene            <301681..>302835
                     /locus_tag="LMJF_21_0830"
                     /db_xref="GeneID:5651624"
     mRNA            <301681..>302835
                     /locus_tag="LMJF_21_0830"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682969.1"
                     /db_xref="GeneID:5651624"
     CDS             301681..302835
                     /locus_tag="LMJF_21_0830"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683021.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651624"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC7"
                     /translation="MSIPLVASGKTVKEDSELFFAVTRGFSVPGVSSQYQTPLAFNQL
                     MRSRLRQRNRFNHDHHDTCAYIERSKNANVVAYTANLVDAATQKRVGSGIGRQCVPYR
                     DHTLHAYFVSLEPSYLEERRRKGVEYDCDELSILERTLAYGCSATPVNTESVLRYWSK
                     HTPEAFAALREEWTADGSVSILAENQATADGEHQGAKDVSAAGDATAAPSSANALTVE
                     SLDAELKTWWAPFHPYISHFVALPTWPGLIVYLPPVAKADSSWRSSVAAVESPASATL
                     AAQTSTSTDRACAAETTEAEPPMVDTTNITYGNHTEPAEATATSGVLSDEDTVVAIIT
                     RIDGELSVLEKVYVKSIEPKRFYNLPRVEYIEVFGVSLATGKETYEKKTC"
     gene            <304663..>305610
                     /locus_tag="LMJF_21_0835"
                     /db_xref="GeneID:5651625"
     mRNA            <304663..>305610
                     /locus_tag="LMJF_21_0835"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682970.1"
                     /db_xref="GeneID:5651625"
     CDS             304663..305610
                     /locus_tag="LMJF_21_0835"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683022.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0835"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0835"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651625"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC6"
                     /translation="MASCAALLFHNFLWEPCGLSMKGQTNTPSVQVTSDANPGADVGA
                     QLGPRAYARGLNRTIRRRLVARDRFKADHHDICMYIERSKNENIVVYRANLIDSKTGE
                     PVESGAHQSACSFKAADPLHAYWIKINPEHVARRRARGELEDACELNMIERKLAYGCK
                     AVVISKDRFFSEVLPDKVSRAAASKKKMEAIELLYDEVQPCVCNFAALSSWPVWMLRL
                     PPLVEGKDAAASVALHTDSETSPSPQGGGEAEEHALPTMNTVVAMVTMIAGKLSVLQK
                     VYVKSIEPKHFYQLPKVEHIEVHGTSLATGESTYEKLTR"
     gene            <307359..>308756
                     /locus_tag="LMJF_21_0840"
                     /db_xref="GeneID:5651626"
     mRNA            <307359..>308756
                     /locus_tag="LMJF_21_0840"
                     /product="putative methionine aminopeptidase 2"
                     /transcript_id="XM_001682971.1"
                     /db_xref="GeneID:5651626"
     CDS             307359..308756
                     /locus_tag="LMJF_21_0840"
                     /codon_start=1
                     /product="putative methionine aminopeptidase 2"
                     /protein_id="XP_001683023.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651626"
                     /db_xref="GOA:Q4QCC5"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC5"
                     /translation="MPPKISAKSKQQPKQQGGNKKGKGSNDDGDDFDAMLAAAVNASK
                     ADAAKNHSNNHQGKRSSNGYGAAPVSRSLAADEPVVPSSANHPENPYPKTADGYPRQT
                     WPEPTVPVSKQFAAGQFPAGEIVDHPGEMNNFRRSSEEKRALARASEQQVQEMREAAE
                     VHRQVRTWAQSWIKPGLSLMLMTDRIEKKLNELIGKDGILRGQAFPTGCSLNHVAAHY
                     TPNTGDEKVVLTYDDVMKVDFGTHINGRIIDCAWTVAFNPMFDPLLQAVKEATYEGIK
                     QAGIDVRLGDIGAAIEEVMESHEVEINGKVHQVKSIRNLSGHNIAPYIIHSGKSVPIV
                     KGGEQAKMEEGEVFAIETFGSTGRGFVNEDLECSHYMMQPGAEVMQLRSEKAQQLLKH
                     IHKSYSTLAFCRKWLDRDGFDRHLMNLNRLVDEGAVNKYPPLVDVKGSFTAQYEHTIY
                     LGPTAKEILSKGSDY"
     gene            <311458..>312417
                     /locus_tag="LMJF_21_0843"
                     /db_xref="GeneID:5651627"
     mRNA            <311458..>312417
                     /locus_tag="LMJF_21_0843"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682972.1"
                     /db_xref="GeneID:5651627"
     CDS             311458..312417
                     /locus_tag="LMJF_21_0843"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683024.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0843"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0843"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651627"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC4"
                     /translation="MMLRLSRRRLATSTGGFSSAAFTGDDGGAYERRKSEQERLKRDH
                     QQEGAGAQEQQPHNGGGDAQHAGTPVSASMSSSSFWEETCSPSGFHGTKGSSSGSGNA
                     TNAAAADAPLARPTIDTYRAMTDEELVETLRTRDEQIRQLRAIYESFHYDADRHFRKM
                     IFDYHDKTIQLSQVHGRMQQASLQINREALSKMRDQQDMMTRDKRIIFTICTLWTLIF
                     WVWVRRHYVKRRELELEPLDGREWAQMSPSITGAGSYNENVFGSNKRNARFTETAWER
                     ELRERREAQNLREQQAALLRNQMELQKAVATQREQRQACRGDS"
     gene            <313333..>313968
                     /gene="HGPRT"
                     /locus_tag="LMJF_21_0845"
                     /db_xref="GeneID:5651628"
     mRNA            <313333..>313968
                     /gene="HGPRT"
                     /locus_tag="LMJF_21_0845"
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /transcript_id="XM_001682973.1"
                     /db_xref="GeneID:5651628"
     CDS             313333..313968
                     /gene="HGPRT"
                     /locus_tag="LMJF_21_0845"
                     /EC_number="2.4.2.8"
                     /codon_start=1
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="XP_001683025.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0845"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0845"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651628"
                     /db_xref="GOA:Q4QCC3"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005904"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC3"
                     /translation="MSNSAKSPSGIVGDEGRRNYPMSAHTLVTQEQVWAATAKCAKKI
                     AEDYRSFKLTTGNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASSYGTGVET
                     SGQVRMLLDVRDSVENRHILIVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSG
                     RKVEVLVDYPVITIPHAFVIGYGMDYAESYRELRDICVLKKEYYEKPESKV"
     gene            <316124..>316840
                     /gene="XRPT"
                     /locus_tag="LMJF_21_0850"
                     /db_xref="GeneID:5651629"
     mRNA            <316124..>316840
                     /gene="XRPT"
                     /locus_tag="LMJF_21_0850"
                     /product="xanthine phosphoribosyltransferase"
                     /transcript_id="XM_001682974.1"
                     /db_xref="GeneID:5651629"
     CDS             316124..316840
                     /gene="XRPT"
                     /locus_tag="LMJF_21_0850"
                     /EC_number="2.4.2.8"
                     /EC_number="2.4.2.22"
                     /codon_start=1
                     /product="xanthine phosphoribosyltransferase"
                     /protein_id="XP_001683026.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651629"
                     /db_xref="GOA:Q4QCC2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC2"
                     /translation="MLPNHSCKGFVDAQGRVFVDGREYPMASGIVATEDVIQANIKAM
                     ANTIAKDYKSLSHRDVRLSPGTAATAEAAEAPISYDNPLIIISVLKGSYIFTSDFIRY
                     LGDCGLPHVVDFVRLASYNSDTTSTGQISMLAGLRFENLRGKHVLIVEDVCDSGRTLR
                     FLRDYIMEKFQPKSVKTLVMVNKEQAARKLDFDPEYFCLAGPNKYIVGYGFEVNDRYR
                     DLRHIFILRDGEATRYPAKL"
     gene            <319307..>326212
                     /locus_tag="LMJF_21_0853"
                     /db_xref="GeneID:5651630"
     mRNA            <319307..>326212
                     /locus_tag="LMJF_21_0853"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682975.1"
                     /db_xref="GeneID:5651630"
     CDS             319307..326212
                     /locus_tag="LMJF_21_0853"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683027.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0853"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0853"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651630"
                     /db_xref="GOA:Q4QCC1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC1"
                     /translation="MLNDLPRWPRYRPIRVIGQGGFGTVYLCVDTEPASPMYEQEVAV
                     KAVSLGALCDEEVLMVMSEVSLLKNVGHPNIITYYDSFLYDDDESALSRKGGATLVPQ
                     ADGDDIAAAGAGFRSQWLCLVTEYMDGGDLAALLRQYSGQGLSSTKGVCEATSLRTLD
                     TAAAARKRGRPSAAVTDGAAAGADQGEASEGDWVSRSRLHRQRLVTTLRAAPRPPMST
                     SATTATKATVMRWDGLNASADQTWMSDASAAAMPTTPLGATDVEAADGAARGSRNGIQ
                     MHTAAASNAAVGSAATGAPHLASVPLEPQLPPLPNQLWVESFLITDIAKQCLDALAYL
                     HALCIVHRDIKPSNIYLSKRDGTVKIGDFGVSKLLQSAEPFTLTFVGTPFYLCPELCM
                     GDPYSFGADIWALGVVLYELYCLKLPFTSDNVLAQIYVITEGKYDTAALSTPHAFAES
                     QQAVLETLYGPSFLRSERLLHSLVVSMVGKMLQVDPAERPSAEELLAGVFGAGSASRC
                     GSSAGLPLAPVAPTPVHRPRSTCVLAHGSVSTPPQRGPSSPAAEPEGVVAATSQAPSN
                     RLGLSASEQHARWAGSLVAAASSALQQEQGASRVSLTAPGSRRSRERRDDVVNDFTGA
                     HTPLAVRVKTSVGDILQGMPSAQRARLGSRAAAEERDEKEEVLRAMLPVTSPKSTPSS
                     VLFHSTMEAGVGSNSANRQTALSPSLAGRGRAEVSALSEKRRGSTAGAEPPSLELAEY
                     PALQLLPAAPFPLELLYGSLANTGDSAVNSTGTTGEQRTVGDKASVSSPLGVQATQQA
                     SPLSSMSSADRPPIGRTHCDDDDALDHPIGAQTRSEIMALMENIPWLKNAEVFSAIPL
                     SAGCDDVMLVERAHRSSVSASGTDGALSSATDNAATGGSEEKAAGAAPASKGSRTAPH
                     QRQSQLPSPLRSPHSPATGTEDMQMSSDPRLPVCRAGVVSPTAPRIEVKTISGTTITM
                     GDSRRPLSSRSPFQQGSAGAAEMAEAESTQSVSQRRISGGFTAASRQPPCIPAAPLRQ
                     RVSVTALSTTVLTSTPTPPASRPDKPQMAQDASGPARPSPSLQPRGNADRQPTAVTAA
                     SKGASASYPRLFSSSSLEPTVGNAASEARLRPFSAARMLATAMASASGAAPPTPKAHS
                     PGHCEGYSTTELEALLQAKLLTHCQRRQRQLGAQWTQRAAREAAKAATRAKLKALYDE
                     AFVSRLAPASSDAAYTATYHSGGTIDGPSEVPDEFVAHADERSRAASDSGDSGAHFPG
                     DDALATPVARAPTQLPALEADAWAKGAPVAAHSAKEVASPTPPPVPSSHGSSLPFSVD
                     ATARQAETEESVLRALSAVYPRPVEIPATTVPGTGMLMDDGDDSKGWLAATPSARRIR
                     EAASLAVAVEHQCAAFRRGKEPARLRVVPPWRPPHDSRDVPGLWETSSAEEEADASAR
                     GRLGRPAPTRVREEVRWRWSAPPSDLDDTAGTTSEDEERGALLSSTASSSAASSMSTS
                     PSSSSALLASTSGADTLDAPGHPSKTPSITAAPGADVQQRLPSPKLVGSGGELGGGVI
                     GSRRSPDDAHAGEPRPSSLLGSPMYVELDSVDGGVRGGHARGDGMHRVSLSTSSLADA
                     SAKATAAAGHEKDETDSASASRFSTPSSTSSALRSSASRSSGALGHPHRSKDEARHDV
                     SSSSHDEGSSAENSSSGSSSDDAPFSASQTASFSFHSFGGAASSTDTDGDDAEPRAAA
                     KRAESDGDEDMSYTYTVQLDAVTGLRHFEYVCPVTVEVVGALPGGCRVVSAVAASHAL
                     DAATAASLSATQVPPSEHCSMKQGNDGLATRVLAAEAPTDVSATPRPHEGSDDTAAAN
                     GGISSCLGQDKASLFGGGYYIMWQEDGGFDAAAASPPTSSAPAPSSSLSSSPPGTGVT
                     VGFTAVPAKQQGHLPAANGMAPPEGFQSARAATLHSAPPSTTNWQPDVTVRVAAASSS
                     CGKDDNNAGSGATAHLRGRTASLHLSGAPLARVAAPLRPSHVALAVLSEEATAKAHTP
                     LTRSSLADSNPTKVDTEVLPASKSASTNADGNPAMDFLCDRAWTRGQTAATPAQEIAA
                     VMETTWWVRVPSSPSAPSQGLETPQQQHQLAGSPQYIRLPLSLALRPLRQRTRFVGLL
                     WRLWVSLQVSEPALSRVLLHRRGGAPSPSPGCTFAEAFGDWVTGTTPARNTDTGECTE
                     EDVSPQSSSEASSSLRLGRTIITTATTGSSSNSDTAADSQVLPASASLTVPSRSSPRK
                     WGLYYVEARTWCAVQLRTDADWAVVRRKVAEMGTMLPFVRLYLLLEEAERASE"
     gene            <326954..>327844
                     /locus_tag="LMJF_21_0855"
                     /db_xref="GeneID:5651631"
     mRNA            <326954..>327844
                     /locus_tag="LMJF_21_0855"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682976.1"
                     /db_xref="GeneID:5651631"
     CDS             326954..327844
                     /locus_tag="LMJF_21_0855"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683028.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0855"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0855"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651631"
                     /db_xref="UniProtKB/TrEMBL:Q4QCC0"
                     /translation="MWASWGSSVPAAPEVNARTYAAASSSPSLSTSSSAIVASPQWRL
                     ISTISQKASRQLCKYPAQYIYASAAAALVLTVTTTLLARHLVQRGEDRVRDGRRMSAA
                     SVPPHGAATGSGCAAGKLGCMEGAKTAPARRGAEDGDDDIEFADLAESAFFSYLRRVK
                     KQKEAPLLAALTYLEAAVAELAEVRRGHAYHDSFVEDEGSEGGEGCHHNSSDAHDSSV
                     DSGGNGNDVGDSGAVAEAQAKVHRLAVVADELLTQWICSLDGVPVRQSEALKQRRKAL
                     VQEAAALTRRISPHLPDIRM"
     gene            <329289..>337193
                     /locus_tag="LMJF_21_0861"
                     /db_xref="GeneID:5651632"
     mRNA            <329289..>337193
                     /locus_tag="LMJF_21_0861"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682977.1"
                     /db_xref="GeneID:5651632"
     CDS             329289..337193
                     /locus_tag="LMJF_21_0861"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683029.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0861"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0861"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651632"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB9"
                     /translation="MGNSSSRSGSSLSHTAVGGSSHRRRSRDSQVRERPALRPLSAGE
                     NVSAVTSATAASSRVAASSLLAGSASPTRGQHRDAAAEALTASAGTQDNHLVSPVSST
                     HQHGLLSLSSLPTKGVVPSPARATAAAVTVSQHSIGERGHPLRDSRGRDRSCDAELSL
                     QQRHHQQQRNKDFDLAVIDAPNSCQAHGDDENANGGAARRGSVVSVHRARSSSTLQAA
                     TDSAAPLPLTTLLSLEDTHLAATKVSTAPTPAGGHTRGTVSMKRGGDTEVNMNEHNTD
                     SSQVCRAVSPSTLIRESRLPLGSPAFSCPPSTAASPPPVGRAARSTNVPCHPSSTTTS
                     TATPQQPDEPLNLGVKGAVGRGSCNSKSDLKSKPEGAGDGRSERGGFWRRQSRNLLFR
                     KLLSRSGSRAERPSLPSRPTAAEDGGSARGTTAEFTAEEGSFCRSDITTKAVYQRTSP
                     AQRAHDVRSTASAAVATQPRSSSPSSPFPAVAAAATGTGLAVSRPLTSSMTAQRVSAF
                     QSPAAGGHSVGRTTVAPRVDDARSPRSGSRSPRCADDVSGPKPSGEKCHEALPRGLPV
                     SKGTPHFLQVVPGEQVGRQDSKESDSTTPTASFAEAVWGTRRAATPATSKTATDNTSL
                     FSDDDHDNDHDSDCLTAAASPSSVYYSLHQQPRQLKAPGVLGAGSSSITTVTDTTARV
                     SPRSPFVSPLTAVAAAESGGSAAAAAFSSSAATADACLRGRRSVSQSAIIAAWNRLGA
                     RTGAPVSGVGAGGGHHGGVESPEPSAEALQMSSVPGKSLAVAGDSIGGDDELATSAVP
                     ASRDTQLARVPTAAAAEVATDEAPSFRHQCTVAGHQEAGNRGSSRRSCAGVASVLPIR
                     GRSVTTRQREPPPPFSPSPENSEPSDAVPQPLSALGQLSIREGAPAAGHPASPPAPTK
                     AVNDIAHGWVVAPPQELHRPPRVRIKYKEEAPSASRASPLTRELPASLHTSTATSTAI
                     ATQWPSSQESRGSDTSLSTAQSLQVGILVPVNVEDRRSGGGLVEERERLLAHRTTAYD
                     EEMMSETATTVDADEEDRANEEGGAAERHAAPRSPQSLAQHQLQRQPIEALPHRASTP
                     RFTTTRTTVAANSAAPDLLSAHYNDQQHYSPPHRMTSGTFFAPSTSGAAACGAILWVH
                     SSPSSPRSCNTSDSRLEAARGAQNVEDEEDSIEEVGLRRTRDSADARRRLHRSGDEHA
                     KRFVGLDVSPFNRNYSSPSVFAPRRDSTGFNAMAAATRGGGGTQRAALVRSNSYQPLS
                     RRSQLEPTHNTSLLSSTARAMPRWRERWTPTPQPTSPLSWSAAGDDIGGTASGLLSTP
                     RGRRGLTSQGAPPLARQPSAHLHYPLPPPISAVLSHVPQYLRREISGSLGSVRWQEVS
                     LHTSGGRASPNLGFAGSSRDNDDTPPHCDALGDDEEDLDAVVNEDDGEDGGDDGAQRR
                     QGCPVSGAVGEDTGDDGNDTFLCLESSEAPTSGMATLQTWHRDDADDDDEEDDKGDTS
                     ENGAGSCSNGEVCSDGRHCLRLPQRHRCRRPVTLPSASTQLPTLQPQESCNVGGASRE
                     FDPSTPSEQGISPSRTGTRTFGDAIVRLPQTRYEPPMPSNRNTFTAFVHLSDISSSQL
                     LATAAAGFQCGPDAHLRGVSTRVHGDEAAAATSEDAGDAVRRAGPHAHTPATAATLIL
                     NNYALRGAHLADGAGVGTHVVDATGGALPISPLNSSLGTAPTDHISRADTPALVAVHG
                     AVARRTSQGAEAEAASTRSESPGSLSCGTPPKLRRLTKAPQGLNHAAAAIAAAAVGLD
                     GSSGGFDGDNDAGSDDLSVPAAQPGATSPRTSWSLESRASAAPVSEGERHALSDEERP
                     WLDVFGHSTPLLDSVADAAVAVDALATVDGHLPQSAPLSASQPLPWWNRHRHTTRSEG
                     SGTLDFSQRGGESGNGGGGHSPCSSLSVNSALAVVPGGRAASPASPATSTGSVAITGS
                     PLGHTLHPGGGAVASVSFRTSGGRVRREAQYPTIPANGCRSSAFSSSSGSTNSNGGDA
                     AHSGAASAALRHKPNGEVLVMQGRSCDAGDSSSAKRVAGEEGIAQAGAAPLAERMRHD
                     HAGLRDACMQTWKRHPWMPVFPSSSRSATMALAAETARAEFDSKGVLDMTAPAHAMTS
                     ITVVPSTLSFIEAEVQSLCNASPLALAIAAASGGSYCGEGESTSDKEALDDGVDGDER
                     SDVDVPAPLSLGVQAHHSRIASSVSNTIAAPTNTAVTAALDGFREAETYARTCVEESA
                     TDARGAGVSVRDTLPTQHRQPLLRQQCSSTTAPFVLTSALPGMGMMASWASETIDGFA
                     GGAGPGSGCCSGSGNVASISTALTTATSLAVLTSRVSCDSLVSPSQTSELALMPRRSG
                     DAADGNGGTGTGTGPGPLLMDERVSGVEAADSSAVTGAHAAEDGDAHYGRAATHTDAG
                     LEVEHELPHPPLATKLIYSHFMAAPHATLHRSVDTRSAGFTVGVDQRDTGLGEQIPLT
                     MPQNSPTPSQPTASCTAGPPGSPNHVFACSPLLLDEEASVDTRAASRAQARPDHHYGL
                     VVAPLPHHEGSTPRVCAQSRSQRQHRGPSIGQIVCRWCGEPYTSAAACLAALRPHSVL
                     RKERRIEKAAKRTAQTLLREGRVTEAVALLKSAGVYVQ"
     gene            <337735..>339765
                     /locus_tag="LMJF_21_0865"
                     /db_xref="GeneID:5651633"
     mRNA            <337735..>339765
                     /locus_tag="LMJF_21_0865"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682978.1"
                     /db_xref="GeneID:5651633"
     CDS             337735..339765
                     /locus_tag="LMJF_21_0865"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683030.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0865"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0865"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651633"
                     /db_xref="GOA:Q4QCB8"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB8"
                     /translation="MWRGSHRRWYSCRQARSSPRTPALGALWSARRMRHSPALERGAG
                     DLRAVVRLPRGMSPFQLSRATVRLGQQRDAVESRPDGGSHIDHSLSPSTTVEGAPSSS
                     AQPSEQLAPWPVDAFEFNAVAAHGGHDVRLAWDAIFSSSDSATADASGNESATSTLTG
                     AGAVRDATSSLLDTASRTIPKLSLVTLDTIRQLKIAEETAEAQAALRGGGWVCTGCWA
                     IVRADCSDNTSSGASDSTGLSSFPRTICPACRTLRHDARMWSCTVSLRRRPDLWQCRC
                     CGEANTRAAANCRCCGVARSASIDTANDDQEEAFVRMTIAVEVDSYPIGHVVVTRNRT
                     TRWRCGACREVNSLQMAVCRHCARERFAVTVSCPTCDAPRVLSNAVVLGGGGADAHLT
                     RGSDSHAVLDTVSPSSAGTADASGGGHTATPHPSARVFGPENCYSPNSTQLTCLQCRS
                     PLHGGRVTTVSATPSWWCACGVVNTMTAYSCVRCRLPRALECPEKLRALLRSAVADSV
                     SASPPLPAQDPGAAPDCSEASPKWDFRSCTNWMCDSCCGVNTASYQVVAESSLSSFSD
                     AACPDHTKRGRRLWMRHGDAECRHCGAPWHHQVLLESNSWRCACHALNSRADAFCTSC
                     GLPALDGVRPDMLSSWSKGDWRCPSCGSLCYRSRQRCSCGTPRPPARLGGAT"
     gene            <345792..>348533
                     /locus_tag="LMJF_21_0870"
                     /db_xref="GeneID:5651634"
     mRNA            <345792..>348533
                     /locus_tag="LMJF_21_0870"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682979.1"
                     /db_xref="GeneID:5651634"
     CDS             345792..348533
                     /locus_tag="LMJF_21_0870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683031.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651634"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB7"
                     /translation="MRDGDCGEAQSLPPPVVEDASAAVIADAVDTSRHDLSCSPSAAT
                     ENSTLAFSPPTQEPTPLPTPAARLFASRPTPSASPLIAGTRPSRWPSTSPLRSCGSPI
                     VTFAPSTRFDQCRQRTNVAVRRSDDVPHFALPIPLLELPLSSTWASSGQMTDSALRAI
                     GLQQPRVLAGSPPTPSPRQTPSSTQSEGLRDFAVDDFSDTASSADSACSTNSSSTMLL
                     DSDIPAVRPRTPPSLALGLSIPSVVLLVPPDCKYSAIPSVMDEIDSSAVAAVDAATKT
                     TPPSLANTRDVSFALLEPEKLARTTARFLTETVVSIREQCHVASAETARMSVALAQCR
                     KTAPAACLMDTSRLTSMKVPPPPPPPPPPLLESLSLSSTPEVTPSIPPLLLAPSPPNS
                     VELANSKMVLRVPDTPSKRLHAAPLDPVCPGNNVELLVNAAAEVTTLWQHKSSPTAIV
                     LSRWGGEEIDESPHPTGSPADKAAAAIFTATIAEVSCDSNLGTGAIDAQPSKATTPPH
                     TSCVAAPSSGGSDASDRCEGTVENFCTSFAGTEQVGEDGAAVTTHPTPHPPPLPAEIR
                     FPHDQERCAVDSAAAAGTARLRSPSKAHTPSRPRLFQHPLKCSPGVATRSLAMAFGAG
                     RSPPSSAESHVEKDGGTHERLSQPPLRINAAREALQSSCEGPAAISVAMTSGIARAAF
                     QHLGCAVVEQDDSADATSPAKQPIHSGSSSSRSCDVGAGTPCLVKAPKDAAAASSPLP
                     LASPTPPRSVLATGYLSLFRLSGDQGSSHLPRCPQRQLPMQPITPFAKDITSATTSRP
                     HQSSSSPVRQPTGGLDVSLLSLTMESGSAPRRSTNLSLSGTPLQHAFPMLCGSPHALT
                     ATIATARQYSGSEGSRSPTSTARSGPRLLSPFPPLSRNAPYGGSAPISPKGAGTTDE"
     gene            <350896..>353463
                     /locus_tag="LMJF_21_0873"
                     /db_xref="GeneID:5651635"
     mRNA            <350896..>353463
                     /locus_tag="LMJF_21_0873"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682980.1"
                     /db_xref="GeneID:5651635"
     CDS             350896..353463
                     /locus_tag="LMJF_21_0873"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683032.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0873"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0873"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651635"
                     /db_xref="GOA:Q4QCB6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB6"
                     /translation="MAFFLKALGLSDSIPGFPFTPAANDPGRTVYTSPRMCWTLRPGT
                     QSDDAQTRVSIFTCSVSAAATAGSSGDRELIKQLARNTMRRAKSLMIPGFLKCHGAVE
                     HSDTIYIATEPCVALKDVLESLELRRHYCGEMEEEYAASVAYGLDTVGGALGALQSNR
                     LVHGNVHCGSIFISAASGFWRLFGLEFISAVDEVAKGAPGCLFESARRAGMVVGYRCP
                     PELGSSSGGDIGSGDPVVAVDAWGLGCLLFETVGVTAEEAMNGRLNSVARNLSAAELR
                     NVCRQSLPKSLHQGCSHLTTPNPRMRTTVAAFVENCEFVKKSPFVQYMKALSGLLLMD
                     RSQQMRLVESLAETVEKFPLRACLCFVLPRLGELARTAAKAGGSSGAIGVSIGPLADP
                     VLKISERTAAGEDFDTHVTPVLVQLYQSADVLLRYKLLLGVEAYGAKLSSTALNNAIW
                     PLYAKGFAYSAPSVREYSARALVHLAPHMSESILGDQVPKALAQLQRDVDGALRANAT
                     IALNLISEHITPPSQRAMVMLAYCCPMLRDSFEPSRVAALRSLHGSLECLSAKQIAES
                     VLPVISPLTADQTSAESRTAALSLLKASMARLEAHHKQLSAQRVTTAAGGPVAANRST
                     DASSTSTPVPAAVPAGTASRGWSLLEGFTISSALSTAGAAPQRVDAVSAPVPSSASSP
                     LRPTPVATVLPTPVVDAASSVGGGGSGWSDDDEAVAASEDDGKGRPHAFRESSQFAKS
                     AAPPPSAPTAPFFAGTKSAPTAASYAASPVNAVGGAHESTSSLTGLASSPPSQPVLTV
                     PNTSRVLSRPGISSLVGGTGGAARVGVSGSTDSVTASASSGPMKLRRKGGLGAARLD"
     gene            <354672..>358508
                     /locus_tag="LMJF_21_0875"
                     /db_xref="GeneID:5651636"
     mRNA            <354672..>358508
                     /locus_tag="LMJF_21_0875"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682981.1"
                     /db_xref="GeneID:5651636"
     CDS             354672..358508
                     /locus_tag="LMJF_21_0875"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683033.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0875"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0875"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651636"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB5"
                     /translation="MSTPKTSPRHRGRDGKSDNKSGGTAAGGSKPSTPSGAATAARGG
                     GGIGFSYHPIHNLQFLKELLRPSAASRIAAAARAVHVDDNHGAAAGAACGPLPLYASA
                     LGWSGATASSLSPPPPPSYGSAVPPYQPTGKGPAPPPFAEANGATPPSTNSLAHRHLD
                     VNALASAAPSVPSLPLVLECATQLSGMLARWRVSNEGERRRPPPPPFAPTPESSYSPP
                     ARQGNQGGAMAPTAAVCAAADAGRPLKSTPHPAGGGGTTVPPPARPSAQRILQMMDLI
                     LWYCLSTAEDAQLATGGRSRGTSGMATPAPPPGATATGAGGVSNQALGGGSSRPFGLR
                     GGRGGRSDSVSVAGGRPGSAGRNGSGSAEPLATQDWLDGRMSSAPPTAGAPTITMSDD
                     QLAERLFRPAVDAVVLLQGPRSQLMPSSSLPSSSLSRSQVADAASRISNSSAVAVAAD
                     TRGGLAPTPVEDATDNDAATAVELQTMALWTLAAVLVRFTDSPFNATVFLPVLFPQVD
                     VRSLAGAAVRHPLLQPLLRGDPRNTSLLCGASAALTALLHKLRSTLQYAEEPPTGRQA
                     AFLSLAAQCGTILTSLHESLCWGLVQSQQQQPQNAGHGTVSTTPSSAAAVPLLNTYAT
                     VVSVTPYHRCPRSREVALRTLQLPVMHSFLAHDEVGAFVPATVLVSNILKNDTMRVAA
                     AQLPGMTETQAGQQGRSEGDETPAAGGDRAAVAASFLQAVLSHADTRVEVWRCMVPLS
                     RLYPRLVNNEFEALMAASVKVASALTAWEAAEAAAEAAAMASVSVVAEREDDLNSQGQ
                     LSPAPSASATLSRPTQSASGGGGNNAEERGVPPPMYGEGEGAGPDAGAAPLSLQYSRA
                     PAASLDAFAECLRTWLHYMGYVWKAFDDNASDPAQRPEGQVDRASVEHKQRIHEELLR
                     PAMRLRRCGADVRTMTLRCIAQIGNAYMSTVADRSLCEEFVAYVQSSAADAQPRVRGE
                     ALTTLGVWLWQYTSMDDFACVAIDSAVHSLTTDPNPVVRTKAAFALSNVTGRLPEGSC
                     AVVRNSPDYIATLCRIAMHAAVIDTESGVQGHGIRMMSHLLQVLTFEELISEVEEFEE
                     GVAEGFLRVLLECLRANNTRGGHNTHQEGDSVGESGGTGAASLRYAVPREAKHRWNAA
                     CALGMGLSREEVFEAEPKYAVEAVEALCTAVVRDHIFKVRTQAAGALARIPGHCLSGT
                     YTATDMTPTVVASLCKALETATSTENFRQYKEQGSLHDALRSALAVMMASTTPSNELE
                     KVFTSHLKVLEKEGLL"
     gene            <359990..>362851
                     /locus_tag="LMJF_21_0880"
                     /db_xref="GeneID:5651637"
     mRNA            <359990..>362851
                     /locus_tag="LMJF_21_0880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682982.1"
                     /db_xref="GeneID:5651637"
     CDS             359990..362851
                     /locus_tag="LMJF_21_0880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683034.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651637"
                     /db_xref="GOA:Q4QCB4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB4"
                     /translation="MSTYESLSTVIVSCGSSSGGSSNGDGASEAALHHHRRPDSVART
                     MAEHADDGIDGALHIASTTGPHSGRLRTRHRRQSNAGRSTGDLENPLGGVSTTYLTLC
                     CDSVSVQLSARDVIDDVSCLFRGGRVTAVVNCCGAHSAFALLAVIAGRVEGTAGNTVL
                     NGIPVSASTYQAQVSFLEDVGEVAEKEEESGSRTARASGGLFAELTVRENLQYTSALR
                     VANSAPAYSVDEVLQQLLLGPYEASKIKNCSLYVRRRVALGKELLLNPSVLLLDEPLE
                     GLATHESQQYLTILSKLAAPSAADAEACRVMREAMCAAAASAAGERGVSACTAANLAA
                     NSHAADVLLYTPRQGRLHSGAQASPSMPADMLPTAATTATATFANPAGCAEAQRIVVL
                     SMVQPRWALLQHVHDVVLLERNRCVFAGSVQDMLAVKLPKGVMRESMAVSASGGGELT
                     DETGALTTGTAAAAPSTPRRDPLTAAPVDSYDAVDASIQQQRLGEQIVHGLYRLAASR
                     MTAAAGGDGSESGEGGAAATAESEFRLIINVESLSDGQASRPSSVAASASSAPCTGTN
                     ADGLSVTPLSQLYAHRQQRTRAKVTAYMEACAMGLVDMPEAFHQPPSSIVQLLHLFRF
                     GFLELRHNLLWDAFSLVCGLTLAAALAALYGRQAGQDGMQNRVGIIFFLVSCVVLQAV
                     LSLDTLRCEYAAFQHYSLRGYYGACTYLIFCAITAALWRFGLASFVALAVFVLSNFGE
                     PWHEYRGVFELSVILAVTSFCSHFGVWFLCAWLPSDHVGRFIIFTFYTLNIILAGLVL
                     NLQTLPETVQAISFMSVVRLAYESCILTQFIGKSFGCHDDDAAKADGTWPRVSVIPPP
                     SSAAHQGGMAAPIAEYAGACRQARASTPLMRGMFGARAAVHTNTCYTGTEYAEFLGFS
                     PSRRWSNVGVLVGMSALLLAGSWIMMTLYRPRRRLRMSA"
     gene            <363755..>364081
                     /locus_tag="LMJF_21_0882"
                     /db_xref="GeneID:5651638"
     mRNA            <363755..>364081
                     /locus_tag="LMJF_21_0882"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682983.1"
                     /db_xref="GeneID:5651638"
     CDS             363755..364081
                     /locus_tag="LMJF_21_0882"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683035.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0882"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0882"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651638"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB3"
                     /translation="MSGLTRWCVNTVTRVWERSRSTANLVYNVGDQLRIVYNTANSHD
                     ERKRDFDATVLRAGGFIAATILCVIVDAQGGVPNTLRWLRALVTTENHASSGAVDAAA
                     PTMATL"
     gene            <364970..>365581
                     /locus_tag="LMJF_21_0883"
                     /db_xref="GeneID:5651639"
     mRNA            <364970..>365581
                     /locus_tag="LMJF_21_0883"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682984.1"
                     /db_xref="GeneID:5651639"
     CDS             364970..365581
                     /locus_tag="LMJF_21_0883"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683036.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0883"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0883"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651639"
                     /db_xref="InterPro:IPR028110"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB2"
                     /translation="MPSESKKATNGGTPAAAAAEAVQSSWKSSRLPYRHPLRLYLPVV
                     IAFVLLNNLAFRVEVDSTGKNLVLPEYVRAIAMERYALRRAMAAGQVPTEPIPFNVFL
                     FFEESVMSALFQAGLFLFRSLSGIQAVCILAWLIHLFELGVCFRICWSCNASFPVTLR
                     YMFCTCVGGFTQLSPLIKARDAWVEEMRATAAVTAALTSTKNQ"
     gene            <367344..>371477
                     /locus_tag="LMJF_21_0885"
                     /db_xref="GeneID:5651640"
     mRNA            <367344..>371477
                     /locus_tag="LMJF_21_0885"
                     /product="putative mis-match repair protein"
                     /transcript_id="XM_001682985.1"
                     /db_xref="GeneID:5651640"
     CDS             367344..371477
                     /locus_tag="LMJF_21_0885"
                     /codon_start=1
                     /product="putative mis-match repair protein"
                     /protein_id="XP_001683037.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0885"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0885"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651640"
                     /db_xref="GOA:Q4QCB1"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB1"
                     /translation="MHTAHSAEMAAGAEEEEAWEGGATMPYDPGMPGALRPLHRPPPP
                     MHDNPMSNCRGATLWPVAQSVSPVERGGAAKAAAQDGSRLRYAAYASLEGRRQAAVGI
                     NLAAHTPHDVDGRYTDGQLLAPPPPRPSSPLHEHSDQQQQQQQQQTHEYSSISDGARH
                     LNPARHRSAASAAALFFHSPSVTDGFASSPCAGGPAAFRAGRRAAAATSAVSSTATFL
                     SATGASAMMVATAASAAAAQAEPCCVAALIFNNAKEVGVALCELPSLTVSLFQYGDTA
                     TFFKTASLLYTRNPVEVLVPSTAVDSELVQTVLQQHGAHMTFTSVQRCFYNAEEGVQR
                     LSQLKSSAEASLCIEDTDRYLCVAAANAVVLYMEHVNDMHLLPGSVRVRAEALEHYME
                     VSRTTARVLQIIPDTACVSAAAATASMELMCSAANGSERADRQQRVRAQRYGAARTPM
                     FLGHDLANPPPLQTVALVDAIPRACTVMGQRYLRRTLLQPLRDRVAVQGRHDAVEWLL
                     CEPRRLHMLRALLRHTAALDLERLTATLTHQPRRERSSAQQQSYLESLQLLWSALPHL
                     EQLHIQLKAYLGPLPRVQAPVNREGVPPLTPPPLPGGGSDAAAPSHDLRSTAAHPSVL
                     HSIATALGQCRFPELETLMGTYLERSVLPSVVGHHEKSAAHYGALHGADTGSTHIPPS
                     VSGMAQQPQPQRRRRLRSDDGAALDSHQHPQERSQRATAVFLRLLRMCFLVQAPHSGE
                     LDALRTRLSLRISDITSYAAELRATYRIFSLRLEPDPVKLYCFSYAVAEEAKAQAGPF
                     TWRYAGGSHFALYLSALREQQQQLRRQREQQQGQGQTLRSSQWHPPSSAGDSLCTASS
                     SPPTELARHTSDAGGAEFESSAIDPFSPFTPGTNYTAPCRLRRRRVRCSTEDLDYRCA
                     RAQECVVAILQLQLHSVQPLVRAIQHEFLGSLQATVESVALLDTLLCFAFYSLTHQCT
                     RPVLVELRTGSTTMAPRVRTLMPERPGDGEAVASSGRRATSVAGGAGASWNRVDEYIN
                     ATGAAAGVGDQGGGTAASAGTSETSSDAATPSCTPSMSTVTAHAMTTAAATTETETRH
                     ASGVRLCLENALHPSATQRQPPSREVARAGLSARWTGAEVGGISRPVSDSSGGLTMSW
                     GSGGGHVCVVTGPNACGKTTLLRILGQYFTLAQAGCFVPAQHAQLFLADRLLAHMLCD
                     ELPSITHSSFRRELMELSELTHAATAESVALIDELGRSTTTAQGFSLAWATALLLSDR
                     RVHSVLTTHYAGLPNLARVLPTRVVAFHFRVTFQHLAARDEGRDGVADSSWRGPARSR
                     ITIAHFGHTLFPGPCPQRWYGLALAEKLHFFEPVLAMARRTRTCPSTAEAHTEENEV"
     gene            <372335..>374473
                     /locus_tag="LMJF_21_0891"
                     /db_xref="GeneID:5651641"
     mRNA            <372335..>374473
                     /locus_tag="LMJF_21_0891"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682986.1"
                     /db_xref="GeneID:5651641"
     CDS             372335..374473
                     /locus_tag="LMJF_21_0891"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683038.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0891"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0891"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651641"
                     /db_xref="GOA:Q4QCB0"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:Q4QCB0"
                     /translation="MVALTAPPPRPEETIPNLDEVEVAFRELLRQGASLDMPQVAAAQ
                     NALQKVLREHTRLLTYMETHSRPNADAASATADDDDDTEPACVYTFRVMYDGAITAVH
                     DSVVAATQQRQRAAGSFSRAKASLEASSSSSLTEDVLQCMETLIESLGWALHRSIAFT
                     GDAQSYFTPMQQKLSALSTHAMSASEPGRATRSLSSTSPATSNTAVAALAIVLPAWLR
                     QANVALSTLSHFVSKTYPHGPWFAHRNRRAVVRSRRLRHPSDVGEAPFETLVRAASRV
                     QDRDVEALSEAVLRVAQAHTQCLAAVRATSERPRDRPSLAKIFAPLNTSLNGLTATCE
                     DVIRRREDDRPHAHAVLEAGNVFTWLATDLEPCVVIEEAFSSANTYINKITARGNVLL
                     LQQENGCALGQQELARATVTWAAMLREALERMVLLVLYRYPRAVPWGESLESPMPRYI
                     SKPRPPSVPRDRGEAVPVWRRAQTAAEQVARRPTHPPSSTTSSTAAPAPPMPRTQDAL
                     VVGAMPPPNTVLKSAEPQPTDAQQSKPTPECTFDAVTQTWTVQHYHQPLVGPASGAKQ
                     EPVLVVLPEEKLDSSHLVRILDCFNTYVTIPVKVRGVAVERCQNSKLQLASSVGPVRI
                     SDTERQEVLIETSAPGVHAAKVNGLTIHLTEAYNTSIVTRMASNVNVTVTARMPDGDQ
                     EVRELALPEQYITTIKEADQLVTREVTYSG"
     gene            <375761..>377686
                     /locus_tag="LMJF_21_0895"
                     /db_xref="GeneID:5651642"
     mRNA            <375761..>377686
                     /locus_tag="LMJF_21_0895"
                     /product="putative aspartyl-tRNA synthetase"
                     /transcript_id="XM_001682987.1"
                     /db_xref="GeneID:5651642"
     CDS             375761..377686
                     /locus_tag="LMJF_21_0895"
                     /EC_number="6.1.1.12"
                     /codon_start=1
                     /product="putative aspartyl-tRNA synthetase"
                     /protein_id="XP_001683039.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0895"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0895"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651642"
                     /db_xref="GOA:Q4QCA9"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA9"
                     /translation="MLRVSLSSCVSCRLRGVAGPTPGVVAAVVVAASSSAVPKRWTSL
                     PNSQVSTQRLCGTSSSATQGASSIRSPHCTSLSPPSTPSAAPTETATLTNGAISGGGC
                     GRACLAAHGASIASLRAAFNGSCGESGCVREGDEVTVRARLERTRGRGKLAFLHLRQP
                     PLESVQAVCEGKELTKQARSITLESIVDVTGIVRRADTPVQSTTCQGWELQVTALHVV
                     SQAATPLPFPYRDTNARLDTRLNHRVMDLRTEKMIAASRLVSALGQSFRNELLARDFI
                     EVHTPKLLGAASEGGSNVFRVDYFERKAYLAQSPQLHKQMMVMGDAMRVFEVGPVFRA
                     ENSLTHRHLTEFVGLDGEMVIKDSHTEVLDVLEPVMCAVLAHLTQQHGNLIDALWKQQ
                     QQQGEGLQTSGGDPQPATAAEPPRCGSRGHAPRDVCCEVALERMTPLGITTDASPTTR
                     TPFKIPAQVDPYHARVGGDGSGCRVLRMSFADASQLLAGCGGPEDMADCTLPVEDFTL
                     PQERRLGQLIKERYGVDLYVIDSFPSSARPFYTMPVDPSMPDGPTRSYDMYLRGEEIC
                     SGAQRVHQIELLEQRLSAKKVDKVSVKDYVDSFRYGAWPHGGFGLGLERIALFFLGLD
                     DIRQVSLFPRDPKRISP"
     gene            <378675..>379946
                     /locus_tag="LMJF_21_0901"
                     /db_xref="GeneID:5651643"
     mRNA            <378675..>379946
                     /locus_tag="LMJF_21_0901"
                     /product="hypothetical protein"
                     /transcript_id="XM_001682988.1"
                     /db_xref="GeneID:5651643"
     CDS             378675..379946
                     /locus_tag="LMJF_21_0901"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683040.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0901"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0901"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651643"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA8"
                     /translation="MLNFSRLGALPARRRRTTALHETLLASAARCHRQWHSTLAASNC
                     GGIAAAPAARRADPCLATSSSSAQALSSHSCPTAAVLVDTSDSALVTLPYCLAVVQEK
                     VRAHLRSLLVQRLLAPLLTESLADLFGEPDSEGSSDTHPYRSGDAAAMTSAVVHSVTQ
                     APSALRYLAFSHQHPQLRHPSWTPLWAASPSSNTPLSAAPCTPHADPYAEIRTDAKRP
                     DEAAVDAFDVHVTLVEQEAAEALVRPCLGEVAPLLGCRACGSFRAVTTAAHNVISAAF
                     SPSTKVGAPSAQPAALSPSLPPSLPVVTYWECCRVDSYIPSYVQVQAAVRHLLLRRRP
                     TADYTATAWSAVASAFMSAPRLPPARPLALVAVVVPDHLTALYSEFADMLEREGGHMM
                     QQQQRRGATCGGPVHLLLFNSKGLAREYAAV"
     gene            <380415..>381761
                     /locus_tag="LMJF_21_0905"
                     /db_xref="GeneID:5651644"
     mRNA            <380415..>381761
                     /locus_tag="LMJF_21_0905"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682989.1"
                     /db_xref="GeneID:5651644"
     CDS             380415..381761
                     /locus_tag="LMJF_21_0905"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683041.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0905"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0905"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651644"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA7"
                     /translation="MILHHSAPLPRMVTLPGCTLHIAVDADLSVNFDRLLCPPHAGSN
                     CVGVSSVAPSVAHATLFSNLPPRTQVRGVRQVNAVSQTVVLRLASSASSADSNGAVTP
                     ASTSALTRNTYVVVVLDAQQVPQMLSAATARRCPPHLSGAGPLGWYLDAVMAGLQQAK
                     EAEENEVCRSGAVSALTDKDVNSSRTDQPSTTTRTLLARRRGTDGDVVHLSLIVVPNA
                     TVALSGLNSTNVNVTGAEAAALFSAAVAWSATRRVIMEVGDVEEPLADRNACSAAARR
                     SHAVPVELDLCATAAHVQQAAQMIAALGNKLLKAWPTSATAVGSTSLFASDSAEASIA
                     DAADVRRDTQRKVIPSDFHALYTSMLTEVSSFSERKTMAALTAFPTMCHLLEYVDSIA
                     GSAPGAQDGSGSGGDGDSDVAVHVPGAVYSINYGEHRSWNVLNSAIIEALVTEYER"
     gene            <382367..>383194
                     /locus_tag="LMJF_21_0910"
                     /db_xref="GeneID:5651645"
     mRNA            <382367..>383194
                     /locus_tag="LMJF_21_0910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682990.1"
                     /db_xref="GeneID:5651645"
     CDS             382367..383194
                     /locus_tag="LMJF_21_0910"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683042.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0910"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0910"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651645"
                     /db_xref="GOA:Q4QCA6"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA6"
                     /translation="MPAAAAAAASSLAQRLAQLGQRFDVIESGLRHLQQQQQPLLRHA
                     APGGAAAGAASSDASFCPASSAVKAPADLPALQPDPKDPLEVARLRRHCVDSGLHATE
                     FLWVPSNYYQENLQWRRDALHAPTIRHLCKTILMENTHCTNKDCADRNNSRYYLVVYQ
                     YVDRFNSDMVGRAIQELNPGMGKKKFNFRLADPAESEKLTGVRSGAVAPFGTAIPIPV
                     ILSVGVTQLAPPTFYVGGGHVDCKCRLDTAQFIRVSKAIVAPISVPLTDEELEQIAD"
     gene            <383928..>384326
                     /locus_tag="LMJF_21_0915"
                     /db_xref="GeneID:5651646"
     mRNA            <383928..>384326
                     /locus_tag="LMJF_21_0915"
                     /product="histone H2A"
                     /transcript_id="XM_001682991.1"
                     /db_xref="GeneID:5651646"
     CDS             383928..384326
                     /locus_tag="LMJF_21_0915"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_001683043.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0915"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0920"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0930"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0915"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0920"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0930"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651646"
                     /db_xref="GOA:Q4QCA4"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA4"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     SSGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDDDISSLLRKV
                     TLSHSGVVPSASKAVAKKKGGKKGKATPSA"
     gene            <384958..>385356
                     /locus_tag="LMJF_21_0920"
                     /db_xref="GeneID:5651647"
     mRNA            <384958..>385356
                     /locus_tag="LMJF_21_0920"
                     /product="putative histone H2A"
                     /transcript_id="XM_001682992.1"
                     /db_xref="GeneID:5651647"
     CDS             384958..385356
                     /locus_tag="LMJF_21_0920"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_001683044.1"
                     /db_xref="GeneID:5651647"
                     /db_xref="GOA:Q4QCA4"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA4"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     SSGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDDDISSLLRKV
                     TLSHSGVVPSASKAVAKKKGGKKGKATPSA"
     gene            <385988..>386386
                     /locus_tag="LMJF_21_0930"
                     /db_xref="GeneID:5651648"
     mRNA            <385988..>386386
                     /locus_tag="LMJF_21_0930"
                     /product="putative histone H2A"
                     /transcript_id="XM_001682993.1"
                     /db_xref="GeneID:5651648"
     CDS             385988..386386
                     /locus_tag="LMJF_21_0930"
                     /codon_start=1
                     /product="putative histone H2A"
                     /protein_id="XP_001683045.1"
                     /db_xref="GeneID:5651648"
                     /db_xref="GOA:Q4QCA4"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA4"
                     /translation="MATPRSAKKAARKSSTKSAKAGLIFPVGRVGGMMRRGQYARRIG
                     SSGAVYLAAVLEYLTAELLELSVKAAAQSGKKRCRLSPRTVMLAARHDDDISSLLRKV
                     TLSHSGVVPSASKAVAKKKGGKKGKATPSA"
     gene            <389310..>390356
                     /locus_tag="LMJF_21_0940"
                     /db_xref="GeneID:5651649"
     mRNA            <389310..>390356
                     /locus_tag="LMJF_21_0940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682994.1"
                     /db_xref="GeneID:5651649"
     CDS             389310..390356
                     /locus_tag="LMJF_21_0940"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683046.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0940"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0940"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651649"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA2"
                     /translation="MGFGVGGWSCTLPGMSFFLESPLRTLVGALEKNYPQYRDHLAQA
                     HKMAHRASEELDRASPYFAKAASYTSVAREQATRFKLDELGPMLLGLALCFFGGSYTM
                     LIAVVETVHLLCWEDLKHSFQVLYHNYERAAEQNRKDHCADADGNCVADVQEVCDADL
                     LSRKAALFFKSVDIEAAEAAGRTIGAAAMSVIAALRVKLARSFALGGSLASMAMTYIP
                     LEAALKDALPVEHKKWSGVIAKTAANVIAMTLASMMCGAIGMMHCCIRGAHMFAQHAV
                     HIAKDHGLLEDDMTLDSPKAKALAAMVALMGLLWQVTHTDANPFPINIFLLPFTVAEY
                     VLFFVANGFLFATL"
     gene            <392064..>393356
                     /locus_tag="LMJF_21_0950"
                     /db_xref="GeneID:5651650"
     mRNA            <392064..>393356
                     /locus_tag="LMJF_21_0950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682995.1"
                     /db_xref="GeneID:5651650"
     CDS             392064..393356
                     /locus_tag="LMJF_21_0950"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683047.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0950"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0950"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651650"
                     /db_xref="GOA:Q4QCA1"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA1"
                     /translation="MSHKRDQLTSETKLGGTPTYFPPLSDADKAQIRRWTSCGVCGHA
                     MSLLTQAYSPLPTAPASRPHHRMVYVFGCNSGYCSRQPTSSMVAFSVQVDQEDEQALA
                     ENAEEEDEDEVIETGPLLPSELPEAVLPPCYVYIDAEPSKEAVVPTDIERELIKMAEE
                     NARSTVTDEELQQLEQTVDLKDTKTDYYYEKFRSRVARAPNQVLRYYERTVAAAAATS
                     ASLRAKDVKPIFMNPDKVKAMVTIPACACCGSTQTAELQVMPTSLYYLHVSEYTALAR
                     ADAAAMAAPAGTLAAASTHSNVVDTQSPVASPSASTTTCKASALSGAATGTEKAIPAN
                     VDDGCDFGTITVYVCAKDCAARQHGVVLRRETLCVEEAPTMRDEERAGKADAAKAGTD
                     GATHKVTLRELLHGNGEGGEDMEDDDEGHIDDEAVSTA"
     gene            <394710..>399065
                     /locus_tag="LMJF_21_0960"
                     /db_xref="GeneID:5651651"
     mRNA            <394710..>399065
                     /locus_tag="LMJF_21_0960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682996.1"
                     /db_xref="GeneID:5651651"
     CDS             394710..399065
                     /locus_tag="LMJF_21_0960"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683048.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0960"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0960"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651651"
                     /db_xref="UniProtKB/TrEMBL:Q4QCA0"
                     /translation="MPSSSSSSSTAHRSEGVRSSGRLSGSHSSWSASHGRPTIGPPPR
                     GDRVIGAQTPRSVEFTEAPHAEMEEKDIYSSSSASSSGSRLRRPCDGDSGDAHRYAVS
                     ASSNCGSCFEMLEHVPENDSHHRAETIVAHGTVTRHMPSMLPPRLGARVGETACCDIR
                     STCSSPAPAASVTAGGTGGSSRPSSSCPSPAASSLLTTPKRVDGTFAGAHSSAAPPPG
                     SGAPFSNDSLDTLSTAQMEAALQLYVEKGGVYTNEMTSALQALPWCAATSVHASPVSR
                     VADPSAEDTDEEAAQHLVDPEVWLGAVAAATASAVAVAENDEQASVAAASAATRIASA
                     EALHKTQGQHSTFEEGSTMLMQPSNIADSSAPVPVERTVEKQRSSADSSSELAAAGGA
                     AAYSDFADHGTRCGPGRSSAVVSPVDSRFHLRGNCSDDSTPRANGVKGHHISTDRKLA
                     YGDANDDSTERAARGERSPSFPQLTPRHRSGSAQQQRQPVPSFVSNTRSLRSSPLYSS
                     VSPMQRSVDDQHRSPATAAASSPAYVAEDATQIAAPPAASAFDAVFSGTAGMHTLFQL
                     CLRTPLATASATMRVSDWYALLDQLRHDGRHKLPPQPILDDVARTIAHSMQSEGHSGG
                     LTSSDFTRVIQRQLKEVKVDMTSPLPRNGSAGDGTASRQEVALHFPQHPRYTVTVPTS
                     AAVSSQSPSFPSRRSSRRSSQTKLTPVTEGGQWRVLPTWCMALAGLFPLEMSKVCPVP
                     VVRYLRSVGLIRAVLEAIIQRLQIEVEAIPECVASISSAASKEAQNPSEGAAVESLVL
                     SPSREGSGGSRSVSNLLARSGVSAGARPASSTVVTEKAVGSSGDRSGTWNEQPNWGSA
                     TAGNHRRRVKCRKRGAATNIVATPERAGGDGAMIASNPQGVSSGSSRPKADTTASAGS
                     DTFKSHYLDQRPLDEISISVVARAKARRLMDTLRRHTVPINRYECFARVEQEDAPVQQ
                     ALCFVSREELKATLSSDNGEDSDEDSDAMSDMIAALTYSPGEEAVASLVGTATKDGSG
                     VDVDQTRSPLPPPPPLSSTSAPNVLPTVIMGATRASMHVGGRVSSVPTSRAASAGSAL
                     RPPPPAPCMFRMSGVLPTALPRKQEEAMVSRLSKPVCDPAAMSLRVASAENGYTSCHA
                     ADTTTTIDTSDSASANAKAIEDRPTRLTPSRLPSGTAAQRHYRSRLHPTDRELSNDTV
                     SRSGPVAPLRNGFRRRRGRLSLSRMDRCYASVCPGRQHQPSSLLASDTGSGGACTSQP
                     AEGRNRSFSFFDVPHVLAAAPLSSSAAAAAAAQVIGDGAPSASSSGVAVPPQPPAPRR
                     QAGHHVASRGAPRGTSRAGSAAPPRAKAKDESAEGRRAGNTPNSAVLKLARRGLRSRR
                     STPRCSSDAPPRDRSAADARGVENSSRPKAADAAGAAHPPAAPLQPHISLYERRLCRQ
                     LQRAYSNEHIYHRTN"
     gene            <400012..>402153
                     /locus_tag="LMJF_21_0970"
                     /db_xref="GeneID:5651652"
     mRNA            <400012..>402153
                     /locus_tag="LMJF_21_0970"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682997.1"
                     /db_xref="GeneID:5651652"
     CDS             400012..402153
                     /locus_tag="LMJF_21_0970"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683049.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0970"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0970"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651652"
                     /db_xref="UniProtKB/TrEMBL:Q4QC99"
                     /translation="MPLHPNSLLGVTPLSLLQQRLQRGRCDGSASSWLHRRLPLQRRC
                     EARGEVQRRSFASRDMQLSRYSPPPSSSSSSLLSTVMQAKDVVTRLGPSERFPGLCGV
                     FLTKPIKKFHPIEVLPTAASAAATTTTAATADSSAERPDASRSPTSAIVSQAPPFVLN
                     LAFAPRHSISLRRFLALRHMFSTSAYLHVATEDGWYLVAPSSAAPLCPDVTGLQAWCC
                     RHHHRYLKHAATAVTAATSSSTPSSRAPRCSTHTGIAKLEAALDNGEELSEEQLQRLA
                     AQEKAFFAHTPENEEADIDDDTDETDDMPAVREPRHPLSQKTAAPTAETLRKRSAGAP
                     ASAFGLSPPLIPEAHLFDINDGVAWLLPPSDDLANHEYWKSHRQRMALYESTGDADAA
                     EQREALLATLRADPAIAQHLSSEQELYAAAEALFQALKHKANVTLNVDADTGLLTLVP
                     LRDLHAGEELLLHYGREWWTGRLLFSLLLSVSDAEMPQIRWIEQLFDHAVDRSEPFPL
                     LIVAHEQRKRPRRGCSGGAKVRKGLKNESSGDGDEQQQQSTQCASLTKPHGDSAETSS
                     TTAMTAELPVSQRKLGRAVLYNTVTHKRATDAAVLAFAVRRSCIEPCFLSRLLAGDAA
                     GGVEPVFYLSEPDKEVPMRVLRRVLLASLRGTTASAQRSIPHKDESASVVAGSAVADT
                     AAAVVDQGAPPQTSTNTGGDGDDGDDAVFSV"
     gene            <403143..>408545
                     /locus_tag="LMJF_21_0980"
                     /db_xref="GeneID:5651653"
     mRNA            <403143..>408545
                     /locus_tag="LMJF_21_0980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682998.1"
                     /db_xref="GeneID:5651653"
     CDS             403143..408545
                     /locus_tag="LMJF_21_0980"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683050.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0980"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0980"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651653"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q4QC98"
                     /translation="MQVQFYQNVMKGQLGTARTQAICFSANNKRLAVADATRHIQLFD
                     EQGERRDKFATKAASDKGGRGYIVTGMTFSPDSSLLAIAQSDNIVFVYRLGLEWGEKK
                     AIRNKLSQTSPVTCVVWPNTSSQGVELIAFATLDGSVKVGMLKANKSHVLYSHDHPAV
                     SMCTSRDNTKILTGHLDGTVYQYVFEASEEGAEVAGAKRLFVHSCAPYMLAWGESICA
                     AGADCQVAFYTPKSGQKPQVIPFDMKDVGSFTGGVCNPSGQAVAIAGREQIRIFDLNI
                     RSHKWEEGTVVYLPHSEGFSAMQWKRDGSRLVTGSVTGSVDVFDCCLRRYRMRGAYEF
                     TYVSHSQVIVKRLASGTRLVLQSYMGFEIQKVNVYQDRYLVAHTSATLLLGDLVSHKL
                     SEVRWQLTGREKFTFDNEQICMVFNVGELCLIEYGKNMILGTCRTEERNAHRISVRVL
                     NPLASDAGAGAAGSGGAGGQRREVSTTTGSPIVSTSVTGSSGALDAYNSRCVIAYLID
                     RQTIQIDDLRSGVSIARVPHESKIDWLELDFRASRLLFRDKQHQLYLYDISRQQRTTL
                     LSYCTYVQWVPRSDVAVAQSRLELCVWYNVESPERVTIVPIRGEVEGMERGNGKTEVI
                     VDEGVSTVAYSLDESLIEFRAAMEERDLDRACDLLERTSLSPGTEVMWSTLANVSLQE
                     MKLFIAERCYAALGDVAKVNALQRIHQLAAKARVDSADTTTGYEHYTVLAELYMMSQD
                     FKRAEQLFLENGRVEDAMQMWEEMNCFDESLAIAESRGLDDVANRRARYFAWLMETRQ
                     YEKAGEMREKDGKFVDAINLYLRGGTPARAAQVVSVNNLKPEQQLLEAIAAALFKAQV
                     FEAAGDFFDKLHMTDRAIDAYKRGHAFSRAVEYAKTAAPQQVVSLEEAWGDYLVSQKH
                     VDQAINHYNEAGKYDKAVKAALDSRQWAKAAVILETQSNGAVGSSGVPVDAATKSAYQ
                     RIAHHYEEVHQYAEAEKLYIKCGAVSDAVDMYSRAGMTDHMYRVAQRHLEQDKLVELF
                     VSQAKQLETKGDYAAAERIYLKVNDADGAIMMYRKNRDYTNMMRLVQAYRSGYVVQTH
                     LALAAQFQKEGNLKAAETHFIAGKDWSRAVSMYRDRDLWDDAVRIAKVHGGANAAKQV
                     VVSRATVMDSEEGVRLLGKFNLIEAGIEAALESSKFDLALQWAQLARPAKVPYVYLKY
                     AMHYEDQGDFRMAEDAFIKSGKPREAIDMYVHQHDFTGAMRVAENHDPSAVPHVCAAN
                     GRVWFQQGNYKEAEALFLRANAPETLLKLYVDAKMFSEAQRVAKAHCPDMQSDVAKRM
                     ALNSNDPQKAGTVLEENSEYQLAIDTYLAATPETVPDPATLANLWVRAVKVAQKHARN
                     LLKEVLRSAIDKLKAAQRYVEAGKCLESCEDYKAAINMYVQARKFDMAEALAKRVSPE
                     LENFVKRAIVQDSISGGSMKDAKVVEEMDPEAAMKAYISKADFANALRMAAQRSPEEV
                     QYVAGLQVQHLLRQGDPVQCLEALNKSAMDSDDFRFYETWMSVAQKVIPLLPGDDAVA
                     TLLQPLHDGLVKVVDSMTQSGQKSEDIAKATALASVVHIYYMSRKMETELNMPDFAVQ
                     LMLGLPRWIPHVAPDKAFYDAGMAAKRSGLEGMQDVAFLYLNRALDINERIDDGDTDS
                     SGIDNTDFAATDFPKVYRLPKEPTVPAQAMEEVNNWVLTVSIDNTAASDTRTLPMVTD
                     PENGELMFAGSVKSPHTGKVYPACAVTGYPVIGGGLTKCAQCHRPANQADWNKFVLTA
                     KRCPWCGAAANPNFKV"
     gene            <409977..>410405
                     /locus_tag="LMJF_21_0990"
                     /db_xref="GeneID:5651654"
     mRNA            <409977..>410405
                     /locus_tag="LMJF_21_0990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001682999.1"
                     /db_xref="GeneID:5651654"
     CDS             409977..410405
                     /locus_tag="LMJF_21_0990"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683051.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.0990"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.0990"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651654"
                     /db_xref="UniProtKB/TrEMBL:Q4QC97"
                     /translation="MVRYVQRPWFSPLGFMASSPTAYAPMMTCIALALIFPFRYQISE
                     YFERQRDGVHVELRRKAVKYYAEMERMHRRQALVNLESIQDDNAPHRLSAVLSVESIQ
                     AGHLDQEYNYWYAHERDAIRAEKLMMEIRELKAKMPADSA"
     gene            <411442..>417591
                     /locus_tag="LMJF_21_1000"
                     /db_xref="GeneID:5651655"
     mRNA            <411442..>417591
                     /locus_tag="LMJF_21_1000"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683000.1"
                     /db_xref="GeneID:5651655"
     CDS             411442..417591
                     /locus_tag="LMJF_21_1000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683052.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1000"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1000"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651655"
                     /db_xref="UniProtKB/TrEMBL:Q4QC96"
                     /translation="MSEHTSTNADLLRMSCADLAPRGMLAAAPVTTAATELAASAPCS
                     ASVAAAPFVHSLVSTQRASSHDVEPYRVCRAHVDQLLELQGEQMGLAQSLKAVLRVAS
                     MHATPVFGADSTAGASQQASTTKLVMENAENMFSDCHGCSSSRSRQQRLPSASAEAGS
                     QLAPTPSSLPSLASSVTSLVHRLHVLQRESAEFAATRCLPALAELFATFEAYWVWKRS
                     SMCDGDVQEEKEASTTAATASSVSANSAMDGAPTASQATQKRLSQQQRPPTLRQRYDQ
                     ALRVRDELLSFLQLHAEAVRALDVQLEQWCQCRGSEPATQSAREWLTASPTGTSGAPV
                     AVSHDVDTQAHTQRCEFEAYVCQLVEVAQATHHIAQLLQAALRALCRPSPHTPRSSLK
                     PSADAVVEDEGLSSSSKQPRQTEVNAAPSPGFHERRFGRLQTRSSVNTGGLAHVRTNA
                     KRVRAHPSTEGSGRVSLSQAPHTSGTVGRPECALHSLSTPEARTLRGCAKPAPCSDAT
                     LASGAVGDAQCSWIDTLSPLTPPPTAATASVSPSSSPPLPIEHSAPHQQLRRQRHGRR
                     RLSSSPGAAAQAEGSTSPDAASSTAGDVSLSPLTVQRGDAAVVPVSSREESADKEPHC
                     PAPMLSFASRLGGPGDAEEDSGVEAAVTPVVTMRPAADRSASCNLGDDVARHLSADAE
                     HPPWPRCHSFSQDGARSLLCELASASADAAAGAGEPLSTGPQPPVSRRRDVPEVLAFA
                     DSTRENFAEVTADRQGATAVYVPPQSEQPASCHGDASAAALTPVIVNVARSEEGHAAS
                     QPFRSPAPPLQRASATWASVFHTTSTSLHLLSPRSLSIDSSAGYRTTRDECGGACEQG
                     LSRVVRAASIPTSLRPRLHHKGASQSSLSAAPVRAPADVAGGAQLARNTTALVYTPSH
                     APPNEPEGDGDAASICSASRTVDPNFYTARVSGAGVSPPPALAAPFHVSASSAGLEPL
                     PTPLEQTQQPAQQQGRQAHHAQEWDRTFSPTPLPLDSLEKELDEAQQRLQAPALLPHS
                     SPAFSASSAASDNHPAPWPQRRSLEDRVMLTMREELKALRAEQRHNLHKMRKYVKHTL
                     EEVAEAVSAVSSRNHSSRGSSCASSRSQRPGAAHKGNDNDVSASAGGAKVTVAAEKQR
                     HASHALEQAHAEASTTSNEVASASAFIKSSSNSATLPSRLSTAQQQRQTAPAAPASPP
                     SRAEELQRSLAVAEAKAARLEQLTVQLKKRLWMAELSRLSPTSATPGARERTAAARHC
                     LSLRDAFVYGLSSDAGDTEDDDGSWAKTGQATGGMGYSDEDGSAADGVAAEERAMLYL
                     VDRELGCRTASDARAHSQRRPSAPRQTTSEVYRSSRQASYDGSRSSSTEHERSPNMRC
                     FEGDTADHLGLAVTSTASADIARRYSGRRLCSSSAAPVGTTSSTTATRSLGILQQRAS
                     IFQVLRQNQAARGAQSAAPTGQQQQSERSRLRPPSPPPLRHCSAGTATEVTAEFTASA
                     QSTAHSLPPCAAQQPRPHPYNAGAASSRYDRQADGGAAAGSPRQSASPHYYTAISGGS
                     DTGFVSEAGLHSSASATALHAEQVLQNARRLLQSRSASLAAGHHSISDNSRSSASLSG
                     GLQAAFTAVSSPKTRENAGDHRSEMSYHHGEGVTGEAPAARVGRCSRPGQWGDCVEQL
                     DGATPPPRAFSAPALHSGMTDAAMALQRVSGSLDHGAASISAAVGGHGPRSHSSSPES
                     AYHGYDTSPCSAVAYSTSKVPRAPSPSAAKAAPKSTAAGPPLLIDVSHATTSVTLARH
                     AQQRVDSATSPISREGAEARATAGRGERGAYIHSDVGLRHRERSARTVTTSIERDYSP
                     PSDRTTDTRSTRGFRSSSSPLHAAAAQHVHDSRQEAPVPLTSRVGQSASRRTSCSTSS
                     TLSCGSAQQALLDTLEKQASTLAAALDHLQEQQRQLREKHQQLSLLAKQRSLVVSAPA
                     PSQTSRGDYQRTAGAAAAAAMTRKSFTRTFSRDRGGNAAAAGTSHASSDLHHLLERFA
                     AAQTSLAERERRVRKALRVVQRQRSALSRDDLL"
     gene            <418886..>420298
                     /locus_tag="LMJF_21_1010"
                     /db_xref="GeneID:5651656"
     mRNA            <418886..>420298
                     /locus_tag="LMJF_21_1010"
                     /product="putative epsilon tubulin"
                     /transcript_id="XM_001683001.1"
                     /db_xref="GeneID:5651656"
     CDS             418886..420298
                     /locus_tag="LMJF_21_1010"
                     /codon_start=1
                     /product="putative epsilon tubulin"
                     /protein_id="XP_001683053.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1010"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1010"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651656"
                     /db_xref="GOA:Q4QC95"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR004057"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="UniProtKB/TrEMBL:Q4QC95"
                     /translation="MPREIVTVQVGQCGNQLGQRWFDVMLQEHKAYPHFPEARDAVFL
                     EAMNHPGRLKARCVAVDMEQGVLHAMLRGPLKDIFDANFFVSDVSGAGNNWAVGHMEY
                     GDRYIDAIAESVRNQVEQCNCIQSFFLMHSLSGGTGSGLGTRVLGMLEDEFPHVFRIC
                     PVVMPSEVDDVVTAPYNSCFSLKELIEHADCVLPLDNDALARMADRALSSRPQGRGVM
                     ASSVPQPQAFSAAKPTDTKGLPYDSMNGLVAQLLSNLTCAMRFPGPLNMDINEITTNL
                     VPFPRLHFLTAAIAPLSVSSKHAAVGPRTVDAMITACLDPGHQFVDVRHGQGSAVTRE
                     AGKTLATALIARGPQTTVGDLTRGVGRLREQMEMPYWNEDGFKTALCGVSPLGHKDSM
                     LLLANNCSIRGKVESMLSKYERLYSVRSHVHHYDQYLSDAYFVHTVETLRTLVDDYAY
                     LDTAAPPKDLPRSMKDLIYY"
     gene            <421056..>421940
                     /locus_tag="LMJF_21_1020"
                     /db_xref="GeneID:5651657"
     mRNA            <421056..>421940
                     /locus_tag="LMJF_21_1020"
                     /product="putative dynein arm light chain"
                     /transcript_id="XM_001683002.1"
                     /db_xref="GeneID:5651657"
     CDS             421056..421940
                     /locus_tag="LMJF_21_1020"
                     /codon_start=1
                     /product="putative dynein arm light chain"
                     /protein_id="XP_001683054.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1020"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1020"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651657"
                     /db_xref="InterPro:IPR019347"
                     /db_xref="UniProtKB/TrEMBL:Q4QC94"
                     /translation="MRTGSNRRHNNGSIGGKIESNSPSVANLQEAILQLLPQRASEED
                     AAAYIDVSGPVDANQTLIRYDIPYAPSDPKRSLKLRKSLGLGAEERVVDPNVRVVIDS
                     FITPRRWVDASTGVVWVQHASPFPSSRIDAAETQERLHAQLEAHQARRTGTSPIRSLL
                     VAECMLEVLRQVTAECWERGLLLLHVHSERVAAQAAHRRLFESRVGHAFRLALKGEKD
                     VAKVEEDMAALKQRVELLGQEEADLRRLCSEFEQRAEEQVLIANKEHSDALTKLKREG
                     VQKRAQLEQQLVIPANLQ"
     gene            <423755..>426199
                     /locus_tag="LMJF_21_1030"
                     /db_xref="GeneID:5651658"
     mRNA            <423755..>426199
                     /locus_tag="LMJF_21_1030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683003.1"
                     /db_xref="GeneID:5651658"
     CDS             423755..426199
                     /locus_tag="LMJF_21_1030"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683055.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1030"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1030"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651658"
                     /db_xref="UniProtKB/TrEMBL:Q4QC93"
                     /translation="MLREARRRKQQVAAKIGHEEYIYRLNGNPFSHQEVIRVRPQGDL
                     DPRRVQAAGIRVGVSGARGAGGPSRPPFAVDDDANYSDGGGRGGRLAPLNPGFGAPIN
                     GPSNEAVVPCSAPEGCNGGTPRGTKYAAANYASPYGGGGGGAGGHPHPLVSQGQHIVS
                     AFTPVIPAITPVRDLPAPLPAVYRPKPPLTFHSGPASSAEVPPLSLTPLPQHPAPSQV
                     CYPSNEAGTPRPAVAQVYLSPGEKGAGRPSTSPTVLPPLNPDGGNIGGGDPFPTRSPR
                     PSTSGAALGGGGGFLINGDGLSAAEERHREKMAARQRAVELQRENARQMLEKQQRKQA
                     EREREIQEYHLAEERLRREREEVARREQAELDREKREKELKMMAPRAAQAMLEKQQRE
                     TQQRREEEAAARRNRGRAPAALEAPETPEMGKEALKSTALPLPTSANVASTSLQSHPP
                     ANHLLPLAAPSVLLPPASAPALPYLVDFNFGSGLRRSPQPLPAPYCYPPANMCPQAAL
                     LPNADTQSIRSELRRITNLLEEQQLQQRRAMDSISVGANAAPQPCYSDAPPPSTKAGA
                     GTYLTTGQPSPSIGAGGSAPVITAQRNSAAPYRSFATGGTLPPPPLATAAPPAPPSSG
                     AGAPSVGIGPWQGLLSPYAGTSAAGAGGSLLNPPSSSIPPFTSSITDNEPELSTEPSR
                     FIGPFRAPVSAVPSPPAVPEPGVTFAGADSMATKRLPPLVHHAGAAEPGAEHCVATPP
                     PASTAASSRLSPVSSASALAPAPFSMPGMNSPTRSPRVEGLPSVRHSSPQATEGPRTD
                     ADEGETARRVSESPIS"
     gene            <428474..>434839
                     /locus_tag="LMJF_21_1040"
                     /db_xref="GeneID:5651659"
     mRNA            <428474..>434839
                     /locus_tag="LMJF_21_1040"
                     /product="putative kinesin"
                     /transcript_id="XM_001683004.1"
                     /db_xref="GeneID:5651659"
     CDS             428474..434839
                     /locus_tag="LMJF_21_1040"
                     /EC_number="3.6.4.4"
                     /codon_start=1
                     /product="putative kinesin"
                     /protein_id="XP_001683056.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1040"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1040"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651659"
                     /db_xref="GOA:Q4QC92"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q4QC92"
                     /translation="MGRGAAQAAYRDDGHIFVCVRIRNVPQNTACLTNNGAAATNTRA
                     STVARKSVLREAQRICVSVVENVVVMHDPASIDDAPTVAKDGNNVVQLLTDRANHAGA
                     ARHSRKTAGGGGAAAGASGTSSRRTVGGARATTAGAARLVSTSTASYYECDHCIASME
                     ESQLLEMPLIRTSDFLQPPPYGTQEEVYQRTAMHAVKAAIDGINSCVFAYGQTGSGKT
                     YTLFGDTTNIRRDAGVVPRTLDDLFGRLEAVKQSYRSDKVTDYSYLVHLSFYEIYQNE
                     VYCLFSRQGPLRVQFVRDLTGKKETMIIHDLQQQTVTSAEKAYPMIEMGLRRRQTAET
                     GMNAHSSRSHAILQIRVAQYRTNPDARETVEHQATINLVDLAGSERQKTANTSGTNRA
                     EGIQINQSLATLARVINDIASGARFVNYRDSLLTMVLKDNLGGNSKTFMIANISPIAF
                     SYQESCATLTYAKDVRKVRNRPMVNKTFQTRANLLEQNTMLKQENEKLKVQMEMWVRS
                     LQSGNPHASVTDMVDLLRVRGGGTAEAGDHLLLSPPRSMAQVVEAEQRRAAGVPLAAA
                     GCNEAFLTAISSGLTAPLLISSHRKYTSVAGIGGSCIEGGTVRVSALVKETMEFPLSH
                     VLHPLPTMAAGDTSHTTDEDSHGAQKRHITIPMNADASSLGCASGEATQRSDAAGEAA
                     ATAGEVMGLGSLVLERVAQRSCEQRYYVHFKPPTTAEGLSRLIDVQVNGKSIGAKGRR
                     ELHHGDVVCAYLEDAAKMEAAAASACLHTQSLISFHYVDLNTLSRGANASMTGMTSAT
                     LGQIAVSVDLPADMENLTLEGIKQLQRDNAKLLDMVRQQAETIDYQCAHASTSMMQAE
                     DLLGGISPVGSPGSGSPNPRSLEPSISASPPPETHKMAVALEAFRRVSVSPSIRGGSV
                     MPADLEADELLRRAATQSESKQRLDNAVRENQKLHRTVVSRNATLDALARRLAELEAG
                     GPLNSLNSPSPSSSLASSSSNTSRSADRGDNSETLAGRRADSGEDDTDMSRRTGGNRG
                     SLTCVSSPSQMRAVSAQRRGEEIVETDEDDEPRPEPIGDGQRRIVYENAEGARERYQA
                     VVREREQFDRILELEALIGELRERISELESRLRFSKDETLEQQMFREQAEAERDALLE
                     ELANARCENSALRRENVSLEGFLARDEQALADAARLADEELERQTAVLADRIKALKAL
                     SRMWKQRTMKYIAMGYGAGSDDKHVGSAGAAHLEAIPWDDLRAAETAAIAKRRLGGGD
                     ADACPIDVAQAIDDFEKSTTEDNVRALEYALLNFEQENQRLLDEIRRIKAELDGFKGL
                     VGRLRAEKAEAEKTLADATDSTEEERRRMQQLLRNTNAQLEEAEENLKRTQARLDDAV
                     EMRESNKRKAVRNNELLLSQQKRTIEELETELCRLRRDHAAKEEELTNLTRYMQGRDA
                     LGGDGVAKSCELRSRIEELVSDSMEEYDAPNGYSVFPAGFEFSDEMVSLIRICLRILL
                     DRLKMELYVLNAQSVHKYQLLIHAVKARTEAHFHTFMHQLRDAVSQMSGRMLRPGSKW
                     GLSESDVLSTLVDHRRRQVGDALSGLLIWYDHWDNAPKTEHVAYMELIRNADCIMQMA
                     RLVRRESLLNTNATSTSLMPIPGKSGTSDTSLLPESSRRNDKTVKGSCKILSRLASST
                     RQSNLARAVNQFSATPSRATITGREDVVGATPCPVEQGATPFSRSATVAALALSQSMI
                     PFSRTATGTHTSGHQPPSAANLESCSLFSRCPSGFPRVSATTVTATGLSPRPNPSTVT
                     PMRPIKQATSGGAATPAAVLATGASPAALTAAARANYSRMASAGVLPVLEADVAYVAN
                     TDVAEAVSISTYNFSRRMSSAAGAGEGAAADKGESVRRPNHLFSRCQTAIPHTSDSVQ
                     QQQQRALRRQNSATPASPKAHSSAGATGTRRQVSRAKATEAFARSKTHYTVPKSTATL
                     GRPSRRRSGVRVSTNSSTRSAGSLGGGSLHARPSSSQHNATRRSALYSIPTAEQARGS
                     GKGCASMLSSNATTKPSAAEISLYNLDVMKSLRERSTSDVNRQVTTDSKPSSTSNRVD
                     LTNISSVQPRKGMVQRASSSTGTRVSAGHDTTPVVPRLDFGALEGKH"
     gene            <437313..>437885
                     /locus_tag="LMJF_21_1050"
                     /db_xref="GeneID:5651660"
     mRNA            <437313..>437885
                     /locus_tag="LMJF_21_1050"
                     /product="putative 60S ribosomal protein L9"
                     /transcript_id="XM_001683005.1"
                     /db_xref="GeneID:5651660"
     CDS             437313..437885
                     /locus_tag="LMJF_21_1050"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L9"
                     /protein_id="XP_001683057.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1050"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1050"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651660"
                     /db_xref="GOA:Q4QC91"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q4QC91"
                     /translation="MVKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLD
                     LRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPINV
                     SVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVL
                     HQMCLVKKKDIRKFLDGIYVQTKTNIEGME"
     gene            <439185..>439616
                     /locus_tag="LMJF_21_1060"
                     /db_xref="GeneID:5651661"
     mRNA            <439185..>439616
                     /locus_tag="LMJF_21_1060"
                     /product="putative 40S ribosomal protein S23"
                     /transcript_id="XM_001683006.1"
                     /db_xref="GeneID:5651661"
     CDS             439185..439616
                     /locus_tag="LMJF_21_1060"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S23"
                     /protein_id="XP_001683058.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1060"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1070"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1060"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1070"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651661"
                     /db_xref="GOA:Q4QC89"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QC89"
                     /translation="MTKTNGQNAARKLVRLRCRNRWADKGWKRAHTFSARKANPFGGS
                     SHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLV
                     SGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPRN"
     gene            <440370..>440801
                     /locus_tag="LMJF_21_1070"
                     /db_xref="GeneID:5651662"
     mRNA            <440370..>440801
                     /locus_tag="LMJF_21_1070"
                     /product="putative 40S ribosomal protein S23"
                     /transcript_id="XM_001683007.1"
                     /db_xref="GeneID:5651662"
     CDS             440370..440801
                     /locus_tag="LMJF_21_1070"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S23"
                     /protein_id="XP_001683059.1"
                     /db_xref="GeneID:5651662"
                     /db_xref="GOA:Q4QC89"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q4QC89"
                     /translation="MTKTNGQNAARKLVRLRCRNRWADKGWKRAHTFSARKANPFGGS
                     SHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLV
                     SGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPRN"
     gene            <443759..>444664
                     /gene="CRK1"
                     /locus_tag="LMJF_21_1080"
                     /db_xref="GeneID:5651663"
     mRNA            <443759..>444664
                     /gene="CRK1"
                     /locus_tag="LMJF_21_1080"
                     /product="cell division protein kinase 2"
                     /transcript_id="XM_001683008.1"
                     /db_xref="GeneID:5651663"
     CDS             443759..444664
                     /gene="CRK1"
                     /locus_tag="LMJF_21_1080"
                     /EC_number="2.7.1.-"
                     /codon_start=1
                     /product="cell division protein kinase 2"
                     /protein_id="XP_001683060.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1080"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1080"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651663"
                     /db_xref="GOA:Q4QC88"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QC88"
                     /translation="MTSRYERQEKIGEGTYGVVYKARDTSTSATVALKRIRLDSEEEG
                     VPCTAIREISLLKELRHENIVKLLDVCHSEHRLTIVFEYLDLDLKKYLDRENGNLDAA
                     TIQHFMRDLLRGVAFCHQRSVLHRDLKPQNLLISREKELKLGDFGLGRSFAIPVRKFT
                     NEVVTLWYRPPDVLLGSMQYGPPVDVWSVGCIFSEMATGTPLFAGKNDADQLMRIFRF
                     LGTPNNRVWPSMNQYPNSNNMLSQPEFLQNFEPEWSNVLGSVPGYEKLGCAGVDLLEK
                     LLRYEPSERITAADALNHPYFSLQF"
     gene            <446400..>448055
                     /locus_tag="LMJF_21_1090"
                     /db_xref="GeneID:5651664"
     mRNA            <446400..>448055
                     /locus_tag="LMJF_21_1090"
                     /product="putative T-complex protein 1, delta subunit"
                     /transcript_id="XM_001683009.1"
                     /db_xref="GeneID:5651664"
     CDS             446400..448055
                     /locus_tag="LMJF_21_1090"
                     /codon_start=1
                     /product="putative T-complex protein 1, delta subunit"
                     /protein_id="XP_001683061.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1090"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1090"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651664"
                     /db_xref="GOA:Q4QC87"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q4QC87"
                     /translation="MSAAIVNRAASGAAAPRRKGNESKKDNNTQTDVRLSNITAAKAV
                     ADCIRTSLGPRGMDKMIIDPKGETIISNDGATILSRLQVTHPCAKMLVDLSKAQDIEA
                     GDGTTSVAVLCGALLRAVEELLNKGIHPTQISESFNECAKLAEKVLEDMSIKIDIDDR
                     DTLIKAAITSLNSKVISQNSDLLAPMAVDAVRKIIRNNGDVDMRDIRVTSALGGTIDD
                     TELIQNGMVFKQKASRVAGGPTRIQDATIALIQFQLSPPKTDMESTVTITDYTQMDRA
                     LKEERKYLLGLCKAIKDAGVNVLLVQKSVLRDAVTAQSLDFLAKMKIMVVTDIERNDI
                     DFITKTLGCMPVANLENLTKDKFGHAKTVIEEGTPSGKVIKIMGVQPPPPSSLNHELF
                     GKTVCFFLRGSNSLMLEEAERALHDSLCVIRSIVKKRAIMPGGAAGEIEVCMQLGKYA
                     RERAEGMQTFCMRAYADAFEIIPYTLAENAGMQPISIVTELRNAHASGHVNSGVNVRK
                     GCVTDMVEENVVQPLLVSTSAVRLASEAVMMILKIDDIIMTRI"
     gene            448847..448969
                     /locus_tag="LMJF_21_5SrRNA_02"
                     /db_xref="GeneID:12980591"
     rRNA            448847..448969
                     /locus_tag="LMJF_21_5SrRNA_02"
                     /product="term=5S(M5) ribosomal RNA"
                     /transcript_id="XR_002460407.1"
                     /db_xref="GeneID:12980591"
     gene            449050..449121
                     /locus_tag="LMJF_21_TRNAPRO_01"
                     /db_xref="GeneID:12980671"
     tRNA            449050..449121
                     /locus_tag="LMJF_21_TRNAPRO_01"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:12980671"
     gene            449273..449346
                     /locus_tag="LMJF_21_TRNAVAL_01"
                     /db_xref="GeneID:12980672"
     tRNA            449273..449346
                     /locus_tag="LMJF_21_TRNAVAL_01"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12980672"
     gene            449409..449481
                     /locus_tag="LMJF_21_TRNALYS_02"
                     /db_xref="GeneID:12980673"
     tRNA            449409..449481
                     /locus_tag="LMJF_21_TRNALYS_02"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12980673"
     gene            complement(<449720..>451822)
                     /locus_tag="LMJF_21_1100"
                     /db_xref="GeneID:5651669"
     mRNA            complement(<449720..>451822)
                     /locus_tag="LMJF_21_1100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683010.1"
                     /db_xref="GeneID:5651669"
     CDS             complement(449720..451822)
                     /locus_tag="LMJF_21_1100"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683062.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1100"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1100"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651669"
                     /db_xref="InterPro:IPR019136"
                     /db_xref="UniProtKB/TrEMBL:Q4QC86"
                     /translation="MTAPHGSPAAAGREKHAIPAFRSYISVELPFAVTPTVTTSSAML
                     DGADHPSTSAHAGERREVEAFLPASFVVPCLHRAMPQQTTARGDAGATHDSAEEPEGG
                     DDEGDDDVPSSSSGGDSGESASRAFPPTVAKRTAVQAVHGVAGQRTELHLLTRHHHHY
                     CTVPIFSGWRSTNWGTGSDEEDEGDRASDSGVGRDGCADAEDAAEGAHLPAQKRRRRE
                     VFASMEPQLLVNGYYRNDLLLRMRQRRRIRRYRDPVTNAVLREEEVDSAEEGQGGSAH
                     GDKDARGTARTSGLSAEVVGVVSREMELARPADFTFALFTPEQLQAAPSLCGADVFPP
                     QHFLGARAPFEVRYEPGRDPNTAVATVSATAAPRDDRLAVDANGDSAVAQYDFATLPT
                     ISISAEESTVLPTRQAAHNSFLHSMGSSLDGGLDTDPPEVQMMVRLLAVRPSWVVQDL
                     QDAMLQSGLCPRAYRNKQVMQCFTYLIRNGPFNRLRLRLGYDPYASASSVVYERITVR
                     LLRRSDVGVRLRDVSRSPHIESVLRLLLERDRERRVEYKSLPAHACRQTLLEMQCRNI
                     RRGQLYIPFQLADVMDDPYMADVARCVEPATAPMELARCGQRRGWLSEAAYSRAMAHY
                     SEALAALLEEEVEPLLRKLQGEEDAEGNATNADKAAESSTSSLRDEELEDDEDEDDSA
                     MFSVSAGDLSEAADDDDE"
     gene            complement(<453127..>458412)
                     /locus_tag="LMJF_21_1110"
                     /db_xref="GeneID:5651670"
     mRNA            complement(<453127..>458412)
                     /locus_tag="LMJF_21_1110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683011.1"
                     /db_xref="GeneID:5651670"
     CDS             complement(453127..458412)
                     /locus_tag="LMJF_21_1110"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683063.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1110"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1110"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651670"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC85"
                     /translation="MHSTAAAPRMARDTPVMTNSKTGTATRVHHLPSYPSDGDDVLSS
                     LCFLQRMASVFEQQGNYAECVKSVESALLLRQANNAAVGNALAERRRALENRASRRHP
                     ATMRRGAPSTGDIDDDYVPLTDNGDVALPMSICLQAQEAVLRCNSYAVEALQHAQYDS
                     AAFFLNRAMFLTDGDEDAQQEASTTDGAGGGVTSSSGGTVSGQWWWRAVLQSSAPQPE
                     SQSAVASVDSIDLDTLTSTQDEVRQKTAATAAAFRACFGPTSHDQQLRLSLRVVTLNH
                     LGCLEQRRGRPRAAVVFLRMAIQAQAQLEESRRLDGDAVAQALPKARRCHLSSSSSSG
                     TEGTVSAYLNLCTVLNELGQHAEAAQVCERVIPLLQQALLECTSAHPAATVGDEADVR
                     TQQQRQRDAKDAQVCTATMLAVAFYSFGASLERRDAASGNVNAQRWAFQEAIQVCHRY
                     GLVPAYCRTIEQVMQALRHPGAATIPAEEGSRSALPFTGSSAANAPASAKRRSGVDVA
                     ASRPLPPPMNPSSWEASSAVTPMADILQFGAPTEYEAPLHCPPLQPVQTELKRLSLPP
                     TSRTAAHTASLPAPQQPPARSAFLRPSGHGSPLPSQLPPLAASYPGGQQNAWCASPEA
                     PGPRSPPSVHEPLTISDRKSSGMKVAATAPPTFALRPSTGAPSTSAFPLTQLRGLPLA
                     AASSSASTTSMTSGPANLRTSIAASLPAALPRSSLSTSIAGLTTGAANAAARLTPNPP
                     RGGRLQAAVSDRQRTLKNAKRQQSKLQKSLERRQQLETAVADAALAEKVFQQLISEKS
                     KTEVERCRRAAAQIQRIWRGVLARTWVATLMAATLRLQRVVRRFLVRVGAQHAREAEE
                     RARQQAEELAQQEAACRVLQARARQFLRRLQIRRTYRANQARHYYAARTIQRGYRAFC
                     ERRAAFLAARAEANRRKDEQWQFRQKVAARRIQSSYLEYRMKRAELDEHRARQRRVRA
                     AVHIQAVVRGYLTRAWYAYYRVYRRDQEVRSAAMQTKLVMIQSACRVICSAYYGQQRA
                     LHAFLAMREARQHRAATRLQSLWRCHVAKIRRARLQAEHDCLVRHAVRIQRWYRMRVL
                     RRAFLVYKAEQQRIRAASRVQRWIRECWQAVKAREFAAYHAELLRQQQQKRLQARAIV
                     VLQACCTACLSDRLVASVRRIYQRHDTVVRVWQRVGRGLAARREVALERRVAYWVAVK
                     ERETARRTAAACVLQQAWRCAAAKDKVQRMRREVAAADVITRAYRVYRARVQLADLRR
                     ARQLRLEDAAARSIQRAFADFLRRQRAKETEAYYRGEHQKKMHRLRRQEAAIMIQSVW
                     RGHVTRKAVERDLQELQAFSAAAVRIQRTWHSRRSRRQLDRELNQRIKERARDAEAAL
                     VVQCFWRKIMAGRRAAHLRVVMQQRLVAAVHIQMWWRVQLAQREFARRRILRREEAAL
                     ELYYAMQWEAHVSLVNSFVRARRAQVLSRDRLRDCLVGQLTEAERHRFTNRHAAATKI
                     QALYRGHYERVYVRGLVAQAREEARRSAELAARQQRAAIAIQCAYRCARSRQQLADLK
                     QVELERVLVSHQEFAEKADPAEVVRELFWLNTTYLQREACNARRREAERKRAAAASIQ
                     CAYRCYKSRQQVSTAADLHQRERAARLLQDCWRHHRDVHRIKKRQRRQAAATRLQCHI
                     RGWLVRRSWPLWRAAVEAERQEHVLLQDMLDHAAIIIQSFWRRVQAQRAAARRRKAHQ
                     ERHCMLARQEAATVIQDTFREHQCRRMERTLRGGP"
     gene            complement(<459162..>461006)
                     /locus_tag="LMJF_21_1120"
                     /db_xref="GeneID:5651671"
     mRNA            complement(<459162..>461006)
                     /locus_tag="LMJF_21_1120"
                     /product="putative U4/U6 small nuclear ribonuclear
                     protein"
                     /transcript_id="XM_001683012.1"
                     /db_xref="GeneID:5651671"
     CDS             complement(459162..461006)
                     /locus_tag="LMJF_21_1120"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative U4/U6 small nuclear ribonuclear
                     protein"
                     /protein_id="XP_001683064.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1120"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1120"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651671"
                     /db_xref="GOA:Q4QC84"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:Q4QC84"
                     /translation="MTSHQSTYVRVAPSPRFKDSQTPASSELIQLRVQHMLPQTTQRA
                     KERVGNLKRLYAVPHALLLREHATAMAATLHRLRLVKAVRNIKVLGAGGGSNVVAGAL
                     CLPFHSCAALPAVPAVVSGDSGSSSPSSVCVLTGSADGLLTLWDAQNCTPLRSQSTYA
                     DSHGWGRVKSVVVHPQQQGGASAASATSFAFTASMFQRVVRVWRVTLGGGDSDAPDQD
                     SGALLQPLTTSPIKSAETVDNSSGGDAGGLQQLALDPTGALLAATHAAGIVHVWDARA
                     VLEGTSSSAAASPVADTSPLTHLYAQDGYETAGATLGIAFHPDGSLLTTSDAGGRIVA
                     WDTRSGQLAFHTGGRVGGHLRAALCVAWSPCGVRVASGGGDGVVHLYDARKLSKAGLG
                     PHNDSGGGAAPFQLLGHDDAVTSLSFYANPLSSGGHGALSQVLPIGLVTTSLDHTVRI
                     WDADTGLCVRTLDAGMPLYAQCRPQLPPVSPRFASSTAIMVVGHSKNWLLYDVDMADE
                     VADEVVVAGGSGITVTENDIVVSAHGSAKDMRFSVLTSYVSRPTNNNEETDSGSSDDD
                     DEMMTLRKKPPPPQGLVKSAAASALQNGGHDKEDDSDEDEMEMLRKKK"
     gene            complement(<461649..>463523)
                     /locus_tag="LMJF_21_1130"
                     /db_xref="GeneID:5651672"
     mRNA            complement(<461649..>463523)
                     /locus_tag="LMJF_21_1130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683013.1"
                     /db_xref="GeneID:5651672"
     CDS             complement(461649..463523)
                     /locus_tag="LMJF_21_1130"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683065.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1130"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1130"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651672"
                     /db_xref="UniProtKB/TrEMBL:Q4QC83"
                     /translation="MFTRVGAFLEAIDKKTEELANAVDEEDLARTAGQRLHSSSGVSR
                     NTSLQQHPQPPLCPARGHDSGVFHESRLGGLPRSRGNAAGSSSDDFQTAGTPPSVMIS
                     SAHVASDKAYAAGHVPLSLPTKLPSFRPSTQDPAIDGGRGGVAAGWKQHLTASTVADP
                     FPGNDLASSQGDAAIVSSAALGGGETPIHNISIAEAAVERLKARCKALEADKTRWQQE
                     AATHRAQCSAARDALWKAEQDTRASRAAQRAAEQALTVYKETSQRLLDEAHHELKQAR
                     DAAAGRSSATEPQQQTDASHDARELHQRLELLQADHASLNAEVERYRQEAAKATAELQ
                     HMQERHRQAQMRVDMLQLEVGAARESLEGEVSAHADTRSALRRLQTQKDELVRRGSSP
                     SLSAAVAQGTGEAGPAVDVGPLQRELNELKQRHQLLTLQASNLQAALDAAAREATDMK
                     ARYNELAKHVNDAEVEMAAGFRASAIYENGNGCSSVFPAPPTTSSMRGHRGPNADRNG
                     LGGHSAAAGAPWAHYPGAAATTPESSGDARRRNPAMVRLAREYGIAGRAVVAVVSSID
                     SFAVQVGRVLTQARWMWRVALMCYIGLLQVWVVLMIIGTLALEDSAHVQEMAKVPEPL
                     "
     gene            complement(<464234..>465145)
                     /locus_tag="LMJF_21_1140"
                     /db_xref="GeneID:5651673"
     mRNA            complement(<464234..>465145)
                     /locus_tag="LMJF_21_1140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683014.1"
                     /db_xref="GeneID:5651673"
     CDS             complement(464234..465145)
                     /locus_tag="LMJF_21_1140"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683066.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1140"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1140"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651673"
                     /db_xref="UniProtKB/TrEMBL:Q4QC82"
                     /translation="MKAIHGGGRIAATTCVHVEVKGSLDIPLNLSLLADLGDPMVEQE
                     IIKEAVRIAVSERLGCFGGVEVHLSSSGGREGGRAAAEQKARQRETQMQPQEAEATAS
                     SYSHGMENSCCGRYCEASVNLEDLGSCIESIQKAYEGLLMHAQLLHELLNTDTATAPS
                     GAADVTVASTPQSQQPSDFDAQADAVKRLAAARQLVADMVADHRSGVVAEAAALQDGA
                     SPQRLASHETDMLADEHAEATAMIHARRYGKRPSHDDDTDAGLRFGLLAGGDEDAEEQ
                     QRQQQAEDRKSEEELRARYMELGYSPL"
     gene            complement(<466274..>471568)
                     /locus_tag="LMJF_21_1150"
                     /db_xref="GeneID:5651674"
     mRNA            complement(<466274..>471568)
                     /locus_tag="LMJF_21_1150"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683015.1"
                     /db_xref="GeneID:5651674"
     CDS             complement(466274..471568)
                     /locus_tag="LMJF_21_1150"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683067.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1150"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1150"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651674"
                     /db_xref="UniProtKB/TrEMBL:Q4QC81"
                     /translation="MLRQDITALQPLQQQEDSVDNAAGPVKSSSSLQQQLKSMPSTLS
                     EALHEFYRAHTQLEPHQHQQQQQPPPLVRGPPPSAPPNVLANIMLANERLSASVTRSH
                     SRDRSVSEAPVETHRDGNKDPHSRQGQAVRPYTGKIRSTVAFSREGERESSASQVRSA
                     SPPDSIATAAPPLRPEVPITTTLDVDPTQPLALLQDRRRGNVEARVDSHDRAAAARHP
                     DPGVTSVAVPPSSTQTGANAAPHRRPSPSPEAAADDELQRTRQKLAEMQRLYSFEKRA
                     HLQQRTRQLREEAQRRQSDDDITERTAQLLIDYESLIRFRDTASREHLEGVLQRVTAE
                     WKRSAESLEQTRAACEDALLSRLHATLAEQQDALAKRLQQHLVLVAKSTVETERAQHA
                     AIAAAVQEQVESFKEEYRRVLEQDMAERQRLMDEQAAHREAQWRSFLKDEHARMVATG
                     EAAAREASRRQLETLHIAMRDITALREQLLHEHTRRQAQVGQEYLVAYEGLASEYVAS
                     TAETAEFVQRLQRDYASVIHALHKEVNRVSAEKQEAVRQSEQCTLQVAEAVAQQLHLA
                     EESVDARWQARWAAEQEAHRAAVLRLTRLHEEALEKVWSASAVKEAKLKEEHEREHAA
                     WEAHLTHQQEQQTAAFDDALRSAQGTVQRLEREKEGLSVQVQQLKDQLRREELAHEAV
                     VQGARQAEEARYTSQLNSLEAAYDAVLQQYKEKLKTACNGSDGSGAGFTTATTAVKRV
                     MVVEKELHEARAEHATQVQQAVEETAALWSARLEECRQQQRAHCKAMEQQHRALRAAL
                     LEEVQRREQALEESCVAERRAHQEELQNVITREKEASQRALERLERQHAAAQRQVEAE
                     AERRVRVGEDALAAREKQLEIAEAEWQRRRTEDKEASLQQLTAHVAAQHAKQLAELEE
                     QEAILRSEHAQLARQQAVMEQDIRRVVRGEMEMRLTEQLAAAEKGWMRLLEAELLQRF
                     TTWQEFRMQELAYVQQLHREEMRLQDEHHAVQITALQDAQQRHLSQEAEAMRAREAAW
                     AAARTASLDAYNEAVAAKLQEVLAVERAQWHTAQQQHAAERDASIETTAARVAEHFAI
                     TEATRAQLEEEVHASYLATLEQQQAKMSALLAEQRHRHEEAIAQVRASSAELAQQQAA
                     QFEKDLDAREREHEAHVREVKEALERQLAAQRSQHAAALAAERSVARDDVTRLQQQAD
                     AAREAYENAASVRMQNMRRLHEQQIAELQQRCDAQARQLGSIEADSYLLEQRVRHEQE
                     ATLRAEYEESIAGLRNAIEERNRGYAELQASLYARVQAEADRIQAAADERVACFMQQQ
                     QKQLAELLLAHERALGEQQQRQQEELARLRAHHEVDLKAQACKLRKEHEATEAALQSQ
                     WEAQQESWQQLLEDERRDRRAADERATAAAADAAELRVAWEQQQAAAYRALDEQYRWL
                     LEQMRSDMQVEREELARRCLEEEEHHFAAKMLQRQHAHRQPPQAQPQQKLSVSTHSFP
                     TPDAPILVAAPESRTPLDRRRSSGAATMTLSTPAAPCSATSQGSPLLISPAAPVELPA
                     AHHHHSHHHNHEQEPHADLVSRSKQRLRQLWDVLEVPSADQRTFLNYADSLAQEAPAA
                     VLQDALLREQRRLEAQLPLLEALTRREYVQRQLRALANVRPLAALSLNSKSDAKLKRW
                     SAEDGDYDTDDALHVSVSAPSPSVSGVLTDGGGSATTSAAVSPPAKMRGKAEGTQLEQ
                     LQLELQRLTVQLRRDITQHEKEYGQLFCVHGTRVMDTL"
     gene            complement(<478700..>482104)
                     /locus_tag="LMJF_21_1160"
                     /db_xref="GeneID:5651675"
     mRNA            complement(<478700..>482104)
                     /locus_tag="LMJF_21_1160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683016.1"
                     /db_xref="GeneID:5651675"
     CDS             complement(478700..482104)
                     /locus_tag="LMJF_21_1160"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683068.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1160"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1160"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651675"
                     /db_xref="UniProtKB/TrEMBL:Q4QC80"
                     /translation="MQTRARSGGTRPLPTVTSAASETDSIRTGGSSDSSSPSYGLRRS
                     NLPAPLAPEVLSSSLPVSQRLDGASSCPVNRAGRLAPDALRMPVLSPTASPLTVQGRS
                     PPPHQREAYQRRVHPGSGDKGGGAMSLPLPSTPTQAGSAPMDESGDDNCRRGPHNTRS
                     SMNSGSSSSSSRQETSSNALGLRTNEPAPSMPSISSRLPAMMQPSKLSTSATASSNVS
                     TTNPPAQQQPASTATMPTVSTSSSRLASQPGVSLLTVSSPARRCCLVADSSDRSVETT
                     PVSTVQIPLPPRSLPQAPAPAQRPSSTVSATSTNNSGTRGAVRQREAEARATVGDGST
                     SKEAYLRDNPRVRALVNNMYQHVMTTQPEEPLRYLAQLRAGTVPQVPSTHLAPPATQR
                     GEARRSPLQQARTVPQPRQLSSRTHGSIHPPYSHAAEGASTSSVSVSSELRRDSGSTC
                     DNDGGHTWAGPLQPTPQQPESAASHGGDVEFTDTFDSGAVSSGVANRPASLTTRSDVA
                     AVVHPLRTPPSAPTTSLQPRGGSSGANAGGRVMPPSIAGTVIHTNAGSNAILSGSASS
                     KHGSPQLLQRSGLATNSLANSGFLSGVAVGSAGHQAGSSGALLQHASGSVSAFRSSGI
                     AAPHSVASFAGSVSGIERGEATPSDLSSLFSTNSVDLQEFIADFRLAKEERYGGSVDH
                     PAITLDELACIIECNSFPCADAEVLLDLFDELQPCARYLAGVRSPTRSPPAVPATLKR
                     NSSPQSLHRGLGPRSMSPISLFNGTVTATAAAESVATGKVCGVGAASSSAVAAMCNNG
                     HATGPAWPPGRVQGAESCVTAAHPPISVAAKDMSHRPERFADGAQYKGCVTINGRADS
                     KDGKVLVIGSRIADGAPLESSSEGGSYNPYSRCTSDAFASASTLQRPQGMSQHPYSDG
                     ADGEEVPTVPFDTLLARMAYKIQGRYPSEAIRIAFYGMVVDEESAAAALESSGRSAGL
                     GVDCAALVTNGRGLHGVVSTDSLTPSETTVMGSSSAGLATTGYGTLPSCSVSLSRCIA
                     EGLFARLGMVDVTAGEVQRGLRSVGLPTGHDEQRVYECHLEDFARLVCAITAVSERGC
                     SASPANPSLTSLRESYVQRGSSSNFTVCNNNSSGGTVLAAPAPWKE"
     gene            complement(<486872..>488242)
                     /locus_tag="LMJF_21_1170"
                     /db_xref="GeneID:5651676"
     mRNA            complement(<486872..>488242)
                     /locus_tag="LMJF_21_1170"
                     /product="surface antigen-like protein"
                     /transcript_id="XM_001683017.1"
                     /db_xref="GeneID:5651676"
     CDS             complement(486872..488242)
                     /locus_tag="LMJF_21_1170"
                     /codon_start=1
                     /product="surface antigen-like protein"
                     /protein_id="XP_001683069.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1170"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1170"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651676"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q4QC79"
                     /translation="MMPPPLPHRRATRACALVAAVALVLVLPTSRARTVGMRSMSAYT
                     EAQQLHTRKFLDGFVQSMPDLHNIWTGDDFCAWKGVTCLRDGVSVSATNWVQLAVPPG
                     RLPEVSSADVDVSQVFVTSISVRANGRNLSGTLPASWGLLQNLRKVRLESNSLTGSLP
                     PEWSGLRSLRELYLSNNNLTGTLPASWGESMKSLAILSLDRNALAGTLPPEWGRMKSM
                     QALVLESNQLSGTLPAEWRFMRAASTLMIGRNYLSGTLPHEWAEMSVMEWMDLHSNRL
                     TGWLPAAWATMTLLNTLLLFDNGFTGTLPTEWARLEFLEELRMQDNVLVGTLPASWSA
                     MVLMQVLDISENTLSGTLPVLWSSMQSLDTLSIRDNQLSGSLPIEWRTLPKIMHLHLE
                     GNALCGCLPLNWTSRYVAVEVDEAVTSVNCATENACNDVNLDSISDKISSSCSSSTSP
                     NGGRRR"
     gene            complement(<489493..>490296)
                     /locus_tag="LMJF_21_1180"
                     /db_xref="GeneID:5651677"
     mRNA            complement(<489493..>490296)
                     /locus_tag="LMJF_21_1180"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683018.1"
                     /db_xref="GeneID:5651677"
     CDS             complement(489493..490296)
                     /locus_tag="LMJF_21_1180"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683070.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1180"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1180"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651677"
                     /db_xref="GOA:Q4QC78"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q4QC78"
                     /translation="MPQDKRLIVTKAVLYKLQRVCAEDGNGGSSSSSTGGADEEGIYL
                     EFILPSVITAQCPRLVRDHRFHLPHRVYAANGRTTCLIVPKVISHDCGKINKRHGYYD
                     AVVTAEAICKHGDAEATKRARRVATTFSHFVVDARIQSKLPHTITDAVKASLPSSAAA
                     ANAAPSSAVRCPRKMITPLDGLEERETLGFRLSQGATAGLVELHKQGQLLFRVGHGGM
                     TAGAVCENAKAFVVALKKEFPTVWRYIQELSLVSNRTERIRFMEVHIAK"
     gene            complement(<491180..>493540)
                     /locus_tag="LMJF_21_1190"
                     /db_xref="GeneID:5651678"
     mRNA            complement(<491180..>493540)
                     /locus_tag="LMJF_21_1190"
                     /product="putative DNA repair and recombination protein,
                     mitochondrial precursor"
                     /transcript_id="XM_001683019.1"
                     /db_xref="GeneID:5651678"
     CDS             complement(491180..493540)
                     /locus_tag="LMJF_21_1190"
                     /codon_start=1
                     /product="putative DNA repair and recombination protein,
                     mitochondrial precursor"
                     /protein_id="XP_001683071.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1190"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1190"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651678"
                     /db_xref="GOA:Q4QC77"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC77"
                     /translation="MAAVAIRVPKPKMTMSAVQGKISVFAEDGERIGQWGGTECFLSR
                     QGGLGPCLVVRSSRHKKHEGTFFQLVRLQRVVSTGVAQGRLTVMVPHEKRQCSVFIDT
                     TEDLDELRMMAGVLQDKARWKDMERNVASRSRRGPQRGGKGDGGGRGSGELRDPGLAQ
                     LSGSGVDSDDDYDASGEDTRKTHHDNDTVAVSAAQGDSFAAHSMVESLTHMTSSQSSV
                     PQRSTVVAGGGSSSSSGPTTSLTKAQQQRLKWTSEQQRAVQLVRAGHNVFVSGAAGTG
                     KTEWLLHVLQHVLPRTRQHRGAKSKADLGAEGEDQEQVVETGRVAVTAATGIAARLIG
                     GKTVHAFSGIGRGEGDPDAILQRVQSNPDVVRAWQRCEVLVIDEISMLSSHTFALLDR
                     VARVLRAPLAPPVSSSQRRQRTSNAALPFGGIQLLVVGDFLQLPPVSRGAGEEVQPAF
                     MAAVWRACAFQQLVFTKDYRHAEDPRFAECCAAVRRGECTPLVRQVLEACLGRKLEER
                     FGVEATTLLARRKDVDRYNAHRLQQLESMQFQRYASEDYAAVPGADIDAEVSLPTVLT
                     LKVGAQVVLLASLPNEPSLANGNLGLVGGFVAQAHGPALPLVRFSTGVEAVVPAVTME
                     VHGRDGRLSLSRRQVPLQLAWALTVHRVQGMTLPMVRLALDKSFFEAGQAYVALSRVR
                     KAEDLSLTALDLDVVAACVSVEARDFYGLGTVTSAPSSQPVITRAGSSPPLEPALSRE
                     RDTACGKGSLRTDGVSGSGVPLSLADIEGGGSRVTATRKRAKTEDG"
     gene            complement(<494924..>495805)
                     /locus_tag="LMJF_21_1200"
                     /db_xref="GeneID:5651679"
     mRNA            complement(<494924..>495805)
                     /locus_tag="LMJF_21_1200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683020.1"
                     /db_xref="GeneID:5651679"
     CDS             complement(494924..495805)
                     /locus_tag="LMJF_21_1200"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683072.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1200"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1200"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651679"
                     /db_xref="UniProtKB/TrEMBL:Q4QC76"
                     /translation="MSLIGGASHARLIAVRPPLVNVCRAPSGVSACVTFCIFAPHHWQ
                     HRAFVSVSTTARLLEPKKKRVSRATKQKPTKATSAPLPFYKSHSVRPVAAATSKTEGA
                     APPAAASFSTTASTASSVPDANIAAPAPMPAPSPPVAAQHAEQPRRSYAPTSAAISEQ
                     LASLRRELLETRLQLAKAEETYAGLYEGVLARLAETDRAAHLTASSLRYTGMALRAAH
                     DNLEVELRRLLTIGLTAEEVDAAAIEAGARQYVRQNIGYHTEHVAAEPPAVPDMARVM
                     EKNERRAAMSNFGKRPQ"
     gene            complement(<497568..>498422)
                     /locus_tag="LMJF_21_1210"
                     /db_xref="GeneID:5651680"
     mRNA            complement(<497568..>498422)
                     /locus_tag="LMJF_21_1210"
                     /product="putative thymidine kinase"
                     /transcript_id="XM_001683021.1"
                     /db_xref="GeneID:5651680"
     CDS             complement(497568..498422)
                     /locus_tag="LMJF_21_1210"
                     /EC_number="2.7.1.21"
                     /codon_start=1
                     /product="putative thymidine kinase"
                     /protein_id="XP_001683073.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1210"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1210"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651680"
                     /db_xref="GOA:Q4QC75"
                     /db_xref="InterPro:IPR001267"
                     /db_xref="InterPro:IPR020633"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC75"
                     /translation="MFRGRIELIIGPMFAGKTTELMRRVKREIHARRSCFVIKYSKDT
                     RYDEHNVASHDQLMLRAQAAVSQLTEVRDTWKRFDVLAIDEGQFFSDLVDFCNTAADA
                     GKVVMVSALDGDYRRKPFGQICELVPYCEAVDKLTAVCMMCHEQPACFTRRTVNVEQQ
                     ELIGGADMYIATCRECYSKQQLPSIEEMRTQRMAIKEVEKRYLGLSDKRATASPQTPE
                     KPAGGWCTKAGVATLPTMVKEGAASSGASAGMKSGRGLCEMQAFTTETPKYQRVEPAC
                     TASAASSE"
     gene            complement(<499923..>504041)
                     /locus_tag="LMJF_21_1220"
                     /db_xref="GeneID:5651681"
     mRNA            complement(<499923..>504041)
                     /locus_tag="LMJF_21_1220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683022.1"
                     /db_xref="GeneID:5651681"
     CDS             complement(499923..504041)
                     /locus_tag="LMJF_21_1220"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683074.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1220"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1220"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651681"
                     /db_xref="UniProtKB/TrEMBL:Q4QC74"
                     /translation="MEEDNQTLMKFYEAHTSDIAALRVLTQERKYKDTVFAAMEARMA
                     SMDAFLKELIDLIGTGHGLRVRRDANSVNSSAAKSSAALTSAPVVTMDEVRDAVQRQR
                     HALEAARQKETKQALVIRALEEEVASLKLQGRSASARLLAQKRGSKKSDNVTADEDCC
                     LPGTAKELRDAQRRIRELERQLSSAMCDAKDAAAAVASLQQQCTVHLQSLQCRDDELT
                     AMRNVLDAKEQLITALEEEARKQQSAAEAQQKQQQRTSQPGARYARTNSAPVAAHHHR
                     SGDEASSDRLIVTHHYRLFGGQTFVDGNSFSPESFKDAFLRSVSTLLQVPYDYLTSVE
                     VRTHSEAVSVELDIRHSACNKEDEIDFFLLSHDYPELVRFLDKAKAELATRKPLDRNA
                     VRVKELEAALAEKAEEVDHLRRAIRSLEASLDRRDSDRAVLDTDVDAALRETEMTVKE
                     VYEALQATQQEAQGLQKALTTQSAQLRLSERAKAAATAAAENLKTELATLQEQLTTAQ
                     ASVEQVREEAVQRALQCHTDEKAELLMNTFRLDVALPTALAQRTANRLLEEAQQARVL
                     QALLLCHAARTAGAVPVAVKKCSLGGGATTMAAAVVLAFYASKKNAEAVKAEIAKKLS
                     EDSGNEVLEYLRMCSDSSKREAVILADAQRAVSEAEQRAAATIAAMQGATQQAQNTQR
                     AVTARQLQEIHARLSSMRPGGSAEANSVLERVDQLVSRLTEAESKARRLEEESRRATQ
                     RLAEAQQEREQLQQTLSDLTARCTEMQVAKEQLAARAATAEGQLRNQQLSAGESEGVL
                     VQKVKLLEEALRAKAAAADSEKDRMLEEHRAAATLAAAQLAEVEEALAIKEAALAQLQ
                     SKTAPPGSGAAASASAEEAALREALRLAKQERTALARQVREMDTDMNDLSNIQASMQR
                     ELEMAQQELRAKKHDFDLLVKQLIRMEEKEKKRASEHSASPKKQDEDAELDDVARESL
                     IVLTNSNATLQQCLHRLHSALTSMGMEVSLSSSNAADSAGAVAGAAPGHGGERNSGRV
                     GNESIGVRHSGHRKSALGATVSRAAIDHQKLSVQVADLLLPVLEVLKTSASSRTASSG
                     CRPRGAAAAAATAPADAAPTHLAVTTQRRVVKHSPNSAPLFRTASTPAAIGAETSGQP
                     SNGGFTIVRDAAIASHGNTPKRGTASDAAVSAAVTGSGGKASMVDEAPRLDFHRQASL
                     RTYIRSNTATSAPVNVGGTALPPASAAAAAAATTGSSASSGAGVSSSGAATRVSGDER
                     KKEKGKEQLPRGASGGGAAAAAGDASESASLANAQVSTRRNAAPMTIAKANLLHRMNT
                     TATATASSGGSSGSAMGTSLGRTACGYRRVPTVTDSSGSSASLMRRARPTHM"
     gene            complement(<507949..>509865)
                     /locus_tag="LMJF_21_1230"
                     /db_xref="GeneID:5651682"
     mRNA            complement(<507949..>509865)
                     /locus_tag="LMJF_21_1230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683023.1"
                     /db_xref="GeneID:5651682"
     CDS             complement(507949..509865)
                     /locus_tag="LMJF_21_1230"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683075.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1230"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1230"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651682"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QC73"
                     /translation="MHVRVKARTPLIRTRLPLRGHSSIPSLAKKTDQPLVRPSAQMRA
                     PGPPAPRKSCGGERKSASSVRHSNANGVDNAPANMRALSHRSALTVCDSVSVSRRFEG
                     QSRCSAVAVDGTVWTGETDGTILIRLVPSGMEVRRIAPIGRAAVLVMKNVSGNMWAGY
                     SDGAIRVFDHVTQKVLRQSTQHTAAVYAMCAADGYVFTGGADGKVYQWMADDLHYSHM
                     YYGHRNAVRSLTTYTDQKSRCRYVVSGSDDGTVKVWEATVAKTSGTPRKDGGCVSTLD
                     GQGRCVLSILVLEDAAELWAGSEDSVIRVWDLSSMTVTTVITGHRAPVVTLLKVGDTV
                     WSGSKDGAITITNRFSKDIVHQASQPPANRSAAPGGQRSSVSILPVTRTVVYEVWATA
                     VDGSWQCWNFTVPEGVKSYVEEADVLKGGWCPSHSRPQRLSRVGQRSSRNVRSSSVNE
                     YSENGLHSASARARRSDEKLRASVAQTRRTVAVLLAGSKVHQGLGAHNGNGFAHRNEA
                     ASVDIVDDDDTPLDIVAESIRNDHTAETQREVQLKQAALAKERRKSAKLRAALEMMCK
                     DPVAIAEEGAKKVFRRTDSLVIAETLAMERQSGKLGSPTTEKLVGVSSQLELLKAQNK
                     AMAAAVTESKKVPD"
     gene            complement(<511808..>515596)
                     /locus_tag="LMJF_21_1240"
                     /db_xref="GeneID:5651683"
     mRNA            complement(<511808..>515596)
                     /locus_tag="LMJF_21_1240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683024.1"
                     /db_xref="GeneID:5651683"
     CDS             complement(511808..515596)
                     /locus_tag="LMJF_21_1240"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683076.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1240"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1240"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651683"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QC72"
                     /translation="MIYRSTPRAESPSHPQLYKAHTESTPCCTSSVTPTRNSFSLSMI
                     PRAQSPHSSSRLTSTSANSVRLKSRRLEDTVYVADVNPAYSVAAAVRCIAPVNDRVMW
                     TAEYSGTLCIRSLPKGTPLKELPGRKGSYCISLLYLPSKDVVWAGFQDGYLHVYSAKN
                     TDLLKEMMVHGGGLNCMIEVEGSVFTGGGNWKLCQWDPTDCNAELQRSLHGHSGGVRC
                     LALYNGPTGAVIFSGSDDGTVRAWDPYESLPGQESTEANIHTFTGHSRAVLALAVVSH
                     ASQLWSAGEDLTLRVWDMRSLACLAVCRGKHTAPISNLMVLESRVWSADKHGHILIWD
                     IATQSLLQDLSERVPYYGLEKGMVLAMQKVQPTTAYKVWTAFSNGVLQCWNAETVPII
                     FDDVSVSGGVFKPPNAGPAAPQVIIAGIGSSASATPAVVNSADVVCSSAVTLASSNNY
                     RDTLSSIHSKDNLPVSIPTTQVQEYIRSLQDELEATKRDAKLNYEKYRMEAQCEIETQ
                     QLLAQENNRLRGLVQELEKRAGEPPEGFDAPVQMSQGAASHHMMEEEVVRLQSVLIET
                     QRQLDEALERQLELEAELDRHKPASSSLHMSSMAIPPKSAAPDPYRQFMRQDGMAKLP
                     STAEDACSDSHFSSVSPSGPVNTSANPLSAFLFTSCQDDGESASHAGVPAEHTRLSRR
                     FKGGNWSYIMQEKPHELRSTFIADFCAGVGVAPTQLERVDLSLGSLVAEVEVVHPANV
                     PAAELERRMQTYRFPALMRLHTDAFTAAKTPPDTAAATINDLQRQLAMAQEQRRVEPS
                     PEPQQPSSNDNGCHSEGRISASEWQRLKDQNNTLRGTLQRQIKLISDLKNESAEKDVK
                     LADARAHLQDAEKRLQEAQEQQQDRTPSASRQRALDSTEAYTENYGRDPPNVDGTARK
                     EASEFERMAELVAVPLAQEMAAAAGRARLPPTAGGAGYDEDHEALQRYLHEQLKPMVS
                     RLKREQGELQLDNGNLKKKIEELTAQVQQQQKQLESERQKKAPVPPVVTSKASDEEVK
                     KLREDHEALKNYLHEQLKPTISRLKREKGELQLDLSRSREDLQRVYDMYDGAAAALEE
                     EHVREAKMGEAMEALRNALEAKELKNQTSREEAVAAGAWNDSHAANSETCQGFEMLSG
                     RPTQPTQLRSCGGTSEPRKEDAKKDPLDKLVALNLDLSVRLADAETVIAQLQNSLACS
                     SSQMTEQCDETRRLLNKIQRYQHSGAWSPDSSEAGRCFSIDNVVSSASPSKSPSQNRQ
                     "
     gene            complement(<518860..>519669)
                     /locus_tag="LMJF_21_1250"
                     /db_xref="GeneID:5651684"
     mRNA            complement(<518860..>519669)
                     /locus_tag="LMJF_21_1250"
                     /product="putative adenylate kinase"
                     /transcript_id="XM_001683025.1"
                     /db_xref="GeneID:5651684"
     CDS             complement(518860..519669)
                     /locus_tag="LMJF_21_1250"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="putative adenylate kinase"
                     /protein_id="XP_001683077.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1250"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1250"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651684"
                     /db_xref="GOA:Q4QC71"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC71"
                     /translation="MSSNDGLSEDTVMYIKDNNIGQLMEYILRCIITDKPTKPLEYVH
                     ELTASPLPPRVVLAGPPASGKGTQARHICSYYKRAIGKKPVHVSSGDLLRAEVAQGTH
                     LGKIAENFMQRGELVPDSLIISIIRNRLTQEDAVMNGWLLDGFPRTRSQAIALDAAGL
                     CPRIFVVLDTPDDVLFGRVEGRRTDPVTGIIYHLKYNPPPENDTALLERLQHRDDDTR
                     EVLGPRLETYHSMVEGLLDYYGSIMYHVDGNRPEAAITKDITEYLQNHNVA"
     gene            complement(<521277..>522779)
                     /locus_tag="LMJF_21_1260"
                     /db_xref="GeneID:5651685"
     mRNA            complement(<521277..>522779)
                     /locus_tag="LMJF_21_1260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683026.1"
                     /db_xref="GeneID:5651685"
     CDS             complement(521277..522779)
                     /locus_tag="LMJF_21_1260"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683078.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1260"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1260"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651685"
                     /db_xref="UniProtKB/TrEMBL:Q4QC70"
                     /translation="MSSTLVAVYEQACSDAAVLPNSALARCFAATEQAMLLQVLSLST
                     NLIGPRGLVALLPVLRECRHTLHTLDLSHNSLDNATIRQLVLCFASGGFSALRRLELR
                     GNLLTYQGGKCLVHWCEGLRTVRQAHDTRQAGVDDVKGRSAHSLAPAAPPGAPASLLC
                     CAEYWCDATDVNIDYVGIEDTAMPEMLQRALLQRITDAMARREARRLGHSSQRRSLSC
                     VATRESGPVADTSGAADSPRLSSADAESVKAPVLDGPPIVGTAHPFARSPADFFTDDN
                     DELQHSDVMKVAAAVGAAAVAVTEARETDVPRFLQDDIDMDVLHKPAYDYTSAGDNVS
                     GGAEELEDVRDDSGYHSDNSPAAGVAGTLLSADAYADQRSFGMHRRSGSVAEALPFPN
                     HSLKEGSGTDARCAVSCSRPASSPPMSPTASDGFASYTAEPSAAAAAQQQQQEEVEPY
                     PPPPLKTASNILDELGLEAVAETAGGGSGGGDGGGMEEDADTVPMWLEAL"
     gene            complement(<524294..>526801)
                     /locus_tag="LMJF_21_1270"
                     /db_xref="GeneID:5651686"
     mRNA            complement(<524294..>526801)
                     /locus_tag="LMJF_21_1270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683027.1"
                     /db_xref="GeneID:5651686"
     CDS             complement(524294..526801)
                     /locus_tag="LMJF_21_1270"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683079.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1270"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1270"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651686"
                     /db_xref="UniProtKB/TrEMBL:Q4QC69"
                     /translation="MAYGGPAPANPHLAALAKDVHRITGNISGPFRKGEYTMVLQQFD
                     MLMATSAVEEVAAMAVECREEMRELDLLGQSRNVLGPDFLTWRLTTPQGRAIGVNGNY
                     SLPKPSTVSDDTYQLYLLEQQIEDAWGQVLLASMRQVPDEQEHHEEIVNDFERLFERC
                     SDYLRAMLQDTMSAVHLLDITVMDASELSTQYVVCAALMKHPPPDVAALVKFIEYLKQ
                     RSIPLSLAAAEQLERIYLRFMKGEAAADVFESVTAAGVIPLSVRPFAMLFNNLTDANA
                     VLDAYDLMLDYGIAPEESTLRILCKQSRMEYAKLHFTTVLKNMANATSATQAHSPSPP
                     PPRSPLASGGAGVAPVHTSAAASTSTASTASRRRDERSYFAQRIEELAERKPKASLLE
                     ALKVLHRAEVEGTSLEGDTYIMSALLRHYCRSTTPRHYLVLPFSESLAYRPGPVSDGV
                     RAASHVEGGGNSKGHPAANGFDLGPDPANEELLEGEGKSAVNEELEGLPGAPTRSRGG
                     EPEAEKGRRPRPRQRDPYFADSSEEGTYILEVLKSYGSYPDNSVLQALSAQYEGQVPH
                     MEIVASAADAFFEGCMASHGTMSPVDCRFLHALGYYYIDNRWRDRAHLLVRRVLEMFY
                     AYHVTFRADLSGTEKWFSYFAVIVGTKTGPLDLGIGLFAASLALSDKTVNPKVATKLT
                     AKRDSSEHVIEAIAELEKCGWDYHRILFCDALMLEPQERASAEKNESPAGANGAGSRD
                     HHHGRGANGSHAAGAVASSAAAAGEEHLGKESIYTSAGQGPSSYNNSHLLSARPSLVT
                     YMYVALRDLGVDKKTADWLRDKLKAARQEALASKRTR"
     gene            complement(<530774..>532105)
                     /locus_tag="LMJF_21_1280"
                     /db_xref="GeneID:5651687"
     mRNA            complement(<530774..>532105)
                     /locus_tag="LMJF_21_1280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683028.1"
                     /db_xref="GeneID:5651687"
     CDS             complement(530774..532105)
                     /locus_tag="LMJF_21_1280"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683080.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1280"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1280"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651687"
                     /db_xref="UniProtKB/TrEMBL:Q4QC68"
                     /translation="MDVPSRPSVAASSTAPQGRPKPRALALQRSGGGALGSGRTQRGE
                     SRVSGTAAIHGAPTRQPAHSERSGQRHTSSGTSLSIAANNAAAECSAPALPSTGCPAS
                     SAQQHGASVDLPYALHDMDEHFFTNRQNWKTEEELPGLVWSLLEGVTLEAPYTSHLWA
                     QAYASPADLLPAPKAKASVLPDMFVHRESQQRTNGFYACVRCGTPVCEPSHQVIPASC
                     SLRGIAVFDALHMNGVELRVCTPTVKGVAPPQSREQRSSSPSFPAVKSLGKVGGAAEL
                     DVVAGGLRFLVHCRHCNGCLGVMRFGEITAPAAAPATTLFCANSACLEYVPYRTRARL
                     DQSIMTDTGADPEAGSSGRGDGAASMFGRASAAEHAQSRATLGSLFGPPHGAVAWGVE
                     GAIGVDYREEQGIISYAGDDTRLDASFDALLKDLDPCADLTPISSSVGSDG"
     gene            complement(<534499..>535272)
                     /locus_tag="LMJF_21_1290"
                     /db_xref="GeneID:5651688"
     mRNA            complement(<534499..>535272)
                     /locus_tag="LMJF_21_1290"
                     /product="putative R-SNARE protein"
                     /transcript_id="XM_001683029.1"
                     /db_xref="GeneID:5651688"
     CDS             complement(534499..535272)
                     /locus_tag="LMJF_21_1290"
                     /codon_start=1
                     /product="putative R-SNARE protein"
                     /protein_id="XP_001683081.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1290"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1290"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651688"
                     /db_xref="GOA:Q4QC67"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:Q4QC67"
                     /translation="MASNVNEESHALYGAVVVRLVDRVMLCKTPSAPMDGFTIPSTAW
                     ADLVSRCSAPHFRTSAFLNVTADKDPKQEVTLSYHLMTDDAFGYGIIGAKAVSRRDGH
                     AALDELAALFKKMFVEPPSTLNPKLADVFVRPARDLLMKYSSGAAAGSAENKVKKVKL
                     AVDEVKNMALDNVERVIQRGQRIDDIVQATDDLQFQAEGFQRSSRDLRNQMWWSSMKG
                     RIILVGAVSFMLLLLYFTFFAGNGNKKTVTTQAPSSAPK"
     gene            complement(<536316..>537137)
                     /locus_tag="LMJF_21_1295"
                     /db_xref="GeneID:5651689"
     mRNA            complement(<536316..>537137)
                     /locus_tag="LMJF_21_1295"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683030.1"
                     /db_xref="GeneID:5651689"
     CDS             complement(536316..537137)
                     /locus_tag="LMJF_21_1295"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683082.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1295"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1295"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651689"
                     /db_xref="GOA:Q4QC66"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q4QC66"
                     /translation="MFPSGFPSSAAGSGNSTADTTAPHMHVHTVVINVGDADGTAVGG
                     NAGVADVFSGVPATVSAVMAAAMDLSNLPGLVDLLSDTTPASTAAREWHAQGCPPFSP
                     EEVISTFDVVQLPLSSPVTATASTSHGDTDGADTAGSPSPPAPEVKECPICLEPLFQT
                     SVVRAAPESVPSSAPSLSELPTAGREKPATASESPPLQSQAPSSPPSVPPSDAAASAD
                     AARPLAHDDTAEATKDAKTVREVYCGHRFHESCILRWITLGHYSCPLCRSPFVFE"
     gene            complement(<540425..>542176)
                     /locus_tag="LMJF_21_1300"
                     /db_xref="GeneID:5651690"
     mRNA            complement(<540425..>542176)
                     /locus_tag="LMJF_21_1300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683031.1"
                     /db_xref="GeneID:5651690"
     CDS             complement(540425..542176)
                     /locus_tag="LMJF_21_1300"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683083.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1300"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1300"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651690"
                     /db_xref="GOA:Q4QC65"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q4QC65"
                     /translation="MQQLFNSQPKEKQEQMMKQAMEMQKMMSKIPGFGKLAQSSTKVL
                     EQLMKMQQQAPPPSSLSTTTTSANAAPASASSTGAAASAASSPRRDLFSNAAGLSSKR
                     LNGSGSSGGPSLDELRKVNLGPEIEALFQELRTIRSRKNEYRDKYYQVQSTLEGLQRE
                     HKDLATREASLRSKLAKVEQEVMLLTSENMELRDSSKSVRQLTQSNKQLKAEVEQLKT
                     AAQASTAPGTTTYVALQQLLHEREDALRSLQRKLDRMRRRDPLLQFSLACSNVSRLCT
                     GAKGEDVGSTDAAAAATEASQEATEKAFAELQTKYHKRQQAAWEAAAHDHAAAAAAYV
                     AVVRRYVMSNVPHSNYDAVVTFTGDAAALSTYFSSVGFEVEMIAGERGRAHVTAASDA
                     LPFSSAPGPFGYAFAASLARRMARAESSDAGAVTPAAAFTVTSAHPFVSAALVRNAKR
                     CSVAYETARASGPGGQATNVTETQVYAKLTIDGVPAYTAEAQDSRSALSNKEAALDKL
                     QQQRRLQFNDTLAKQEKAELVQAQLVAKMQHQGGFALEKDVHVLVQEAATAKLVAAGD
                     VALVEMLQQLGVLAAAA"
     gene            complement(<543544..>544620)
                     /locus_tag="LMJF_21_1310"
                     /db_xref="GeneID:5651691"
     mRNA            complement(<543544..>544620)
                     /locus_tag="LMJF_21_1310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683032.1"
                     /db_xref="GeneID:5651691"
     CDS             complement(543544..544620)
                     /locus_tag="LMJF_21_1310"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683084.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1310"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1310"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651691"
                     /db_xref="UniProtKB/TrEMBL:Q4QC64"
                     /translation="MRCVRVLLHGKLSYPVGTGRLALGTALLPLLPSNDIFYDPAKLR
                     YRLDQDGYLYFKNTVPRDVVNAALDDLATQMRECGLTLDEDRARQAELNGFAMGVPYP
                     STSGGELPPPNIHHTDTIRNAVSGTSVMATVRQVFGGAVQATTLQTLHLGAPGESFGF
                     RMPSVFLNRGTKLALVAIVPLHDTPLHMGTPLLVRSSNSHATYAQLRRTYGQWEVEGD
                     SIRGDGCYTENPAELSPLGKLPGTDETTGASIIVDVNPFISSALEAGDLLLTTVYTMQ
                     SFLTNQTNCWRLMAEAVWCMDGDDVGLDPRYMGSGAPGLAAWTESRDDPTVYPKSLME
                     AKKEWGLVPDLAAVTMDEAETSST"
     gene            complement(<545267..>545752)
                     /locus_tag="LMJF_21_1320"
                     /db_xref="GeneID:5651692"
     mRNA            complement(<545267..>545752)
                     /locus_tag="LMJF_21_1320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683033.1"
                     /db_xref="GeneID:5651692"
     CDS             complement(545267..545752)
                     /locus_tag="LMJF_21_1320"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683085.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1320"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1320"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651692"
                     /db_xref="UniProtKB/TrEMBL:Q4QC63"
                     /translation="MRLPRCTFLRRQPNLSGCRARPPTSVSSMSLFVLAVILAVCVAG
                     SLFTVVHAKDCITRGPNSMIAWKYEDGSFQCDNCIGAHAVGVSSGTVRRRWTEYDKDR
                     NILNSFVEEHREGKKLVLHDESRGMSILLRSDLSGIRTEGEQTFRQLYSGAFISVVDC
                     T"
     gene            complement(<547309..>552087)
                     /locus_tag="LMJF_21_1330"
                     /db_xref="GeneID:5651693"
     mRNA            complement(<547309..>552087)
                     /locus_tag="LMJF_21_1330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683034.1"
                     /db_xref="GeneID:5651693"
     CDS             complement(547309..552087)
                     /locus_tag="LMJF_21_1330"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683086.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1330"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1330"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651693"
                     /db_xref="GOA:Q4QC62"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC62"
                     /translation="MPPRRRSARKAGSAVPKQHVDGAPVCVKKELRDEEAEAADDAHA
                     EKKHVAMVAEQSHRDEECRRAEDRLEGAGEVNGEAAPGSPEGSQEAREDEAAQLEERH
                     GAEDGGGRDGSTSSTSSAARLSTYTPPRFPSTRTSGTELELIHPAMTTTHPSPRASAR
                     CDSDAGDLTPHSRLVIRDIDVENFKSYYGTHRIGPFHKTFTAVIGPNGSGKSNVIDSM
                     LFVFGRNAKKIRLEKLAEVIHNSAAHPSLSYASVTVNFIRLLETAAEEKDSEQRQEVA
                     GSELSIKREVFRTGASQYYIDGVRRTQKEVMECLISQGVDLDHNRFLILQGEVEQIAL
                     MKPKAEKEGEEGLLEYLDDLIGTSQFVGRISDMTATAETAQLARLEALDKERKLKAER
                     EALDEAKNSTLSFVTKDNQLQKTLIVMCQLRMRGIEERLEEPRRLLTEIDERIRSMEK
                     EVVQRRDEKAQAEEAFAAAKKHVAEAQRGRDAVRARRQSAEAHLEQVKSGADQEEKAR
                     KKVADQLRKAKEELQRAVLHQQDAEREAAIHQQNHNEAVEAVATLQLEHDTLAEELLP
                     RLRPLRQQLEEKKKHRAPYARAVTEAKEQLRTVRSRLGGLADSVAKKQQQVKDLAALT
                     TRSTARVAELERLLRDSDSKDLQEEVLRVQDQIGESARRKYAINNSIQELKNAYRDGE
                     ADDRAMEFLLAQRSLKGYYGTLRQLGRIDDQYDIAAGVSSNAWGFHVVEDRQTATEAL
                     MLLKQNNIGRATMMVVSEVEREVGSRMAKPFQCPNPKSRRLFDLIQPTNPKFRCVFYQ
                     AVRDTLVVETLTEARETAFGGSGHDAMATGTPSLSTGGAANQQRHRVVTVKGELVEPS
                     GTITGGGAAPRGAKLKAARSPQDKQSIKEELQRLQQDLVQAAEEERALNVRLHQLHEQ
                     ESHVYPEQRRKLRHELNTLVAKADGDAARLASLRSELAQSTQELEENRERHEQAVRDC
                     ETALQNAEKAYITHNADVEALEAQVDEAGGARFKAVAASLTAQQERADAEEASLRACR
                     RQAQKHRATQERKAADIVDYEQQLKKLEEEAQDNAEEQVRTCVKVLEGLVRELNGAEA
                     QLAKAQTSAEDARAAVPVANGAALNAQKKLDDEQRYRQTEAAKIADALQELSKFQQKI
                     EGCEEKIRENVELYGKETLGQGDAEDEEDQAAEVDEEDGDEDDEHVNEDESEAVHGRK
                     RARARPGRRSDEAALHASSARGSSALVASPPAKRAHVELRQTTFRLTAEELDGCDYDR
                     SVHLAKALSEETKRLHSEIDFRAVALWRERDVAHREAKAVYEAKKLLSDEAERELQTL
                     KGTRRQAFMHTFEHIRQRLKEVYQLLTHGGDADMELVDVNDPFEGINFVVRPPKKSWK
                     QISNLSGGEKTLSSLALIFSLHHIKPTPIYVMDEIDAALDFRNVSIVANYVLRQARGA
                     QFIIISLRNNMFEEAHQLVGVCKVNDTTSTLVLMPRSFRRLIGTQLAEAASEQWRKRS
                     ERRRSCHQLGEAGVARNADGGDVDGHARSPRTSVVHQPHTPSSGARPTVGDASPMSTS
                     TWPRSSGSVDGARDSRKSVRFASVNSATAVAADDNAYSEP"
     gene            complement(<555322..>556773)
                     /locus_tag="LMJF_21_1340"
                     /db_xref="GeneID:5651694"
     mRNA            complement(<555322..>556773)
                     /locus_tag="LMJF_21_1340"
                     /product="putative ATP synthase"
                     /transcript_id="XM_001683035.1"
                     /db_xref="GeneID:5651694"
     CDS             complement(555322..556773)
                     /locus_tag="LMJF_21_1340"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATP synthase"
                     /protein_id="XP_001683087.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1340"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1340"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651694"
                     /db_xref="GOA:Q4QC61"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QC61"
                     /translation="MPALSAAAADTISLVRQLQLLDDNTIRLLEQLFTNRLNGELVTS
                     LVDGREESLAVALFRLCAGTHAENILGYSLRFLADLVYADREIGVQLGRGDLVKEFGG
                     HPASLLLQIASSHSESLGIANPAIYLAATALRYGEYEGNETAFKDFFALARHTFAPET
                     LQVTDIAFTVQACVQLARRKDFRPLLFEANLVSCIPHLLTDIVSSDSAGIIQVIYETL
                     LLSWLLSFEYEGLVLLVRERMIPQLHRVLQRVQKEKCVRVSLMTLLNMVEAERKYMNK
                     LLNPSSEEWVDSRIYQLGRLHQSETPGQQISTFKKGPSLVAEMVSVGMIKTLSQVSRR
                     KFGDEDINVMVDQLNAALEKSMQVLTSFSQYRGEVLSGVLEWTPVHTSTKFWKEKAVN
                     VEDNGYEVLVALGKVLRESKDELTLAVGCHDLGEIVRYHPTGRNLLTLAPMAGVKECV
                     MMLMSHPNPEVAKEALLCTQKIMVQRWEYMQTA"
     gene            complement(<558367..>563688)
                     /locus_tag="LMJF_21_1350"
                     /db_xref="GeneID:5651695"
     mRNA            complement(<558367..>563688)
                     /locus_tag="LMJF_21_1350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683036.1"
                     /db_xref="GeneID:5651695"
     CDS             complement(558367..563688)
                     /locus_tag="LMJF_21_1350"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683088.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1350"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1350"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651695"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="UniProtKB/TrEMBL:Q4QC60"
                     /translation="MLGEGRVRTGAVHARAAGSRRTEDTVAPLSIGSAASSYCFPRIS
                     QPLLISLSLPLASSHPAALSTTPVRSPVEQANGALARSQFFVSSCFRFCTAIPLDPSA
                     CRLQCCPRYHHRRCAFTPSHPQLSAASLSLFACAPLRTRSASPLRRSLSCLGTWRARA
                     KLHNKEPHTQAALIPTIPFSPAVAHVRLMSHGGDKAPDAATVTPAPARSANKKHNRSS
                     GSYAKSYGRESYEKHKAKQVRPLQPPQEPLRQVNANAAAMPLSTELSLRPFASHEPAG
                     LESSLPSSADFDDGELEASPLTMSSQSYVPKHRRRQGGDHVCALQQDVAAAKVMRHTP
                     PLPHESQRHADPTALPEHRRVALSEGSDGELLQHHATGKENMSIGSHAAPSPAGATAA
                     SSTSLQSVPKPASSAEVKQRAVSSVSHPATSAAAATATDFRCAASGHVHQRPLSLSGA
                     ATAPRQASVSSTLTTSAGGRGGAMAARVPQKRIASVKSRPLTTVARKQPPSLSNAKAE
                     TAERHESPAPTPTAAARERSPEMDAALRCELYQMESVLDYVAEVVTALGERRRCAAPP
                     QSTKGFRASVVPTRRCGGTSSSPEALDGSDVDLPDHAACVRNSGGTVAFLPDIHQAAS
                     RLLSAFTKLEYVQLSEDVDMPLLERDAVEYSARLLRLVDGVERQLSLHEDTLVRRRLS
                     ERRYIFRAMHQLVHFIVRMTHEVVLLRGLALCHDLGQVLEAWGSFRGGVEAQARAAAG
                     ASDSDTRGKSEDAAASSAPRLLQQHLIFPVAMLRGSPFFLWLEGRWFPAMRQWRKFVF
                     DALQAASSGDIEGAIRRSRQEALRIDGLEEILRPGETITTLLREQVEQPIEELGRALS
                     MKRAAMAALREVLEGTEATDGTLNAAHLSKVLTAAQAFTVARGGRGSGVDKLAASVGG
                     DEEDAELVCRAEELLARLAEADVLHRATKAALQHPAPELVTALEHITRANELLLLWGR
                     ACDVTSAQTALATGRAALDAYMQRLHSGRLSDNASLLSSTNGDVSTGKCMTPSRANGS
                     SAAAPVPWIGDGFPASFDVRSLYVAHTPGGAWSKDLSMTYIELCEVFGMLYTQRQARR
                     DLELALALARPSVEDYGTRPAVALSLSPQVTPRRPTRDAVSPADTLQVSKDGANAHGC
                     SLTCSAGGTGETHASDGSTPPAQNMPKGPSAEELHRCIQQAEEAGVGGPLVEEARARL
                     RLLDTLRLKIHFDAQTRVLPVADAAQASFHDVYKQIHDFCQTQLQQPPRAAGAERRLR
                     IRYEDTEGDFISLLDQQDWHMMLSELAPHGCGGVKIELFCDYPTVPGMMSNSMAVPNG
                     DDVPRTGVESELASGDFQTETAPETSTPAGPAAATGPAAATPEKRTNVFQRLASAPKG
                     TAAAPAASGQRKPRMHPHSLGATSPQRALLPPRARGSGSGAVRTVSPQKCGAASRAAV
                     GGGSARGKDSSSSAATGAAAPKTAALTAENLRRNLLYPQAPPCSEGAEAAAREEVRRS
                     GGRSSSNGMAAAARPAAAEADGYTAASTAAPASAAEAHNSVSSSNANGDGERESSAAH
                     LSLDMARRWEMPSDDEWQLLEIQTRASISTVCPDRCIEMHESMTTTSRPTHVPPRAEP
                     PRNTFTATYCSRKVERISERGSGGAGEAVGAVVEVSTAPKRRLSHSPSRPPRRWASDA
                     FTLDDVETVCSEQSRVPQQASKPKGPMSLPPRPVNAGGGGGTRTPQRVRRGARGTPTR
                     SNPNAGDDDRDGGQGDIPNASDVLFEEMQRMREANTRAMAQRKSSWH"
     gene            complement(<564342..>565412)
                     /locus_tag="LMJF_21_1360"
                     /db_xref="GeneID:5651696"
     mRNA            complement(<564342..>565412)
                     /locus_tag="LMJF_21_1360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683037.1"
                     /db_xref="GeneID:5651696"
     CDS             complement(564342..565412)
                     /locus_tag="LMJF_21_1360"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683089.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1360"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1360"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651696"
                     /db_xref="UniProtKB/TrEMBL:Q4QC59"
                     /translation="MLCTLIAAVLILVVAPPGAQAAASPSSFRCLRPFSASATFPNVA
                     KAHPAQNCDYFYFSVEDAKAELKCASPSAVTTAVSDEMSCNVTVRVSMRRASDAVSHL
                     QRQVGTDEDYFTHEASTVSTTTSPTRSGNTCPSAAPFVTEDEDVWRYAVSLKAKGDSS
                     IHYKGFNGGNGYSLCCAALEEADCAWITPQKGDKDLDCDEDVDVGFASQRSRVLRGCP
                     LPFPAPCSAGGGVFDAPAGARVLLTDLDEGESSGVFHAVITKPLHRIVEGPWEVMVQM
                     WRRRQQMPRGGREDSFSVPADHSIEAEVLGRIMVPFTLNLTELQKQALITQIPSMALT
                     AEDVAGVAQAAGENAADETGDL"
     gene            complement(<567347..>570496)
                     /locus_tag="LMJF_21_1370"
                     /db_xref="GeneID:5651697"
     mRNA            complement(<567347..>570496)
                     /locus_tag="LMJF_21_1370"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683038.1"
                     /db_xref="GeneID:5651697"
     CDS             complement(567347..570496)
                     /locus_tag="LMJF_21_1370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683090.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1370"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1370"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651697"
                     /db_xref="UniProtKB/TrEMBL:Q4QC58"
                     /translation="MDDSRKADEQERGVDTMEKSVAVKVPLPALLDIKAEALRSNPSF
                     VVTCFSTLLTAVLLGLCFMIVGVPPLYIAARRGRCIYVGVMVPLLTVIGTVLSYYAMQ
                     HPQRVFNSALAQIVKETEQHAAYLSTAVNNVETELETRRVTLGLAYTHEPARMRSLPM
                     APEESGLQRFSRISMPAGAAAGMLATLPAISGPGLLHGIDELEEERGMIIATVHVGKE
                     WRWLMGLLGKLNLRSLTGSANPVVHHQRIAVRALVISVARVERMILSLYFSSFVLNRA
                     NAAAAVNPSGLAASKSVAGCGSGFGHSAQRHQESAHGRTSTSMFEPSAPIMTSVKLHP
                     SHKPGHELGDSSTESVFTVPRETPNESRDRAESGGAGEEMTSQLTSLNVKGLPFGRVK
                     LPQFPPLLTENTGSRKPQKTHAHAHKGPSVARGAATASAPVQRVLHLDTDAQVTDEKA
                     QRPDKASASEHSVRSLADTNKADEASDQGGGSGDNSPLAVGKEWRRSTIIPSSLVGHA
                     ATLCIQSHTVAAAENAANKAFMDGNAGGSGAVLSHCLSISAQHPEQQLSSGGDNGDSV
                     GRSCTVAPHSDGNATGASPISSPRSRPRLARSTHSRQPGSAVVANPSLTLNRGARFIG
                     DENSVFATVLIHVEKGNSACGSRLYGAQAHASYDASANRHYFTNGADSSLTHSCGFHP
                     FTIFYISNHKGQRERLTTREQQLLEFVYCRPEEPSELDSVNHRCATDLSSLAVRDTGQ
                     CSGDTVAAAATTHAGRSTASFARETANPPSSTSHHASNSVFTEPRVDSFIVAMQILQD
                     RPMRLTFLPVVMAPVQPKGTPLVHNDATMQPLKAACRTDLESTGKELHLASGGGIRST
                     PTASAIAMPARGRSSSGGVGSSDDGATNSTPEAVRRTPSPTTVPVLECVIDDVLCILT
                     EIEITVDTSFKRPSKVLLNGVSLEDVSEEGSERGEIGVDEDEGVSQDSVEGSTGSQSL
                     YGAGDTKQPTDLRGLPRQRAGNEAEVIQQGIRSVMATPRGRVMLRHGDSRSVASLNRY
                     KHGERSTLGQEFSEVIHLE"
     gene            complement(<573306..>574409)
                     /locus_tag="LMJF_21_1380"
                     /db_xref="GeneID:5651698"
     mRNA            complement(<573306..>574409)
                     /locus_tag="LMJF_21_1380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683039.1"
                     /db_xref="GeneID:5651698"
     CDS             complement(573306..574409)
                     /locus_tag="LMJF_21_1380"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683091.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1380"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1380"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651698"
                     /db_xref="UniProtKB/TrEMBL:Q4QC57"
                     /translation="MIFTIVNAVLSAIFLMLVVVPPLYIFSPDDNAGEPNRLPSAGEV
                     LLDESVTQGVKQRLYVLVVIPTCTTLNALFLYFAYYRPVRFVHYRVELNVLTLRWTLE
                     ARRQQLQKSGVLAVGNRSIVGGGVSASSFVVNGSSVASLKRSEMSTRTVHLGQGSNQA
                     QRLASTLKWEWRRHVRPKSVRKDTWVNSAVFAEIGDLRDQVEQHFLTKASVAEANFTK
                     AVVKAVGVFVPPTSAALLGQVTDVAAEAKQGNGFYLSSRPPLSTLGSPRSGPRSTARH
                     GMLRDGKAAPRPQSNVAPLVPAESLHPDHPRGSIMPASSSGGGSGVSCVGSKFAVFRG
                     GESTSWGRSNTGAGLPQVLRSNALERTREPADM"
     gene            complement(<576220..>578013)
                     /locus_tag="LMJF_21_1390"
                     /db_xref="GeneID:5651699"
     mRNA            complement(<576220..>578013)
                     /locus_tag="LMJF_21_1390"
                     /product="zinc finger domain-like protein"
                     /transcript_id="XM_001683040.1"
                     /db_xref="GeneID:5651699"
     CDS             complement(576220..578013)
                     /locus_tag="LMJF_21_1390"
                     /codon_start=1
                     /product="zinc finger domain-like protein"
                     /protein_id="XP_001683092.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1390"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1390"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651699"
                     /db_xref="GOA:Q4QC56"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QC56"
                     /translation="MDNGDLLRYALQRRQYLVAIWLTLQQRWFVTSFNASTRVVGWAA
                     VALGVALVTFTVVTFARNVVPVLTTPGTLPYVFLQCLLVFVSFNIYVNYFCSTALSRH
                     IGQAPPEYTYRGPYTTNATGAPYDDSDFSQDSSDDSVEEGDGSPWVCGRTQEMSSMAA
                     GVPMAQHTFSSPHRGVAEAPRGPFDTTLNDSLSPQVPVPAVTGMVAPSQPPLPTTNFP
                     GIRVVRVFRGDESADGDAAATVPLHQPKAGVACWRGSTRSLLDCLTRLTRRTSAVFHA
                     RGCHRCHLPNRPKTVATLDTLLELEAIAGTAERYPPRLRVARVLDVPRRYCHHCRRLK
                     APREHHCAICNERVTKMDHHCPWINNCVDAENQRYFVLFVWWLWVGTLLATGFLGYGY
                     IRESSNARKFRRLHAQWKTSPNKAAVEAKLRALHMPYGPAGVLLTSYLTTLAFGVAVI
                     VCLCMSVFLYVNKRLVLENTTAIESIYVHEKRTHVYASTNFAYRSPYDLGKWLNFVDL
                     FSTARDPLVKMALKAEAEADRRATAARPGGCADDRGWRWAAAARRLAQRVAIAVWLTG
                     FPTFRPIYGDGVHYPTFDLLASGELHPLLAE"
     gene            complement(<579762..>581555)
                     /locus_tag="LMJF_21_1400"
                     /db_xref="GeneID:5651700"
     mRNA            complement(<579762..>581555)
                     /locus_tag="LMJF_21_1400"
                     /product="zinc finger domain-like protein"
                     /transcript_id="XM_001683041.1"
                     /db_xref="GeneID:5651700"
     CDS             complement(579762..581555)
                     /locus_tag="LMJF_21_1400"
                     /codon_start=1
                     /product="zinc finger domain-like protein"
                     /protein_id="XP_001683093.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1400"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1400"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651700"
                     /db_xref="GOA:Q4QC55"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:Q4QC55"
                     /translation="MDNGDLLRYALQRRQYLVAIWLTLQQRWFVTSFNASTRVVGWAA
                     VALGVALVTFTVVTFARNVVPVLTTPGTLPYVFLQCLLVFVSFNIYVNYFCSTALSRH
                     IGQAPPEYTYRGPYTTNATGAPYDDSDFSQDSSDDSVEEGDGSPWVCGRTQEMSSMAA
                     GVPMAQHTFSSPHRGVAEAPRGPFDTTLNDSLSPQVPVPAVTGMVAPSQPPLPTTNFP
                     GIRVVRVFRGDESADGDAAATVPLHQPKAGVACWRGSTRSLLDCLTRLTRRTSAVFHA
                     RGCHRCHLPNRPKTVATLDTLLELEAIAGTAERYPPRLRVARVLDVPRRYCHHCRRLK
                     APREHHCAICNECVTKMDHHCPWINNCVDAENQRYFVLFVWWLWVGTLLATGFLGYGY
                     IRESSNARKFRRLHAQWKTSPNKAAVEAKLRALHMPYGPAGVLLTSYLTTLAFGVAVI
                     VCLCMSVFLYVNKRLVLENTTAIESIYVHEKRTHVYASTNFAYRSPYDLGKWLNFVDL
                     FSTARDPLVKMALKAEAEADRRATAARPGGCADDRGWRWAAAARRLAQRVAIAVWLTG
                     FPTFRPIYGDGVHYPTFDLLASGELHPLLAE"
     gene            complement(<582748..>584025)
                     /locus_tag="LMJF_21_1410"
                     /db_xref="GeneID:5651701"
     mRNA            complement(<582748..>584025)
                     /locus_tag="LMJF_21_1410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683042.1"
                     /db_xref="GeneID:5651701"
     CDS             complement(582748..584025)
                     /locus_tag="LMJF_21_1410"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683094.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1410"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1410"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651701"
                     /db_xref="InterPro:IPR010376"
                     /db_xref="UniProtKB/TrEMBL:Q4QC54"
                     /translation="MCRQAVAHPPSLPPPSSLVASAFSVQELTAQRRRSVHTTASGTD
                     RGEGVPQLLLLMPPAVVAVVLSTPLQRSTRSLLSRRLFLFAAVAEMNRAPPGACALAA
                     VAPLSYLRRRCTAASSSPPFLLSPLHAACASATARRPFTSSLLSKLGDSVASKVSRLA
                     ENVWLADEKLVTEPRRKFEPQRVANTSLAERLAVQRNVRQRLVPTKVQVDKSRQYVEF
                     TWPADAVEVMRCVSLEAEPSDPTEPPRTSSAKSSSRPATAPVARPSSAGPAASSQAPE
                     RAATSARGAPAGELTRAPLPACHSPCVPSGTPLRTRALAEYLRAYTPSTDGALGGKDI
                     IIYGRRGIAITKIIPVGNYALRFVFSDGHNGGIYSYAYLYYLTSPSTKYGLMRGYITE
                     LRQRRRSRDPPKRAPSSKYAKAIAQRAATTRKH"
     gene            complement(<584585..>585394)
                     /locus_tag="LMJF_21_1420"
                     /db_xref="GeneID:5651702"
     mRNA            complement(<584585..>585394)
                     /locus_tag="LMJF_21_1420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683043.1"
                     /db_xref="GeneID:5651702"
     CDS             complement(584585..585394)
                     /locus_tag="LMJF_21_1420"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683095.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1420"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1420"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651702"
                     /db_xref="UniProtKB/TrEMBL:Q4QC53"
                     /translation="MMRFRGSHYQQLLTQLPRNLLVFDGHCLLCQARVRYVLERNFSF
                     FGFFSFATRKVEGEIAEGLDRHRIYFASLDSKEGANVRRLFFQRALSSSASRASCSAA
                     LPQLVLPVPEDLVLVFIEKVPSQTASFLTGVRPGGLAADDRTLFENKTAASYGRGAAN
                     SASATTFSTASSRLVNAAETDLFVSTNYTAMCRVGMHLDRFLARSIFRFLYCAVPTSV
                     GNWWFERYVCRRRKNIWGTSEQDAVKECSIIEGMRERRWVWRGVSSNSLQR"
     gene            complement(<587138..>588577)
                     /locus_tag="LMJF_21_1430"
                     /db_xref="GeneID:5651703"
     mRNA            complement(<587138..>588577)
                     /locus_tag="LMJF_21_1430"
                     /product="putative 2-oxoisovalerate dehydrogenase alpha
                     subunit"
                     /transcript_id="XM_001683044.1"
                     /db_xref="GeneID:5651703"
     CDS             complement(587138..588577)
                     /locus_tag="LMJF_21_1430"
                     /EC_number="1.2.4.4"
                     /codon_start=1
                     /product="putative 2-oxoisovalerate dehydrogenase alpha
                     subunit"
                     /protein_id="XP_001683096.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1430"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1430"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651703"
                     /db_xref="GOA:Q4QC52"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q4QC52"
                     /translation="MFHISRAVRCNALATAIAGRTSLSDAIRQVQKVWNLDFKDGPVI
                     TSTLAFNDEPDPAAPIFHVLDLQGRVFVEDKADSRAAAATPSTVNEAGKMESQSADVG
                     EVFRYHAEDEMSVITREVAQGMMSAMLTHNTMDKIMLEAQRQGRISFYMTMFGEEAAV
                     IGAAAGLASNDELFAQYREAGILTYRGYTIPEFIAQCMGNCECDAKGRQMPIHYGSKR
                     LHAQMVSSPLATQIPHGAGAGYAFRLENQALERRLPAGTLLSTIPEARICATFFGEGA
                     ASEGDFHAGLNFASTVGSHTLFFVRNNGYAISTPTHSQYMGDGILSRAVGYGIPAARV
                     DGLDALAVYHTVRKAREMILNSHRPVLVEALTYRLSHHSTSDDSTAYRSRDEIEHFAE
                     TFSPIERFEHFVTARGWWTPEQSREVVERTRSEVLSELRRQEKLPAWPVSTLCDDVFE
                     HLTPELERQRTQLVEHYQAHRSIYDQEKL"
     gene            complement(<590888..>591553)
                     /locus_tag="LMJF_21_1440"
                     /db_xref="GeneID:5651704"
     mRNA            complement(<590888..>591553)
                     /locus_tag="LMJF_21_1440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683045.1"
                     /db_xref="GeneID:5651704"
     CDS             complement(590888..591553)
                     /locus_tag="LMJF_21_1440"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683097.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1440"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1440"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651704"
                     /db_xref="GOA:Q4QC51"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q4QC51"
                     /translation="MSRFYTAKEVREHAFHDDAYVSLNGKVLDLTPLIAAYKEMPKFA
                     HLAKPLVQVAGTDISHWWDAEANDLRSCVDVNSGMRTYAMPLGRVPHMPTIYPDSNID
                     LNYDIPWWKDPQYIIGALTSRTRRIRIVNTLTGDETTLDVCAEETLEELLRERYLSIN
                     AHARSYTWVRLDPDPRELDMSRTLEDNGIHDEADSFEDLGLNADYYIPAIHLYYNDDL
                     TEA"
     gene            complement(<593488..>596706)
                     /gene="PRMT5"
                     /locus_tag="LMJF_21_1450"
                     /db_xref="GeneID:5651705"
     mRNA            complement(<593488..>596706)
                     /gene="PRMT5"
                     /locus_tag="LMJF_21_1450"
                     /product="putative arginine N-methyltransferase, type II"
                     /transcript_id="XM_001683046.1"
                     /db_xref="GeneID:5651705"
     CDS             complement(593488..596706)
                     /gene="PRMT5"
                     /locus_tag="LMJF_21_1450"
                     /codon_start=1
                     /product="putative arginine N-methyltransferase, type II"
                     /protein_id="XP_001683098.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1450"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1450"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651705"
                     /db_xref="GOA:Q4QC50"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q4QC50"
                     /translation="MHRRIHKTGEVYTSTKHPPRRSSYLRRLLFPQFPEMSFDGGGIS
                     NGPEAQANASAMEEDYCLHGRERFQNQWALAGVFSPASLRVYGITGEPVLMRSIKQAR
                     MLGATFGTCFLGHFPRCKSPPSSGDNDAAAVAQKGDASSGAGPSRGSSSYDSLPFSSL
                     LLGPCPPPNMTADPHMLDQAWRREVAGTWNALHMPSEWCQTMNGVVTELSWSTRAQRQ
                     RIAEQLELAAFMCLRAVQVPLPFYAADVAWSGGNDDDGRDREDNEGGATAGTRGGAQP
                     MSDAEENQRNIRVACLAADVLLSFIQQCTRVKVWVRCDACNPAHRYQLQRLRQAILYG
                     YSTLKTDSRRVIYRINTPCSVTSITTSLMCGAPPPSSSSSPRLGVVHTEAASSLMALL
                     YYSTWNPRMLLPSEWFGEEVVGFECPTAAALLACLAPHGVAPPEHPHYRPDAPGTTLA
                     EEDVVEAQKHEHPNHGDPDEDSAPLRRTPPTYHKGESEGSQADYSLFDWYDSVTELET
                     SHEAGSAVAAAKGGSKGACSASDTSYEAAADCRRSHVLRSRYTYVMPEDLQPLVASRW
                     AGTYPPFVSTLTFIVELLRRRAMPVFDRTFFDQYPLLNYLHFKGVEEPTRDVFASFEG
                     QLQLPLQPLSHHLSSGVYEVFERDARKYRQYREAVFHYVRDWYAAGAEQQHAHQNHIF
                     FAKHGVMQRVPVPSPDERILHLVLLGCGRGPLIDECLHAVSALGVRLRIFAIEKNRLA
                     AAFTRMRWANDPEWTQLAYTFGHTLEVIVADGRTIATAAENGSLTLPADFGLCDLIVS
                     ELLGSLGDNELSPECLEAFHAQLEDIQLSRGIAFNPHLMCIPQQYTAWVAPLMSATFD
                     AAVTEAAVKGLTVPPPGCHDHHAALNHTLLVTNLSRAVTLAPPQPCWTFEHRFHGGSS
                     NYYKGDRGAMKRREPASLERAASLLFEVPPCGRCCGLAGYFSAVLYQSATAPATIIAT
                     APVERTEDMYSWFPCVFALEPAQQAELQDVEQAAAEESRMVAIRVQLDRRTSLEEQRV
                     WYEWSVTYGDAAVERQSPKTSGDASAAPLVHNKNGWAASMLL"
     gene            complement(<597261..>598796)
                     /locus_tag="LMJF_21_1460"
                     /db_xref="GeneID:5651706"
     mRNA            complement(<597261..>598796)
                     /locus_tag="LMJF_21_1460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683047.1"
                     /db_xref="GeneID:5651706"
     CDS             complement(597261..598796)
                     /locus_tag="LMJF_21_1460"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683099.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1460"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1460"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651706"
                     /db_xref="UniProtKB/TrEMBL:Q4QC49"
                     /translation="MNRHYAYYYDPRGATLRAPFCYPDEVPLRAQEHHSDVSGAEWPK
                     PSDLPLPSVFPMPPHVLPQLSLPAVSAPTAEAAARGMVAAPHAWAIPPPVLYPPPPPP
                     PWWFYGTHPLPLPASSSGSSASSTGSSRHASSSSPVSARSTTRPSRHPSANAARPHAE
                     AAAPSRHGVAVPAGSVETPVAAASRGDAGGGHAAKKPSVASSGSRYAAGHTVGTGRAA
                     RRSMGSLSASSATTSPWSATTTTAHSDLPQRVERRVYASSGSGSSEMQRSATGQTVQV
                     APRRTNVAQCVPPDQLQVYGDDVVQERGYSSVMTRMKHAVSAAEAYLEKMEHLYRRLR
                     SRYEEVVMSPGKVTRYGADITADEGVEEKRHRRTAPAATTRATRGPPEKGLLHPPERP
                     FSRQTHLQPTAPLPHAERPVSPALSAAQPSAVEPSPPLSSSSSATSATSLRRELHLLE
                     SQWQRLEELKRHGGGGTTTAVSMPAALSPSTATSTAGEDPFTNRRFLQLIKDRKHLLT
                     SAT"
     gene            complement(<600709..>601527)
                     /locus_tag="LMJF_21_1470"
                     /db_xref="GeneID:5651707"
     mRNA            complement(<600709..>601527)
                     /locus_tag="LMJF_21_1470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683048.1"
                     /db_xref="GeneID:5651707"
     CDS             complement(600709..601527)
                     /locus_tag="LMJF_21_1470"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683100.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1470"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1470"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651707"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q4QC48"
                     /translation="MAKWNALSAEIEAARASGDHTKLLAHVHVGLQMLQEIGATNAPI
                     QCESLLCMEASQAHYKMMQYDEALQCAERACESLLRGCKAELQDKAQIAEIEVFMGFV
                     LCKQGGHSAAVEAQELLQKVLHWIDVDAKSAMPMQAVAAVNLRRSVLTGLGLSTTVQA
                     TTLASKGETAEAKVLYAKGLDTLIEALNQHIDENDVELVKMTLEAILTSFEGLDDVSQ
                     AVATCRKYISWCRRHDDASGVADGESMLTALCARQKIENPLEAEKAKETEEATK"
     gene            complement(<602852..>605335)
                     /locus_tag="LMJF_21_1480"
                     /db_xref="GeneID:5651708"
     mRNA            complement(<602852..>605335)
                     /locus_tag="LMJF_21_1480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683049.1"
                     /db_xref="GeneID:5651708"
     CDS             complement(602852..605335)
                     /locus_tag="LMJF_21_1480"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683101.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1480"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1480"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651708"
                     /db_xref="GOA:Q4QC47"
                     /db_xref="InterPro:IPR026619"
                     /db_xref="UniProtKB/TrEMBL:Q4QC47"
                     /translation="MPLYMVQPQQQQEQPQVAFPAGRAMSIMNKAPPPIRQASSSSSP
                     PTPSPLFTSGSERGGEAAAAACSTKPLSAVSAPGASGAALQSARRSAGAASSSDARLA
                     AAGPIPSVSIHAAAAAAAAAAEAHSAGVAVSVFGPGAGPPPTAATVATSASPGPSPPP
                     PPPSQVLTVATTEEAAKEAQRQQILGLANALLTFCCIGNTRVTSIRQCTSSFFVLLYQ
                     RLFDCTIAGIDRSPNTAEKRRRNVMLVLEQLRQHPYSLEDIEAEEVVKLNEDHISRLI
                     MVFVQVAEDMRQQQELQQQQQQQHQQQQQQQQAAMVASSSAMVARQDATGGQYPLPHP
                     AHAEDFDAAKTTGGAYAPVGYRVAEVMPPPALQQADAAGMSSGGYHFHQPMDNFYVAP
                     APPLNGGPASGGGIMDPSGGGSPHMISGGAELGEGVSPSSVSHYLDSSVMPTDNLLEE
                     WYRNLVYPPAGGPAEETEMMSAVDPGHVSLHGGYSQRRHPRSDRLGREAGASLTSSGS
                     PMYGTGQQLASASPPERRLLVGRHRHHRTQLDADDIVRRFQRLEEVLDAQEQRHRKPF
                     VDASSSPAMQEGSLAERGARESRHRRHAAPQPPSAAFDPRGGALAPTPEKRSATEVDG
                     GALPQQEAPPSSQQQPAYSQPPPQQHHAPPRTPAHPFVSEPPLTRQERYFFAHRPQHR
                     IDVAQRDSKIERLRSARYLGDMQQLLRQRMRREYDTQMSAMRGSLKEFIRTSKEAKID
                     LMRRVRDENARYRAAYATLMEAAANEAQVPARVMSRHTVQLADYYATALQHSLLVCDS
                     LKREADRRTKNELLRYAEEVSAWQQHLLL"
     gene            complement(<610304..>612316)
                     /locus_tag="LMJF_21_1490"
                     /db_xref="GeneID:5651709"
     mRNA            complement(<610304..>612316)
                     /locus_tag="LMJF_21_1490"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683050.1"
                     /db_xref="GeneID:5651709"
     CDS             complement(610304..612316)
                     /locus_tag="LMJF_21_1490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683102.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1490"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1490"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651709"
                     /db_xref="UniProtKB/TrEMBL:Q4QC46"
                     /translation="MNEMDRAPVSSRRPCASQDPQRRPLCREEEGATPTALAVSSTTL
                     GGRGGAHMCSCTVSSPNREGTCSSNILSYTLTHSTSPVVPWGCGRQPNHLQAPPRLAP
                     LTESPIVARGFGPPPIAPAPLALAESSEHALCAPQLTFTAGAPGGTCLCSARSALPLL
                     PFSSVLTASQRATPVPVWRRSKPLTRLPATTLGPTLSGNSGSPDDVVVALSDASMPKG
                     ETGEWMCAEASLQPSAAEPTPNAGSAVRHVDYQAAATQTGCVGSSLAAKVATESSQMA
                     LPDALAHLVEPPQGASAPSKTATDQLVNAPVGDIELRKRREEDSSDARASLSSALSSL
                     GHPSNHNVHSSVDGVLWAHEAPEQPAYAHQHQLPAIFSQLVQDLLAAEPRADVEGDDD
                     LLERWIQSWFENRCMTQPLQQSRSNSMKHLRTLQEAAVGAIANGAYVQGARSSNYVEP
                     REKPAVDKNVGDATHAGPAARPAAGPSTTISASAAVTRTTTKSASAQLFPSSTAASPP
                     HQYVPLTVEYSCSTLQSRMTSGASQRATSPPKPPQAQPLPVSPGTLHTAGASSTPGPP
                     PHSAADGGGGVLAAVVGLSSPPQQPQQQPQPAKPLSGGPHLPAPASTRSMSSKQTVVA
                     AAALAGGGEGDKGASGARPKLATTACAVFAHSSSSSAPKEAAHPHE"
     gene            complement(<613018..>614730)
                     /locus_tag="LMJF_21_1500"
                     /db_xref="GeneID:5651710"
     mRNA            complement(<613018..>614730)
                     /locus_tag="LMJF_21_1500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683051.1"
                     /db_xref="GeneID:5651710"
     CDS             complement(613018..614730)
                     /locus_tag="LMJF_21_1500"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683103.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1500"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1500"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651710"
                     /db_xref="UniProtKB/TrEMBL:Q4QC45"
                     /translation="MHLHISSIPHRNSNNSKGGVLDATGPMLSAKRGALLLQAYHRPG
                     EVISYKAGDYHLVPKKFTVGKRIAVRSYLDRNRTELSDRTFMPQKNWFRPYDLQDGCF
                     DRDHERLSYRFYNLETKVIWKAFDTPELIGMLLHDETVKGNSGMYAPDMLDAALHYTR
                     EARYWRCIGITKPFYDRNTLRAHCWEDNGLQVGTLVMSQAMRHALMDLERAVRRKELG
                     LEPNYLWDRWGPIGFIDGARADYLPRFEHNPYVDPDGVDVTEIDVLPFNTHEQIRERY
                     RDFIEPDTAPFEEVFRSPSHGSLTTLADIPNASVVALYKDLKLKAGTPVAGDAVELAP
                     ADVRTLFYLSANPEWRAVADGKASWEEVVDAMQPVQAELDEKIDAARLLQNTRHNAER
                     VRAFFEEKCGFHDFMYTPDKTITAAVLCYLTELRRICTETAWGAALAKCLTDMERVQG
                     MGRDAFLVYRHIEDAILDKKRRLWAGRFAGESHEESTLDYLLENFGRRAERPRNVGTT
                     GVEFDREQEPIGRQVQRRVLDSDKANKLAEIRRSRGKMWSKKRSVFDALHEKQLQNFN
                     YGVH"
     gene            complement(<615366..>619751)
                     /locus_tag="LMJF_21_1510"
                     /db_xref="GeneID:5651711"
     mRNA            complement(<615366..>619751)
                     /locus_tag="LMJF_21_1510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683052.1"
                     /db_xref="GeneID:5651711"
     CDS             complement(615366..619751)
                     /locus_tag="LMJF_21_1510"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683104.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1510"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1510"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651711"
                     /db_xref="UniProtKB/TrEMBL:Q4QC44"
                     /translation="MKDSATTSAAAAAPRGGDCGRHHRHDCVVPRRTDVAQHTCFYFT
                     VFFSNNPPIFHSNRIPPERLGMRTVVPSTTAREEVRQMASRVSSVSLSAAADGSASSA
                     SPSSPSSPCTGCQQRYWKTVFGEPETDGAARPGMGHPYANGFYAAWAEAEEDRDGATA
                     LVGDYRSATATVEEVPQQTLQNVAFPTAFGSCGGACMLPVRTCGRRTPSASAVPSPKM
                     PLPAEAASPQASPSKPQPPPPQFPSAADTAIVRAADAEKSTQEATSECAQKRVAETLA
                     ISSAATNNAPGPFSSTTCTLPLRCTATPAKDASPTKTVAGAPTIPDHCKPTLPAVKWE
                     DEDNAAVHSAHNEGTATSTIATESRGQLGQGSTQLPRLHVGTDTMTSTAEGETLPPPQ
                     QRPTPTAAPAAALNAVPITSAPAGLRTSTAVNCVASHLVAHTSAGPRSSIDETGSAAL
                     AASAPIREGPPWNMRVEEVRSAKGELRYYRIILTASFAALVTTHIGLMHSMQTRNAAT
                     ALVVLCPPCGLHFRFLLHHADILRSVLNRTTEFAIRTVQRFFCLLYSPTQKPKGSQQQ
                     VLKGIAALLEAHPEGLETYRAVKTELTNALCLRFPLPMLALATSAWAVPVLMRSSLFS
                     MRTQSCIKRVSAKSLGGPGDASSKLASGLSADDASASVGKRLGTGAPPCGPACSTPLL
                     LDEILHEAASFVREYSEGFASAFICGLLSLTESAVGSAGLRSQRRVSNNGSITAGVTA
                     AAPAVNGLTSPDVSGVPPSPSCTQNGSSPIATHEASPYFSGGGGAAAAGSRGAPAWLS
                     PYAAYWSSITGQCSPLQSGEDSLIDFGKPAPITLEGYDRASSSSCSVEHLDADAALTA
                     HVSTSKITAKTPVVSPLRMDAACAAAMPSYSPKHHFLCEENGTEAAVDPAMHLPPAGD
                     RTTAVPPTSKASPPLVVSEETFFTPGARRVMVLGSVASSDTVAARSCSAENSPHSSAA
                     PRTAAAPAGAPSAAAAAPHLPPKTAGSSTTPSTAKEDEYLLHLDRLGRVVIFTRDAVL
                     ARQLLIIAAFLWNGYGCGAAIGGGLAARSGAPGRAGASGQQRVARSAAEDVALRNQEA
                     QHMYETAVAAAVSSAEYANVPVQWVAEEFSESCLSTLCSRFSPENALLVVVPRQLQCR
                     RVYLRKYVTGTTVLVEEHSGKGARICTTPFPFRCSISKQVVVQPDPTVATLLREACSL
                     HQSSLGSVSFADVFQRMIGWLHWQSAAALSRTAAAVRAASAATTANGSSLTRFVSSDA
                     VWPSSDVSIGSASASSGARENNKSSHITTPVTTSPETRLTRSTNKSASSTVYHCDSLW
                     EPESVEENLLPGSMGGVGAWSHSAGASVPATGGATATAKTAALRAGPMPATSKLLVSH
                     GLLQPPAAFTSASHVVASPVRTASFKLFQWLRSSPTSPWAATTHSHPVLSPAALGHMQ
                     GADGVVGGQRSRLLAGADGEEDVFT"
     gene            complement(<623184..>624299)
                     /locus_tag="LMJF_21_1520"
                     /db_xref="GeneID:5651712"
     mRNA            complement(<623184..>624299)
                     /locus_tag="LMJF_21_1520"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683053.1"
                     /db_xref="GeneID:5651712"
     CDS             complement(623184..624299)
                     /locus_tag="LMJF_21_1520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683105.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1520"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1520"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651712"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q4QC43"
                     /translation="MFRSLNNVRRPSHMHNTAKGRAARKRENVHLVPLCSFSVFCMHA
                     RTHAISFLLRSLSELVCAVISSAVEAQRSASLALLLPRPRPSAQMERGRSCRRCGCTL
                     QFCPCCGAALGGRRDGAVKGPPNGSEGGLFSCNSSLRTRSAAERALGSGASVPWSQST
                     AAWRKRLPRRPVSAYEVYLAAVHGVVADEGGKEAAAASRALADPRPAMAAAEGGQRSD
                     EQVRAAALSWLRMTPVEKRVYEEEAQSWQTRLETLSTAPPSAHDLGEGSSSAAALPDA
                     LPSAEQPLPQQQHSSHLVAQRSSPKATAERLPRSKSSFVLFRAHMKGRRKMCMRELCA
                     VWRNMSAEEKAPYDAAAASKRTEQFLSQTPSAPGSQS"
     gene            complement(<624781..>626817)
                     /locus_tag="LMJF_21_1530"
                     /db_xref="GeneID:5651713"
     mRNA            complement(<624781..>626817)
                     /locus_tag="LMJF_21_1530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683054.1"
                     /db_xref="GeneID:5651713"
     CDS             complement(624781..626817)
                     /locus_tag="LMJF_21_1530"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683106.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1530"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1530"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651713"
                     /db_xref="InterPro:IPR006968"
                     /db_xref="UniProtKB/TrEMBL:Q4QC42"
                     /translation="MLQEYTGERCVSYRVNPQRGGCVETVAEVDAQDFFTEPGGLVTS
                     PTTPSTPAGSTSARQARRRVVTTLERILLPDGYPSSVTEDLLPFALWDLAQVLAKNVT
                     ATLSTRAVLLGVGVGESKADLTSATLSWMMQDGTRMIGSVVFAPLIPQGLECRAKTWQ
                     LVADFTTDIANLLELCAPWLPGGQTTFRVVLVAASVVKALGSVCRNCTRASFTRHFAL
                     RNNAADIAAKASTRSSVGSFIGLVLGVAVAYIVPATSRSLNLVVFALGSVLHIFASYR
                     SVRGVQLKHLNAPRLEWCLVQYSLFEAKVLIASKKDSGPLSVMPILDVSPRSANAAER
                     LLILPSLRAVPPPSDSFYDSVRGFLCRYCFPPTLTLRIHCGASLFRLLQHQRGLTTRC
                     KHELVQQVESALASRGIALLVDDVDMTYYVILPEYFTVEGVPAMWVRYKRQYGDDLTC
                     MEAKQRQSAAARAAQRRQDGAASLSPSGAAVAAPDAGHGLDEAGRRAAQAEAELERLQ
                     KERVVVPPHILPLAYRQLWAYFYAFMHYRAVRLRREGPLTHAKDVLEGLHKNRSLECQ
                     RLHIITALRADGTLEAGHSDASDVPHSPAQFEEITSPASTTSDVPLERRVVPALATRA
                     GGDDGDDGDNTAAPSYDGLHPQFIEFVRALRMTGWELDELLVGNEGYTTVVHYL"
     gene            complement(<630437..>636097)
                     /locus_tag="LMJF_21_1540"
                     /db_xref="GeneID:5651714"
     mRNA            complement(<630437..>636097)
                     /locus_tag="LMJF_21_1540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683055.1"
                     /db_xref="GeneID:5651714"
     CDS             complement(630437..636097)
                     /locus_tag="LMJF_21_1540"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683107.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1540"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1540"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651714"
                     /db_xref="GOA:Q4QC41"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:Q4QC41"
                     /translation="MGDSANTASVRFPLSADAAAEALAVAGQQRGAAHLLSNEDDVDE
                     DDVYEESEERYNSDDDAHGGERSLPAKTAEAAASVFMKGTPRSFGPVAGAGGDLGSGA
                     EAKGAGGSAAASLNAQRSALIAANLSRQLFKAKMPDIAASTKYQDELEEEDLDQLSAV
                     DRDFVMNTKDLFDDVDAELLGEDFVPHEHVVGIIASEATGGEASPDEIDDNLVDYKDL
                     EAEINADLADYIDAHHQEFNNAICDFSEMVLAVSGSDDTLAEFKKELADAIVSLESHA
                     GELKVLRLRAAKSLFMADALEHIQEVVLAEAEVKGLLQNRHYLAAVQTLQAQARLLAG
                     DELKGVRAVQSLRDTHNATISTLHHLIIDDLLACVFRHERLVEADAQLLQEMLDSSER
                     DTKDTHAAAPSVQHTIYKYWKMAGVGAPGSGHPDDDEDDAGEVDRDDGLVAATHNGTT
                     AGSTKTAGVGGLARKDRTLSAIIETLTDDPRDDQVLGNYLKFVPLCVKSLMLLGKIDH
                     CHETFFSRATRSMERFIAHFLCLYDAWRRRTRSGASLSNDEVEAAIRGTHVRALDLAC
                     DLISFDEAVATIQARDLRAMLGALFTELEKILRNAAYLQKVVLVAHFPFVSPYVVQPD
                     PFVPEATSRQWNVMNAPLRNEMWLHDTLTTALDHAQNSMRNAPAQSDKSSSSRSLPAA
                     GGDSNVGDVIAKFLELFNTDAVLASLKAETEEKDVAAAAAAAATTTPVNLKTSGGVAL
                     NTDAAANDVSLFLAFDRRKPCLTLQNILDRVNSACAQTRAIFPAAEAVLRKLQLAVSA
                     ELRDAVRVKLVAEVQTLLQEWDLQALWSQLNYHIECVFHVICDAKESQDETDDAVTLL
                     PFLRQKNLISRVQRTATIMLDADKQGDDTTTLDRLLSTYASGGLLRMVEETGTVSFSL
                     VGAVKKAQADMRKAREGQASQFDVMQCDKAKLIAFTDSGLGGGGVGGAGAPLVLLHAS
                     MLRRWFVFTAMNALTCYECAARFYSRSCDRVPEFRLLSEEECVVGFFKRFLRATYIPT
                     LHAFHSQQLQLLLMSIGDSGGTSAAGATPSASPLPEDAGSTTSRGGKAPTAMKALSGA
                     WPTVVVDEVQHPILACVQYVGQVLAKVSDVRRILPESLTEEVEQNTSEALIIELVVFL
                     KRQVQWLGRGTLAHRLLDKPFEDAFSGMPNRRWAALADEENILDAHRYIDQDLYRYYQ
                     LNSDERTSGHEYNRSTVSVLEAMRVLETSSAASPGDGGGAGAAEAELDQHIGRMEPRD
                     ICVRDDSTLVAFALLCTSAEWLCDVLLRYLWPRRRRARNYTDCCVPGYCFAHEMRVSD
                     AASFVLVDGDYTMQRKIRLSGHLVRLCSLAQVALFHLSVEARFLAFLFLPQLRDVSYD
                     VVAVSSAADMFVQAYARRVHNFYAILRQHLHAKKIKYTCLTAGKPASELILMELAHLR
                     DKAISQAGLMRLRTDLLVMQTTLQLVLPADSDVREAVSRFFLRPVLFLRHIFNKDVVN
                     EIVSSLDYLNFSTKEVEVLIRLVFRQVSGSNDDTLAVQQIRFFYQKLKTIRNLRCAGN
                     RTGGGSSVVSEPSLLPDGRGSSADAIGGGGLPSFVPLSTNAAAVAAAALDDGDDYHSG
                     AFSYDDGGSDASDLQPPPLPLSSATRGCQSAAGGLAASPSMSAPPESVPAPTSASAAA
                     APVSARLTTSSEEDEEDDEGEEDEETPEASTTLRPDRQPQQRPIPRGADRTRSSISAV
                     APAGAEATALGSRPTRRVDPTSLPDTPCLPSSKSATAAKPALARPVVPPLAMAPFRGA
                     PSKAPAPAAKAGAVKVEASSEEDEDDEEYEYEEETSEYEEEEEEEEEVEEEEEEEEEV
                     EAAPVQASTDKRPPHPRPHPAGSPTNGTAAAIRRPSASSAFAPK"
     gene            complement(<637746..>638171)
                     /locus_tag="LMJF_21_1550"
                     /db_xref="GeneID:5651715"
     mRNA            complement(<637746..>638171)
                     /locus_tag="LMJF_21_1550"
                     /product="putative 40S ribosomal protein S11"
                     /transcript_id="XM_001683056.1"
                     /db_xref="GeneID:5651715"
     CDS             complement(637746..638171)
                     /locus_tag="LMJF_21_1550"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S11"
                     /protein_id="XP_001683108.1"
                     /db_xref="GeneID:5651715"
                     /db_xref="GOA:Q4QCN7"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="UniProtKB/TrEMBL:Q4QCN7"
                     /translation="MHRPSRKHVNKSGHIRYSKKIGLGFKTPAKALNGKYIDRKCPFT
                     SNVVIRGRILRGVVHSTKMHRTIIIRRNYLHFIKKYQRYQKRHKSLAVHCSPAFDPKQ
                     GDEVVIGQCRPLSKTIRYNVLEVVSKSSADKMGKKFAKN"
     gene            complement(<639508..>641100)
                     /locus_tag="LMJF_21_1560"
                     /db_xref="GeneID:5651716"
     mRNA            complement(<639508..>641100)
                     /locus_tag="LMJF_21_1560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683057.1"
                     /db_xref="GeneID:5651716"
     CDS             complement(639508..641100)
                     /locus_tag="LMJF_21_1560"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683109.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1560"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1560"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651716"
                     /db_xref="UniProtKB/TrEMBL:Q4QC39"
                     /translation="MHIYSKDQQAFHLQRTPAEKWWSRANTFIVVVQLACFLSVVIRT
                     IAGASNSMSNSFFTNSVLSLKAPYIVDGCVYNVTRRHAFFNNVQYSLSKDNVGYFVSR
                     AVLNIRYLIALAAVHVVVSTTNRLWFETNTHEVRYHFVVFRKDMLTTWEILLMVLSFV
                     VTLGITEENRIMTDYINHCAASKSVSGHFYNSVQPYTELVVSYIISIAATVINGAFAV
                     WNLSKKNPLDLMLREAKRQQEEWRQAMEQYYGLGNPDATTAAQSEGWAGGTQPQIIYA
                     DNRARTVSPSADAAAALPVSGNELAKAGEADPLQHHRHGHHHSTRKRLGHRLNAISSS
                     LRRRSHSEEELKLSAPQTPPQFTSAPPQQQVHLEQELPHFGPSVSRPLTPILNEEYDQ
                     VEIPEVRQQGVGEGALGDRVRPTAAMMGDPGAVIESSNSGRYDLHEVNDDEDDERGGQ
                     ASYSVVGGASGVAGGLRVRGMSGSEASTTLVAAHLATMPPPPPVHSGDRQQQAQMSRG
                     QMLAPPSPLQGGAETTDDTVHL"
     gene            complement(<645248..>646555)
                     /locus_tag="LMJF_21_1552"
                     /db_xref="GeneID:5651717"
     mRNA            complement(<645248..>646555)
                     /locus_tag="LMJF_21_1552"
                     /product="putative RNA helicase"
                     /transcript_id="XM_001683058.1"
                     /db_xref="GeneID:5651717"
     CDS             complement(645248..646555)
                     /locus_tag="LMJF_21_1552"
                     /codon_start=1
                     /product="putative RNA helicase"
                     /protein_id="XP_001683110.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1552"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1552"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651717"
                     /db_xref="GOA:Q4QC38"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q4QC38"
                     /translation="MSSDLADFDGDDVRTTVVAAQPMGVGMGTHSAVALGGFQDFCLK
                     SELANAIRENGFEHPSEVQHQALPKAMLGADILAQAKSGMGKTAVFVFALLEQVEKVP
                     QGQKPYCQAVVLVHARELAYQIEQEFKRFSKYLPYATTGVFFGGIPEDENVKQLKKEV
                     PAIIVGTPGRMKALIQNKAFDTTHVKWFVVDEFDRCLEDVKMRRDVQEIFMKLPKEKQ
                     VMMFSATMTDELRDVAKKFMKDATEIYVDQRAKLTLHGLAQFYMNVTEPEKTRRLAEI
                     LDVVEFNQAIIFTSSVERCEALNRQLQQMKFPSQAVHSRMSQEERLRVYESCKANNTR
                     IMVATDLFGRGVDFDRINLVVQYDMASEADSYLHRVGRAGRFGTKGLTIAFITTDEKE
                     IKRENRTYTDGGIMKEVQERFEMKVEELTDINTQLNENQYMNK"
     gene            complement(<648200..>649387)
                     /locus_tag="LMJF_21_1555"
                     /db_xref="GeneID:5651718"
     mRNA            complement(<648200..>649387)
                     /locus_tag="LMJF_21_1555"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683059.1"
                     /db_xref="GeneID:5651718"
     CDS             complement(648200..649387)
                     /locus_tag="LMJF_21_1555"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683111.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1555"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1555"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651718"
                     /db_xref="UniProtKB/TrEMBL:Q4QC37"
                     /translation="MQGTWSVLKKNCLNFVPGLALFASQSRDAFATWLKIYNRGYTYG
                     PQEFYEQAEVYTPDYWKRGHSQDKNMWVDMNLSEEVSQKELAQLMHYKLDLWRMGHGL
                     GLGLFLGGYALIPAFFWLSSDTFAPSCFCKTDEEKKAWREAQDMYRYRSAPSYIMDTK
                     WYFDFHAYPWNATQERAWDDLFEKNNVRRDPKLLRPAAEMYDGFLKFYQIRRKSLRHL
                     ARSMNLPTFPLLSRTCASTRVRDYWNLAWNEDYMVITQKLHQQMSDEDLHDYAWRRFL
                     APCDKNLSRDEIMTRVNDYHDFLGPKFVEEGKAPNLIILTNYVLGYYNDPAYLVEDIS
                     ALDGNDFEYMAHYGKDAFLRRLEFENGPLRDQVEAHTQKLIADRAAAAAEVATTKAPQ
                     VTA"
     gene            complement(<651499..>652902)
                     /locus_tag="LMJF_21_1558"
                     /db_xref="GeneID:5651719"
     mRNA            complement(<651499..>652902)
                     /locus_tag="LMJF_21_1558"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683060.1"
                     /db_xref="GeneID:5651719"
     CDS             complement(651499..652902)
                     /locus_tag="LMJF_21_1558"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683112.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1558"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1558"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651719"
                     /db_xref="UniProtKB/TrEMBL:Q4QC36"
                     /translation="MTHSACFDACMLFSECGPPVNRTNPVDGREVSTRSSPHISPPPS
                     PPLSLSTLSRPSLRLAVHLRASDAFSSGSPFFFPFSTIVTTSKMSSPAAAPATVFARY
                     PAALALPTADPNALAVETMLRFAEVRYTRADARLGDLSLTISPAASFSSAAAATSSTS
                     AAKAKSEVCAGLMPCLKRLGGESAFDAVPSLHAATAVCVEVLTVQCLFPAFLFYTHFD
                     PALYKAAMRRSVEPKVASFWEGIRGTYRAHILRENPFFYSGTAAAEVPRGKLSLTSLA
                     KLKEVGEGVDKAFAVLESLRKTATTAGIEAGNVFFLGTSRPTYIDALVYAAASSFVHA
                     DLKEAAAGVKGHQRRVQDACPALLEYVEGMRRQFFEADSGTYCLKPCATAADADPHVA
                     MADEAERQYRSGRLQTLWWTGLFASAYFLLVNADMLVALLEQAEEDDEEVAAAEAAAG
                     AAGGTATQQSSPSSAFV"
     gene            complement(<660957..>662270)
                     /locus_tag="LMJF_21_1561"
                     /db_xref="GeneID:5651720"
     mRNA            complement(<660957..>662270)
                     /locus_tag="LMJF_21_1561"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683061.1"
                     /db_xref="GeneID:5651720"
     CDS             complement(660957..662270)
                     /locus_tag="LMJF_21_1561"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683113.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1561"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1561"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651720"
                     /db_xref="UniProtKB/TrEMBL:Q4QC35"
                     /translation="MKSVKKTPRGEHHSLVPTTTTTAANSTSNGTKDHIHNGNNAAAS
                     RRTSVPLLDEESLKANTASASSGAAGGFTLVPHSDDRLKLSGATISGSPPSQPHSVDN
                     SHIYTMLQQQQAVAMAAAQLEHAYNQTCYLLQQCSHNALLTVLMSLLNDYPTTLVQPI
                     RMRVEQVLAHQMSPSASGRVAVPGRRVSEFVPNSSAAPWTPSNMRGSAAPTPTTNSTT
                     PSHRRGRGHKGKEEEQEICSIHNNLRAMKHLQLNVSTGLYECIHGFHCLVDGPTDASP
                     KRLSTASAVSPSTSASRANGPAPSADSQPFAPPPTIVSSAAAESRFSMSEVEALRMLG
                     YPLPNTNSDQPQPHLAHESPRPQPTLQQPHQQFSHASLRSSGLGFSGPSHHDPESSQL
                     ANGGGFTVISGDRSSAGTSPLDPRLSMDIPSLEYLLQSVRDIDDD"
     gene            complement(<665711..>667318)
                     /locus_tag="LMJF_21_1563"
                     /db_xref="GeneID:5651721"
     mRNA            complement(<665711..>667318)
                     /locus_tag="LMJF_21_1563"
                     /product="choline dehydrogenase, like protein"
                     /transcript_id="XM_001683062.1"
                     /db_xref="GeneID:5651721"
     CDS             complement(665711..667318)
                     /locus_tag="LMJF_21_1563"
                     /codon_start=1
                     /product="choline dehydrogenase, like protein"
                     /protein_id="XP_001683114.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1563"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1563"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651721"
                     /db_xref="GOA:Q4QC34"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="UniProtKB/TrEMBL:Q4QC34"
                     /translation="MRRGVKCLAGAAADVGSLKFDVIVVGGGASGSLIAGRLAMENLK
                     TLVIEEGADIRKYPEWYHTLPASTIAHRLAQRGFEAKDTLTTPQQHPDGVTKAPVWIP
                     TPRVLGGHGVMGSRTWNLGDERDWEGSPWSFREELLPRVRTFENMEVFVPHRGKRGKF
                     LICRPLNFSPYFKAFCEAASQDVPLMSELTRKEFQIGCGCGRPDTFVDQSLGVANTTL
                     QRYLLGTIKLNRPVRVECGTKVVGIRGSGGNASTAAGVSLRRADGQLVDVESTLVVVS
                     AGSIGSARLLTASRGSVDVDASVGQHFWDIPQVVLQYHVKNRDSHNCYLDPLVCKVLR
                     VDLWYGRPQLSLRSSWDDLIMYWSSTGTSTPDVEIQFQPFTLANDGTQPMPREHGCQF
                     VVRPLRPRSRGKVNANGSIDPNYFSDAGDLAALQKGVAYVKDCLVKKTPFVPIIGALA
                     HELFESSGINGGSCADAVDPQNCRLKGVSNVYVCDHSILPSPLTGSTLPYTLALADRF
                     VDTLLKRRGLTHKVEEDPAAQVTRIVY"
     gene            complement(<669890..>672295)
                     /locus_tag="LMJF_21_1565"
                     /db_xref="GeneID:5651722"
     mRNA            complement(<669890..>672295)
                     /locus_tag="LMJF_21_1565"
                     /product="putative serine/threonine-protein kinase"
                     /transcript_id="XM_001683063.1"
                     /db_xref="GeneID:5651722"
     CDS             complement(669890..672295)
                     /locus_tag="LMJF_21_1565"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="XP_001683115.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1565"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1565"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651722"
                     /db_xref="GOA:Q4QC33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q4QC33"
                     /translation="MEKYTQLKVLGKGSFGSAWLIQRNADRAQFVAKEVRLGGLKPAE
                     RESAQKEIDMLRTLNHPNITRYVDHFEHKGSLFIVMEYANGGDLYMRIKQQQGQLFSE
                     KGILQCFSQICLALSYMHERRILHRDLKTQNVFLTKDGVVKVGDFGISTVLRNTYELK
                     HTICGTPYYFSPELCLNKPYNNKSDVWALGCILYEMTTLNHAFDGSNMKALVQKILKG
                     VYPPIHPMYSSNLSRLISSMLQIDPHKRPNVSQVLNLSFIREALAGLREEVQVARADR
                     RSVVSVEERAHLQEAAALRKEEYRRRELESAATLAKAQQQQQAILMQQQLEGEERRRN
                     LVEQQRRLQRQQEMVLQERKRALDERVREQRKLQGQKSKADAKANRHREKQWDDNMKE
                     QAIEEQHRREAQEHHPRSDCQGPPQLQQERLQQQQEQSAAEAYREMRRQAAANKQRCY
                     RESVFPGGAPWSQQRQQDEPSAVPPGQPPPPRTPPSSSHYCSRKMTPEELEDARSQAF
                     WQMRREAMDNRKKMLGHDVTDTGESWAPTSVEAVPGASPAPSNGKSATLASVPAPPQM
                     STLPPPSSTAAAETKPTTKSMSRKDKSTPESTGAQLPASSPAPAVLLPSGAAAATAAV
                     VPQGVDNGMTPDGEEGLHNFLNGEAAATSPTEAEDRRRDDDYNALDTVIGETLKADRK
                     KSFKDDFDDAAFGEATDSSRLVLDGKTFHLPNVSATDPLMHRIESLRIFLEKEMGDDD
                     LIKCYRAMNNISASDDEVMHQLQSALPPSKQRFIPLVAHLVVCEDAFNRQGASSSASA
                     IGL"
     gene            complement(<673879..>675333)
                     /locus_tag="LMJF_21_1566"
                     /db_xref="GeneID:5651723"
     mRNA            complement(<673879..>675333)
                     /locus_tag="LMJF_21_1566"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683064.1"
                     /db_xref="GeneID:5651723"
     CDS             complement(673879..675333)
                     /locus_tag="LMJF_21_1566"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683116.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1566"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1566"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651723"
                     /db_xref="GOA:Q4QC32"
                     /db_xref="InterPro:IPR018799"
                     /db_xref="UniProtKB/TrEMBL:Q4QC32"
                     /translation="MEAIIEKTQKELGAVIQAPKLTDKLLSRPPFRYIHDIVMSFMKA
                     TGFPDGLFDADQRDSAKVADKKAKVQFLEKLIAAVEAATGTPVAARPAKIVAGEEAEK
                     TNELFQQLARCAALSSAQKAAAVRKVSGGGEPAPVAAAAPAPSSKKESGETKAPPSET
                     EEERTKRREEERRRRHEEKKREAEKAKERTAADPPSRTKEETKQAAATAASGETERHR
                     HREERKRESTEAVDTATTSARKAPPRPKPTHEVIEAQNAAADARPAVGVIREGKRGKA
                     DTESEDEEKEDWQKVAEQYEVKPAARTAAVAEDADVKGLLGQQALKAKREQEAAARRA
                     EVTGDGAAAATPAGGGIIIHSSKNTASRGGGSHALGDSDLNQLREQLQLLTKASNPLG
                     KFLEAIHDDIDSMTRELEMWRSESRNQALAAAEARRQTEESLQEIHANLQNLEDAISD
                     QVLKTNNLRQTILANDAAMEVMAKTIVNPDIAAQ"
     gene            complement(<676400..>676840)
                     /locus_tag="LMJF_21_1568"
                     /db_xref="GeneID:5651724"
     mRNA            complement(<676400..>676840)
                     /locus_tag="LMJF_21_1568"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683065.1"
                     /db_xref="GeneID:5651724"
     CDS             complement(676400..676840)
                     /locus_tag="LMJF_21_1568"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683117.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1568"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1568"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651724"
                     /db_xref="UniProtKB/TrEMBL:Q4QC31"
                     /translation="MPGRELPASRGGAQTSMPARRVATPYASRRPPRNNPARPGLAVG
                     QRTDAGLPTTTTTTASRSGQRSPVPVEAAPACPCCAACLKALQEVLHAYKALLLNSKR
                     LFIDDALHHYNGDEAWIRVLRSLGWSNEQAPTTGVGRRSDLAQR"
     gene            complement(<677467..>678492)
                     /locus_tag="LMJF_21_1567"
                     /db_xref="GeneID:5651725"
     mRNA            complement(<677467..>678492)
                     /locus_tag="LMJF_21_1567"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683066.1"
                     /db_xref="GeneID:5651725"
     CDS             complement(677467..678492)
                     /locus_tag="LMJF_21_1567"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683118.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1567"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1567"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651725"
                     /db_xref="GOA:Q4QC30"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="UniProtKB/TrEMBL:Q4QC30"
                     /translation="MFKAPPKVGPGRKVTEEANPYKSWEHMNHTWLILMCLGCLCAGW
                     LAGHFVEVDESKIKPKYAREDVVASACKQFEFRPDLAATSIRTAFVLAARRAGFPAET
                     VDESCAVVRGLDDVAGIMNYLSSTYPASSTEDVASLAAIAGIKYLNGPYEAILDQWRW
                     GRNDSDTAPTRNIPKNPNQNVFSIPTILHALGGLTEAECVALLACHSVGEFHENVSGL
                     ESATHTGRRYTLNNRYYQFLLEHERAFAPLTVARTQYNKEVATLPQTLRCVYVKENTN
                     GKAKKRQCVVNAAELELLKNKTWRELVVRYAADEELWREQFQSAFTKMIESNFKRLRP
                     YSDPNSA"
     gene            complement(<679481..>682276)
                     /locus_tag="LMJF_21_1569"
                     /db_xref="GeneID:5651726"
     mRNA            complement(<679481..>682276)
                     /locus_tag="LMJF_21_1569"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683067.1"
                     /db_xref="GeneID:5651726"
     CDS             complement(679481..682276)
                     /locus_tag="LMJF_21_1569"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683119.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1569"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1569"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651726"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q4QC29"
                     /translation="MEPSILNMQDYAAASSWRRRDQLRGLLSNHADLVTSCIPLAAQG
                     VLFTSAQIALHNTEKGLAISLSPLMGTSAVGLMPLDEAVPSLNAAARMRWLDMAEGTK
                     TSCVEWCEDLLFLGSSRGRVLVCDVPVESCRESSGLFSPCGALLTSSSEVALSRVTVP
                     PSAPASSTLVRSVRVNQCVSKTSVLAAQDTSVYLWDLTGGSLPVQRWFPHRHIDAATP
                     VMFAEWAPESASVVLSGTYDSSVMLVDTRSAAASNSVAFSCRRAVGRPAVAHCGDFNP
                     LLPSIVAISFSDGTVAVYDARYPLQAVQTVTTLQGDAVRLRWWRHNADLLTTAGSDGS
                     VALWNLRCPPSFCVGRAQYQMSLSDLAMTNTFSDQRAIGITVGGELTLTGLQPEALMG
                     LAPTLSYGNGETERKGSGGLSSGSAASPPPPPITAAEEEALRKEEHDACGFLYLRRLK
                     EAYQMLAQCASRRLVLHQTDVAMQLISHIDVVRVPLFDYAGFVEQLHGAAKEVDDVLQ
                     VLEENGWSYEAIRLQFEASVLHCSSHLSTTVALDRIRAMSKPNPSDVQTLEALRLNVM
                     LHRVLDSEDVDQVVVSVRTALDLIIAHPGISELIDVQAVEQIVRLLLRKNYLEGERFV
                     QFLLSQLRVDREQTSVPCQLLRAAMSAAQEPSVTMGMPTRVARRFVERFYRDMTAAKD
                     AVLTQLHIQRLGVEHYREVITIVNAYQERCIQKNLPGMFGWVALKPLLLFLHCLTADS
                     NYVTFFWVSVQYIEAFAHFPGVRKVEAVLFAVVDRIHSAAGKITNDLDELADTTRFSI
                     PMLRHVDNTLSTTHEFLTVLIRVQLECENVAVARNMRVMPPVMEQVQDVLNSASEDVL
                     EAWAGVMDALLECDQPDMIRKYCLATVRTFSEQMEDLMEVSAKGEADERLNEILDVCD
                     DFFAAVARRKAKGGDDA"
     gene            complement(<685460..>687262)
                     /locus_tag="LMJF_21_1570"
                     /db_xref="GeneID:5651727"
     mRNA            complement(<685460..>687262)
                     /locus_tag="LMJF_21_1570"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683068.1"
                     /db_xref="GeneID:5651727"
     CDS             complement(685460..687262)
                     /locus_tag="LMJF_21_1570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683120.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1570"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1570"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651727"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QC28"
                     /translation="MTQLSGWFSQVQYLHTRRERGLHPVNEMNRFAILVCGLLCGICV
                     SLPYTFDLYTTRLRDQFELSAGDLSTVSTVGLVFFYFLLPFSVIFEIFGPFANFVICL
                     TTGVIGTVGLAQTFSGAIPGNVTTISIFYAFLNLASGLMDTTYISTLFEVFPRNRGPV
                     VCLAKLMTGLGSTIFACLSTTLFKDNLIGFIYFLCAFIAVVMVCAGALIVLPLYYMNW
                     WRLRGKSAEEVVLLQATKPLYEHKFVPVRRLMVGYAVALTLIVFFTVETPVVAYVSVV
                     SRSVELTIGVVVSVLTLSVFLMLLPLRWLGGMDEAAPSDLELRAIALSYEAPALERDA
                     SVGAARGASESGSRQDPRYPGLTVLDYWKSLDLWLILLYMFCVSPIGIVMSHNGSTIS
                     IAKTGNPRSTRTAALYTAFIGLGNSVGRIAFGLLEAYVQHTKGWSGCRRVLVTAALFV
                     SPTLATVGGVLLLVLPGKLILLPYIVVYIMNGFNAALQALIFTCLFESFHNTLYNMGY
                     TVMVICVIVFNRLLFGMYVDMQHRKLQLSASQECNRAVCIETPFIVATCLAAGGLLVA
                     GLVHVRYARFVARLQERRPEAAKPTECCTSHSRP"
     gene            complement(<692976..>694865)
                     /locus_tag="LMJF_21_1580"
                     /db_xref="GeneID:5651728"
     mRNA            complement(<692976..>694865)
                     /locus_tag="LMJF_21_1580"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683069.1"
                     /db_xref="GeneID:5651728"
     CDS             complement(692976..694865)
                     /locus_tag="LMJF_21_1580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683121.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1580"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1580"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651728"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q4QC27"
                     /translation="MPSCGTSLVSGLKKLGKPIFSQTREVQQRKEKGLHPVSELRRFH
                     LFVCCFFCSVCASLTYAFDLFTTQFRSQFKLTLSDLTIISTVGLVFCYFTIPYTFIFQ
                     PLGPFAIFWISATATAIGGVGLAGIFRGHITGNTATITVFYALLNMASGLIDMSYVST
                     LVEVFPRNRGPIVCLAKVMTGLGSSVLAAMSSTFFEDSIDGFIYFIAAFVIVVCIWSS
                     FVIVLPPYIVNWWRRQGKTPEQIAALKATVIYYERKFVPMPRLIVGYAVVLLLLVFFT
                     TEAPLLAYMPNVSGRSRIVVGIITVALTCSIVVMLLPLRILGGVNELDPELERLEDFE
                     EAARTKDVDEDGRLVQLDDLGQEVRTSNEGSGEVLEPFRNATVGTGTSSQSEDVINRY
                     AHQDPRYEGTVKDYLLNIDVWLIMLLFVCYGCMGVIVLYNSSTISIALTGHKRSIQLS
                     ALYTAFLGVGSSVGRIAFGLFEAYVQHQEPENRKVLVSMALPVSPAMAFLAGIFLLFL
                     PGKAVLLPFILVYMEEGIFAGINALIFPCMFESNHNFLYNLSFFVQMCSIISFNLGMF
                     GRTIDREQRRLHIPMDRECNVKSCVRTPIIVSTVLAFFGVLVALAIHFRYAAFVKRTR
                     ERVRA"
     gene            complement(<696334..>697743)
                     /locus_tag="LMJF_21_1590"
                     /db_xref="GeneID:5651729"
     mRNA            complement(<696334..>697743)
                     /locus_tag="LMJF_21_1590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683070.1"
                     /db_xref="GeneID:5651729"
     CDS             complement(696334..697743)
                     /locus_tag="LMJF_21_1590"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683122.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1590"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1590"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651729"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q4QC26"
                     /translation="MFALHTHVVFSSSFPSFLVSDGEAVSDDDHPGACVMKRGVSWVE
                     RLPRELLLNVFIDVIRNDGDSFGWIGVLSSVCRSWYQLCQHPVLWEYVAKRICVVYPL
                     VVRLHGAAPYDAVSQEIVNRMRLLESEEQCIVQYDPLEPLPAPSRAALHKTMEKVRRY
                     RESQQYYKYVQRRRRVVLHFFLSVTLFSVALAITTAMCVSEGLDTGGLCNTTIVFGLL
                     WMAYLCIVAIIVSNVVMQAHFEPLPLLLRLRRNKLLIFASAVTILLGICDIIIPTLLI
                     QINLGRKERFSWLWCGITVILSFCLWQLYALMHIIPAARQQLRYQMTHVNVREGFRFV
                     VLNIPNGFPFLFAAASFCALQYVQYGYRIYLLLGGVPVIVSLGVLALVFLLDFYSLHR
                     FKDLAMGICFFLAMLFPISLLVWEFRGLCLLPLAAAAFGIFFAHARYVVSSAIHELMR
                     TIRAERNGCILRTPDANKN"
     gene            complement(<700191..>700916)
                     /locus_tag="LMJF_21_1600"
                     /db_xref="GeneID:5651730"
     mRNA            complement(<700191..>700916)
                     /locus_tag="LMJF_21_1600"
                     /product="hypothetical protein"
                     /transcript_id="XM_001683071.1"
                     /db_xref="GeneID:5651730"
     CDS             complement(700191..700916)
                     /locus_tag="LMJF_21_1600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_001683123.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1600"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1600"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651730"
                     /db_xref="UniProtKB/TrEMBL:Q4QC25"
                     /translation="MKIFSTLGNPGTLAATKPKKGEVVLASPEATVSKYKEAIKQHKK
                     ALKELHACTERFTHALAAVAASLQLLTSDTHIPVMVQSSGALASGIEEVQDGVLLQDL
                     MEELDYSLSTRFKQIAEDQRELKESRERKSKAERTLMLLRSQCDKLQLKKDVDAKVQA
                     LYLAKTQKRDEHEVECTRLKAEFEDTFQDFTKRFGILVYEDMKGLTVHLHRVLSALSY
                     QVRKCKDNIMAHPITPKPIAEMS"
     gene            complement(<701697..>702170)
                     /locus_tag="LMJF_21_1605"
                     /db_xref="GeneID:5651731"
     mRNA            complement(<701697..>702170)
                     /locus_tag="LMJF_21_1605"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683072.1"
                     /db_xref="GeneID:5651731"
     CDS             complement(701697..702170)
                     /locus_tag="LMJF_21_1605"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683124.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1605"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1605"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651731"
                     /db_xref="UniProtKB/TrEMBL:Q4QC24"
                     /translation="MNHAGGYSISGQAHTHTHTDGTMSALQQRCPLTAEERAQSLEVL
                     ADLLASTFDGEVNTADVHRALSRGDTADSDDDDLWRVRMMECAHERNARVAGEAAQRG
                     TRKWICPMCETANWIVDARETLRKRQGESSCGFSLTVTDPLRCECCSYDGATAPS"
     gene            complement(<704611..>705093)
                     /locus_tag="LMJF_21_1610"
                     /db_xref="GeneID:5651732"
     mRNA            complement(<704611..>705093)
                     /locus_tag="LMJF_21_1610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683073.1"
                     /db_xref="GeneID:5651732"
     CDS             complement(704611..705093)
                     /locus_tag="LMJF_21_1610"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683125.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1610"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1610"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651732"
                     /db_xref="UniProtKB/TrEMBL:Q4QC23"
                     /translation="MERVRIRYVLTGACPPTYSGRVVHDFVALKQPNGCDTTIEMVKE
                     RFRSNWPADVKELAESISESGIRVLKAGRVLNDHDSLMRHLTASERKACLVSGDTKVG
                     DTNDEMQKPSVLMHMVIQGNRAPLENSRKEKHKVSSTPEGGNSNEGHEMKKDSCCCVM
                     "
     gene            complement(<706768..>707790)
                     /locus_tag="LMJF_21_1620"
                     /db_xref="GeneID:5651733"
     mRNA            complement(<706768..>707790)
                     /locus_tag="LMJF_21_1620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683074.1"
                     /db_xref="GeneID:5651733"
     CDS             complement(706768..707790)
                     /locus_tag="LMJF_21_1620"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683126.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1620"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1620"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651733"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q4QC22"
                     /translation="MLRRTEIALKKGWTHNPGHTRRGGKNLAWRPKISDAKLSQFVPL
                     ALVHPRRHPNNWQERQFNALGYTKWPKDIGFYNAGDNFEVTPEAAWRLYVHARDEPYW
                     GKLHCEKTIITLLPVVEKAPKENMERVLDVFRHYLKRYGADHYIYNAVMQAAAFAKNY
                     EQAEQLFKEMETLGLEPNAQSYVNMMLAAKLCGLPPEKSEAYFKRAVKDGAMQSVMRM
                     DTEFRMWMDQLDRLGSFTASSGYLSVNEEGAKPMPRDMWAIWGWHRSESKFISRRDLI
                     MQQVRARVHSGKELVGTVYTKTRRQPWAKFNGMLRHDYNGPSYRAPTIFPDAPEYTNE
                     AGHKAF"
     gene            complement(<708606..>709133)
                     /locus_tag="LMJF_21_1630"
                     /db_xref="GeneID:5651734"
     mRNA            complement(<708606..>709133)
                     /locus_tag="LMJF_21_1630"
                     /product="putative calcineurin B subunit"
                     /transcript_id="XM_001683075.1"
                     /db_xref="GeneID:5651734"
     CDS             complement(708606..709133)
                     /locus_tag="LMJF_21_1630"
                     /codon_start=1
                     /product="putative calcineurin B subunit"
                     /protein_id="XP_001683127.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1630"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1630"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651734"
                     /db_xref="GOA:Q4QC21"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q4QC21"
                     /translation="MNEIPLTAEELQNIRESTALTDAQVQRLYKSFSKLNKDKSGKIT
                     RAEFNSIPALASNPLVDRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFK
                     MYDVDGDGRISNKDLFQMLSIMVGVNLSQMQLQQIVDKTFIEADVDRDGYITFEEFQA
                     LAVNSDFGDRLNLHF"
     gene            complement(<709863..>710558)
                     /locus_tag="LMJF_21_1640"
                     /db_xref="GeneID:5651735"
     mRNA            complement(<709863..>710558)
                     /locus_tag="LMJF_21_1640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683076.1"
                     /db_xref="GeneID:5651735"
     CDS             complement(709863..710558)
                     /locus_tag="LMJF_21_1640"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683128.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1640"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1640"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651735"
                     /db_xref="UniProtKB/TrEMBL:Q4QC20"
                     /translation="MQLLPRAATVTKRKAHVLITGDDCSTTKTSEPSAQLHPLVGYAS
                     TVSLPTVYSALAKVTGRVLSFAAAREEDRLSRQGFHELLALIGPAEVLGTKYADTMFT
                     SLPSYNADNDTTEALAIFTLLIEHRYHPRLNSNVEALFAAFDTDVKGVVPAEALCPDV
                     LAAWAVQRTYGNLRNQWQRFAAVISMESERSADVLPLLPPLASRTAIRAALCSTAAIY
                     TAACSLDLDGSSL"
     gene            complement(<712537..>714036)
                     /locus_tag="LMJF_21_1650"
                     /db_xref="GeneID:5651736"
     mRNA            complement(<712537..>714036)
                     /locus_tag="LMJF_21_1650"
                     /product="putative protein kinase"
                     /transcript_id="XM_001683077.1"
                     /db_xref="GeneID:5651736"
     CDS             complement(712537..714036)
                     /locus_tag="LMJF_21_1650"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /product="putative protein kinase"
                     /protein_id="XP_001683129.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1650"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1650"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651736"
                     /db_xref="GOA:Q4QC19"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q4QC19"
                     /translation="MPTSSGVDQAKLREVIRVLKSVGHVGMAESLEVEWGMKPNTAAH
                     AKNAKKGRKSLPHKSRESSKARGNSFPSLSSIAVAPSPLQVTSQSRFVVTCIGDEEDL
                     WSPDEDPADAKRCIAPLFDYGAGLLRDHYAEYAAHPVSFVSVHPYEKQQPPSNLPWRH
                     FELKVFYEAGKTGSEEKKEFELVKGDLIGGRYHVDAPIDAATFSRTVRCYDEQTGQPV
                     CLKIIRNSKTFLDQGLDELRALTCVNDAGDADACCVVRLLDYFYFREHLVLVTELLFD
                     NLYEYARKLDIVERCAYFTLARLQRIVRQVLTALKLIHSVNLIHCDIKPENIAFKSVS
                     DCDVKVLDLGSSCYMTDTLSSYVQSRSYRAPEVILGCKYGPAVDIWSLGATAAELATG
                     TVLFNVESVPTMLASIASVCGPIPAEMLQEGRNTSLYVTQHGAFYDYEDEQLVFHFPS
                     EPPDAAVLFGFDDHDYVDFVRLCLTLDAALRPSAAQLLDHPFLTKTYTD"
     gene            complement(<715428..>716321)
                     /locus_tag="LMJF_21_1660"
                     /db_xref="GeneID:5651737"
     mRNA            complement(<715428..>716321)
                     /locus_tag="LMJF_21_1660"
                     /product="putative mitochondrial structure specific
                     endonuclease I (SSE-1)"
                     /transcript_id="XM_001683078.1"
                     /db_xref="GeneID:5651737"
     CDS             complement(715428..716321)
                     /locus_tag="LMJF_21_1660"
                     /codon_start=1
                     /product="putative mitochondrial structure specific
                     endonuclease I (SSE-1)"
                     /protein_id="XP_001683130.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1660"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1660"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651737"
                     /db_xref="GOA:Q4QC18"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR020046"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q4QC18"
                     /translation="MPAREKAIVLIDGPALVHRWYHRWSYTTERYGTSLDVKQFAIKN
                     ARFMIATAHSFDPAHMAQHLLSPQTEYAHTPKHNRIIVCFDHGDGGRRQIYADYKANR
                     LQKAVTSEFRLIERVAKKVFADEPRESLLVVPDCDAGLANLNAEADDMIATLAFFNQQ
                     NTRPTVVMSHDYDLYQLVDEAKKSYHYDIRTKHLVSERGVMERVGVPPKLVRDFKSLA
                     GDSSDNIPGVNGIGKVRARNLLKKYGDLDGILFKGIKKETGHLGELLNEGAKMALISR
                     QLVDFRMCPKVIKVCESFMRI"
     gene            complement(<717386..>718717)
                     /locus_tag="LMJF_21_1670"
                     /db_xref="GeneID:5651738"
     mRNA            complement(<717386..>718717)
                     /locus_tag="LMJF_21_1670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683079.1"
                     /db_xref="GeneID:5651738"
     CDS             complement(717386..718717)
                     /locus_tag="LMJF_21_1670"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683131.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1670"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1670"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651738"
                     /db_xref="UniProtKB/TrEMBL:Q4QC17"
                     /translation="MDADDLRQLAINVSMDDIAASRDATKRLQQLFTPQQIVAMLKDA
                     PSTHALRVLVGEMEAVGNPDVFHLIGGVLEDVFTQPSRESKAVLFAPAAQFLVEFIVR
                     SAAAADTAVASSMSKALHRLIAIAGDSTEAAAFLGPCLDANFHNEQVLRLFDCDAVES
                     AENKTVCGFLEQWTSLLPFMFEATLDAFENDPLLQANYTIASGVACRTVDVPSALRQR
                     TMDILRAKDDSLCFAYVCRFWSIALLRHEANGQRDAAACVSTVMPAAEASERDERATE
                     AIFDLLGSAASTQAGWDAVTRQLPCKTLQVRLSSTSPSLRLSTLNLMLCMLTSPHMNV
                     SFFTKDLLLDAWQTRTSPDDMVRLALWRVANAALLQESLNRMLGAACASFLSSGAHEE
                     NVAVRSLKLTAAERLLRHSTLPENVKARLSQVVERGLYPAGSSGVSLIAKD"
     gene            complement(<719475..>719927)
                     /locus_tag="LMJF_21_1675"
                     /db_xref="GeneID:5651739"
     mRNA            complement(<719475..>719927)
                     /locus_tag="LMJF_21_1675"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683080.1"
                     /db_xref="GeneID:5651739"
     CDS             complement(719475..719927)
                     /locus_tag="LMJF_21_1675"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683132.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1675"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1675"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651739"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q4QC16"
                     /translation="MEEQLFQSDIVDLGLTTLEALVREQRLQNARMESRLSVLEKRMS
                     SLPLHMGLTAPKKLTCSDGDDDGATRSTALSLEEVEAPGPNASADDPATPMCDYCFLF
                     SHKCFPCPRCGREWYCSAACQRLRHRCHVSRCGQQYLPQTCLQPRIAH"
     gene            complement(<724413..>726122)
                     /gene="PUF3"
                     /locus_tag="LMJF_21_1680"
                     /db_xref="GeneID:5651740"
     mRNA            complement(<724413..>726122)
                     /gene="PUF3"
                     /locus_tag="LMJF_21_1680"
                     /product="putative pumillio protein 3"
                     /transcript_id="XM_001683081.1"
                     /db_xref="GeneID:5651740"
     CDS             complement(724413..726122)
                     /gene="PUF3"
                     /locus_tag="LMJF_21_1680"
                     /codon_start=1
                     /product="putative pumillio protein 3"
                     /protein_id="XP_001683133.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1680"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1680"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651740"
                     /db_xref="GOA:Q4QC15"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q4QC15"
                     /translation="MAWTVHEDEYRTEGYDNLEEILQYVVHTEESVQQSKPTVKYTKS
                     SQVFATPSPLTAAELSSPIKHQLTNTVPWQPQSHTPTNSSFHSLGIPYTSAQSPQQRR
                     CNNRFNGSYSGQCDRKPKIMSSSETCILSPGARKRGMGTGQMDHMMATELNEMPMPEL
                     ITQEVLASKDMMVGGGYSDWSGSGSKYFQSGALTADSLRGRVYETAKDQHGCRYLQRW
                     LDTNCDPEALQVMMNEIIPHVGELMTDQYANFLIQKLFDIMPDDVRYKVAIVAAPQIC
                     MISLTPHGTFSVQKMIETISTREEMEIISEALCKDVVRLVKDAHGNHVIQKVLQRFDF
                     DDKEYIYRAVATDCVSIAKNKQGCCVLQRCLEHASPRQKAALVDQVLACCLQIVQDPF
                     GNYVLQYVLEEHDSKINDTIALAFLPHLVQLSMNKFSSNVMEKVLRGASGPVQVMYME
                     EMCNPEIISHLIQDDYGNYVLQTALTINAPVQAAQLVNVIRPFMPLIRNAPYAKKMEG
                     KMENVARKVECNHFHAPRDCEVDARQGSSGGSPHGKFDRSPNHGRHYVGGTDQQQPYN
                     HPT"
     gene            complement(<726699..>727454)
                     /locus_tag="LMJF_21_1690"
                     /db_xref="GeneID:5651741"
     mRNA            complement(<726699..>727454)
                     /locus_tag="LMJF_21_1690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683082.1"
                     /db_xref="GeneID:5651741"
     CDS             complement(726699..727454)
                     /locus_tag="LMJF_21_1690"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683134.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1690"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1690"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651741"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="UniProtKB/TrEMBL:Q4QC14"
                     /translation="MVTETFLRKALFARCAIDLCGKKILPKDAFVALLTQGKLTPSQF
                     QMTDAEAVKYIDTLKRAKMIVEVDDYVYTDVKAVVDAVHLKSGLPLVPATSKTFGNLY
                     HALCESLSAFHRQSLPAAERAVSREREFWAFTALGSGTQMLVLAYLTFQVYGWDVMEP
                     VAFFVTTATALCSYAYFLYFRTEHSYESVDDSFLPHLLMRELGVLRVDADKAIREMKA
                     MQELQAVVSLDDERVSKLVEAAVKKKSTCACHS"
     gene            complement(<727900..>728595)
                     /locus_tag="LMJF_21_1700"
                     /db_xref="GeneID:5651742"
     mRNA            complement(<727900..>728595)
                     /locus_tag="LMJF_21_1700"
                     /product="putative proteasome alpha 2 subunit"
                     /transcript_id="XM_001683083.1"
                     /db_xref="GeneID:5651742"
     CDS             complement(727900..728595)
                     /locus_tag="LMJF_21_1700"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome alpha 2 subunit"
                     /protein_id="XP_001683135.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1700"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1700"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651742"
                     /db_xref="GOA:Q4QC13"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QC13"
                     /translation="MSEAFYGLTTFSPSGKLVQIEYATTAAGKGTTALGVKATDGVVI
                     AAKKKAPSTLVDASSIQKVFILDEHVGCTYSGMGPDCRVLIDSARKNCQQYRLMYNEP
                     IPISQLVRKISALYQEFTQSGGVRPFGCSLLVAGVDANGYHLYQVDPSGTFWAWKATA
                     IGTGSPDAKAFLEKRYTVDMELEDAVHTALLTLKEGFDGQMTSENTQVGRVVGNRFEV
                     LSVDQLRDYLDQI"
     gene            complement(<729353..>729826)
                     /gene="COX6"
                     /locus_tag="LMJF_21_1710"
                     /db_xref="GeneID:5651743"
     mRNA            complement(<729353..>729826)
                     /gene="COX6"
                     /locus_tag="LMJF_21_1710"
                     /product="putative cytochrome c oxidase subunit VI"
                     /transcript_id="XM_001683084.1"
                     /db_xref="GeneID:5651743"
     CDS             complement(729353..729826)
                     /gene="COX6"
                     /locus_tag="LMJF_21_1710"
                     /EC_number="1.9.3.1"
                     /codon_start=1
                     /product="putative cytochrome c oxidase subunit VI"
                     /protein_id="XP_001683136.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1710"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1710"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651743"
                     /db_xref="GOA:Q4QC12"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:Q4QC12"
                     /translation="MPHEDHKKYRVQREDLPAMPHFSDFNDPRFCGTTNKQKNGILAY
                     YQWLHCIGNWGEEHSMCKKMRWYVERMMHETWLEKWEEKRALGHFDHTVLYGVKPWKE
                     FEPLYQPVKKNRKGAYEYWLDRDFEPLYDVDAADWRERAPILHDMFVLGKKPVSE"
     gene            complement(<730246..>730647)
                     /gene="RPL32"
                     /locus_tag="LMJF_21_1720"
                     /db_xref="GeneID:5651744"
     mRNA            complement(<730246..>730647)
                     /gene="RPL32"
                     /locus_tag="LMJF_21_1720"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_001683085.1"
                     /db_xref="GeneID:5651744"
     CDS             complement(730246..730647)
                     /gene="RPL32"
                     /locus_tag="LMJF_21_1720"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_001683137.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1720"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1720"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651744"
                     /db_xref="GOA:Q4QC11"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="UniProtKB/TrEMBL:Q4QC11"
                     /translation="MVKPTVSKAIVKKRTKRFTRHRYELFPQLSSSWRKPRGEDSPVR
                     RRYKGQKAMPNKGYGSDRATKYITPSGFRNFPINNVEDLYMLVMQNRKYAGVISHTVG
                     ARKRKAIVRKAMELDVRLANGNAKLRKIANQ"
     gene            <732250..>732765
                     /locus_tag="LMJF_21_1730"
                     /db_xref="GeneID:5651745"
     mRNA            <732250..>732765
                     /locus_tag="LMJF_21_1730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683086.1"
                     /db_xref="GeneID:5651745"
     CDS             732250..732765
                     /locus_tag="LMJF_21_1730"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683138.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1730"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1730"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651745"
                     /db_xref="UniProtKB/TrEMBL:Q4QC10"
                     /translation="MSTSKEAADQSRKFGFKESREQYQQRKRQEKQLKWTERLSKEDL
                     GKLRIELDSLKRARFLAPQQNERKCLVHRMIRDLEAAENKEPKEETPVVATMPSALDS
                     DSDDDIFSGKGTLTNDEHKRLFIPRSVRKKPEEKKCEKTAQQLAGEAERELLAAVHDD
                     DDLDSFLDSLR"
     gene            <733275..>734423
                     /locus_tag="LMJF_21_1740"
                     /db_xref="GeneID:5651746"
     mRNA            <733275..>734423
                     /locus_tag="LMJF_21_1740"
                     /product="putative RNA polymerase II"
                     /transcript_id="XM_001683087.1"
                     /db_xref="GeneID:5651746"
     CDS             733275..734423
                     /locus_tag="LMJF_21_1740"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /product="putative RNA polymerase II"
                     /protein_id="XP_001683139.1"
                     /db_xref="GeneID:5651746"
                     /db_xref="GOA:Q4QC09"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="UniProtKB/TrEMBL:Q4QC09"
                     /translation="MDLNMRLLTRIFTYRRNHAEQGTIMSSKIAELSGRILSQQQYSQ
                     ILEQRRWLQGLLKEVSLDMGAKEKEKSASPVVLPYGSIVSGTSFKDGDADYIVSFPIV
                     SESTRQSGACVIDRERQEKFLSDIFSHIRKRNSDVELHPQRIFRARVPIVQYVRKSGQ
                     ESARFDLSLSLDGLKNSLLLRQYMAGDPRLRLGVLGAKQWGREQQILNARRGWISPYA
                     LSIMYIHYMKETGRTALSFDEEAVSQRVNAIVSTAAESEGDISHVDELASILPLQEAD
                     MLLVEKDVFDFFAFYGTPGGFDFDASVVDIRSRERFSSKDQWCQLLDQLDERERWNLL
                     GHEVILLRDPFEPHSLGRSVDFFRGEEIRERFRSAAVRKEPLSLFAFL"
     gene            <735000..>736157
                     /locus_tag="LMJF_21_1750"
                     /db_xref="GeneID:5651747"
     mRNA            <735000..>736157
                     /locus_tag="LMJF_21_1750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683088.1"
                     /db_xref="GeneID:5651747"
     CDS             735000..736157
                     /locus_tag="LMJF_21_1750"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683140.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1750"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1750"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651747"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q4QC08"
                     /translation="MSPVLVPTACEDWSLNIDDESAKRFWWNNTYSITLWEETLNIEQ
                     QAEKITDGDVWSKFIDLQLRCAFKICSICHSPEGNADMKICCYCGNTVHENCSEPAAP
                     EQIMWKPANLAYVEHMRACFQCQAVNYKEPLAPQSPSEWDNARRAAKRALTISDEYPP
                     ATVERIQKLLQRAETTSNDAVLLSELKSLVQSYFQSPQSLQFLRKERVASKGGGIGVV
                     AARKIPAFSIIGVYPGYLDFMSGEQAKCGRPVPKYALMEYNCANYFNEVFVELQTTFT
                     PFINEPNVDEKSNCAWIQEPHRKNGRLSVICVRDIQEGEELTIGYGPIYPRTYPYCYD
                     AYACHQIEGHTTHPCYSLWHWPTLQEADARFVCHIGYIERDDCYVLWKNET"
     gene            <737227..>738519
                     /locus_tag="LMJF_21_1760"
                     /db_xref="GeneID:5651748"
     mRNA            <737227..>738519
                     /locus_tag="LMJF_21_1760"
                     /product="putative centromere/microtubule binding protein
                     cbf5"
                     /transcript_id="XM_001683089.1"
                     /db_xref="GeneID:5651748"
     CDS             737227..738519
                     /locus_tag="LMJF_21_1760"
                     /codon_start=1
                     /product="putative centromere/microtubule binding protein
                     cbf5"
                     /protein_id="XP_001683141.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1760"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1760"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651748"
                     /db_xref="GOA:Q4QC07"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q4QC07"
                     /translation="MGKKKVGEIQRSEDFCIPAGDRDANSALPAEEWPLLLKNYDKMN
                     VRSTHFTLLECGWSPLRRPLAEYIKYGMINMDKPSNPSSHEVVSWIKRILKCDKTGHA
                     GTLDPKVTGALIICTDRATRLVKSQQNAGKTYIGVLRLHDTVSQKKVDAALQRLTGPC
                     FQRPPLIAAVKRQLRIRNIYSNQLIEYDKHRHLAVFETHCEAGTYIRTLCVHVGLILG
                     AGGHMEELRRIRTGVITENDHLSTMHDVMDAQWLYENEKDDTYLRRVILPCEYLLSNH
                     KRIVVKDSAVNAVCYGAKLMIPGLARFDNGIERDDVVVLMTTKGEAIALAYAEMTTSQ
                     MASVDHGIVARSKRVIMDRDTYPRRWGLGPIAVKKRSMMKDGLLDKYGRPQSNTPSDW
                     FYVDYGGVKTNAEGVQYGQAPSKVGGVKRQRVPDSDDD"
     gene            <739905..>740816
                     /locus_tag="LMJF_21_1770"
                     /db_xref="GeneID:5651749"
     mRNA            <739905..>740816
                     /locus_tag="LMJF_21_1770"
                     /product="putative ATP synthase F1 subunit gamma protein"
                     /transcript_id="XM_001683090.1"
                     /db_xref="GeneID:5651749"
     CDS             739905..740816
                     /locus_tag="LMJF_21_1770"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative ATP synthase F1 subunit gamma protein"
                     /protein_id="XP_001683142.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1770"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1770"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651749"
                     /db_xref="GOA:Q4QC06"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:Q4QC06"
                     /translation="MSGRLRLYKEKLEGYNRFYSIVKTIKMVTMAKFRQAQVRIKTRD
                     YTLRYTEKAFSKPGQLVGDSPQAKAIYIPVMTNRGSCGALNSNVVKVIDSVASSRAYL
                     MPLGKRGIESLSKLYPSSFRMGIVNDMHEPMHFAYATYVWENAQQLCPEADRVHVIFH
                     RCVSAGSQKQCYYNIPSYEKWREDLADASSTENQKSRYLFANTLLNEDEQMIRDFYDF
                     HATLAILNAVCENELSEQAARLVAVEGQLSNISTLQQKTSSLYNKTRQSSITSSLIEI
                     ISAMTSLEGNAAKGVQRTNFWEGARMK"
     gene            <741751..>742500
                     /gene="RPS6"
                     /locus_tag="LMJF_21_1780"
                     /db_xref="GeneID:5651750"
     mRNA            <741751..>742500
                     /gene="RPS6"
                     /locus_tag="LMJF_21_1780"
                     /product="putative 40S ribosomal protein S6"
                     /transcript_id="XM_001683091.1"
                     /db_xref="GeneID:5651750"
     CDS             741751..742500
                     /gene="RPS6"
                     /locus_tag="LMJF_21_1780"
                     /codon_start=1
                     /product="putative 40S ribosomal protein S6"
                     /protein_id="XP_001683143.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1780"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1780"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651750"
                     /db_xref="GOA:Q9NE83"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /translation="MKLNIAYPRNGTVKQFEISDEVLRRVQLQDYRLGNEVDGAIFGS
                     EFKGYIFRLRGGSDKDGFPMVPGVLASSRVSLLVKRGAIGFNTFRGYQGERRRKNVRG
                     CVLASDIALVNVTISKVGDQPIEGVTDTTAPRRLGPKRASKIRKLFNLSRTEDVRKYV
                     VRRRVVKSGKKDRLKAPKIQRLITPRVKARRAKKAKDAIAKVRASAAERREYLRLIAS
                     NRRALRQRDHSKKHTRKVHAQRAEVAAFQKK"
     gene            <743417..>743986
                     /locus_tag="LMJF_21_1790"
                     /db_xref="GeneID:5651751"
     mRNA            <743417..>743986
                     /locus_tag="LMJF_21_1790"
                     /product="putative vacuolar ATP synthase"
                     /transcript_id="XM_001683092.1"
                     /db_xref="GeneID:5651751"
     CDS             743417..743986
                     /locus_tag="LMJF_21_1790"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase"
                     /protein_id="XP_001683144.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1790"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1800"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1790"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1800"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651751"
                     /db_xref="GOA:Q4QC03"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:Q4QC03"
                     /translation="MKYQIASVVAAAAVLGGAAAVSCSDKYPQSSAFFGSMGCASALI
                     FANLGSAYGTAKSGVGVAHLGILHAERIMRGIVPVVMAGILGIYGLIVSVIINNNIKA
                     DDNSYSAFAGYLHFGAGLAAGLSSLAAGLSIGIAGDASVRAYGKQEKIFVAMILMLIF
                     AEALGLYGLIIALLMNNTAGKVAAGCQQA"
     gene            <745523..>746092
                     /locus_tag="LMJF_21_1800"
                     /db_xref="GeneID:5651752"
     mRNA            <745523..>746092
                     /locus_tag="LMJF_21_1800"
                     /product="putative vacuolar ATP synthase"
                     /transcript_id="XM_001683093.1"
                     /db_xref="GeneID:5651752"
     CDS             745523..746092
                     /locus_tag="LMJF_21_1800"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /product="putative vacuolar ATP synthase"
                     /protein_id="XP_001683145.1"
                     /db_xref="GeneID:5651752"
                     /db_xref="GOA:Q4QC03"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:Q4QC03"
                     /translation="MKYQIASVVAAAAVLGGAAAVSCSDKYPQSSAFFGSMGCASALI
                     FANLGSAYGTAKSGVGVAHLGILHAERIMRGIVPVVMAGILGIYGLIVSVIINNNIKA
                     DDNSYSAFAGYLHFGAGLAAGLSSLAAGLSIGIAGDASVRAYGKQEKIFVAMILMLIF
                     AEALGLYGLIIALLMNNTAGKVAAGCQQA"
     gene            <747549..>748943
                     /gene="GAA1"
                     /locus_tag="LMJF_21_1810"
                     /db_xref="GeneID:5651753"
     mRNA            <747549..>748943
                     /gene="GAA1"
                     /locus_tag="LMJF_21_1810"
                     /product="GPI transamidase component
                     GAA1,putative;with=GeneDB:Tb927.10.210"
                     /transcript_id="XM_001683094.1"
                     /db_xref="GeneID:5651753"
     CDS             747549..748943
                     /gene="GAA1"
                     /locus_tag="LMJF_21_1810"
                     /codon_start=1
                     /product="GPI transamidase component
                     GAA1,putative;with=GeneDB:Tb927.10.210"
                     /protein_id="XP_001683146.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1810"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1810"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651753"
                     /db_xref="GOA:Q4QC02"
                     /db_xref="InterPro:IPR007246"
                     /db_xref="UniProtKB/TrEMBL:Q4QC02"
                     /translation="MLRRVIFNGARHHGGKLAPFFLVLGIGLLCLLPVLRTRKIYIDE
                     NAVGQMFPSADAGSVTAYLDPTVHWPQRLVRGRRSPGSEIAAVYVNTDYPASVSLANA
                     LIEVIRRRKSLACDVQFYFVNSSEEWPVPQAYTRAALVLNLSTLYNRHICIDTLGGNG
                     IQPNQDYTNIAVQLAAANQFLPSYLCQRRHRSTDDAHAGFWHYWAYLEASVQLPTRPQ
                     PWHIIPTHSINTIAISSDPLYSASSVFPHSQLPDAFAQLVLKIIVSLNGLEEKFHHST
                     FVWLPVSLWRYVEYDHAQFCIILFVASIFSTTYSEYQLRGISITPLFVTLLLTPVAAA
                     AAFQVAGWWAVVSASAAFSLLFRLLMGHANSGMLLSFNAIALCLLIILQPACGLVAGA
                     AAAIQVSFIHTALQNRPAMAVGAAVSSALAYYFIYHLRLPLFGVDGISELFVSFVIYP
                     NAVWIGSRFLCFLY"
     gene            <749538..>749816
                     /locus_tag="LMJF_21_1820"
                     /db_xref="GeneID:5651754"
     mRNA            <749538..>749816
                     /locus_tag="LMJF_21_1820"
                     /product="putative 60S ribosomal protein L37a"
                     /transcript_id="XM_001683095.1"
                     /db_xref="GeneID:5651754"
     CDS             749538..749816
                     /locus_tag="LMJF_21_1820"
                     /codon_start=1
                     /product="putative 60S ribosomal protein L37a"
                     /protein_id="XP_001683147.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1820"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1820"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651754"
                     /db_xref="GOA:Q4QC01"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q4QC01"
                     /translation="MAKRTVKMGVMGRYGTRYGANPRKRAKKLEVSQHAKHFCSFCGK
                     FAFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNSTVRSTVRRLRELAKI"
     gene            <750625..>751359
                     /locus_tag="LMJF_21_1830"
                     /db_xref="GeneID:5651755"
     mRNA            <750625..>751359
                     /locus_tag="LMJF_21_1830"
                     /product="putative proteasome alpha 5 subunit"
                     /transcript_id="XM_001683096.1"
                     /db_xref="GeneID:5651755"
     CDS             750625..751359
                     /locus_tag="LMJF_21_1830"
                     /EC_number="3.4.25.1"
                     /codon_start=1
                     /product="putative proteasome alpha 5 subunit"
                     /protein_id="XP_001683148.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1830"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1830"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651755"
                     /db_xref="GOA:Q4QC00"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q4QC00"
                     /translation="MFTSKSEYDRGVNTFSPEGRIFQIEYAVEAIKLGSTSLGIRTPK
                     GVVLAAEKRVPSTLVVPSSMSKIMEIDSHIAAVMSGMVADARILVEHARVESQNHRFT
                     YNEPMSVESCTLATCDLSIQFGESGGKRKLMSRPFGVSLLIAGVDEKGPQLWQTDPSG
                     THTRYDAQAIGGGAEAAQSVFTERYHRNMTLEEGETLAVDILKQVMEDQLSPENIEVA
                     VVRADDGKLHMYTPTEIKAIMSRMPE"
     gene            <752777..>754171
                     /gene="PEX14"
                     /locus_tag="LMJF_21_1840"
                     /db_xref="GeneID:5651756"
     mRNA            <752777..>754171
                     /gene="PEX14"
                     /locus_tag="LMJF_21_1840"
                     /product="putative peroxin 14"
                     /transcript_id="XM_001683097.1"
                     /db_xref="GeneID:5651756"
     CDS             752777..754171
                     /gene="PEX14"
                     /locus_tag="LMJF_21_1840"
                     /codon_start=1
                     /product="putative peroxin 14"
                     /protein_id="XP_001683149.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1840"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1840"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651756"
                     /db_xref="GOA:Q4QBZ9"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ9"
                     /translation="MAAEVPSQPQAALEAPLPEPEQPSLSELDADTTVQSAIRFLQDP
                     RVRCSPVESQIRFLKGKGVSDGQIKYALAKVGRTVTAEKIASVRAPLANAAPTGATAT
                     AYATPLSAQLKTARQNAPVAMTPGPQYTQMLFPHSPPPPQVERQTKTVDWRDVVIGAG
                     AAMLAGFSAYKLFNRYSPYEFRRKSDKKPRLYRGSSSRPRPANIASSGSETDASSTPQ
                     RGCVLPLPPPPPMAAAAEPSVSAASPAALTEEVKRLQTELDEAKEALANERKKCADLA
                     VSAAKIRADKQQLSRANDRLTQQIDGLKKDIESLEGKKSSAVGEATQTAAEGAVAAVP
                     APPSTYFPSVTTEGEQARNSAEVTSVTSASAPNSDVMPVLPVVPSPEATAIAAAAPAM
                     PDPITEAAQAAPASVAAVAPAPESPPAVFAASTPYVDAAAPVATVTEVAAPLLSIGSA
                     EPPKAGDGTPMSTG"
     gene            <755993..>757930
                     /locus_tag="LMJF_21_1850"
                     /db_xref="GeneID:5651757"
     mRNA            <755993..>757930
                     /locus_tag="LMJF_21_1850"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683098.1"
                     /db_xref="GeneID:5651757"
     CDS             755993..757930
                     /locus_tag="LMJF_21_1850"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683150.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1850"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1850"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651757"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ8"
                     /translation="MRAKLEEAALAEATFHPTISPRVRALKRSGDSAGADRDSSAQLR
                     YRLQLLELPDEPAHAAHRHTPRLSHTSEMIIRACRGRGGAEPPPEERLYRDYFYRQQA
                     VEEARLVTPSPAVVRSKRHIDAHIAELYSFEQQRQRAIASARDALLSASAEAHRRVYV
                     DPRALVERLTKPFSPPQQRTAAAQLEKNPCPFHPQTGASSAELAHQARLRGLHRWVRY
                     FCGADILSMPVLSTFQGRAAQEAATLSALLRRHSPTKTEWSVEELADAFANEAGYNSF
                     IAELWRRRPPIGEASAALSELTHRPCLNPKSAMIVDKKAEHRCGPTHDRLFLNARAKQ
                     LSQRQQELEEEQASLEDKQREQQRRQRLQAAWRAQEAQRLEAYRAEQAEERRKSAAAE
                     ASAAEERLRPSTTSCSRQLFLPSSSPQLCNGGRASVSPSVSPRQPSVATTDAVLTPRS
                     SMPSMAAASSAPQPEVSRVRGGNTGSTTTARSKGSGDNGRDSGCPSPAFHPTTGSAQA
                     APAAQCLTSSISRNVEDWPVADKQELDRAAEALRDALVDPARSCRATPQGSTAPSQCS
                     LPAATCFTPCDVNRPLDSQGKLHARSLDVLLACAQLRDPRAFPSGERERLDRAQKRQL
                     RELGRLLYSRYMSRVHGKSST"
     gene            <758588..>758827
                     /locus_tag="LMJF_21_1855"
                     /db_xref="GeneID:5651758"
     mRNA            <758588..>758827
                     /locus_tag="LMJF_21_1855"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683099.1"
                     /db_xref="GeneID:5651758"
     CDS             758588..758827
                     /locus_tag="LMJF_21_1855"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683151.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1855"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1855"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651758"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ7"
                     /translation="MSSIQNTIVSRIHEAFQPAELEVTEISAEEAKYNVRIVSAAFAD
                     VPLIQRHRMVNDLFGEELRSGTIHALSISAKPPPS"
     gene            <762802..>764133
                     /locus_tag="LMJF_21_1860"
                     /db_xref="GeneID:5651759"
     mRNA            <762802..>764133
                     /locus_tag="LMJF_21_1860"
                     /product="beta tubulin"
                     /transcript_id="XM_001683100.1"
                     /db_xref="GeneID:5651759"
     CDS             762802..764133
                     /locus_tag="LMJF_21_1860"
                     /codon_start=1
                     /product="beta tubulin"
                     /protein_id="XP_001683152.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1860"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1860"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651759"
                     /db_xref="GOA:Q4QBZ6"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ6"
                     /translation="MREIVSCQAGQCGNQIGSKFWEVISDEHGVDPTGTYQGDSDLQL
                     ERINVYFDESTGGRYVPRAVLMDLEPGTMDSVRAGPYGQLFRPDNFIFGQSGAGNNWA
                     KGHYTEGAELIDSVLDVCRKEAESCDCLQGFQLSHSLGGGTGSGMGTLLISKLREEYP
                     DRIMMTFSVIPSPRVSDTVVEPYNTTLSVHQLVENSDESMCIDNEALYDICFRTLKLT
                     TPTFGDLNHLVAAVMSGVTCCLRFPGQLNSDLRKLAVNLVPFPRLHFFMMGFAPLTSR
                     GSQQYRGLSVAELTQQMFDAKNMMQAADPRHGRYLTASALFRGRMSTKEVDEQMLNVQ
                     NKNSSYFIEWIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVEEEGEYDEEEEAY"
     gene            <766053..>767939
                     /locus_tag="LMJF_21_1870"
                     /db_xref="GeneID:5651760"
     mRNA            <766053..>767939
                     /locus_tag="LMJF_21_1870"
                     /product="putative histone deacetylase"
                     /transcript_id="XM_001683101.1"
                     /db_xref="GeneID:5651760"
     CDS             766053..767939
                     /locus_tag="LMJF_21_1870"
                     /codon_start=1
                     /product="putative histone deacetylase"
                     /protein_id="XP_001683153.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1870"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1870"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651760"
                     /db_xref="GOA:Q4QBZ5"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ5"
                     /translation="MPKRQRSDEKAAHHVELSVESGRRFDAYIRGWMQGTVEQPLLRP
                     SLLPPLTPLPTLAGPSKSCAAQAPATSAAATTVGDLSRLCEWTPPSPIMPASRTAVVY
                     DTSMLDHVSPDAGDFERPARLQSTLDHLTAIGLLPCCRRIPARTAKKHELRRVHSREL
                     IDTIDQLDFFMGIQEGRGGVIGQDLFASEHTSRAARMAAGCVIEAVKAVLSGAATNAF
                     AIVRPPGHHAGPVNAAGFCLYNNVAVAARAAQAELVAAQGEHNPAGDTQQPHILILDW
                     DVHHCDGTESIFYDDPSVLVISLHQYGNGHGHVLRKVSSAAAKHPAEISTPSKEDITA
                     DDLAALLSAGTIEPPPVSAPEASRPEAASDPPQDSTEGRRVRAAVDYNSLAAQIEKED
                     DAEIAALFGVDLNTASSSSSNSSSASNSSSVSADSTSVARNDTRPVHYAGDTVGLSFD
                     ETPLQRATGTEEEELFYPGTGHLNRVGGDATPAAQGRNINIPWPTHGMGDLEYLQLLH
                     EVVLPAAREFRPELVLISCGFDSASGDLLGSMRLTPSGYYIMTRLMAQNFPRLVVALE
                     GGYNVRNVALCSEAVMRALLESSGCQCDRLPKSRMLWCQASSLVAHIKRMHAPYWSCF
                     SQNV"
     gene            <769389..>770120
                     /locus_tag="LMJF_21_1880"
                     /db_xref="GeneID:5651761"
     mRNA            <769389..>770120
                     /locus_tag="LMJF_21_1880"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_001683102.1"
                     /db_xref="GeneID:5651761"
     CDS             769389..770120
                     /locus_tag="LMJF_21_1880"
                     /codon_start=1
                     /product="conserved hypothetical protein"
                     /protein_id="XP_001683154.1"
                     /db_xref="EnsemblGenomes-Gn:LmjF.21.1880"
                     /db_xref="EnsemblGenomes-Tr:LmjF.21.1880"
                     /db_xref="EnsemblGenomes-Tr:mRNA"
                     /db_xref="GeneID:5651761"
                     /db_xref="UniProtKB/TrEMBL:Q4QBZ4"
                     /translation="MEFFQVVDPVTLAPASYAHVALQLALAVACAVLLGVCLHVLPER
                     LVCVSKTARAKVPREALANAATPASKLSVANTPSSLAAASATPSFSAAAPVGTAPKPQ
                     AKAAAPAASAAVAESTLHDVLEAFFEEETLLDEALLDATAPSALPEKETAPANRTPGK
                     PTQPPLKKTGDFSPGLAAKMTQRLQVEACPASTASSPQVASKPPERNNTAERELEDAL
                     DAYMEEEQLLDEAILDSAVAAAHRT"
CONTIG      join(FR796417.1:1..772972)
//
DBGET integrated database retrieval system